Genetically Modified Microorganisms Capable Of Producing Beta-glucans And Methods For Producing Beta-glucans

Abstract

The present invention relates to genetically modified microorganisms capable of producing beta-glucans, characterized in that the genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain. The present invention also relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity or the use of such a polypeptide for producing .beta.-glucans. Furthermore, the present invention relates to methods for producing .beta.-glucans comprising the introduction of a promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of the polynucleotide, or a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize .beta.-glucans.

Description

RELATED APPLICATIONS

[0001] This application is a divisional of U.S. application Ser. No. 13/935,043, filed Jul. 3, 2013, which claims benefit (under 35 USC 119(e)) of U.S. Provisional Application No. 61/667,961, filed Jul. 4, 2012. The entire contents of each of these applications are hereby incorporated by reference herein in their entirety.

SUBMISSION OF SEQUENCE LISTING

[0002] The Sequence Listing associated with this application is filed in electronic format via EFS-Web and hereby incorporated by reference into the specification in its entirety. The name of the text file containing the Sequence Listing is Sequence_Listing_074008_1544_01. The size of the text file is 185 KB, and the text file was created on Mar. 18, 2016.

[0003] The present invention relates to genetically modified microorganisms capable of producing beta-glucans (herein also referred to as .beta.-glucans), characterized said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain. D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain. The present invention also relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity or the use of such a polypeptide for producing .beta.-glucans. Furthermore, the present invention relates to methods for producing .beta.-glucans comprising the introduction of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize .beta.-glucans. In context of the present invention, the term ".beta.-glucans" may particularly comprise polymers consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3. .beta.-glucans are known well-conserved components of cell walls in several microorganisms, particularly in fungi and yeast (Novak, Endocrine, Metabol & Immune Disorders--Drug Targets (2009), 9: 67-75). Biochemically, .beta.-glucans comprise non-cellulosic polymers of .beta.-glucose linked via glycosidic .beta.(1-3) bonds exhibiting a certain branching pattern with .beta.(1-6) bound glucose molecules (Novak, loc cit). A large number of closely related .beta.-glucans exhibit a similar branching pattern such as schizophyllan, scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran, all of which exhibit a linear main chain of .beta.-D-(1-3)-glucopyranosyl units with a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3 (Novak, loc cit; EP-B1 463540; Stahmann, Appl Environ Microbiol (1992), 58: 3347-3354; Kim, Biotechnol Letters (2006), 28: 439-446; Nikitina, Food Technol Biotechnol (2007), 45: 230-237). Although these .beta.-glucans are structurally closely related, their respective microbial producers are not. Examples of microorganisms producing these structurally closely related .beta.-glucans are Schizophyllum commune (for schizophyllan; Martin, Biomacromolecules (2000), 1: 49-60; Rau, Methods in Biotechnol (1999), 10: 43-55, DOI: 10.1007/978-1-59259-261-6_4); Sclerotium rolfsii, Sclerotium glucanicum, and Sclerotium delphinii (for scleroglucan; Survase, Food Technol Biotechnol (2007), 107-118); Porodisculus pendulus (for pendulan; EP-B1 463540); Botrytis cinerea (for cinerian; Stahmann, loc cit) Laminaria sp. (for laminarin; Kim, loc cit); and Lentinula edoles (for lentinan, Nikitina, loc cit). At least two of said .beta.-glucans-schizophyllan and scleroglucan--even share an identical structure and differ only slightly in their molecular mass, i.e. in their chain length (Survase, loc cit).

[0004] Such .beta.-glucans are widely used as thickeners and find application in several applications such as food industry and particularly oil industry (enhanced oil recovery, EOR) (Survase, loc cit). Also, such .beta.-glucans are used in the pharmaceutical industry in tablet formulations and excipients as well as in immunotherapy as antiviral agents (Survase, loc cit).

[0005] Industrial production of .beta.-glucans is mostly performed by fermentation processes using their natural microbial producers. Classical ways to improve .beta.-glucan synthesis, e.g., of schizophyllan is based on manipulation of the development of S. commune (Rau, Habilitation, Braunschweig 1997). The most common approach is to convert dicaryotic cells via protoplast generation into monocarytic cells (Rau, Habilitation, Braunschweig 1997). Another approach is to cross different monocaryotic cells to form a new dicaryotic cell (Rau, Habilitation, Braunschweig 1997). Further possible approaches comprise, e.g., a classical random based mutagenesis using UV radiation, transposon mutagenesis or using suitable chemicals (e.g., nitrosoguanidin (NTG or N-methyl-N'-nitro-N-nitrosoguanidin), 2-aminofluorene (2-AF), 4-nitro-o-phenylenediamine (NPD), 2-methoxy-6-chloro-9-(3-(2-chloroethyl) aminopropylamino)acridine.times.2HCl (ICR-191), 4-nitroquinolone-N-oxide (NQNO), benzo[.alpha.]pyrene (B[alpha]p), or sodium azide (SA)) (Czyz, J Appl Genet (2002), 43(3): 377-389). Due to the rearrangement of genetic material within the crossing event it is possible to select strains exhibiting higher .beta.-glucan (schizophyllan) productivity.

[0006] Yet, all of these approaches are undirected and do not allow targeted modification of the .beta.-glucan producing microorganisms. In fact, results and efficiency of such approaches are not predictable and identification and selection of improved strains is labored and costly.

[0007] This technical problem has been solved by the means and methods described herein below and as defined in the claims.

[0008] In particular, as has been surprisingly found in context with the present invention, overexpression of 1,3-.beta.-D-glucan synthase in a .beta.-glucan producing microorganism such as, e.g., S. commune or S. rolfsii leads to significant higher yields of the respective .beta.-glucan. This finding was indeed unexpected given the fact that the biosynthetic pathway of .beta.-glucan synthesis was only poorly understood and moreover, for most .beta.-glucan producing microorganisms (such as Schizophyllum commune), there was no proposed .beta.-glucan biosynthesis pathway available at all. Moreover, in context of those microorganisms whose .beta.-glucan biosynthesis pathway was at least investigated (such as Pediococcus parvulus), enzymes such as .alpha.-phosphoglucomutase (.alpha.-PGM) and particularly UDP-glucose pyrophosphorylase (UGP) were assumed to represent a bottle-neck in .beta.-glucan synthesis (Velasco, Int J Food Microbiol (2007), 115: 325-354). Accordingly, overexpression of these enzymes was assumed to increase the yields of .beta.-glucan synthesis (Velasco, loc cit). Yet, as has been found in context with the present invention, overexpression of UGP in S. commune did not result in an increased yield of the .beta.-glucan schizophyllan. In sharp contrast, as further described herein below and in the Examples, it has been found in context of the present invention that S. commune possesses two copies of 1,3-.beta.-D-glucan synthase (genome sequence known from Ohm, Nature Biotech (2010), 28: 957-963) and, surprisingly, that overexpressing either of the two copies of 1,3-.beta.-D-glucan synthase in S. commune leads to significant higher yields in the production of schizophyllan. Given that schizophyllan has a structure which is closely related to other .beta.-glucans such as scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran (all of which are polymers consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3), it appears to be likely that overexpression of polypeptides having 1,3-.beta.-D-glucan synthase activity in corresponding microorganisms as also described herein may therefore result in higher yields of those .beta.-glucans.

[0009] Accordingly, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain. Said polynucleotide may be endogenous or exogenous. For example, in context with the present invention, the overexpression of said polynucleotide may result from the introduction of a strong (e.g., constitutive or inducible) promoter upstream of said polynucleotide thereby increasing the expression level of said polynucleotide, or, preferably, from the introduction of at least one copy of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity. In one embodiment, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain. Said genetically modified microorganism is preferably capable of stably maintaining and expressing the additional polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity. Said genetically modified microorganism may originate from a corresponding non-modified microorganism which preferably per se, i.e. naturally, contains a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity. Also, said genetically modified microorganism is preferably per se, i.e. before modification, able to produce a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3 as described herein. Into said genetically modified microorganism, a strong promoter or at least one polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity may have been introduced. Non-limiting examples of means and methods for the introduction of a promoter sequence into a microorganism may comprise inter alia homologous recombination as known in the art (Ohm, World J Microbiol Biotechnol (2010), 26: 1919-1923). Also, in context with the present invention, the microorganism may have been modified such that more polypeptide having 1,3-.beta.-D-glucan synthase-activity is expressed, e.g., by inserting a strong promoter as described herein, by adding introns into a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, by adapting the codon usage, by improving the ribosomal binding site for better translational initiation, by introducing elements in the mRNA that stabilize it, or by inserting a polynucleotide with a higher transcription level having 1,3-.beta.-D-glucan synthase-activity into the microorganism (cf. Ohm, loc cit).

[0010] In context with the present invention, the promoter may be introduced into said microorganism upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity and in a manner that said promoter increases or enhances the expression of said polynucleotide. Non-limiting examples of means and methods for the introduction of a polynucleotide into a microorganism may comprise transformation, transduction and transfection as commonly known in the art and as also exemplified herein (Sambrook and Russell (2001), Molecular Cloning: A Laboratory Manual, CSH Press, Cold Spring Harbor, N.Y., USA; Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647; Methods in Yeast Genetics, A Laboratory Course Manual, Cold Spring Harbor Laboratory Press, 1990; van Peer, Applied Environ Microbiol (2009), 75: 1243-1247; Schmid, "Genetics of Scleroglucan Production by Sclerotium rolfsii", dissertation Technische Universitat Berlin, D83 (2008)). Non-limiting examples of means and methods for the introduction of a promoter sequence into a microorganism may comprise inter alia homologous recombination as known in the art (Ohm, World J Microbiol Biotechnol (2010), 26: 1919-1923). Strong promoters to be introduced upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity in context with the present invention may comprise, inter alia, constitutive promoters such as, e.g., tef1 promoter (translation and elongation factor 1a, S. commune, A. niger), gpdA promoter (glyceraldehyde-3-phosphate dehydrogenase, S. commune, A. niger, Schuren, Cur Genet (1998), 33: 151-156), trpC promoter (tryptophan biosynthesis, Aspergilus nidulans) or inducible promoters such as, e.g., glaA promoter (glucoamylase, A. niger), alcA (alcohol dehydrogenase, A. nidulans) cbhl (cellobiohydrolase I, Trichoderma reesei; Knabe, Dissertation "Untersuchung von Signalkomponenten der sexuellen Entwicklung bei dem Basidiomyceten Schizophyllum commune" (2008)) thiA (thiamine biosynthesis, Aspergillus oryzae) (Moore, Biotechnology, Vol. III, Genetic Engineering of Fungal Cells, Enceclopedia of Life Support Systems (2007)). In context with the present invention, preferred promoters comprise tef1 and gdpA.

[0011] Generally, in context with the present invention, the polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity may be introduced into the microorganism in any suitable form, e.g., comprised in a vector, a plasmid, or as naked nucleic acid as further described and exemplified herein. The polynucleotide introduced into the microorganism may then be exogenous, on a vector/plasmid within the microorganism (i.e. outside of the microbial chromosome(s)), or it may be incorporated into the microbial chromosome(s) by, e.g., random (ectopic) or homologous recombination or any other suitable method as known in the art. In context with the present invention, the polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity which has been introduced into the microorganism (i.e. the additional copy to the natural endogenous polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity of a corresponding unmodified strain) does not necessarily have to have the same nucleotide sequence as the natural endogenous polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity of a corresponding unmodified strain, as long as it has 1,3-.beta.-D-glucan synthase-activity as described herein.

[0012] In one embodiment of the present invention, the genetically modified microorganism is able to produce at least 1.5 times, more preferably at least 1.8 times more, more preferably at least 2.0 times more, and most preferably at least 2.2 times more .beta.-glucan polymer compared to the corresponding non-modified control microorganism. In this context, production of, e.g., 1.5 times "more" .beta.-glucan polymer may mean that a genetically modified microorganism produces an amount of .beta.-glucan polymer which is 1.5 times higher compared to the amount of .beta.-glucan polymer produced in the same time under the same conditions by a corresponding non-modified control microorganism. Alternatively, production of, e.g., 1.5 times "more" .beta.-glucan polymer may mean that a genetically modified microorganism produces the same amount of .beta.-glucan polymer as a corresponding non-modified control organism under the same conditions, however, 1.5 times faster. The amount of produced .beta.-glucan polymer may be measured by methods known in the art and as also described herein.

[0013] Furthermore, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, or a polypeptide having 1,3-.beta.-D-glucan synthase-activity, or of a genetically modified microorganism according to claim 1 for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0014] Furthermore, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0015] (a) introducing (i) a strong (e.g., constitutive or inducible) promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of said polynucleotide, or, preferably, (ii) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize said polymer; [0016] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0017] (c) optionally recovering said polymer from the medium.

[0018] As regards step (c) of the method described and provided herein, it is noted that in some cases (e.g., when .beta.-glucans such as schizophyllan is used for oil drilling purposes), the culture broth may also be used directly (e.g., pumped into the drill hole), without previous recovery of the pure .beta.-glucan. As such, the recovery step (c) is optional. Strong promoters to be introduced upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity in context with the present invention may comprise, inter alia, constitutive promoters such as, e.g., tef1 promoter (translation and elongation factor 1a, S. commune, A. niger), gpdA promoter (glyceraldehyde-3-phosphate, S. commune, A. niger), trpC promoter (tryptophan biosynthesis, Aspergillus nidulans) or inducible promoters such as, e.g., glaA promoter (glucoamylase, A. niger), alcA (alcohol dehydrogenase, A. nidulans) cbhl (cellobiohydrolase I, Trichoderma reesei) thiA (thiamine biosynthesis, Aspergillus oryzae), tef1 and gdpA being preferred promoters. In context with the present invention, the promoter is preferably introduced into said microorganism upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity and in a manner that said promoter increases or enhances the expression of said polynucleotide. Said promoter or said polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity may be introduced in said microorganism by any means and methods known in the art, preferably in a manner that after introduction the promoter can increase the expression of said polynucleotide or that said polynucleotide can be stably maintained and expressed by the microorganism, respectively. Non-limiting examples of means and methods for the introduction of a promoter sequence into a microorganism may comprise, inter alia, recombinant homology as known in the art (Ohm, loc cit). Non-limiting examples of such methods for the introduction of a polynucleotide into a microorganism may comprise transformation, transduction and transfection as commonly known in the art and as also exemplified herein (Sambrook and Russell (2001), Molecular Cloning: A Laboratory Manual, CSH Press, Cold Spring Harbor, N.Y., USA; Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647; Methods in Yeast Genetics, A Laboratory Course Manual, Cold Spring Harbor Laboratory Press, 1990; van Peer, Applied Environ Microbiol (2009), 75: 1243-1247; Schmid, "Genetics of Scleroglucan Production by Sclerotium rolfsii", dissertation Technische Universitat Berlin, D83 (2008)).

[0019] In context with the present invention, the strong promoter introduced into a microorganism upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity preferably increases the expression level of said polynucleotide at least 1.5-fold, more preferably at least 1.8-fold, more preferably at least 2.0-fold, and most preferably at least 2.2-fold. In this context, the expression level of a polynucleotide can be easily assessed by the skilled person by methods known in the art, e.g., by quantitative RT-PCR, Northern Blot (for assessing the amount of expressed mRNA levels), Dot Blot, Microarray or the like.

[0020] Generally, the term "overexpression" as used herein comprises both, overexpression of polynucleotides (e.g., on the transcriptional level) and overexpression of polypeptides (e.g., on the translation level). Accordingly, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain. In context with the present invention, a genetically modified microorganism is to be considered as "overexpressing" a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity if it expresses at least 1.5-fold, more preferably at least 1.8-fold, more preferably at least 2.0-fold, and most preferably at least 2.2-fold of said polynucleotide compared to a non-modified control microorganism of the same strain. In this context, the expression level of a polynucleotide can be easily assessed by the skilled person by methods known in the art, e.g., by quantitative RT-PCR (qRT-PCR), Northern Blot (for assessing the amount of expressed mRNA levels), Dot Blot, Microarray or the like (see, e.g., Sambrook, loc cit; Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647). Preferably, the amount of expressed polynucleotide is measured by qRT-PCR. Furthermore, in context with the present invention, a genetically modified microorganism is to be considered as "overexpressing" a polypeptide having 1,3-.beta.-D-glucan synthase-activity if it expresses at least 1.5-fold, more preferably at least 1.8-fold, more preferably at least 2.0-fold, and most preferably at least 2.2-fold of said polypeptide compared to a non-modified control microorganism of the same strain. In this context, the expression level of a polypeptide can be easily assessed by the skilled person by methods known in the art, e.g., by Western Blot, ELISA, EIA, RIA, or the like (see, e.g., Sambrook, loc cit; Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647). Preferably, the amount of expressed polypeptide is measured by Western Blot.

[0021] Generally, in context with the present invention, the polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity may be introduced into the microorganism in any suitable form, e.g., comprised in a vector, a plasmid or as naked nucleic acid. The polynucleotide introduced into the microorganism may then be exogenous (e.g., on a vector or a plasmid) within the microorganism (i.e. outside of the microbial chromosome(s)), or it may be incorporated into the microbial chromosome(s) by, e.g., random (ectopic) or homologous recombination or any other suitable method as known in the art. In context with the present invention, the polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity which has been introduced into the microorganism (i.e. the additional copy to the natural endogenous polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity of a corresponding unmodified strain) does not necessarily have to have the same nucleotide sequence as the natural endogenous polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity of a corresponding unmodified strain, as long as it has 1,3-.beta.-D-glucan synthase-activity as described herein. Methods for culturing microorganisms such as fermentation processes are known in the art and also described and exemplified herein (Kumari, Bioresource Technol (2008), 99: 1036-1043; Reyes, J Natural Studies (2009), 7(2), January-June). In context with the present invention, such methods allow the respective microorganism to grow and to produce the desired .beta.-glucan as described and exemplified herein. Suitable media may comprise, e.g., coconut water as described in Reyes, loc cit. Furthermore, as known in the art, there are several media particularly suitable for particular microorganisms. For example, also in context with the present invention, suitable media for culturing S. commune comprise CYM medium (25 g agar (Difco), 20 g glucose (Sigma), 2 g trypticase peptone (Roth), 2 g yeast extract (Difco), 0.5 g MgSO.sub.4.times.7 H.sub.2O (Roth), 0.5 g KH.sub.2PO.sub.4 and 1 g K.sub.2HPO.sub.4 (both from Riedel-de Haen) per liter H.sub.2O) (particularly useful for cultivation on solid support) or a medium comprising 30 g glucose (Sigma), 3 g yeast extract (Difco), 1 g KH.sub.2PO.sub.4 (Riedel-de Haen), 0.5 g MgSO.sub.4.times.7 H.sub.2O (Roth) per liter H.sub.2O (particularly useful for liquid cultures) as also described and exemplified herein. Further suitable media for culturing S. rolfsii are known in the art (Survase, Bioresource Technol (2006), 97: 989-993). The .beta.-glucan produced in accordance to the present invention can be recovered by various methods known in the art and described herein (see also "Recommended Practices for Evaluation of Polymers Used in Enhanced Oil Recovery Operations, API Recommended Practice 63 (RP 63), 1.sup.st Ed, American Petoleum Institute, Washington D.C., Jun. 1, 1990; Kumari, Bioresource Technol (2008), 99: 1036-1043).

[0022] In context with the present invention, the term "average branching degree about 0.3" may mean that in average about 3 of 10.beta.-D-(1-3)-glucopyranosyl units are (1-6) linked to a single .beta.-D-glucopyranosyl unit. In this context, the term "about" may mean that the average branching degree may be within the range from 0.1 to 0.5, preferably from 0.2 to 0.4, more preferably from 0.25 to 0.35, more preferably from 0.25 to 0.33, more preferably from 0.27 to 0.33, and most preferably from 0.3 to 0.33. It may also be 0.3 or 0.33. Schizophyllan, scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran all have an average branching degree between 0.25 and 0.33; for example, scleroglucan and schizophyllan have an average branching degree of 0.3 to 0.33 (Survase, loc cit; Novak, loc cit). The average branching degree of a .beta.-glucan can be determined by methods known in the art, e.g., by periodic oxidation analysis, methylated sugar analysis and NMR (Brigand, Industrial Gums, Academic Press, New York/USA (1993), 461-472).

[0023] In one embodiment of the present invention, the polymer to be produced is selected from the group consisting of schizophyllan, scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran. For example, the polymer may be schizophyllan or scleroglucan, particularly schizophyllan.

[0024] The microorganism of the present invention and as referred to and as employed in context with the present invention (hereinafter also referred to as "microorganism in context of the present invention") may generally be a microorganism which is per se (i.e. naturally, in a non-modified state in context with the present invention) capable of synthesizing .beta.-glucan polymers, particularly those polymers consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3. That is, such microorganisms preferably possess per se (i.e. naturally, in a non-modified state in context with the present invention) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity. Non-limiting examples of microorganisms in context of the present invention are Schizophyllum commune, Sclerotium rolfsii, Sclerotium glucanicum, Sclerotium delphinii, Porodisculus pendulus, Botrytis cinerea, Laminaria sp., Lentinula edoles, and Monilinia fructigena. For example, the microorganism in context with the present invention may be S. commune or S. rolfsii, particularly S. commune.

[0025] The polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity as referred to and to be employed in context with the present invention (hereinafter also referred to as the "polynucleotide in context of the present invention") may be a 1,3-.beta.-D-glucan synthase gene. For example, the polynucleotide in context of the present invention may comprise or may consist of a nucleic acid sequence which is at least 70%, preferably at least 75%, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99%, more preferably at least 99.5%, and most preferably 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, provided that the polypeptide encoded by said polynucleotide has 1,3-.beta.-D-glucan synthase-activity as further described and exemplified herein below. SEQ ID NO: 1 represents the nucleotide sequence of the gene of glucan synthase I of S. commune strain Lu15531 (obtained from Jena University (Germany) strain collection, Germany, Prof. E. Kothe; Jena University internal strain name: W22). SEQ ID NO: 3 represents the nucleotide sequence of the gene of glucan synthase II of S. commune strain Lu15531. SEQ ID NO: 5 represents the cDNA sequence of glucan synthase I of S. commune strain Lu15531. SEQ ID NO: 7 represents the cDNA sequence of glucan synthase II of S. commune strain Lu15531. SEQ ID NO: 9 represents the nucleotide sequence of the gene of glucan synthase I of S. commune strain Lu15634 (strain collection, BASF SE; monocaryotic strain originating from dicaryotic S. commune strain from strain collection at the Technical University of Braunschweig (Germany), Prof. Rau; generated by spore isolation). SEQ ID NO: 11 represents the nucleotide sequence of the gene of glucan synthase II of S. commune strain Lu15634. SEQ ID NO: 13 represents the cDNA sequence of glucan synthase I of S. commune strain Lu15634. SEQ ID NO: 15 represents the cDNA sequence of glucan synthase II of S. commune strain Lu15634.

[0026] The polypeptide as referred to and to be used in context with the present invention and the polypeptide encoded by the polynucleotide in context of the present invention (said polypeptides hereinafter also referred to as the "polypeptide in context of the present invention") has 1,3-.beta.-D-glucan synthase-activity. In one embodiment, it is a 1,3-.beta.-D-glucan synthase. For example, the polypeptide in context of the present invention may comprise or consist of an amino acid sequence which at least 70%, preferably at least 75%, more preferably at least 80%, more preferably at least 85%, more preferably at least 90%, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98%, more preferably at least 99%, more preferably at least 99.5%, and most preferably 100% identical to SEQ ID NO: 6, 8, 14 or 16, provided that the polypeptide has 1,3-.beta.-D-glucan synthase-activity. SEQ ID NO: 6 represents the amino acid sequence of glucan synthase I of S. commune strain Lu15531. SEQ ID NO: 8 represents the amino acid sequence of glucan synthase II of S. commune strain Lu15531. SEQ ID NO: 14 represents the amino acid sequence of glucan synthase I of S. commune strain Lu15634. SEQ ID NO: 16 represents the amino acid sequence of glucan synthase II of S. commune strain Lu15634.

[0027] In context with the present invention, the term "1,3-.beta.-D-glucan synthase-activity" means that the respective polypeptide is capable of catalyzing the elongation of the 1,3-.beta.-D-glucan chain (chain can be linear or branched) using UDP-glucose as substrate (see Inoue, Eur J Biochem (1995), 231: 845-854). For example, in context with the present invention, a polynucleotide may be considered to encode a polypeptide having 1,3-.beta.-D-glucan synthase-activity if an S. commune cell which is transformed with said polynucleotide and which expresses said polynucleotide constitutively is able to produce at least 50%, more preferably at least 75%, more preferably at least 100%, more preferably at least 120%, more preferably at least 150%, more preferably at least 200%, and most preferably at least 220% more schizophyllan compared to an S. commune cell not being transformed with said polynucleotide, wherein the following conditions may be applied. The respective S. commune cultures with transformed and non-transformed cells, respectively, may be cultivated as follows. For the liquid cultures, the following medium may be used (hereinafter referred to as "Standard Medium"): 30 g glucose (Sigma), 3 g yeast extract (Difco), 1 g KH.sub.2PO.sub.4 (Riedel-de Haen), 0.5 g MgSO.sub.4.times.7 H.sub.2O (Roth) per liter H.sub.2O. For both, pre-cultures and for main culture, 250 ml shaking flasks filled with 30 ml Standard Medium may be used. The cultivation may be carried out at 27.degree. C. and 225 rpm. Before each inoculation, the biomass may be homogenized for 1 minute at 13500 rpm using T 25 digital ULTRA-TURRAX.RTM. (IKA). The first pre-culture may be inoculated with 50 mg of wet biomass. The cultures may then be incubated for 72 hours. After 72 hours, the second pre-culture may be started. The concentration of the homogenized wet biomass from the first pre-culture used for inoculation may be 250 mg. Cultivation time may be 45 hours. After 45 hours, the main culture may be inoculated with 500 mg of homogenized wet biomass from the second pre-culture and cultivated for another 45 hours. Subsequently, the cultures may be treated as follows. 10 ml of the culture, 20 ml H.sub.2O and 90 .mu.l Acticide BW20 may be mixed. The sample may then be digested for 24 h at 40.degree. C. with .beta.-glucanase (0.3 ml) (Erbsloh). After the incubation, the sample may be centrifuged (e.g., 30 minutes at 3400 g) and the supernatant may be analyzed for glucose content using HPLC cation exchanger (Aminex HPX-87-H, BIO-RAD) with 0.5 M H.sub.2SO.sub.4 (Roth) as eluent and 0.5 ml/min flow rate at 30.degree. C. The typical schizophyllan structure as described herein may be confirmed by further analytical approaches as described in the Example herein below (e.g., by NMR and XRD). The same evaluation may be performed mutatis mutandis for assessing whether a given polypeptide has 1,3-.beta.-D-glucan synthase-activity in context of the present invention. In this case, a corresponding polynucleotide encoding said polypeptide to be assessed is evaluated mutatis mutandis as described above. If the expression of such a polynucleotide encoding said polypeptide to be assessed is considered to encode a polypeptide having 1,3-.beta.-D-glucan synthase-activity as described above, the polypeptide itself is considered to have 1,3-.beta.-D-glucan synthase-activity.

[0028] The level of identity between two or more sequences (e.g., nucleic acid sequences or amino acid sequences) can be easily determined by methods known in the art, e.g., by BLAST analysis. Generally, in context with the present invention, if two sequences (e.g., polynucleotide sequences or amino acid sequences) to be compared by, e.g., sequence comparisons differ in identity, then the term "identity" may refer to the shorter sequence and that part of the longer sequence that matches said shorter sequence. Therefore, when the sequences which are compared do not have the same length, the degree of identity may preferably either refer to the percentage of nucleotide residues in the shorter sequence which are identical to nucleotide residues in the longer sequence or to the percentage of nucleotides in the longer sequence which are identical to nucleotide sequence in the shorter sequence. In this context, the skilled person is readily in the position to determine that part of a longer sequence that matches the shorter sequence. Furthermore, as used herein, identity levels of nucleic acid sequences or amino acid sequences may refer to the entire length of the respective sequence and is preferably assessed pair-wise, wherein each gap is to be counted as one mismatch. These definitions for sequence comparisons (e.g., establishment of "identity" values) are to be applied for all sequences described and disclosed herein.

[0029] Moreover, the term "identity" as used herein means that there is a functional and/or structural equivalence between the corresponding sequences. Nucleic acid/amino acid sequences having the given identity levels to the herein-described particular nucleic acid/amino acid sequences may represent derivatives/variants of these sequences which, preferably, have the same biological function. They may be either naturally occurring variations, for instance sequences from other varieties, species, etc., or mutations, and said mutations may have formed naturally or may have been produced by deliberate mutagenesis. Furthermore, the variations may be synthetically produced sequences. The variants may be naturally occurring variants or synthetically produced variants or variants produced by recombinant DNA techniques. Deviations from the above-described nucleic acid sequences may have been produced, e.g., by deletion, substitution, addition, insertion and/or recombination. The term "addition" refers to adding at least one nucleic acid residue/amino acid to the end of the given sequence, whereas "insertion" refers to inserting at least one nucleic acid residue/amino acid within a given sequence. The term "deletion" refers to deleting or removal of at least one nucleic acid residue or amino acid residue in a given sequence. The term "substitution" refers to the replacement of at least one nucleic acid residue/amino acid residue in a given sequence. Again, these definitions as used here apply, mutatis mutandis, for all sequences provided and described herein.

[0030] Generally, as used herein, the terms "polynucleotide" and "nucleic acid" or "nucleic acid molecule" are to be construed synonymously. Generally, nucleic acid molecules may comprise inter alia DNA molecules, RNA molecules, oligonucleotide thiophosphates, substituted ribo-oligonucleotides or PNA molecules. Furthermore, the term "nucleic acid molecule" may refer to DNA or RNA or hybrids thereof or any modification thereof that is known in the art (see, e.g., U.S. Pat. No. 5,525,711, US 471 1955, U.S. Pat. No. 5,792,608 or EP 302175 for examples of modifications). The polynucleotide sequence may be single- or double-stranded, linear or circular, natural or synthetic, and without any size limitation. For instance, the polynucleotide sequence may be genomic DNA, cDNA, mitochondrial DNA, mRNA, antisense RNA, ribozymal RNA or a DNA encoding such RNAs or chimeroplasts (Gamper, Nucleic Acids Research, 2000, 28, 4332-4339). Said polynucleotide sequence may be in the form of a vector, plasmid or of viral DNA or RNA. Also described herein are nucleic acid molecules which are complementary to the nucleic acid molecules described above and nucleic acid molecules which are able to hybridize to nucleic acid molecules described herein. A nucleic acid molecule described herein may also be a fragment of the nucleic acid molecules in context of the present invention. Particularly, such a fragment is a functional fragment. Examples for such functional fragments are nucleic acid molecules which can serve as primers.

[0031] The term "hybridization" or "hybridizes" as used herein in context of nucleic acid molecules/DNA sequences may relate to hybridizations under stringent or non-stringent conditions. If not further specified, the conditions are preferably non-stringent. Said hybridization conditions may be established according to conventional protocols described, for example, in Sambrook, Russell "Molecular Cloning, A Laboratory Manual", Cold Spring Harbor Laboratory, N. Y. (2001); Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647; Ausubel, "Current Protocols in Molecular Biology", Green Publishing Associates and Wiley Interscience, N. Y. (1989), or Higgins and Hames (Eds.) "Nucleic acid hybridization, a practical approach" IRL Press Oxford, Washington D.C., (1985). The setting of conditions is well within the skill of the artisan and can be determined according to protocols described in the art. Thus, the detection of only specifically hybridizing sequences will usually require stringent hybridization and washing conditions such as 0.1.times.SSC, 0.1% SDS at 65.degree. C. Non-stringent hybridization conditions for the detection of homologous or not exactly complementary sequences may be set at 6.times.SSC, 1% SDS at 65.degree. C. As is well known, the length of the probe and the composition of the nucleic acid to be determined constitute further parameters of the hybridization conditions. Variations in the above conditions may be accomplished through the inclusion and/or substitution of alternate blocking reagents used to suppress background in hybridization experiments. Typical blocking reagents include Denhardt's reagent, BLOTTO, heparin, denatured salmon sperm DNA, and commercially available proprietary formulations. The inclusion of specific blocking reagents may require modification of the hybridization conditions described above, due to problems with compatibility. In accordance to the invention described herein, low stringent hybridization conditions for the detection of homologous or not exactly complementary sequences may, for example, be set at 6.times.SSC, 1% SDS at 65.degree. C. As is well known, the length of the probe and the composition of the nucleic acid to be determined constitute further parameters of the hybridization conditions.

[0032] Hybridizing nucleic acid molecules also comprise fragments of the above described molecules. Such fragments may represent nucleic acid molecules which code for a functional 1,3-.beta.-D-glucan synthase as described herein or a functional fragment thereof which can serve as a primer. Furthermore, nucleic acid molecules which hybridize with any of the aforementioned nucleic acid molecules also include complementary fragments, derivatives and variants of these molecules. Additionally, a hybridization complex refers to a complex between two nucleic acid sequences by virtue of the formation of hydrogen bonds between complementary G and C bases and between complementary A and T bases; these hydrogen bonds may be further stabilized by base stacking interactions. The two complementary nucleic acid sequences hydrogen bond in an antiparallel configuration. A hybridization complex may be formed in solution (e.g., Cot or Rot analysis) or between one nucleic acid sequence present in solution and another nucleic acid sequence immobilized on a solid support (e.g., membranes, filters, chips, pins or glass slides to which, e.g., cells have been fixed). The terms complementary or complementarity refer to the natural binding of polynucleotides under permissive salt and temperature conditions by base-pairing. For example, the sequence "A-G-T" binds to the complementary sequence "T-C-A". Complementarity between two single-stranded molecules may be "partial", in which only some of the nucleic acids bind, or it may be complete when total complementarity exists between single-stranded molecules. The degree of complementarity between nucleic acid strands has significant effects on the efficiency and strength of hybridization between nucleic acid strands. This is of particular importance in amplification reactions, which depend upon binding between nucleic acids strands. The term "hybridizing sequences" preferably refers to sequences which display a sequence identity of at least 45%, more preferably at least 50%, more preferably at least 55%, more preferably at least 60%, more preferably at least 65%, more preferably at least 70%, more preferably at least 75%, more preferably at least 80%. more preferably at least 85%, more preferably at least 90%, more preferably at least 95%, more preferably at least 96%, more preferably at least 97%, more preferably at least 98% more preferably at least 99%, more preferably at least 99.5%, and most preferably 100% identity with a nucleic acid sequence as described herein encoding a 1,3-.beta.-D-glucan synthase.

[0033] Also described herein are vectors containing a polynucleotide in context of the present invention. The present invention relates also to a vector comprising the polynucleotide in context of the present invention. The term "vector" as used herein particularly refers to plasmids, cosmids, viruses, bacteriophages and other vectors commonly used in genetic engineering. In a preferred embodiment, the vectors are suitable for the transformation, transduction and/or transfection of microorganisms as described herein, e.g., fungal cells, prokaryotic ells (e.g., bacteria), yeast, and the like. Specific examples of microorganisms in context with the present invention are Schizophyllum commune, Sclerotium rolfsii, Sclerotium glucanicum, Sclerotium delphinii, Porodisculus pendulus, Botrytis cinerea, Laminaria sp., Lentinula edoles, and Monilinia fructigena. In a particularly preferred embodiment, said vectors are suitable for stable transformation of the microorganism, for example to express the polypeptide having 1,3-.beta.-D-glucan synthase activity as described herein. Accordingly, in one aspect of the invention, the vector as provided is an expression vector. Generally, expression vectors have been widely described in the literature. As a rule, they may not only contain a selection marker gene and a replication-origin ensuring replication in the host selected, but also a promoter, and in most cases a termination signal for transcription. Between the promoter and the termination signal there is preferably at least one restriction site or a polylinker which enables the insertion of a nucleic acid sequence/molecule desired to be expressed.

[0034] It is to be understood that when the vector provided herein is generated by taking advantage of an expression vector known in the prior art that already comprises a promoter suitable to be employed in context of this invention, for example expression of a polypeptide having 1,3-.beta.-D-glucan synthase activity as described herein. The nucleic acid construct is preferably inserted into that vector in a manner the resulting vector comprises only one promoter suitable to be employed in context of this invention. The skilled person knows how such insertion can be put into practice. For example, the promoter can be excised either from the nucleic acid construct or from the expression vector prior to ligation. A non-limiting example of the vector of the present invention is pBluescript II comprising the polynucleotide in context of the present invention. Further examples of vectors suitable to comprise the polynucleotide in context of the present invention to form the described herein are known in the art and comprise, for example pDrive, pTOPO, pUC19 and pUC21.

[0035] Generally, the present invention relates to all the embodiments described herein as well as to all permutations and combinations thereof. The following particular aspects of the present invention must not be construed as limiting the scope of the present invention on such aspects.

[0036] In one aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain.

[0037] In one aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain.

[0038] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain.

[0039] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain.

[0040] In one aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain.

[0041] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain.

[0042] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain.

[0043] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain.

[0044] In another aspect, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0045] In another aspect, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0046] In another aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0047] In another aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0048] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0049] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0050] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0051] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0052] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0053] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0054] In another aspect, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0055] In another aspect, the present invention relates to a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0056] In another aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0057] In another aspect, the present invention relates to a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0058] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0059] In another aspect, the present invention relates to a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0060] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0061] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0062] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0063] In another aspect, the present invention relates to a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0064] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing schizophyllan.

[0065] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing scleroglucan.

[0066] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0067] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0068] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing schizophyllan, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0069] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing schizophyllan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0070] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing scleroglucan, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15.

[0071] In another aspect, the present invention relates to the use of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing scleroglucan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0072] In another aspect, the present invention relates to the use of a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing schizophyllan.

[0073] In another aspect, the present invention relates to the use of a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing scleroglucan.

[0074] In another aspect, the present invention relates to the use of polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0075] In another aspect, the present invention relates to the use of a polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing schizophyllan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0076] In another aspect, the present invention relates to the use of polypeptide having 1,3-.beta.-D-glucan synthase-activity for producing scleroglucan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16.

[0077] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0078] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0079] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0080] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0081] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan.

[0082] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, wherein said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan. In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0083] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0084] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0085] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0086] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan.

[0087] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan.

[0088] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0089] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0090] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0091] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing schizophyllan.

[0092] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan.

[0093] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing scleroglucan.

[0094] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0095] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0096] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for schizophyllan.

[0097] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for schizophyllan.

[0098] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, for scleroglucan.

[0099] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, for scleroglucan.

[0100] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0101] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0102] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0103] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0104] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0105] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0106] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0107] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0108] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0109] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0110] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0111] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0112] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0113] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0114] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0115] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0116] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0117] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0118] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0119] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0120] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0121] In another aspect, the present invention relates to a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0122] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0123] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0124] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0125] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0126] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0127] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing schizophyllan.

[0128] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0129] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15, for producing scleroglucan.

[0130] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0131] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0132] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0133] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0134] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0135] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0136] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0137] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0138] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0139] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0140] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0141] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing schizophyllan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0142] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0143] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0144] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0145] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0146] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0147] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Schizoyphyllum commune, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0148] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0149] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0150] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0151] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0152] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0153] In another aspect, the present invention relates to the use of a genetically modified microorganism capable of producing scleroglucan, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0154] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0155] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3.

[0156] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0157] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing schizophyllan.

[0158] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase-activity, compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0159] In another aspect, the present invention relates to the use of a genetically modified microorganism of the species Sclerotium rolfsii, characterized in that said genetically modified microorganism contains at least one copy more of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity compared to a corresponding non-modified control microorganism of the same strain, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16, for producing scleroglucan.

[0160] In another aspect, the present invention relates to a method of producing schizophyllan, said method comprising the steps of: [0161] (a) introducing a strong (e.g., constitutive or inducible) promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of said polynucleotide, or a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize schizophyllan; [0162] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce schizophyllan; and [0163] (c) optionally recovering schizophyllan from the medium.

[0164] In another aspect, the present invention relates to a method of producing scleroglucan, said method comprising the steps of: [0165] (a) introducing a strong (e.g., constitutive or inducible) promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of said polynucleotide, or a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize scleroglucan; [0166] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce scleroglucan; and [0167] (c) optionally recovering scleroglucan from the medium.

[0168] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0169] (a) introducing a strong (e.g., constitutive or inducible) promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of said polynucleotide, or a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Schizophyllum commune being able to synthesize said polymer; [0170] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0171] (c) optionally recovering said polymer from the medium.

[0172] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0173] (a) introducing a strong (e.g., constitutive or inducible) promoter upstream of a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity thereby increasing the expression of said polynucleotide, or a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Sclerotium rolfsii being able to synthesize said polymer; [0174] (b) culturing said microorganism of (a) in a medium, thereby allowing said so microorganism to produce said polymer; and [0175] (c) optionally recovering said polymer from the medium.

[0176] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0177] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize said polymer, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0178] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0179] (c) optionally recovering said polymer from the medium.

[0180] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0181] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize said polymer, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0182] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0183] (c) optionally recovering said polymer from the medium.

[0184] In another aspect, the present invention relates to a method of producing schizophyllan, said method comprising the steps of: [0185] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize schizophyllan, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0186] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce schizophyllan; and [0187] (c) optionally recovering schizophyllan from the medium.

[0188] In another aspect, the present invention relates to a method of producing scleroglucan, said method comprising the steps of: [0189] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize scleroglucan, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0190] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce scleroglucan; and [0191] (c) optionally recovering scleroglucan from the medium.

[0192] In another aspect, the present invention relates to a method of producing schizophyllan, said method comprising the steps of: [0193] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize schizophyllan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0194] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce schizophyllan; and [0195] (c) optionally recovering schizophyllan from the medium.

[0196] In another aspect, the present invention relates to a method of producing scleroglucan, said method comprising the steps of: [0197] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize scleroglucan, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0198] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce scleroglucan; and [0199] (c) optionally recovering scleroglucan from the medium.

[0200] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0201] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Schizophyllum commune being able to synthesize said polymer, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0202] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0203] (c) optionally recovering said polymer from the medium.

[0204] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0205] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Sclerotium rolfsii being able to synthesize said polymer, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0206] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0207] (c) optionally recovering said polymer from the medium.

[0208] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0209] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Schizophyllum commune being able to synthesize said polymer, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0210] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0211] (c) optionally recovering said polymer from the medium.

[0212] In another aspect, the present invention relates to a method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: [0213] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Sclerotium rolfsii being able to synthesize said polymer, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0214] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0215] (c) optionally recovering said polymer from the medium.

[0216] In another aspect, the present invention relates to a method of producing schizophyllan, said method comprising the steps of: [0217] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Schizophyllum commune being able to synthesize said polymer, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0218] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0219] (c) optionally recovering said polymer from the medium.

[0220] In another aspect, the present invention relates to a method of producing scleroglucan, said method comprising the steps of: [0221] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Sclerotium rolfsii being able to synthesize said polymer, wherein said polynucleotide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 1, 3, 5, 7, 9, 11, 13 or 15; [0222] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0223] (c) optionally recovering said polymer from the medium.

[0224] In another aspect, the present invention relates to a method of producing schizophyllan, said method comprising the steps of: [0225] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Schizophyllum commune being able to synthesize said polymer, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0226] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0227] (c) optionally recovering said polymer from the medium.

[0228] In another aspect, the present invention relates to a method of producing scleroglucan, said method comprising the steps of: [0229] (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism of the species Sclerotium rolfsii being able to synthesize said polymer, wherein said polypeptide is at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 100% identical to SEQ ID NO: 6, 8, 14 or 16; [0230] (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and [0231] (c) optionally recovering said polymer from the medium.

[0232] The Figures show:

[0233] FIG. 1 XRD Spectrum of Schizophyllan sample. The triple helix could be seen as an intensive diffraction at 5.degree. 2.theta. and the amorphous region of the material gives broad diffraction in the range of 20-25.degree. 2.theta.

[0234] FIG. 2 .sup.1H-NMR of schizophyllan (50 mg of gel) in [D.sub.6]-DMSO measured at 50.degree. C. (16 scans, 600 MHz). The substitution pattern of schizophyllan can be assigned from the integrations of the CH.sub.2OH at 3.7 ppm and CH.sub.2O (ether) at 4.1 ppm signals, the ratio was determined to be 3.3:1 indicating the correct repeating unit.

[0235] FIG. 3 13C-NMR of schizophyllan (50 mg of gel) in [D6]-DMSO measured at 50.degree. C. (10.000 scans, 600 MHz). Assignment of the signals, .delta. (ppm): 60 and 61 (C-6), 68 (C6-C .beta.(1-6)), 68 (C4-OH side glucose), 70 (C-2 backbone), 72 (C-2), 76 (C-5), 76.7 (C-3 side glucose), 86 (c-.sctn.backbone), 103 (C-1).

[0236] FIG. 4 Schematic picture of the repeating unit of schizophyllan.

[0237] The following Examples illustrate the present invention. Yet, the present invention must not be construed as being limited by the following Examples.

EXAMPLES

Example 1

Cloning of the .beta.-1,3-Glucan Synthase Expression Plasmid (pGS_1) and Transformation into S. commune

[0238] In the genome of Schizophyllum commune, two genes encoding for .beta.-1,3-glucan synthase were identified by using BLAST analysis (query genes: 1,3-.beta.-glucan synthase sequence from Mycosphaerella graminicola, Saccharomyces cerevisiae, Cryptococcus neoformans, Schizosaccharomyces pombe); cf. Ullman, Biochem J (1997), 326: 929-942. In context of the present invention, it was proven that the overexpression of either of these .beta.-1,3-glucan synthases in S. commune results in increased yields of schizophyllan production.

[0239] Two expression plasmids (pGS_1)] and (pGS_2) (having pBluescript II as backbone) were generated carrying selection marker cassette (amp.sup.R, ura1), strong constitutive promoter (Tef1 promoter), the synthase gene sequence (genomic seqence) and terminator sequence (Tef1 terminator).

[0240] All polynucleotide sequences described herein originate from Schizopyllum commune. The polynucleotides represented by SEQ ID NO: 1 and 3 (genes .beta.-1,3-glucan synthases I and II of Lu15531, respectively) were synthesized by Eurofins MWG GmbH/Germany (eurofinsdna.com/de) according to the original sequence data sourced from JGI data base (jgi.doe.gov/Scommune; gene position: scaffold 2, 1194740-1200474 and gene position: scaffold 6, 1391067-1396555). The sequences were delivered on pMK plasmids (pMK_GS_1) and (pMK_GS_2) (Eurofins plasmids containing kan.sup.R, ColE1 origin and genomic sequence of respective .beta.-1,3-glucan synthases). The polynucleotides were further used for the cloning of the complete expression plasmid. Plasmid (pMK_GS_1) contained a polynucleotide represented by SEQ ID NO: 1 flanked by 5' SpeI and 3' SalI restriction sites. Plasmid (pMK_GS_2) contained a polynucleotide represented by SEQ ID NO: 3 flanked by 5' SpeI and 3' EcoRV restriction sites, respectively.

[0241] The individual elements (SEQ ID NO: 17, 18 and 33 (Tef1 promoter, Tef1 terminator and ura1) were isolated from the genomic DNA of Schizophyllum commune using PCR technology prepared by established microbiologic protocols (Sambrook, Current Protocols in Molecular Biology, Update May 9, 2012, Print ISSN: 1934-3639, Online ISSN: 1934-3647).

[0242] All plasmid isolations were conducted according to manufacturer's instructions using HiSpeed Maxi Kit (Quiagen/Germany). For this purpose, Escherichia coli XL10 cells (Stratagene) containing the final expression plasmid or one of the interim plasmids were cultivated in Luria-Bertoni (LB) medium (Sigma-Aldrich) containing 50 mg/ml Ampicillin (Sigma-Aldrich).

[0243] For isolation of tef1 promoter sequence (SEQ ID NO: 17), 50 .mu.l PCR reaction contained 1.25 U PfuUltra Hotstart Mastermix (Stratagene) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l H.sub.2O, 22.1 pmol of forward primer TefP_forw (XbaI) (SEQ ID NO: 21) and 100 pmol of reverse primer TefP_rev (SpeI) (SEQ ID NO: 22), and 100 ng of template (genomic DNA of Schizophyllum commune). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used for the amplification: initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 55.degree. C., 1 minute elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes.

[0244] For amplification of the synthetic .beta.-1,3-glucan synthase gene (SEQ ID NO: 1), 50 .mu.l PCR reaction contained 1.25 U PfuUltra Hotstart Mastermix (Stratagene) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l H.sub.2O, 100 pmol of forward primer GS1_forw (SpeI) (SEQ ID NO: 27) and 22 pmol of reverse primer GS1_rev (SalI)(SEQ ID NO: 28), 100 ng template (pMK_GS_1). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used for the amplification: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 55.degree. C., 8 minutes elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes.

[0245] In the next PCR reaction step, fusion of the first two PCR products (tef1 promoter (SEQ ID NO: 17) with .beta.-1,3-glucan synthase gene (SEQ ID NO: 1) was carried out. 50 .mu.l PCR reaction contained 1.25 U of Pwo Hotstart Mastermix (Roche) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l of H.sub.2O, 22.1 pmol of each primer: Fusion TefP_GS1_forw (XbaI) (SEQ ID NO: 29) and Fusion TefP_GS1_rev (SalI) (SEQ ID NO: 30) and 100 ng of both templates. The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used for the fusion of both sequences: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 55.degree. C., 8 minutes elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes.

[0246] The product of the fusion PCR was treated with SalI and XbaI restriction enzymes (Roche) according to manufacturer's instructions and the vector (pBluescript 2KSP, Stratagene Cloning Systems) was linearized using the same restriction enzymes and subsequently treated with alkaline phosphatase (Roche) according to manufacturer's instructions. Both, the digested PCR product and the linearized pBluescript 2KSP vector, were ligated using T4 DNA Ligase (New England Biolabs, Inc., Beverly, Mass./USA) and transformed into Escherichia coli XL10 cells (Stratagene) according to manufacturer's instructions.

[0247] For isolation of tef1 terminator sequence (SEQ ID NO: 18) following PCR reaction was carried out: 50 .mu.l PCR reaction contained 1.25 U of Pwo Hotstart Mastermix (Roche) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l of H.sub.2O, 24 pmol of forward primer TefT_forw (SalI) (SEQ ID NO: 23) and 21 pmol of reverse primer TefT_rev (SalI) (SEQ ID NO: 24), and 100 ng of template (genomic DNA of Schizophyllum commune). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 60.degree. C., 1 minute elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes. The PCR product was treated with SalI restriction enzyme (Roche) and ligated with the plasmid containing tef1 promoter and .beta.-1,3-glucan synthase, which was before linearized with SalI restriction enzyme (Roche) and treated with alkaline phosphatase (Roche) according to manufacturer's instructions. After ligation, the DNA construct was transformed into Escherichia coli XL10 cells (Stratagene) according to manufacturer's instructions. To enable screening of Schizophyllum commune strains after transformation with the .beta.-1,3-glucan synthase expression, a plasmid selection marker (ura1; SEQ ID NO: 33) was introduced into the plasmid. For that purpose, ura1 gene was isolated from the genomic DNA of Schizophyllum commune. The PCR reaction contained 2.5 U of Pwo Hotstart Mastermix (Roche), 22 .mu.l of H.sub.2O, 21 pmol of forward primer Ura_forw (NotI) (SEQ ID NO: 19), 38 pmol of reverse primer Ura_rev (XbaI) (SEQ ID NO: 20) and 100 ng of the template (genomic DNA of Schizophyllum commune). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 60.degree. C., 2 minutes elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes. The PCR Product was digested with XbaI and NotI restriction enzymes (Roche) and ligated into the XbaI/NotI site of the .beta.-1,3-glucan synthase expression plasmid (pGS_1) using T4 DNA Ligase (New England Biolabs, Inc., Beverly, Mass./USA). The resulting plasmid encoding .beta.-1,3-glucan synthase with tef1 promoter and terminator, and containing ura1 selection marker was transformed into Escherichia coli XL10 cells (Stratagene) according to manufacturer's instructions.

[0248] For the transformation of Schizophyllum commune with the .beta.-1,3-glucan synthase expression plasmid (pGS_1), plasmid preparation was carried out as follows. Escherichia coli XL10 cells containing the .beta.-1,3-glucan synthase expression plasmid were cultivated in Luria-Bertoni (LB) medium (Sigma-Aldrich) containing 50 mg/ml Ampicillin (Sigma-Aldrich) and the plasmid isolation was conducted according to manufacturer's instructions using HiSpeed Maxi Kit (Quiagen).

[0249] Schizophyllum commune (Lu15527; obtained from strain collection of University of Jena (Germany), Prof. E. Kothe, Jena University internal strain name: 12-43) was transformed based on the method described by van Peer et al. (van Peer, loc cit) as basis. The method was modified according to the description below.

[0250] For preparation of S. commune protoplasts, fresh culture was inoculated on a plate containing complex medium (CYM). For incubation at 26.degree. C. for 2-3 days, plates were sealed with parafilm.

[0251] For inoculation of liquid preculture (50 ml working volume), the biomass from the plate was macerated for 1 minute at 13500 rpm using T 25 digital ULTRA-TURRAX.RTM. (IKA), inoculated in shaking flask containing liquid CYM medium and incubated at 30.degree. C., 220 rpm for further 3 days. Main culture was inoculated with 15 ml of the preculture in 200 ml CYM medium and incubated further 3 days at 30.degree. C. at 220 rpm. After finishing the culture growth, the main culture was divided in four 50 ml samples and centrifuged (4000 rpm, 15 min). Obtained pellet was washed twice with 1 M MgSO.sub.4 (50 ml) (Roth). After washing, four samples were united and dissolved 50 ml 1M MgSO.sub.4.

[0252] To enable cell wall lysis, 100 mg Caylase (Cayla, Toulouse, France) were dissolved in 1 mL 1 M MgSO.sub.4 and added to the pellet suspension. The sample was incubated over night at 30.degree. C. under slight shaking (70 rpm). Subsequently distilled water was added to the sample (in 1:1 ratio), which was then incubated under slight shaking (70 rpm) for further 5 min. After this step, cells were incubated without shaking for 10 min and subsequently centrifuged (1100 rpm, 20 min, 4.degree. C.). After the supernatant was filtrated using Miracloth-Membrane, one volume of cold 1 M sorbitol was added and the sample was allowed to equilibrate for 10 min. Subsequently, the sample was centrifuged (2000 rpm, 20 min, 2.degree. C.). Pellet was washed by re-suspending carefully in 1 M sorbitol and centrifugation step was repeated. Finally the protoplasts were re-suspended in 1 M sorbitol and 50 mM CaCl.sub.2 at a concentration of 10.sup.8 protoplasts per ml.

[0253] DNA used for transformation was a circular plasmid (pGS_1) and the integration in the genome of S. commune was ectopic. To transform the protoplasts with the DNA, 100 .mu.l protoplasts and 10 .mu.l DNA (5-10 .mu.g) were gently mixed and incubated for 60 min on ice. Subsequently, one volume of PEG 4000 (40%) was added and the sample was incubated for 5 to 10 min on ice. After adding 2.5 ml regeneration medium (complete medium containing 0.1 .mu.g/ml Phleomycin and 0.5 M MgSO.sub.4), the sample was incubated at 30.degree. C., 70 rpm overnight.

[0254] After PEG mediated transformation, regenerated protoplasts were spread on petri dishes containing 40 ml solidified minimal medium: 2 g aspartic acid (Roth), 20 g glucose (Sigma), 0.5 g MgSO.sub.4 (Roth), 0.5 g KH.sub.2PO.sub.4, 1 g K.sub.2HPO.sub.4 (both from Riedel-de Haen), 120 .mu.g thiaminhydrochlorid (Roth) per liter, pH 6.3 containing 1% low melting agarose (Sigma). Selection plates were incubated 5 days at 30.degree. C.

Example 2

Cloning of the .beta.-1,3-Glucan Synthase Expression Plasmid [pGS 2] and Transformation into S. commune

[0255] The expression plasmid for the second .beta.-1,3-glucan synthase (SEQ ID NO: 3) (pGS_2) was prepared analogously to the preparation of (pGS_1) as described above in Example 1.

[0256] As a source of the promoter sequence tef1 (SEQ ID NO: 17); the same PCR product as in Example 1 was used.

[0257] Polynucleotide represented by SEQ ID NO: 3 was amplified from the (pMK_GS_2) plasmid following PCR reaction: 50 .mu.l PCR reaction contained 1.25 U PfuUltra Hotstart Mastermix (Stratagene) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l H.sub.2O, 23 pmol of each primer: GS2_forw (SpeI)/SEQ ID NO: 31) and GS2_rev (EcoRV)(SEQ ID NO: 32), 100 ng of template (pMK_GS_2). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used for the amplification: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 53.degree. C., 8 minutes elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes.

[0258] For isolation of tef1 terminator sequence (SEQ ID NO: 18) and introduction of the EcoRV (5') and ApaI (3') sites, the following PCR reaction was carried out: 50 .mu.l PCR reaction contained 1.25 U of Pwo Hotstart Mastermix (Roche) and 1.25 U Taq PCR Mastermix (Quiagen), 22 .mu.l of H.sub.2O, 37 pmol of forward primer TefT_forw (EcoRV) (SEQ ID NO: 25) and 25 pmol of reverse primer TefT_rev (ApaI)(SEQ ID NO: 26), and 100 ng of template (genomic DNA of Schizophyllum commune). The reaction was carried out in Gene Amp.RTM. PCR System 9700 Thermal Cycler from PE Applied Biosystems. The following program was used: an initial heating step up to 95.degree. C. for 4 minutes was followed by 30 cycles of 30 seconds denaturing at 95.degree. C., 30 seconds of annealing step at 58.degree. C., 1 minute elongation step at 72.degree. C., followed by one cycle at 72.degree. C. for 10 minutes. The PCR product was treated with EcoRV and ApaI restriction enzyme (Roche) and ligated with the vector (pBluescript 2KSP, Stratagene Cloning Systems), which was before digested the same restriction enzymes. After ligation, the DNA construct was transformed into Escherichia coli XL10 cells (Stratagene), according to manufacturer's instructions.

[0259] Subsequently, tef1 promoter was cloned into the plasmid. For this purpose, the PCR product was digested with XbaI and SpeI (Roche) and ligated with the plasmid described above according to manufacturer's instructions, containing tef1 terminator which was linearized using XbaI and SpeI. The ligation was carried out as described in Example 1 herein. After ligation, the DNA construct was transformed into Escherichia coli XL10 cells (Stratagene) according to manufacturer's instructions.

[0260] Subsequently, ura1 was cloned into the plasmid. The same PCR product as in Example 1 was used. After digestion of the PCR product with NotI and XbaI, the fragment was cloned into the plasmid carrying the polynucleotide represented by SEQ ID NO: 7, tef1 promoter and terminator sequences. Before ligation, the plasmid was linearized by NotI and XbaI. Transformation was carried out as described above in Example 1.

[0261] Finally, .beta.-1,3-glucan synthase (SEQ ID NO: 3) was ligated into the plasmid. For this purpose, the PCR product was treated with SpeI and EcoRV and ligated into the target expression plasmid as described above. Transformation was carried out as described above in Example 1.

[0262] Transformation of Schizophyllum commune with (pGS_2) followed as described in Example 1.

Example 3

Verification of the Functionality of the Engineered S. commune Strains

[0263] Genetically modified S. commune strains generated as described above were tested in shaking flasks for increased schizophyllan production. To assure the reproducibility of the results, a three-step cultivation was applied, consisting of two pre-cultures and one main culture as further described herein below.

[0264] For the cultivation of the genetically modified Schizophyllum commune strains, two different media were used. For cultivation on solid media, CYM medium (25 g agar (Difco), 20 g glucose (Sigma), 2 g trypticase peptone (Roth), 2 g yeast extract (Difco), 0.5 g MgSO.sub.4.times.7 H.sub.2O (Roth), 0.5 g KH.sub.2PO.sub.4 and 1 g K.sub.2HPO.sub.4 (both from Riedel-de Haen) per liter H.sub.2O) was used. Strains were inoculated on agar plates containing CYM medium covered with cellophane (to avoid mycelium growth into the agar) and incubated for three to four days at 26.degree. C.

[0265] For the liquid cultures, the following medium was used (hereinafter referred to as "Standard Medium"): 30 g glucose (Sigma), 3 g yeast extract (Difco), 1 g KH.sub.2PO.sub.4 (Riedel-de Haen), 0.5 g MgSO.sub.4.times.7 H.sub.2O (Roth) per liter H.sub.2O.

[0266] For both pre-cultures and for main culture, 250 ml shaking flasks filled with 30 ml Standard Medium were used. The cultivation was carried out at 27.degree. C. and 225 rpm. Before each inoculation, the biomass was homogenized for 1 minute at 13500 rpm using T 25 digital ULTRA-TURRAX.RTM. (IKA).

[0267] The first pre-culture was inoculated with 50 mg of wet biomass. The cultures were incubated for 72 hours. After 72 hours, the second pre-culture was started. The concentration of the homogenized wet biomass from the first pre-culture used for inoculation was 250 mg. Cultivation time was 45 hours. After 45 hours, the main culture was inoculated with 500 mg of homogenized wet biomass from the second pre-culture and cultivated for another 45 hours.

[0268] After the cultivation was finished, standard analytical methods as described herein below were applied to define the biomass concentration, schizophyllan concentration, ethanol concentration and residual glucose in medium. 50 ml aliquots of the cultures were stabilized with 3 g/l Acticide BW20 (Thor).

[0269] Ethanol and glucose concentration was estimated using HPLC method. For this purpose 14 ml of the culture were centrifuged (30 min, 8500 rpm). The supernatant was sterile-filtrated and 1 ml of the filtrate was injected for the HPLC analysis (HPLC cation exchanger: Aminex HPX-87-H, BIO-RAD with 0.5 M H.sub.2SO.sub.4, Roth, as eluent and 0.5 ml/min flow rate at 30.degree. C.).

[0270] Due to the fact that schizophyllan consists only of glucose molecules, the quantification of this polymer can be done using standard analytical methods for glucose. 10 ml of the culture, 20 ml H.sub.2O and 90 .mu.l Acticide BW20 were mixed. The sample was digested for 24 h at 40.degree. C. with .beta.-glucanase (0.3 ml) (Erbsloh). After the incubation, the sample was centrifuged (30 minutes at 3400 g) and the supernatant was analyzed for glucose and ethanol content using HPLC cation exchanger (Aminex HPX-87-H, BIO-RAD) with 0.5 M H.sub.2SO.sub.4 (Roth) as eluent and 0.5 ml/min flow rate at 30.degree. C.

[0271] For the biomass determination, the remaining biomass in form of pellet (after .beta.-glucanase digestion sample was centrifuged) was washed twice with 50 ml H.sub.2O, filtrated using Whatman-Filter (with determination of filter's weight before filtration), washed twice with H.sub.2O and dried in HB43S drying scale from Mettler Toledo. Drying of the filter was carried out for 5 to 10 minutes at 180.degree. C. Subsequently, weight of the dry filter was determined.

[0272] The evaluation of the results obtained in shaking flasks showed clear effect of the overexpression of both .beta.-1,3-glucan synthases on the schizophyllan production. Because of the fact that in the expression plasmid was ectopically integrated into genome and the integration locus has an explicit effect on the expression of the target gene, 40 clones carrying the plasmid (pGS_1) and 40 clones carrying the plasmid (pGS_2) were tested in shaking flask experiments. The increase of schizophyllan production in the genetically modified strains is shown in Table 1 in comparison to the non-modified Schizophyllum commune control strain. The results shown in the Table 1 refer to the best strain of each 40 strains tested. For classification of the strains, the amount of schizophyllan in the sample was decisive. 10 ml of the culture, 20 ml H.sub.2O and 90 .mu.l Acticide BW20 were mixed. The sample was digested for 24 h at 40.degree. C. with 0.3 ml .beta.-glucanase (Erbsloh). After the incubation, the sample was centrifuged (30 minutes at 3400 g) and the supernatant was analyzed for glucose and ethanol content using HPLC cation exchanger (Aminex HPX-87-H, BIO-RAD) with 0.5 M H.sub.2SO.sub.4 (Roth) as eluent and 0.5 ml/min flow rate at 30.degree. C.

[0273] In addition to increased yields of schizophyllan production in the genetically modified S. commune strains, a clear decrease in the synthesis of the by-product ethanol was observed. This can be an indication that the excess rate of glucose by up-regulated .beta.-1,3-glucan synthase activity is metabolized more directly in the schizophyllan pathway instead of partly being used for ethanol synthesis.

TABLE-US-00001 TABLE 1 Comparison of Schizophyllum commune control strain with two genetically modified S. commune strains carrying glucan synthase expression plasmid (pGS_1) or (pGS_2). Schizophyllan EtOH [% Strain [%] [%] S. commune control strain 100 100 S. commune (pGS_1) 220 9 S. commune (pGS_2) 215 3.6

Structure and Conformation Analysis of the Product

[0274] To assure that the polymer synthesized through genetically modified S. commune strains is schizophyllan, XRD and NMR methods were applied to confirm the structure of the molecule as follows.

[0275] Powder X-ray diffraction (XRD) allows rapid, non-destructive analysis of materials consisting of multiple components. Moreover, the sample preparation is straightforward. The data from the measurement is presented as a diffractogram in which the diffracted intensity (I) is shown as a function of scattering angle 2.theta.. The crystallinity of the given material can be determined by this measurement. In general, crystalline materials have reflection patterns of a series of sharp peaks whereas amorphous materials give a broad signals. Many polymers exhibit semicrystalline behaviour which can also be detected by XRD (Hammond, The basics of chrystallography and diffraction, 3.sup.rd Ed., Oxford University Press 2009).

Sample Preparation from Aqueous Solution

[0276] Aqueous solution containing schizophyllan was poured in ethanol to precipitate schizophyllan. The precipitation was filtered and dried either in a vacuum oven. The dried sample was measured by XRD.

Sample Measurement and Results by XRD

[0277] Schizophyllan exhibits a triple helical structure. This was evident from the diffractogram of the precipitated and dried schizophyllan sample (FIG. 2). The triple helix could be seen as an intensive diffraction at 5.degree. 2.theta. and the amorphous region of the material gives broad diffraction in the range of 20-25.degree. 2.theta. (Hisamatsu, Carbohydr Res (1997), 298: 117).

Sample Measurement and Results by NMR

[0278] The NMR spectra were recorded on a Varian VNMRS 600 MHz system equipped with a .sup.13C-enhanced cryo probe (inverse configuration) at ambient temperatures or at 50.degree. C. using standard pulse sequences for .sup.1H and .sup.13C.

[0279] It is known that schizophyllan has a triple helical structure formed by three .beta.(1-3)-D-glucan chains held together by hydrogen bonds in water. This structure is shielded in the magnetic field due to the rigid, ordered conformation. This means that in NMR spectrum, chemical shifts for schizophyllan are not obtained (Rinaudo, Carbohydr Polym (1982), 2: 135; Vlachou, Carbohydr Polym (2001), 46: 349) (2D NMR). In order to investigate the molecular structure of schizophyllan and not the macromolecular structure consisting of triple helices and further to record the successful NMR spectra with a good signal-to-noise ratio, the conformation of the triple helix has to be changed. It is also known that the triple helix of schizophyllan can be altered to form a random coil structure by addition of DMSO. When the DMSO concentration exceeds a certain threshold values (i.e. 87%), the conformation change takes place; therefore deuterated [D.sub.6]-DMSO was used as a solvent for the measurements. This conformation matter is important to take into consideration when conducting NMR experiments for schizophyllan. Hence, the sample was measured in [D.sub.6]-DMSO, the well-resolved spectra can be obtained (FIGS. 2 and 3).

SUMMARY

[0280] The chemical structures of the materials from S. commune (GS_1) and S. commune (GS_2) strain was identified to be the correct for that of schizophyllan. In addition, the materials exhibit the triple helix conformations.

Sequences Referred to in the Present Application

TABLE-US-00002 [0281] TABLE 2 Assignment of SEQ ID NOs. SEQ ID NO: type of sequence description 1 nucleotide sequence Gene sequence* 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15531 2 amino acid sequence translation of SEQ ID NO: 5 3 nucleotide sequence Gene sequence* 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15531 4 amino acid sequence translation of SEQ ID NO: 7 5 nucleotide sequence cDNA 1,3-.beta.-D-glucan synthase I of S. commune strain Lu 15531 6 amino acid sequence polypeptide sequence 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15531 7 nucleotide sequence cDNA 1,3-.beta.-D-glucan synthase II of S. commune strain Lu 15531 8 amino acid sequence polypeptide sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15531 9 nucleotide sequence Gene sequence* 1,3-.beta.-D-glucan synthase I of S. commune strain Lu 15634 10 amino acid sequence translation of SEQ ID NO: 13 11 nucleotide sequence Gene sequence* 1,3-.beta.-D-glucan synthase II of S. commune strain Lu 15634 12 amino acid sequence translation of SEQ ID NO: 15 13 nucleotide sequence cDNA 1,3-.beta.-D-glucan synthase I of S. commune strain Lu 15634 14 amino acid sequence polypeptide sequence 1,3-.beta.-D-glucan synthase I of S. commune strain Lu 15634 15 nucleotide sequence cDNA 1,3-.beta.-D-glucan synthase II of S. commune strain Lu 15634 16 amino acid sequence polypeptide sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu 15634 17 nucleotide sequence tef1 promoter from S. commune 18 nucleotide sequence tef1 terminator from S. commune 19 nucleotide sequence Ura_forw (Notl) primer 20 nucleotide sequence Una_rev (Xbal) primer 21 nucleotide sequence TefP_forw (Xbal) primer 22 nucleotide sequence TefP_rev (Spel) primer 23 nucleotide sequence TefT_forw (Sall) primer 24 nucleotide sequence TefT_rev (Sall) primer 25 nucleotide sequence TefT_forw (EcoRV) primer 26 nucleotide sequence TefT_rev (Apal) primer 27 nucleotide sequence GS1_forw (Spel) primer 28 nucleotide sequence GS1_rev(Sall) primer 29 nucleotide sequence Fusion_TefP_GS1_forw (Xbal) primer 30 nucleotide sequence Fusion_TefP GS1 rev (Sall) primer 31 nucleotide sequence GS2_forw (Spel) primer 32 nucleotide sequence GS2_rev (EcoRV) primer 33 nucleotide sequence ura gene (S. commune) 34 amino acid sequence Ura protein *Gene sequence includes introns and flanking regions. In the gene sequences below (for SEQ ID NO: 1, 3, 9 and 11), predicted exons are shown in capital letters, introns are shown in lower case letters.

TABLE-US-00003 Gene sequence 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15531 DNA S. commune SEQ ID NO: 1 CCCGTCCCTCAAGGCCGTTCTTTCGCTGGCGACCGACCCGGTGTTCGCGAGAA CCTGTTGTTTCTGACGATCATCAGCCCTTTCTTCTCGTCGCTCTTTAGCTCTCCC TAGACCGTCTTTTACTCTACTCTTCGACGCACGCCATGTCCGGCCCAGGATATG GCAGGAATCCATTCGACAATCCCCCGCCCAACAGAGGTCCCTATGGCCAGCAG CCAGGTTTCCCGGGGCCCGGCCCTCGGCCTTACGACTCGGACGCGGACATGA GCCAGACCTATGGCAGCACAACCAGGCTCGCCGGCAGTGCCGGTTACAGCGA CAGAAACGgtgcgcacgtcgctaccgtacttcctcgatcgtcgattcacataccatgcagGCA GCTTCGACGGCGACCGCTCCTACGCGCCCTCAATTGACTCGCGCGCCAGCGTGCCCAGCAT ATCGCCCTTCGCAGACCCGGGTATCGGCTCTAATGAGCCGTATCCCGCTTGGT CGGTCGAACGCCAGATTCCCATGTCCACGGAGGAGATTGAGGACATCTTCCTC GACCTCACCCAAAAGTTTGGCTTCCAGCGCGACTCCATGCGGAATACGgtgcgtga ataagcagcccactcgaccgcgggaacagcacaattgacctgtcacccagTTCGACTTCAT GATGCACCTCCTCGATTCCCGTGCCTCGCGCATGACGCCCAACCAAGCTCTGCTCACGCTT CACGCCGACTACATTGGTGGCCAGCATGCCAATTACCGGAAGTGGTATTTCGCC GCACAGCTCAACCTCGATGACGCGGTCGGGCAAACCAATAACCCCGGTATCCA GCGCTTGAAGACCATCAAGGGCGCTACGAAGACCAAGTCGCTCGACAGCGCAC TCAACCGCTGGCGCAACGCGATGAACAACATGAGCCAGTACGATCGCCTCCGG CAAATTGCGCTCTACCTCCTCTGCTGGGGTGAAGCAGGCAACATCCGTCTG GC GCCCGAGTGCTTGTGCTTCATCTTCAAGTGCGCGGACGACTACTACAGAAGTCC CGAGTGTCAGAACCGGATGGACCCCGTGCCGGAAGGGCTGTACCTGCAGACG GTCATCAAGCCGCTCTATCGCTTCCTACGTGATCAGGCGTACGAAGTCGTTGAT GGGAAGCAAGTGAAGCGCGAGAAGGACCACGACCAGATTATCGGTTATGACGA CGTCAACCAGTTATTCTGGTATCCGGAAGGTTTGGCTAAGATCGTCATGTCGGA CAACgtgcgtatgatcttatcggttaaaattcgtccgctcacatctttccagACACGACTTG TAGATGTACCTCCGGCGCAGCGGTTCATGAAGTTCGCCAAGATCGAGTGGAACCGCGTCTTC TTCAAGACGTACTTTGAGAAGCGCTCTACTGCCCATCTCCTGGTCAACTTCAAC CGTATATGGATCCTCCACGTCTCGATGTACTTCTTCTACACGGCATTCAACTCTC CACGAGTCTACGCGCCGCACGGCAAACTCGACCCCTCCCCTGAGATGACCTGG TCCGCGACTGCCCTTGGAGGCGCTGTGTCCACCATGATCATGATCCTTGCCACT ATCGCGGAGTACACCTACATCCCCACGACATGGAACAATGCGTCGCACCTCAC CACGCGGCTCATTTTCCTCCTGGTCATCCTCGCGCTCACTGCTGGCCCAACATT CTATATCGCCATGATAGACGGACGCACGGACATCGGCCAAGTACCACTCATCGT GGCCATAGTGCAGTTCTTCATCTCCGTCGTCGCCACCCTCGCTTTCGCTACCAT CCCTTCTGGTCGCATGTTCGGCGACCGTGTGGCTGGCAAGTCAAGAAAGCACA TGGCATCGCAGACGTTCACAGCGTCGTACCCGTCCATGAAGCGGTCATCTCGC GTAGCGAGTATCATGCTGTGGCTTTTGGTCTTTGGCTGCAAATACGTCGAGTCT TACTTCTTCTTGACGTCCTCCTTCTCCAGCCCGATCGCGGTCATGGCGCGTACG AAGGTACAGGGCTGCAACGACCGTATCTTCGGCAGCCAGCTGTGCACGAATCA GGTCCCGTTCGCGCTGGCAATCATGTACGTGATGGACCTGGTACTGTTCTTCCT GGACACGTACCTGTGGTACATCATCTGGCTGGTGATCTTCTCGATGGTGCGCG CGTTCAAGCTTGGTATCTCGATCTGGACGCCCTGGAGCGAGATCTTCACCCGCA TGCCGAAGCGTATTTACGCAAAGCTGCTGGCGACGGCCGAGATGGAGGTCAAG TATAAGCCCAAGgtatgctgaattcaatctggtcaggtgaattcaccctcatattgtggtaca gGTGCTCGTCTCACAAATCTGGAACGCGGTCATCATCTCCATGTACCGGGAGCATCTCTTGTC CATCGAGCACGTCCAGCGCTTGCTTTACCACCAGGTTGATGGTCCCGATGGCC GCCGCACCCTCAGGGCACCGCCGTTCTTCACCAGCCAGCGAACTGCGAAGCCA GGCCTGTTCTTCCCTCCTGGTGGCGAGGCTGAGCGCCGCATCTCGTTCTTTGC CTCATCGCTGACGACCGCGCTCCCGGAGCCTCTGCCGATCGACGCCATGCCCA CCTTCACCGTGCTCGTTCCCCATTACTCCGAGAAGATTCTGCTCAGTCTGCGCG AGATTATCCGCGAGGAGGACCAGAACACCCGCGTTACCTTACTGGAGTACCTCA AGCAGCTCCACCCTGTCGAATGGGACAATTTCGTCAAGGACACCAAGATCTTGG CGGAAGAGTCGGGAGACGTCCAGGACGAGAAGCGCGCGCGCACGGACGACTT GCCGTTCTATTGCATCGGGTTCAAGACCTCGTCACCAGAGTACACCCTGCGTAC GCGTATCTGGGCCTCACTGCGCGCACAGACGCTGTACCGCACGGTCTCCGGTA TGATGAACTACTCCAAGGCGATTAAGCTCCTCTATCGCGTCGAGAACCCGGATG TCGTTCATGCCTTCGGTGGGAACACGGAACGTCTTGAACGCGAGCTTGAGCGC ATGTCTCGCCGCAAGTTCAAGTTCGTCATCTCGATGCAGCGGTACTCCAAGTTC AACAAGGAGGAGCAGGAGAACGCCGAGTTCCTTCTGCGCGCGTACCCGGATTT GCAGATCGCGTACCTCGATGAAGAGCCCGGTCCCAGCAAGAGCGACGAGGTTC GGTTGTTTTCGACACTCATCGACGGACACTCCGAGGTGGACGAGAAGACGGGC CGCCGCAAGCCCAAGTTCCGCATCGAGCTGCCCGGTAACCCCATCCTCGGTGA CGGGAAGTCGGATAACCAGAACCACGCCATCGTCTTCTACCGCGGCGAGTACA TTCAGGTCATTGACGCTAACCAGGACAATTACCTGGAAGAGTGTCTCAAGATCC GTAATGTCCTGGGCGAGTTTGAGGAATACTCCGTGTCGAGCCAGAGCCCGTAC GCGCAGTGGGGCCACAAGGAGTTCAACAAGTGCCCCGTCGCTATCCTGGGTTC CCGCGAGTACATCTTCTCGGAGAACATCGGTATCCTCGGTGACATCGCTGCCG GCAAGGAACAGACGTTCGGTACCATTACGGCGCGTGCGCTTGCGTGGATCGGC GGCAAGCTGCATTACGGTCACCCGGATTTCCTCAATGCGACGTTCATGACGACG CGTGGTGGCGTGTCAAAAGCGCAGAAGGGCTTGCATCTTAACGAGGATATCTTC GCTGGTATGACCGCCGTGTCCCGCGGAGGGCGCATCAAGCACATGGAGTACTA CCAGTGCGGCAAAGGTCGTGATCTCGGATTCGGCACGATCTTGAACTTCCAGA CCAAGATCGGTACTGGTATGGGCGAGCAGCTGCTCTCGCGCGAGTACTACTAT CTGGGCACGCAATTGCCTATCGACCGGTTCTTGACGTTCTACTACGCGCACG CT GGTTTCCATGTCAACAACATCCTGGTCATCTACTCCATCCAGGTCTTCATGGTCA CCCgtaagtgcaggccctcatgaccgccgagcaagcagtctaacggatgtgcagTGCTGTACC TGGGCACATTGAACAAGCAGCTGTTCATCTGCAAGGTCAACTCCAATGGCCAGGTTCTT AGTGGACAAGCTGGGTGCTACAACCTCATCCCGGTCTTCGAGTGGATTCGCCG GAGTATCATCTCCATCTTCTTGGTGTTCTTCATCGCCTTCTTGCCGTTGTTCTTG CAAGgtatgttcacttctcatgtgccatttgtcaatcgctcactcgtacgacagAGCTTTGCG AACGCGGAACAGGAAAGGCGTTGCTGCGTCTCGGGAAGCACTTCCTGTCACTGTCGCCCAT CTTCGAAGTGTTCTCCACCCAAATCTACTCGCAGGCGCTCTTGAACAACATGAG TTTCGGTGGTGCGCGCTACATCGCTACAGGACGCGGTTTCGCGACGAGTCGGA TACCCTTCAACATCCTCTACTCGCGTTTCGCGCCGCCGAGCATCTACATGGGCA TGCGTAATCTGCTGCTCTTGCTGTACGCGACGATGGCCATTTGGATCCCACACC TGATCTACTTCTGGTTCTCCGTCCTCTCCCTCTGCATCGCGCCATTCATGTTCAA TCCGCATCAATTCTCGTACGCTGACTTCATCATCGACTACCGGGAGTTCTTGCG CTGGATGTCGCGCGGTAACTCGCGGACGAAGGCGAGTAGCTGGTACGGATATT GCCGTCTGTCGCGTACCGCGATTACTGGGTACAAGAAGAAGAAACTGGGACAC CCGTCGGAGAAGCTGTCGGGCGATGTGCCGCGTGCGCCGTGGAGGAACGTCA TCTTCTCGGAGATCCTTTGGCCCATCGGCGCGTGCATCATCTTCATCGTCGCGT ACATGTTCGTCAAATCGTTCCCTGACGAGCAGGGCAACGCGCCGCCGAGCCCG CTGGTCCGCATTCTGCTCATCGCGGTTGGCCCTACTGTGTGGAACGCGGCGGT GCTCATCACGCTGTTCTTCCTGTCGCTCTTCCTGGGCCCGATGATGGATGGCTG GGTCAAGTTCGGCTCAGTCATGGCGGCACTTGCGCATGGTCTAGCGCTCATAG GCATGCTCACGTTCTTCGAGTTCTTCgtacgtccttcgcgttgttgtggtcgagtgctttgct aacaccgccttcagTGGTTCCTCGAGCTCTGGGATGCCTCGCACGCCGTGCTCGGCGTCATC GCCATTATTGCCGTTCAGCGCGGGATCCAGAAGATCCTCATTGCCGTCTTCCTG ACGCGTGAGTACAAGCACGACGAGACGAACCGCGCGTGGTGGACAGGTAAATG GTATGGACGCGGGCTGGGTACCTCGGCCATGTCCCAGCCGGCGCGCGAGTTC ATCGTGAAGATCGTGGAGATGTCGCTGTGGACGTCGGACTTCCTGCTTGCGCA CCTGTTGCTCATCATCTTGACGGTGCCGCTACTGCTGCCGTTCTTCAACTCGAT CCATTCGACGATGCTTTgtgagtgatttgtagtcgttggtcacggatgattgctgactcgcg tgcagTCTGGTTGCGCCCTTCGAAGCAGATTAGGCAACCTCTGTTCTCCACTAAGCAGAAGCG GCAACGGCGATGGATTgtaagttcctttgattgctctggctaccgaccttcgctcacctgtct cagGTCATGAAGTATACCGTGGTATATCTCGTGGTGGTGGCTTTCCTCGTTGCGCTCATCGCT CTGCgtacgttttctgtcgcgctcaccctctattttcactaacgtttcctccagCCGCGCTCT TCCGCGAGAGCATCCACTTCAACTGCGAGATCTGCCAGAGTATATAGTCATATAACGACGTCTA TCGTATCGCCGGACGAGAGCCCCGTCGCCTACACACTGACATGGAATTGCTGT GTATACAATCGATCTTCTGACCGCGTCGGGGGCGTTGCCGTCTTTCTACTATCA ACTTGCTTGTGTATCAACATTTCTTCTCTCCAAGCCTACATTGACATAGAGTAATA GCCCATGTTCATACAACAATCGCATAGCATTGCATATACCAT Translation of SEQ ID NO: 5 amino acid S. commune SEQ ID NO: 2 MSGPGYGRNPFDNPPPNRGPYGQQPGFPGPGPRPYDSDADMSQTYGSTTRLAG SAGYSRNGSFDGDRSYAPSIDSRASVPSISPFADPGIGSNEPYPAWSVERQIPMS TEEIEDIFLDLTQKFGFQRDSMRNTFDFMMHLLDSRASRMTPNQALLTLHADYIGGQ HANYRKWYFAAQLNLDDAVGQTNNPGIQRLKTIKGATKTKSLDSALNRWRNAMNN MSQYDRLRQIALYLLCWGEAGNIRLAPECLCFIFKCADDYYRSPECQNRMDPVPEG LYLQTVIKPLYRFLRDQAYEVVDGKQVKREKDHDQIIGYDDVNQLFVVYPEGLAKIVM SDNTRLVDVPPAQRFMKFAKIEWNRVFFKTYFEKRSTAHLLVNFNRIWILHVSMYFF YTAFNSPRVYAPHGKLDPSPEMTWSATALGGAVSTMIMILATIAEYTYIPTTWNNAS HLTTRLIFLLVILALTAGPTFYIAMIDGRTDIGQVPLIVAIVQFFISVVATLAFATIPSGRM FGDRVAGKSRKHMASQTFTASYPSMKRSSRVASIMLWLLVFGCKYVESYFFLTSSF

SSPIAVMARTKVQGCNDRIFGSQLCTNQVPFALAIMYVMDLVLFFLDTYLWYIIWLVI FSMVRAFKLGISIWTPWSEIFTRMPKRIYAKLLATAEMEVKYKPKVLVSQIWNAVIISM YREHLLSIEHVQRLLYHQVDGPDGRRTLRAPPFFTSQRTAKPGLFFPPGGEAERRIS FFASSLTTALPEPLPIDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLH PVEWDNFVKDTKILAEESGDVQDEKRARTDDLPFYCIGFKTSSPEYTLRTRIWASLR AQTLYRTVSGMMNYSKAIKLLYRVENPDVVHAFGGNTERLERELERMSRRKFKFVI SMQRYSKFNKEEQENAEFLLRAYPDLQIAYLDEEPGPSKSDEVRLFSTLIDGHSEVD EKTGRRKPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYIQVIDANQDNYLEECLKIR NVLGEFEEYSVSSQSPYAQWGHKEFNKCPVAILGSREYIFSENIGILGDIAAGKEQTF GTITARALAWIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLHLNEDIFAGMTAVSR GGRIKHMEYYQCGKGRDLGFGTILNFQTKIGTGMGEQLLSREYYYLGTQLPIDRFLT FYYAHAGFHVNNILVIYSIQVFMVTLLYLGTLNKQLFICKVNSNGQVLSGQAGCYNLI PVFEWIRRSIISIFLVFFIAFLPLFLQELCERGTGKALLRLGKHFLSLSPIFEVFSTQIYS QALLNNMSFGGARYIATGRGFATSRIPFNILYSRFAPPSIYMGMRNLLLLLYATMAIW IPHLIYFWFSVLSLCIAPFMFNPHQFSYADFIIDYREFLRWMSRGNSRTKASSWYGY CRLSRTAITGYKKKKLGHPSEKLSGDVPRAPWRNVIFSEILWPIGACIIFIVAYMFVKS FPDEQGNAPPSPLVRILLIAVGPTVWNAAVLITLFFLSLFLGPMMDGVVVKFGSVMAA LAHGLALIGMLTFFEFFWFLELWDASHAVLGVIAIIAVQRGIQKILIAVFLTREYKHDET NRAVWVTGKWYGRGLGTSAMSQPAREFIVKIVEMSLWTSDFLLAHLLLIILTVPLLLP FFNSIHSTMLFWLRPSKQIRQPLFSTKQKRQRRWIVMKYTVVYLVVVAFLVALIALPA LFRESIHFNCEICQSI Gene sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15531 DNA S. commune SEQ ID NO: 3 CTGTCCAAAGAAGAGATCGAGGACATCTTCCTCGATCTGACGCAGAAGTTTGGC TTTCAGCGGGATTCCATGCGGAACATGgtacgtggcgtatgcccatgtgcggcgttctgagg cctaaacgttttccgccagTTCGACTTCACCATGCAGCTGCTTGACAGCCGAGCGTCTCGTATG ACCCCCAACCAGGCGCTCCTCACCCTCCACGCCGACTACATTGGTGGCCAGCA TGCGAACTACCGGAAGTGGTACTTCGCGGCGCAGCTCGACCTTGACGACGCCG TGGGACAAACTCAGAATCCGGGTCTCAACCGCCTCAAGTCCACTCGCGGATCG GGCAAGCGACCACGCCATGAAAAGTCGCTGAACACGGCATTGGAGCGCTGGC GGCAAGCCATGAACAACATGTCGCAGTATGACCGCTTACGCCAGATCGCGCTC TACCTGCTCTGCTGGGGCGAAGCGGCGCAAGTGCGATTCATGCCCGAGTGCTT GTGCTTCATCTTCAAGTGCGCCGACGACTATTATCGTTCGCCGGAGTGCCAGAA CAGGATGGAGCCGGTACCGGAGGGTCTCTACCTGAGGACGGTCGTAAAGCCG CTCTACAGATTTGTCCGGGATCAAGGCTATGAGGTGGTGGAGGGAAAATTCGTA CGGCGGGAACGGGATCACGACCAAATCATTGGTTACGATGACGTGAATCAGCT GTTCTGGTACCCGGAGGGCATTGCCCGTATCGTCCTGTCGGACAAGgtaagcacctc tgtgcatcttctgtgacatacagggctaattgtcgagcagAGTCGTCTGGTCGACCTCCCTC CAGCACAGCGCTTCATGAAGTTCGACCGTATCGAGTGGAATCGCGTCTTCTTCAAGACG TTCTACGAGACTCGATCCTTTACGCATCTTTTGGTCGACTTCAACCGTATCTGGG TCGTGCACATCGCTCTCTACTTCTTCTACACCGCATACAACTCCCCCACGATCTA CGCCATCAACGGCAACACTCCGACGTCTCTGGCTTGGAGCGCGACTGCGCTCG GCGGTGCGGTAGCGACAGGTATCATGATCCTCGCCACGATCGCCGAGTTCTCG CACATCCCCACGACATGGAACAACACCTCGCATCTGACTCGCCGCCTCGCCTTC CTCCTCGTCACGCTCGGCCTCACATGTGGTCCGACGTTCTACGTCGCGATTGCA GAGAGCAACGGGAGCGGCGGCTCTTTGGCCTTGATTCTCGGCATCGTCCAGTT CTTCATCTCCGTCGTAGCGACTGCGCTCTTCACTATCATGCCTTCTGGTCGTAT GTTCGGCGACCGCGTCGCAGGCAAGAGTCGCAAGTATCTCGCCAGCCAGACGT TCACGGCCAGCTACCCGTCGTTGCCCAAGCACCAGCGGTTCGCATCACTCCTG ATGTGGTTCCTCATCTTCGGGTGCAAGTTGACGGAGAGTTACTTCTTCCTGACG TTGTCCTTCCGCGACCCTATTCGCGTCATGGTCGGCATGAAGATCCAGAACTGC GAGGACAAGATTTTCGGCAGCGGCCTTTGCAGGAATCACGCAGCATTCACCCT CACGATCATGTACATCATGGACCTCGTCTTGTTCTTCCTCGACACCTTCCTTTGG TATGTCATCTGGAACTCGGTTTTCAGTATCGCACGCTCTTTCGTACTCGGCCTTT CGATCTGGACACCATGGAGGGACATCTTCCAGCGTCTGCCGAAGCGTATCTAC GCGAAGCTTCTAGCGACCGGCGACATGGAGGTCAAGTACAAGCCCAAGgtgtgtga atagctcgctgtaaggttcttgattctgactcattcgcagGTCTTGGTTTCGCAAATCTGG AACGCCATCATCATCTCCATGTACCGCGAGCACTTGCTCTCTATCGAGCACGTTCAAAAGC TCCTGTACCATCAAGTGGACACTGGCGAAGCCGGCAAGCGGAGTCTTCGCGCG CCTCCGTTCTTCGTCGCGCAGGGCAGCAGCGGTGGCTCGGGCGAGTTCTTCCC GCCTGGTAGCGAGGCTGAGCGTCGTATCTCTTTCTTCGCGCAGTCTCTATCTAC GGAGATTCCTCAGCCCATCCCGGTTGACGCCATGCCGACGTTCACAGTGCTTA CGCCTCACTACAGCGAGAAGgtgcgctttttcctgggcgcattcaacattagctgactgtcgt gcacagATCCTTCTTTCGCTCCGTGAGATTATCCGCGAGGAGGACCAGAACACCCGCGTG ACATTGCTTGAGTATCTCAAGCAGCTTCACCCGGTCGAGTGGGAGAACTTCGTC AAGGACACCAAGATTTTGGCCGAGGAGTCCGCTATGTTCAACGGTCCAAGTCCT TTCGGCAACGATGAGAAGGGTCAGTCCAAGATGGACGATCTTCCTTTCTACTGC ATCGGTTTCAAGAGCGCCGCGCCCGAGTACACCCTCCGCACCCGTATCTGGGC GTCCTTGCGCGCGCAGACCCTCTACCGCACGGTCTCCGGCATGATGAACTATG CGAAGGCGATTAAGCTGCTCTACCGCGTCGAGAACCCCGAGGTCGTGCAGCAG TTCGGCGGTAACACGGACAAGCTCGAGCGCGAGTTGGAGCGGATGGCCCGGC GGAAGTTCAAGTTCCTGGTGTCCATGCAGCGCTACTCGAAGTTCAACAAGGAGG AGCACGAGAACGCCGAGTTCTTGCTCCGCGCGTACCCGGACCTGCAGATCGCG TACCTGGAGGAAGAGCCTCCTCGCAAGGAGGGTGGCGATCCACGCATCTTCTC TGCCCTCGTCGACGGCCACAGCGACATCATCCCGGAGACCGGCAAGCGGCGC CCCAAGTTCCGCATCGAGCTGCCCGGCAACCCCATTCTCGGTGACGGCAAGTC GGACAACCAGAACCACGCCATCGTCTTCTACCGCGGCGAGTACCTCCAGCTTAT CGACGCCAACCAGGACAACTACCTCGAGGAGTGCTTGAAGATCCGTAACGTAC TCGCCGAGTTCGAGGAGTACGACGTCTCTAGCCAGAGTCCGTACGCGCAGTGG AGTGTCAAGGAGTTCAAGCGCTCCCCGGTCGCCATCGTCGGTGCACGCGAGTA TATCTTCTCGGAGCACATCGGTATTCTCGGTGATTTGGCGGCTGGCAAGGAACA GACGTTCGGTACGCTCACGGCACGCAACAACGCCTTCCTTGGCGGCAAGCTGC ACTACGGTCACCCGGATTTCCTCAACGCCCTCTACATGAACACGCGCGGTGGT GTCTCCAAGGCGCAGAAGGGTCTCCATCTCAACGAGGATATTTACGCCGGTATG AACGCGGTCGGTCGCGGTGGACGCATCAAGCATAGCGAATACTACCAGTGCGG CAAGGGTCGTGACCTCGGTTTTGGCACCATCTTGAACTTCCAGACCAAGATCGG TACGGGTATGGGCGAGCAGATCCTCTCGCGCGAGTACTACTACCTCGGAACCC AATTGCCCATCGATCGCTTCCTCACGTTCTACTACGCGCACCCAGGTTTCCAGA TCAACAACATGCTGGTTATCCTATCCGTGCAGGTCTTCATCGTTACCAgtacgttgatt gcatatcgttagcctgacagcgtctgacgaattcccagTGGTCTTCCTCGGTACCTTGAAGTCT TCGGTCACGATCTGCAAGTACACGTCCAGCGGTCAGTACATCGGTGGTCAATCCG GTTGCTACAACCTCGTCCCGGTCTTCCAGTGGATCGAGCGCTGCATCATCAGCA TCTTCTTGGTGTTCATGATCGCTTTCATGCCGCTCTTCCTGCAAGgtaagagctcgtca acctgctcaagggccttgcgctgatcatcatctcagAACTCGTCGAGCGCGGTACCTGGAGTGCC ATCTGGCGTCTGCTCAAGCAGTTTATGTCGCTGTCGCCTGTCTTCGAGGTGTTC TCCACCCAGATTCAGACACACTCCGTGTTGAGCAACTTGACGTTCGGTGGTGCG CGTTACATCGCTACCGGTCGTGGGTTCGCCACCAGTCGTATCAGCTTCAGCATC TTGTTCTCGCGTTTCGCAGGCCCGAGTATCTACCTCGGCATGCGCACGCTCATT ATGCTGCTCTACGTGACGTTGACGATCTGGACGCCATGGGTCATTTACTTCTGG GTTTCCATTCTCTCGCTCTGCATCGCGCCGTTCTTGTTCAATCCGCATCAATTCG TCTTCTCGGATTTCCTCATCGACTACAGgtacgtcggacgagcgctgttccgcgacgtaagctg accggttatacagGGAATACCTCCGGTGGATGTCGCGTGGTAACTCGCGCTCGCACAAC AACTCCTGGATTGGGTACTGCCGGTTGTCCCGCACGATGATCACTGGGTACAA GAAGAAGAAGCTGGGCCACCCGTCGGAGAAGCTTTCCGGCGACGTTCCTCGTG CAGGCTGGCGCGCCGTCTTATTCTCGGAGATCATCTTCCCGGCATGCATGGCC ATCCTCTTCATCATCGCGTACATGTTCGTCAAGTCGTTCCCTCTCGACGGCAAG CAGCCTCCCTCCGGCCTCGTTCGCATCGCCGTCGTGTCTATCGGCCCCATCGT GTGGAACGCCGCCATCCTGTTGACGCTCTTCCTTGTGTCGTTGTTCCTCGGCCC CATGCTCGACCCGGTCTTCCCCCTCTTCGGTTCCGTTATGGCCTTCATCGCGCA TTTCCTCGGCACAATCGGAATGATTGGGTTCTTCGAGTTCCTGgtatgtgcccataccttt cattcgtcttcaactatctaacagattcatagTGGTTCCTCGAGTCCTGGGAGGCGTCGCATGCC GTGCTGGGTCTCATCGCCGTCATCTCCATCCAGCGCGCCATTCACAAAATTCTT ATCGCCGTTTTCCTCAGTCGCGAGTTCAAGCACGACGAGACGAACAGGGCTTG GTGGACTGGTCGCTGGTATGGCCGTGGCCTCGGCACGCACGCCATGTCGCAG CCGGCGCGTGAGTTCGTCGTCAAGATCATCGAGTTGTCGCTCTGGAGCTCGGA TCTCATACTCGGCCACATCCTGCTGTTCATGCTTACTCCGGCTGTCCTCATCCC GTACTTCGACCGTCTGCACGCCATGATGCTCTgtacgtcgtgtctcattgtttgtgttggtc atactcttaccctctcttagTCTGGCTGCGCCCCTCAAAGCAAATCCGCGCGCCTCTGTACTCA ATCAAGCAGAAGAGGCAAAGACGCTGGATTgtcagtgttcagtgccttattctatcagctcttac tgacgtcttcatagATCATGAAGTACGGTACTGTATACGTTACCGTCATCGCGATCTTCGTCG CGCTCATCGCGCTTCgtgagtacccttgctatctttcgtacctgagcgtcgctgacccctttc ccagCCCTCGTCTTCCGACACACTCTAAAGGTCGAGTGCTCCCTTTGCGACAGCTTGTAATAT CGGACTCGTATATATCTAGACTTCTCCGCACCATGTGTAGCTGACGCTTGGGTA TACTTCGCGGTGCCGAGCTAATTGTCGACGGACATTCTCCATCGTTGAGTGCAG CGACATCGGGTGGTTTACGACACGGACACTTTTCATTGTACCCTCTACGAATGC AAGAACTCTCTTACGACCAGTACCTATGTGCTAAGCCGTCGCCTGTTCAGGATC

ATACATACATACGTTTCTAGATACCTTACAGTTAGGCCTATTCAGGGAGAGTCTG CATAAAA Translation of SEQ ID NO: 7 amino acid S. commune SEQ ID NO: 4 MRNMFDFTMQLLDSRASRMTPNQALLTLHADYIGGQHANYRKVVYFAAQLDLDDAV GQTQNGLNRLKSTRGSGKRPRHEKSLNTALERWRQAMNNMSQYDRLRQIALYLL CWGEAAQVRFMPECLCFIFKCADDYYRSPECQNRMEPVPEGLYLRTVVKPLYRFV RDQGYEVVEGKFVRRERDHDQIIGYDDVNQLFWYPEGIARIVLSDKSRLVDLPPAQ RFMKFDRIEWNRVFFKTFYETRSFTHLLVDFNRIWVVHIALYFFYTAYNSPTIYAING NTPTSLAWSATALGGAVATGIMILATIAEFSHIPTTWNNTSHLTRRLAFLLVTLGLTCG PTFYVAIAESNGSGGSLALILGIVQFFISVVATALFTIMPSGRMFGDRVAGKSRKYLA SQTFTASYPSLPKHQRFASLLMWFLIFGCKLTESYFFLTLSFRDPIRVMVGMKIQNC EDKIFGSGLCRNHAAFTLTIMYIMDLVLFFLDTFLVVYVIWNSVFSIARSFVLGLSIWTP WRDIFQRLPKRIYAKLLATGDMEVKYKPKVLVSQIWNAIIISMYREHLLSIEHVQKLLY HQVDTGEAGKRSLRAPPFFVAQGSSGGSGEFFPPGSEAERRISFFAQSLSTEIPQPI PVDAMPTFTVLTPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLHPVEWENFVKDTKI LAEESAMFNGPSPFGNDEKGQSKMDDLPFYCIGFKSAAPEYTLRTRIWASLRAQTL YRTVSGMMNYAKAIKLLYRVENPEVVQQFGGNTDKLERELERMARRKFKFLVSMQ RYSKFNKEEHENAEFLLRAYPDLQIAYLEEEPPRKEGGDPRIFSALVDGHSDIIPETG KRRPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYLQLIDANQDNYLEECLKIRNVLA EFEEYDVSSQSPYAQWSVKEFKRSPVAIVGAREYIFSEHIGILGDLAAGKEQTFGTL TARNNAFLGGKLHYGHPDFLNALYMNTRGGVSKAQKGLHLNEDIYAGMNAVGRGG RIKHSEYYQCGKGRDLGFGTILNFQTKIGTGMGEQILSREYYYLGTQLPIDRFLTFYY AHPGFQINNMLVILSVQVFIVTMVFLGTLKSSVTICKYTSSGQYIGGQSGCYNLVPVF QWIERCIISIFLVFMIAFMPLFLQELVERGTWSAIWRLLKQFMSLSPVFEVFSTQIQTH SVLSNLTFGGARYIATGRGFATSRISFSILFSRFAGPSIYLGMRTLIMLLYVTLTIWTP VVVIYFVVVSILSLCIAPFLFNPHQFVFSDFLIDYREYLRWMSRGNSRSHNNSWIGYCR LSRTMITGYKKKKLGHPSEKLSGDVPRAGWRAVLFSEIIFPACMAILFIIAYMFVKSFP LDGKQPPSGLVRIAWSIGPIVWNAAILLTLFLVSLFLGPMLDPVFPLFGSVMAFIAHF LGTIGMIGFFEFLWFLESWEASHAVLGLIAVISIQRAIHKILIAVFLSREFKHDETNRAW WTGRVVYGRGLGTHAMSQPAREFVVKIIELSLWSSDLILGHILLFMLTPAVLIPYFDRL HAMMLFWLRPSKQIRAPLYSIKQKRQRRWIIMKYGTVYVTVIAIFVALIALPLVFRHTL KVECSLCDSL cDNA 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15531 DNA S. commune SEQ ID NO: 5 ATGTCCGGCCCAGGATATGGCAGGAATCCATTCGACAATCCCCCGCCCAACAG AGGTCCCTATGGCCAGCAGCCAGGTTTCCCGGGGCCCGGCCCTCGGCCTTAC GACTCGGACGCGGACATGAGCCAGACCTATGGCAGCACAACCAGGCTCGCCG GCAGTGCCGGTTACAGCGACAGAAACGGCAGCTTCGACGGCGACCGCTCCTAC GCGCCCTCAATTGACTCGCGCGCCAGCGTGCCCAGCATATCGCCCTTCGCAGA CCCGGGTATCGGCTCTAATGAGCCGTATCCCGCTTGGTCGGTCGAACGCCAGA TTCCCATGTCCACGGAGGAGATTGAGGACATCTTCCTCGACCTCACCCAAAAGT TTGGCTTCCAGCGCGACTCCATGCGGAATACGTTCGACTTCATGATGCACCTCC TCGATTCCCGTGCCTCGCGCATGACGCCCAACCAAGCTCTGCTCACGCTTCAC GCCGACTACATTGGTGGCCAGCATGCCAATTACCGGAAGTGGTATTTCGCCGC ACAGCTCAACCTCGATGACGCGGTCGGGCAAACCAATAACCCCGGTATCCAGC GCTTGAAGACCATCAAGGGCGCTACGAAGACCAAGTCGCTCGACAGCGCACTC AACCGCTGGCGCAACGCGATGAACAACATGAGCCAGTACGATCGCCTCCGGCA AATTGCGCTCTACCTCCTCTGCTGGGGTGAAGCAGGCAACATCCGTCTGGCGC CCGAGTGCTTGTGCTTCATCTTCAAGTGCGCGGACGACTACTACAGAAGTCCCG AGTGTCAGAACCGGATGGACCCCGTGCCGGAAGGGCTGTACCTGCAGACGGT CATCAAGCCGCTCTATCGCTTCCTACGTGATCAGGCGTACGAAGTCGTTGATGG GAAGCAAGTGAAGCGCGAGAAGGACCACGACCAGATTATCGGTTATGACGACG TCAACCAGTTATTCTGGTATCCGGAAGGTTTGGCTAAGATCGTCATGTCGGACA ACACACGACTTGTAGATGTACCTCCGGCGCAGCGGTTCATGAAGTTCGCCAAGA TCGAGTGGAACCGCGTCTTCTTCAAGACGTACTTTGAGAAGCGCTCTACTGCCC ATCTCCTGGTCAACTTCAACCGTATATGGATCCTCCACGTCTCGATGTACTTCTT CTACACGGCATTCAACTCTCCACGAGTCTACGCGCCGCACGGCAAACTCGACC CCTCCCCTGAGATGACCTGGTCCGCGACTGCCCTTGGAGGCGCTGTGTCCACC ATGATCATGATCCTTGCCACTATCGCGGAGTACACCTACATCCCCACGACATGG AACAATGCGTCGCACCTCACCACGCGGCTCATTTTCCTCCTGGTCATCCTCGCG CTCACTGCTGGCCCAACATTCTATATCGCCATGATAGACGGACGCACGGACATC GGCCAAGTACCACTCATCGTGGCCATAGTGCAGTTCTTCATCTCCGTCGTCGCC ACCCTCGCTTTCGCTACCATCCCTTCTGGTCGCATGTTCGGCGACCGTGTGGCT GGCAAGTCAAGAAAGCACATGGCATCGCAGACGTTCACAGCGTCGTACCCGTC CATGAAGCGGTCATCTCGCGTAGCGAGTATCATGCTGTGGCTTTTGGTCTTTGG CTGCAAATACGTCGAGTCTTACTTCTTCTTGACGTCCTCCTTCTCCAGCCCGATC GCGGTCATGGCGCGTACGAAGGTACAGGGCTGCAACGACCGTATCTTCGGCAG CCAGCTGTGCACGAATCAGGTCCCGTTCGCGCTGGCAATCATGTACGTGATGG ACCTGGTACTGTTCTTCCTGGACACGTACCTGTGGTACATCATCTGGCTGGTGA TCTTCTCGATGGTGCGCGCGTTCAAGCTTGGTATCTCGATCTGGACGCCCTGGA GCGAGATCTTCACCCGCATGCCGAAGCGTATTTACGCAAAGCTGCTGGCGACG GCCGAGATGGAGGTCAAGTATAAGCCCAAGGTGCTCGTCTCACAAATCTGGAA CGCGGTCATCATCTCCATGTACCGGGAGCATCTCTTGTCCATCGAGCACGTCCA GCGCTTGCTTTACCACCAGGTTGATGGTCCCGATGGCCGCCGCACCCTCAGGG CACCGCCGTTCTTCACCAGCCAGCGAACTGCGAAGCCAGGCCTGTTCTTCCCT CCTGGTGGCGAGGCTGAGCGCCGCATCTCGTTCTTTGCCTCATCGCTGACGAC CGCGCTCCCGGAGCCTCTGCCGATCGACGCCATGCCCACCTTCACCGTGCTCG TTCCCCATTACTCCGAGAAGATTCTGCTCAGTCTGCGCGAGATTATCCGCGAGG AGGACCAGAACACCCGCGTTACCTTACTGGAGTACCTCAAGCAGCTCCACCCT GTCGAATGGGACAATTTCGTCAAGGACACCAAGATCTTGGCGGAAGAGTCGGG AGACGTCCAGGACGAGAAGCGCGCGCGCACGGACGACTTGCCGTTCTATTGCA TCGGGTTCAAGACCTCGTCACCAGAGTACACCCTGCGTACGCGTATCTGGGCC TCACTGCGCGCACAGACGCTGTACCGCACGGTCTCCGGTATGATGAACTACTC CAAGGCGATTAAGCTCCTCTATCGCGTCGAGAACCCGGATGTCGTTCATGCCTT CGGTGGGAACACGGAACGTCTTGAACGCGAGCTTGAGCGCATGTCTCGCCGCA AGTTCAAGTTCGTCATCTCGATGCAGCGGTACTCCAAGTTCAACAAGGAGGAGC AGGAGAACGCCGAGTTCCTTCTGCGCGCGTACCCGGATTTGCAGATCGCGTAC CTCGATGAAGAGCCCGGTCCCAGCAAGAGCGACGAGGTTCGGTTGTTTTCGAC ACTCATCGACGGACACTCCGAGGTGGACGAGAAGACGGGCCGCCGCAAGCCC AAGTTCCGCATCGAGCTGCCCGGTAACCCCATCCTCGGTGACGGGAAGTCGGA TAACCAGAACCACGCCATCGTCTTCTACCGCGGCGAGTACATTCAGGTCATTGA CGCTAACCAGGACAATTACCTGGAAGAGTGTCTCAAGATCCGTAATGTCCTGGG CGAGTTTGAGGAATACTCCGTGTCGAGCCAGAGCCCGTACGCGCAGTGGGGCC ACAAGGAGTTCAACAAGTGCCCCGTCGCTATCCTGGGTTCCCGCGAGTACATCT TCTCGGAGAACATCGGTATCCTCGGTGACATCGCTGCCGGCAAGGAACAGACG TTCGGTACCATTACGGCGCGTGCGCTTGCGTGGATCGGCGGCAAGCTGCATTA CGGTCACCCGGATTTCCTCAATGCGACGTTCATGACGACGCGTGGTGGCGTGT CAAAAGCGCAGAAGGGCTTGCATCTTAACGAGGATATCTTCGCTGGTATGACCG CCGTGTCCCGCGGAGGGCGCATCAAGCACATGGAGTACTACCAGTGCGGCAAA GGTCGTGATCTCGGATTCGGCACGATCTTGAACTTCCAGACCAAGATCGGTACT GGTATGGGCGAGCAGCTGCTCTCGCGCGAGTACTACTATCTGGGCACGCAATT GCCTATCGACCGGTTCTTGACGTTCTACTACGCGCACGCTGGTTTCCATGTCAA CAACATCCTGGTCATCTACTCCATCCAGGTCTTCATGGTCACCCTGCTGTACCT GGGCACATTGAACAAGCAGCTGTTCATCTGCAAGGTCAACTCCAATGGCCAGGT TCTTAGTGGACAAGCTGGGTGCTACAACCTCATCCCGGTCTTCGAGTGGATTCG CCGGAGTATCATCTCCATCTTCTTGGTGTTCTTCATCGCCTTCTTGCCGTTGTTC TTGCAAGAGCTTTGCGAACGCGGAACAGGAAAGGCGTTGCTGCGTCTCGGGAA GCACTTCCTGTCACTGTCGCCCATCTTCGAAGTGTTCTCCACCCAAATCTACTC GCAGGCGCTCTTGAACAACATGAGTTTCGGTGGTGCGCGCTACATCGCTACAG GACGCGGTTTCGCGACGAGTCGGATACCCTTCAACATCCTCTACTCGCGTTTCG CGCCGCCGAGCATCTACATGGGCATGCGTAATCTGCTGCTCTTGCTGTACGCG ACGATGGCCATTTGGATCCCACACCTGATCTACTTCTGGTTCTCCGTCCTCTCC CTCTGCATCGCGCCATTCATGTTCAATCCGCATCAATTCTCGTACGCTGACTTCA TCATCGACTACCGGGAGTTCTTGCGCTGGATGTCGCGCGGTAACTCGCGGACG AAGGCGAGTAGCTGGTACGGATATTGCCGTCTGTCGCGTACCGCGATTACTGG GTACAAGAAGAAGAAACTGGGACACCCGTCGGAGAAGCTGTCGGGCGATGTGC CGCGTGCGCCGTGGAGGAACGTCATCTTCTCGGAGATCCTTTGGCCCATCGGC GCGTGCATCATCTTCATCGTCGCGTACATGTTCGTCAAATCGTTCCCTGACGAG CAGGGCAACGCGCCGCCGAGCCCGCTGGTCCGCATTCTGCTCATCGCGGTTG GCCCTACTGTGTGGAACGCGGCGGTGCTCATCACGCTGTTCTTCCTGTCGCTCT TCCTGGGCCCGATGATGGATGGCTGGGTCAAGTTCGGCTCAGTCATGGCGGCA CTTGCGCATGGTCTAGCGCTCATAGGCATGCTCACGTTCTTCGAGTTCTTCTGG TTCCTCGAGCTCTGGGATGCCTCGCACGCCGTGCTCGGCGTCATCGCCATTATT GCCGTTCAGCGCGGGATCCAGAAGATCCTCATTGCCGTCTTCCTGACGCGTGA

GTACAAGCACGACGAGACGAACCGCGCGTGGTGGACAGGTAAATGGTATGGAC GCGGGCTGGGTACCTCGGCCATGTCCCAGCCGGCGCGCGAGTTCATCGTGAA GATCGTGGAGATGTCGCTGTGGACGTCGGACTTCCTGCTTGCGCACCTGTTGC TCATCATCTTGACGGTGCCGCTACTGCTGCCGTTCTTCAACTCGATCCATTCGA CGATGCTTTTCTGGTTGCGCCCTTCGAAGCAGATTAGGCAACCTCTGTTCTCCA CTAAGCAGAAGCGGCAACGGCGATGGATTGTCATGAAGTATACCGTGGTATATC TCGTGGTGGTGGCTTTCCTCGTTGCGCTCATCGCTCTGCCCGCGCTCTTCCGC GAGAGCATCCACTTCAACTGCGAGATCTGCCAGAGTATATAG polypeptide sequence 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15531 amino acid S. commune SEQ ID NO: 6 MSGPGYGRNPFDNPPPNRGPYGQQPGFPGPGPRPYDSDADMSQTYGSTTRLAG SAGYSDRNGSFDGDRSYAPSIDSRASVPSISPFADPGIGSNEPYPAWSVERQIPMS TEEIEDIFLDLTQKFGFQRDSMRNTFDFMMHLLDSRASRMTPNQALLTLHADYIGGQ HANYRKWYFAAQLNLDDAVGQTNNPGIQRLKTIKGATKTKSLDSALNRWRNAMNN MSQYDRLRQIALYLLCWGEAGNIRLAPECLCFIFKCADDYYRSPECQNRMDPVPEG LYLQTVIKPLYRFLRDQAYEVVDGKQVKREKDHDQIIGYDDVNQLFWYPEGLAKIVM SDNTRLVDVPPAQRFMKFAKIEWNRVFFKTYFEKRSTAHLLVNFNRIWILHVSMYFF YTAFNSPRVYAPHGKLDPSPEMTWSATALGGAVSTMIMILATIAEYTYIPTTWNNAS HLTTRLIFLLVILALTAGPTFYIAMIDGRTDIGQVPLIVAIVQFFISVVATLAFATIPSGRM FGDRVAGKSRKHMASQTFTASYPSMKRSSRVASIMLWLLVFGCKYVESYFFLTSSF SSPIAVMARTKVQGCNDRIFGSQLCTNQVPFALAIMYVMDLVLFFLDTYLWYIIWLVI FSMVRAFKLGISIWTPWSEIFTRMPKRIYAKLLATAEMEVKYKPKVLVSQIWNAVIISM YREHLLSIEHVQRLLYHQVDGPDGRRTLRAPPFFTSQRTAKPGLFFPPGGEAERRIS FFASSLTTALPEPLPIDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLH PVEWDNFVKDTKILAEESGDVQDEKRARTDDLPFYCIGFKTSSPEYTLRTRIWASLR AQTLYRTVSGMMNYSKAIKLLYRVENPDVVHAFGGNTERLERELERMSRRKFKFVI SMQRYSKFNKEEQENAEFLLRAYPDLQIAYLDEEPGPSKSDEVRLFSTLIDGHSEVD EKTGRRKPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYIQVIDANQDNYLEECLKIR NVLGEFEEYSVSSQSPYAQWGHKEFNKCPVAILGSREYIFSENIGILGDIAAGKEQTF GTITARALAWIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLHLNEDIFAGMTAVSR GGRIKHMEYYQCGKGRDLGFGTILNFQTKIGTGMGEQLLSREYYYLGTQLPIDRFLT FYYAHAGFHVNNILVIYSIQVFMVTLLYLGTLNKQLFICKVNSNGQVLSGQAGCYNLI PVFEWIRRSIISIFLVFFIAFLPLFLQELCERGTGKALLRLGKHFLSLSPIFEVFSTQIYS QALLNNMSFGGARYIATGRGFATSRIPFNILYSRFAPPSIYMGMRNLLLLLYATMAIW IPHLIYFWFSVLSLCIAPFMFNPHQFSYADFIIDYREFLRWMSRGNSRTKASSWYGY CRLSRTAITGYKKKKLGHPSEKLSGDVPRAPWRNVIFSEILWPIGACIIFIVAYMFVKS FPDEQGNAPPSPLVRILLIAVGPTVWNAAVLITLFFLSLFLGPMMDGVVVKFGSVMAA LAHGLALIGMLTFFEFFWFLELWDASHAVLGVIAIIAVQRGIQKILIAVFLTREYKHDET NRAVWVTGKWYGRGLGTSAMSQPAREFIVKIVEMSLWTSDFLLAHLLLIILTVPLLLP FFNSIHSTMLFWLRPSKQIRQPLFSTKQKRQRRWIVMKYTVVYLVVVAFLVALIALPA LFRESIHFNCEICQSI cDNA 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15531 DNA S. commune SEQ ID NO: 7 ATGCGGAACATGTTCGACTTCACCATGCAGCTGCTTGACAGCCGAGCGTCTCGT ATGACCCCCAACCAGGCGCTCCTCACCCTCCACGCCGACTACATTGGTGGCCA GCATGCGAACTACCGGAAGTGGTACTTCGCGGCGCAGCTCGACCTTGACGACG CCGTGGGACAAACTCAGAATCCGGGTCTCAACCGCCTCAAGTCCACTCGCGGA TCGGGCAAGCGACCACGCCATGAAAAGTCGCTGAACACGGCATTGGAGCGCTG GCGGCAAGCCATGAACAACATGTCGCAGTATGACCGCTTACGCCAGATCGCGC TCTACCTGCTCTGCTGGGGCGAAGCGGCGCAAGTGCGATTCATGCCCGAGTGC TTGTGCTTCATCTTCAAGTGCGCCGACGACTATTATCGTTCGCCGGAGTGCCAG AACAGGATGGAGCCGGTACCGGAGGGTCTCTACCTGAGGACGGTCGTAAAGCC GCTCTACAGATTTGTCCGGGATCAAGGCTATGAGGTGGTGGAGGGAAAATTCGT ACGGCGGGAACGGGATCACGACCAAATCATTGGTTACGATGACGTGAATCAGC TGTTCTGGTACCCGGAGGGCATTGCCCGTATCGTCCTGTCGGACAAGAGTCGT CTGGTCGACCTCCCTCCAGCACAGCGCTTCATGAAGTTCGACCGTATCGAGTG GAATCGCGTCTTCTTCAAGACGTTCTACGAGACTCGATCCTTTACGCATCTTTTG GTCGACTTCAACCGTATCTGGGTCGTGCACATCGCTCTCTACTTCTTCTACACC GCATACAACTCCCCCACGATCTACGCCATCAACGGCAACACTCCGACGTCTCTG GCTTGGAGCGCGACTGCGCTCGGCGGTGCGGTAGCGACAGGTATCATGATCCT CGCCACGATCGCCGAGTTCTCGCACATCCCCACGACATGGAACAACACCTCGC ATCTGACTCGCCGCCTCGCCTTCCTCCTCGTCACGCTCGGCCTCACATGTGGTC CGACGTTCTACGTCGCGATTGCAGAGAGCAACGGGAGCGGCGGCTCTTTGGCC TTGATTCTCGGCATCGTCCAGTTCTTCATCTCCGTCGTAGCGACTGCGCTCTTC ACTATCATGCCTTCTGGTCGTATGTTCGGCGACCGCGTCGCAGGCAAGAGTCG CAAGTATCTCGCCAGCCAGACGTTCACGGCCAGCTACCCGTCGTTGCCCAAGC ACCAGCGGTTCGCATCACTCCTGATGTGGTTCCTCATCTTCGGGTGCAAGTTGA CGGAGAGTTACTTCTTCCTGACGTTGTCCTTCCGCGACCCTATTCGCGTCATGG TCGGCATGAAGATCCAGAACTGCGAGGACAAGATTTTCGGCAGCGGCCTTTGC AGGAATCACGCAGCATTCACCCTCACGATCATGTACATCATGGACCTCGTCTTG TTCTTCCTCGACACCTTCCTTTGGTATGTCATCTGGAACTCGGTTTTCAGTATCG CACGCTCTTTCGTACTCGGCCTTTCGATCTGGACACCATGGAGGGACATCTTCC AGCGTCTGCCGAAGCGTATCTACGCGAAGCTTCTAGCGACCGGCGACATGGAG GTCAAGTACAAGCCCAAGGTCTTGGTTTCGCAAATCTGGAACGCCATCATCATC TCCATGTACCGCGAGCACTTGCTCTCTATCGAGCACGTTCAAAAGCTCCTGTAC CATCAAGTGGACACTGGCGAAGCCGGCAAGCGGAGTCTTCGCGCGCCTCCGTT CTTCGTCGCGCAGGGCAGCAGCGGTGGCTCGGGCGAGTTCTTCCCGCCTGGT AGCGAGGCTGAGCGTCGTATCTCTTTCTTCGCGCAGTCTCTATCTACGGAGATT CCTCAGCCCATCCCGGTTGACGCCATGCCGACGTTCACAGTGCTTACGCCTCA CTACAGCGAGAAGATCCTTCTTTCGCTCCGTGAGATTATCCGCGAGGAGGACCA GAACACCCGCGTGACATTGCTTGAGTATCTCAAGCAGCTTCACCCGGTCGAGTG GGAGAACTTCGTCAAGGACACCAAGATTTTGGCCGAGGAGTCCGCTATGTTCAA CGGTCCAAGTCCTTTCGGCAACGATGAGAAGGGTCAGTCCAAGATGGACGATC TTCCTTTCTACTGCATCGGTTTCAAGAGCGCCGCGCCCGAGTACACCCTCCGCA CCCGTATCTGGGCGTCCTTGCGCGCGCAGACCCTCTACCGCACGGTCTCCGGC ATGATGAACTATGCGAAGGCGATTAAGCTGCTCTACCGCGTCGAGAACCCCGA GGTCGTGCAGCAGTTCGGCGGTAACACGGACAAGCTCGAGCGCGAGTTGGAG CGGATGGCCCGGCGGAAGTTCAAGTTCCTGGTGTCCATGCAGCGCTACTCGAA GTTCAACAAGGAGGAGCACGAGAACGCCGAGTTCTTGCTCCGCGCGTACCCGG ACCTGCAGATCGCGTACCTGGAGGAAGAGCCTCCTCGCAAGGAGGGTGGCGAT CCACGCATCTTCTCTGCCCTCGTCGACGGCCACAGCGACATCATCCCGGAGAC CGGCAAGCGGCGCCCCAAGTTCCGCATCGAGCTGCCCGGCAACCCCATTCTCG GTGACGGCAAGTCGGACAACCAGAACCACGCCATCGTCTTCTACCGCGGCGAG TACCTCCAGCTTATCGACGCCAACCAGGACAACTACCTCGAGGAGTGCTTGAAG ATCCGTAACGTACTCGCCGAGTTCGAGGAGTACGACGTCTCTAGCCAGAGTCC GTACGCGCAGTGGAGTGTCAAGGAGTTCAAGCGCTCCCCGGTCGCCATCGTCG GTGCACGCGAGTATATCTTCTCGGAGCACATCGGTATTCTCGGTGATTTGGCGG CTGGCAAGGAACAGACGTTCGGTACGCTCACGGCACGCAACAACGCCTTCCTT GGCGGCAAGCTGCACTACGGTCACCCGGATTTCCTCAACGCCCTCTACATGAA CACGCGCGGTGGTGTCTCCAAGGCGCAGAAGGGTCTCCATCTCAACGAGGATA TTTACGCCGGTATGAACGCGGTCGGTCGCGGTGGACGCATCAAGCATAGCGAA TACTACCAGTGCGGCAAGGGTCGTGACCTCGGTTTTGGCACCATCTTGAACTTC CAGACCAAGATCGGTACGGGTATGGGCGAGCAGATCCTCTCGCGCGAGTACTA CTACCTCGGAACCCAATTGCCCATCGATCGCTTCCTCACGTTCTACTACGCGCA CCCAGGTTTCCAGATCAACAACATGCTGGTTATCCTATCCGTGCAGGTCTTCAT CGTTACCATGGTCTTCCTCGGTACCTTGAAGTCTTCGGTCACGATCTGCAAGTA CACGTCCAGCGGTCAGTACATCGGTGGTCAATCCGGTTGCTACAACCTCGTCC CGGTCTTCCAGTGGATCGAGCGCTGCATCATCAGCATCTTCTTGGTGTTCATGA TCGCTTTCATGCCGCTCTTCCTGCAAGAACTCGTCGAGCGCGGTACCTGGAGT GCCATCTGGCGTCTGCTCAAGCAGTTTATGTCGCTGTCGCCTGTCTTCGAGGTG TTCTCCACCCAGATTCAGACACACTCCGTGTTGAGCAACTTGACGTTCGGTGGT GCGCGTTACATCGCTACCGGTCGTGGGTTCGCCACCAGTCGTATCAGCTTCAG CATCTTGTTCTCGCGTTTCGCAGGCCCGAGTATCTACCTCGGCATGCGCACGCT CATTATGCTGCTCTACGTGACGTTGACGATCTGGACGCCATGGGTCATTTACTT CTGGGTTTCCATTCTCTCGCTCTGCATCGCGCCGTTCTTGTTCAATCCGCATCAA TTCGTCTTCTCGGATTTCCTCATCGACTACAGGGAATACCTCCGGTGGATGTCG CGTGGTAACTCGCGCTCGCACAACAACTCCTGGATTGGGTACTGCCGGTTGTC CCGCACGATGATCACTGGGTACAAGAAGAAGAAGCTGGGCCACCCGTCGGAGA AGCTTTCCGGCGACGTTCCTCGTGCAGGCTGGCGCGCCGTCTTATTCTCGGAG ATCATCTTCCCGGCATGCATGGCCATCCTCTTCATCATCGCGTACATGTTCGTCA AGTCGTTCCCTCTCGACGGCAAGCAGCCTCCCTCCGGCCTCGTTCGCATCGCC GTCGTGTCTATCGGCCCCATCGTGTGGAACGCCGCCATCCTGTTGACGCTCTTC CTTGTGTCGTTGTTCCTCGGCCCCATGCTCGACCCGGTCTTCCCCCTCTTCGGT TCCGTTATGGCCTTCATCGCGCATTTCCTCGGCACAATCGGAATGATTGGGTTC TTCGAGTTCCTGTGGTTCCTCGAGTCCTGGGAGGCGTCGCATGCCGTGCTGGG TCTCATCGCCGTCATCTCCATCCAGCGCGCCATTCACAAAATTCTTATCGCCGTT

TTCCTCAGTCGCGAGTTCAAGCACGACGAGACGAACAGGGCTTGGTGGACTGG TCGCTGGTATGGCCGTGGCCTCGGCACGCACGCCATGTCGCAGCCGGCGCGT GAGTTCGTCGTCAAGATCATCGAGTTGTCGCTCTGGAGCTCGGATCTCATACTC GGCCACATCCTGCTGTTCATGCTTACTCCGGCTGTCCTCATCCCGTACTTCGAC CGTCTGCACGCCATGATGCTCTTCTGGCTGCGCCCCTCAAAGCAAATCCGCGC GCCTCTGTACTCAATCAAGCAGAAGAGGCAAAGACGCTGGATTATCATGAAGTA CGGTACTGTATACGTTACCGTCATCGCGATCTTCGTCGCGCTCATCGCGCTTCC CCTCGTCTTCCGACACACTCTAAAGGTCGAGTGCTCCCTTTGCGACAGCTTGTA A polypeptide sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15531 amino acid S. commune SEQ ID NO: 8 MRNMFDFTMQLLDSRASRMTPNQALLTLHADYIGGQHANYRKVVYFAAQLDLDDAV GQTQNPGLNRLKSTRGSGKRPRHEKSLNTALERWRQAMNNMSQYDRLRQIALYLL CWGEAAQVRFMPECLCFIFKCADDYYRSPECQNRMEPVPEGLYLRTVVKPLYRFV RDQGYEVVEGKFVRRERDHDQIIGYDDVNQLFWYPEGIARIVLSDKSRLVDLPPAQ RFMKFDRIEWNRVFFKTFYETRSFTHLLVDFNRIWVVHIALYFFYTAYNSPTIYAING NTPTSLAWSATALGGAVATGIMILATIAEFSHIPTTWNNTSHLTRRLAFLLVTLGLTCG PTFYVAIAESNGSGGSLALILGIVQFFISVVATALFTIMPSGRMFGDRVAGKSRKYLA SQTFTASYPSLPKHQRFASLLMWFLIFGCKLTESYFFLTLSFRDPIRVMVGMKIQNC EDKIFGSGLCRNHAAFTLTIMYIMDLVLFFLDTFLVVYVIWNSVFSIARSFVLGLSIWTP WRDIFQRLPKRIYAKLLATGDMEVKYKPKVLVSQIWNAIIISMYREHLLSIEHVQKLLY HQVDTGEAGKRSLRAPPFFVAQGSSGGSGEFFPPGSEAERRISFFAQSLSTEIPQPI PVDAMPTFTVLTPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLHPVEWENFVKDTKI LAEESAMFNGPSPFGNDEKGQSKMDDLPFYCIGFKSAAPEYTLRTRIWASLRAQTL YRTVSGMMNYAKAIKLLYRVENPEVVQQFGGNTDKLERELERMARRKFKFLVSMQ RYSKFNKEEHENAEFLLRAYPDLQIAYLEEEPPRKEGGDPRIFSALVDGHSDIIPETG KRRPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYLQLIDANQDNYLEECLKIRNVLA EFEEYDVSSQSPYAQWSVKEFKRSPVAIVGAREYIFSEHIGILGDLAAGKEQTFGTL TARNNAFLGGKLHYGHPDFLNALYMNTRGGVSKAQKGLHLNEDIYAGMNAVGRGG RIKHSEYYQCGKGRDLGFGTILNFQTKIGTGMGEQILSREYYYLGTQLPIDRFLTFYY AHPGFQINNMLVILSVQVFIVTMVFLGTLKSSVTICKYTSSGQYIGGQSGCYNLVPVF QWIERCIISIFLVFMIAFMPLFLQELVERGTWSAIWRLLKQFMSLSPVFEVFSTQIQTH SVLSNLTFGGARYIATGRGFATSRISFSILFSRFAGPSIYLGMRTLIMLLYVTLTIWTP VVVIYFVVVSILSLCIAPFLFNPHQFVFSDFLIDYREYLRWMSRGNSRSHNNSWIGYCR LSRTMITGYKKKKLGHPSEKLSGDVPRAGWRAVLFSEIIFPACMAILFIIAYMFVKSFP LDGKQPPSGLVRIAWSIGPIVWNAAILLTLFLVSLFLGPMLDPVFPLFGSVMAFIAHF LGTIGMIGFFEFLWFLESWEASHAVLGLIAVISIQRAIHKILIAVFLSREFKHDETNRAW WTGRVVYGRGLGTHAMSQPAREFVVKIIELSLWSSDLILGHILLFMLTPAVLIPYFDRL HAMMLFWLRPSKQIRAPLYSIKQKRQRRWIIMKYGTVYVTVIAIFVALIALPLVFRHTL KVECSLCDSL Gene sequence 1,3-.beta.-D-glucan synthase I of S. commune strain Lu15634 DNA S. commune SEQ ID NO: 9 CCCGTCCCTCAAGGCCGTTCTTTCGCTGGCGACCGACCCGGTGTTCGCGAGAA CCTGTTGTTTCTGACGATCATCAACCCTTTCTTCTCGTCGCTCTTTAGCTCTCCC TAGACCGTCTTTTACTCTACTCTTCGACGCACGCCATGTCCGGTCCAGGATATG GCAGGAATCCATTCGACAATCCCCCGCCCAACAGAGGTCCCTATGGCCAGCAG CCAGGTTTCCCGGGGCCCGGCCCTCGGCCTTACGACTCGGACGCGGACATGA GCCAGACCTATGGCAGCACAACCAGGCTCGCCGGCAGTGCCGGTTACAGCGA CAGAAACGgtgcgaacgtcgctaccgtacttcctcgatcgtcgactcacatatcacgcagGC AGCTTCGACGGCGACCGCTCCTACGCGCCCTCAATTGACTCGCGCGCCAGCGTGCCCAGC ATATCGCCCTTCGCAGACCCGGGTATCGGCTCTAATGAGCCGTATCCCGCTTG GTCGGTCGAACGCCAGATCCCCATGTCCACGGAGGAGATTGAGGATATCTTCC TCGACCTCACCCAAAAGTTTGGCTTCCAGCGCGACTCCATGCGGAATACGgtgcgt gaataagcagcccactcgaccgcgggaacagctcaattgacctgtcacccagTTCGACTTCA TGATGCACCTCCTTGATTCCCGTGCCTCGCGCATGACGCCCAACCAAGCTCTGCTCACGCT TCACGCCGACTACATTGGTGGCCAGCACGCCAACTATAGGAAGTGGTATTTCGC CGCTCAGCTCAACCTCGATGACGCGGTCGGGCAAACCAATAACCCCGGTATCC AGCGCTTGAAGACCATCAAGGGCGCTACGAAGACCAAGTCGCTCGACAGCGCA CTCAACCGCTGGCGCAATGCGATGAACAACATGAGCCAGTACGATCGCCTCCG GCAAATTGCGCTCTATCTCCTCTGCTGGGGAGAAGCAGGCAACATCCGTCTGG CGCCCGAGTGCTTGTGCTTCATCTTCAAGTGCGCGGACGACTACTACAGAAGTC CCGAGTGTCAGAACCGGATGGACCCCGTGCCGGAAGGGCTGTACCTCCAGAC GGTCATCAAGCCGCTCTATCGCTTCCTACGTGATCAGGCGTACGAAGTCGTTGA TGGGAAGCAAGTGAAGCGCGAGAAGGACCACGACCAGATTATCGGTTATGACG ACGTCAACCAGTTATTCTGGTATCCGGAAGGTTTGGCTAAGATCGTCATGTCGG ACAACgtgcgtatgatcttatcggttacaattcgtccgctcacatctttccagACACGACT TGTAGATGTACCTCCGGCGCAGCGGTTCATGAAGTTCGCCAAGATCGAGTGGAACCGCGTCTTC TTCAAGACGTACTTTGAGAAGCGCTCTACTGCCCATCTCCTGGTCAACTTCAAC CGTATATGGATCCTCCACGTCTCGATGTACTTCTTCTACACGGCATTCAACTCTC CACGAGTCTACGCGCCGCACGGCAAACTCGACCCCTCCCCTGAGATGACCTGG TCCGCGACTGCCCTTGGAGGCGCTGTGTCCACCATGATCATGATCCTTGCCACT ATCGCGGAGTACACCTACATCCCCACGACATGGAACAATGCGTCGCACCTCAC CACGCGGCTCATTTTCCTCCTGGTCATCCTCGCGCTCACTGCTGGACCAACATT CTATATCGCCATGATAGACGGACGCACGGACATCGGCCAAGTACCACTCATCGT GGCCATAGTGCAGTTCTTCATCTCCGTCGTCGCCACCCTCGCTTTCGCTACCAT CCCTTCTGGTCGCATGTTCGGCGACCGTGTGGCTGGCAAGTCAAGAAAGCACA TGGCATCGCAGACGTTCACAGCGTCGTACCCGTCCATGAAGCGGTCATCTCGC GTAGCGAGTATCATGCTGTGGCTTTTGGTCTTTGGCTGCAAATACGTCGAGTCT TACTTCTTCTTGACGTCCTCCTTCTCCAGCCCGATCGCGGTCATGGCGCGTACG AAGGTACAGGGCTGCAACGACCGTATCTTCGGCAGCCAGCTGTGCACGAATCA GGTCCCGTTCGCGCTGGCAATCATGTACGTGATGGACCTGGTACTGTTCTTCCT GGACACGTACCTGTGGTACATCATCTGGCTGGTGATCTTCTCGATGGTGCGCG CGTTCAAGCTTGGTATCTCGATCTGGACGCCCTGGAGCGAGATCTTCACCCGCA TGCCGAAGCGTATCTACGCGAAGCTGCTGGCGACGGCCGAGATGGAGGTCAA GTATAAGCCCAAGgtatgctgaatgcaatctggtcaggtgaattcaccctcatattgttgtg cagGTGCTCGTCTCGCAAATCTGGAACGCGGTCATCATCTCCATGTACCGGGAGCATCTCTTGT CCATCGAGCACGTCCAGCGCCTGCTATACCACCAGGTTGATGGTCCAGACGGT CGCCGCACCCTCAGGGCACCGCCGTTCTTCACCAGCCAGCGAACTGCGAAGCC AGGCCTGTTCTTCCCTCCTGGTGGCGAGGCTGAGCGCCGTATCTCGTTCTTTGC CTCATCGCTGACGACCGCGCTCCCTGAGCCTCTGCCGATCGACGCCATGCCCA CCTTCACCGTGCTCGTTCCCCATTACTCGGAGAAGATTCTGCTCAGTCTGCGCG AGATTATTCGCGAGGAGGACCAGAACACCCGCGTCACCTTGCTGGAGTACCTC AAGCAGCTCCACCCTGTCGAATGGGACAACTTCGTCAAGGACACCAAGATCTTG GCGGAAGAGTCGGGCGACGTCCAGGACGAGAAGCGCGCGCGCACGGACGACT TGCCGTTCTACTGCATCGGGTTCAAGACCTCGTCACCAGAGTACACCCTGCGTA CGCGTATCTGGGCTTCACTGCGCGCACAGACGCTGTACCGCACGGTCTCCGGT ATGATGAACTACTCCAAGGCGATCAAGCTCCTCTATCGCGTCGAGAACCCGGAT GTCGTTCATGCCTTCGGTGGGAACACGGAACGTCTTGAACGCGAGCTTGAGCG CATGTCTCGCCGCAAGTTCAAGTTCGTCATCTCGATGCAGCGGTACTCTAAGTT CAACAAGGAGGAGCAAGAGAACGCCGAATTCCTTCTGCGCGCGTACCCGGATT TGCAGATCGCGTACCTCGATGAAGAGCCCGGTCCCAGCAAGAGCGACGAGGTT CGGTTGTTTTCGACACTCATCGATGGACACTCCGAGGTGGATGAGAAGACCGG CCGCCGCAAGCCCAAGTTCCGCATTGAGCTGCCCGGTAACCCCATCCTCGGTG ACGGGAAGTCGGATAACCAGAACCACGCCATTGTCTTCTACCGCGGCGAGTAC ATCCAGGTCATCGACGCTAACCAGGACAATTACCTGGAAGAGTGTCTCAAGATC CGTAACGTCCTGGGCGAGTTTGAGGAATACTCCGTGTCGAGCCAGAGCCCGTA CGCACAGTGGGGCCACAAGGAGTTCAACAAGTGCCCCGTCGCTATCCTGGGTT CTCGCGAGTACATCTTCTCGGAGAACATCGGTATCCTCGGTGACATCGCCGCC GGCAAGGAACAGACGTTCGGTACCATTACGGCGCGTGCGCTTGCGTGGATCGG CGGCAAGCTGCATTACGGTCACCCGGATTTCCTCAATGCGACGTTCATGACGAC GCGTGGTGGCGTGTCAAAAGCGCAGAAGGGCTTGCATCTCAACGAGGATATCT TCGCTGGTATGACCGCCGTGTCCCGCGGAGGGCGCATCAAGCACATGGAGTAC TACCAGTGCGGCAAAGGTCGTGATCTCGGTTTCGGCACGATCTTGAACTTCCAG ACGAAGATCGGTACTGGTATGGGCGAGCAGCTCCTCTCGCGCGAGTACTACTA CCTGGGCACGCAATTGCCTATCGACCGGTTCTTGACGTTCTACTACGCGCACGC TGGTTTCCACGTCAACAACATCCTGGTCATCTACTCCATCCAGGTCTTCATGGTC ACCTgtaagtgcaggcgctcatgaccgccgagaacgtagtctgacggatgtgcagTGCTGTA CCTGGGCACATTGAACAAGCAGCTGTTCATCTGCAAGGTCAACTCCAATGGCCAGGTTCT TAGTGGACAAGCTGGGTGCTACAACCTCATCCCGGTCTTCGAGTGGATTCGCC GGAGTATCATCTCCATCTTCTTGGTGTTCTTCATCGCCTTCTTGCCTCTATTCTT GCAAGgtatgttcactttccatgtgtcatccgttagccgctcaccatacgacagAGCTGTGCG AGCGCGGAACGGGAAAGGCGTTGCTGCGTCTCGGGAAGCACTTCTTGTCACTGTCGCCCA TTTTCGAAGTGTTCTCCACCCAGATTTACTCGCAGGCGCTCTTGAACAACATGA GCTTCGGTGGTGCGCGCTACATCGCCACAGGTCGTGGTTTCGCGACTAGTCGC ATACCCTTCAACATCCTCTACTCGCGTTTCGCGCCGCCAAGCATCTACATGGGC

ATGCGTAACCTGCTGCTCCTGCTGTACGCGACGATGGCCATTTGGATCCCGCA CCTGATCTACTTCTGGTTCTCCGTCCTCTCCCTCTGCATCGCGCCATTCATGTTC AATCCGCATCAATTCTCGTACGCCGACTTCATCATCGACTACCGGGAGTTCTTG CGCTGGATGTCGCGCGGTAACTCGCGAACGAAGGCGAGCAGCTGGTACGGAT ACTGCCGTCTGTCGCGTACCGCGATTACTGGGTACAAGAAGAAGAAGCTGGGA CACCCGTCGGAGAAGCTGTCGGGCGACGTACCGCGTGCGCCGTGGAGGAACG TTATCTTCTCGGAGATCCTGTGGCCCATCGGCGCGTGCATCATCTTCATCGTCG CGTACATGTTCGTCAAGTCGTTCCCCGACGAGCAGGGCAACGCGCCGCCGAGC CCGCTGGTCCGGATTCTGCTCATCGCGGTTGGCCCTACTGTGTGGAACGCGGC GGTGCTCATAACGCTGTTCTTCCTGTCGCTCTTCCTGGGCCCGATGATGGATGG CTGGGTCAAGTTCGGCTCGGTCATGGCGGCCCTTGCGCATGGCCTGGCGCTTA TAGGCATGCTCACGTTCTTTGAGTTCTTCgtacgtccttcgcgttgtgtcgtcaagtgctctg ctaacgccgtcttcagTGGTTCCTTGAGCTCTGGGATGCCTCGCACGCCGTGCTCGGCGTCAT CGCTATCATTGCCGTTCAGCGCGGGATCCAGAAGATCCTCATTGCCGTCTTCCT GACGCGTGAGTACAAGCACGACGAGACGAACCGCGCGTGGTGGACAGGTAAAT GGTATGGACGCGGGCTGGGTACCTCGGCCATGTCCCAGCCGGCGCGCGAGTT CATCGTGAAGATCGTGGAGATGTCGTTGTGGACGTCGGACTTCCTGCTTGCGC ACCTGTTGCTCATCATCTTGACGGTGCCGCTACTGCTGCCGTTCTTCAACTCAAT TCATTCGACGATGCTTTgtgagtggtttgtagtcgttggtcatggatgatttctgactcgcg tgcagTCTGGTTGCGCCCTTCGAAGCAGATTAGGCAACCTCTGTTCTCCACCAAGCAGAAGCGG CAACGGCGATGGATTgtgagttcctttgattgctctgggtaccgaccttcgctcacctttctt agGTCATGAAGTATACCGTGGTATATCTCGTGGTGGTGGCTTTCCTCGTCGCGCTCATCGCTCT GCgtacgttttccctcgcgctcaccctgtattttcactaacgtttcctccagCCGCCCTCTTC CGCGAGAGCATCCACTTCAACTGCGAGATCTGCCAGAGTATATAGTCATATAACGACGTCTATC GTATCGCCGGACGAGAGCCCCGTCGCCTACACACTGACATGGAATCGCTGTGT ATACAATCGATCTTCTGACCGCGTCGGGGGCGTTGCCGTCTTTCTACTATCAAT TTGCTTGTGTATCAACATTTCTTCTCTCCAAGCCTACATTGACATAGAGTAATAG CCCATGTTCATACAACAATCGCATAGCATTGCATATACCAT translation of SEQ ID NO: 13 amino acid S. commune SEQ ID NO: 10 MSGPGYGRNPFDNPPPNRGPYGQQPGFPGPGPRPYDSDADMSQTYGSTTRLAG SAGYSDRNGSFDGDRSYAPSIDSRASVPSISPFADPGIGSNEPYPAWSVERQIPMS TEEIEDIFLDLTQKFGFQRDSMRNTFDFMMHLLDSRASRMTPNQALLTLHADYIGGQ HANYRKWYFAAQLNLDDAVGQTNNPGIQRLKTIKGATKTKSLDSALNRWRNAMNN MSQYDRLRQIALYLLCWGEAGNIRLAPECLCFIFKCADDYYRSPECQNRMDPVPEG LYLQTVIKPLYRFLRDQAYEVVDGKQVKREKDHDQIIGYDDVNQLFWYPEGLAKIVM SDNTRLVDVPPAQRFMKFAKIEWNRVFFKTYFEKRSTAHLLVNFNRIWILHVSMYFF YTAFNSPRVYAPHGKLDPSPEMTWSATALGGAVSTMIMILATIAEYTYIPTTWNNAS HLTTRLIFLLVILALTAGPTFYIAMIDGRTDIGQVPLIVAIVQFFISVVATLAFATIPSGRM FGDRVAGKSRKHMASQTFTASYPSMKRSSRVASIMLWLLVFGCKYVESYFFLTSSF SSPIAVMARTKVQGCNDRIFGSQLCTNQVPFALAIMYVMDLVLFFLDTYLWYIIWLVI FSMVRAFKLGISIWTPWSEIFTRMPKRIYAKLLATAEMEVKYKPKVLVSQIWNAVIISM YREHLLSIEHVQRLLYHQVDGPDGRRTLRAPPFFTSQRTAKPGLFFPPGGEAERRIS FFASSLTTALPEPLPIDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLH PVEWDNFVKDTKILAEESGDVQDEKRARTDDLPFYCIGFKTSSPEYTLRTRIWASLR AQTLYRTVSGMMNYSKAIKLLYRVENPDVVHAFGGNTERLERELERMSRRKFKFVI SMQRYSKFNKEEQENAEFLLRAYPDLQIAYLDEEPGPSKSDEVRLFSTLIDGHSEVD EKTGRRKPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYIQVIDANQDNYLEECLKIR NVLGEFEEYSVSSQSPYAQWGHKEFNKCPVAILGSREYIFSENIGILGDIAAGKEQTF GTITARALAWIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLHLNEDIFAGMTAVSR GGRIKHMEYYQCGKGRDLGFGTILNFQTKIGTGMGEQLLSREYYYLGTQLPIDRFLT FYYAHAGFHVNNLVIYSIQVFMVTLLYLGTLNKQLFICKVNSNGQVLSGQAGCYNLI PVFEWIRRSIISIFLVFFIAFLPLFLQELCERGTGKALLRLGKHFLSLSPIFEVFSTQIYS QALLNNMSFGGARYIATGRGFATSRIPFNILYSRFAPPSIYMGMRNLLLLLYATMAIW IPHLIYFWFSVLSLCIAPFMFNPHQFSYADFIIDYREFLRWMSRGNSRTKASSWYGY CRLSRTAITGYKKKKLGHPSEKLSGDVPRAPWRNVIFSEILWPIGACIIFIVAYMFVKS FPDEQGNAPPSPLVRILLIAVGPTVWNAAVLITLFFLSLFLGPMMDGVVVKFGSVMAA LAHGLALIGMLTFFEFFWFLELWDASHAVLGVIAIIAVQRGIQKILIAVFLTRKVVYGRG LGTSAMSQPAREFIVKIVEMSLWTSDFLLAHLLLIILTVPLLLPFFNSIHSTMLFWLRPS KQIRQPLFSTKQKRQRRWIVMKYTVVYLVVVAFLVALIALPALFRESIHFNCEICQSI Gene sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15634 DNA S. commune SEQ ID NO: 11 CTGTCCAAGGAGGAGATCGAGGACATCTTCCTCGATTTGACGCAGAAGTTTGGC TTTCAGCGGGATTCCATGCGGAATATGgtacgtggcgtgtgcccatgtgcggcgttctgagg cctaacgttttccgccagTTCGACTTCACCATGCAGCTGCTTGACAGCCGAGCGTCTCGTATG ACCCCCAACCAGGCGCTCCTCACCCTCCACGCCGACTACATTGGTGGCCAGCA TGCGAACTACCGGAAGTGGTACTTCGCGGCGCAGCTCGACCTTGACGACGCCG TGGGACAAACTCAGAATCCGGGTCTCAACCGCCTCAAGTCCACTCGCGGATCG GGCAAGCGACCACGCCATGAAAAGTCGCTGAACACGGCATTGGAGCGCTGGC GGCAAGCCATGAACAACATGTCGCAGTATGACCGCTTACGCCAGATCGCGCTC TACCTGCTCTGCTGGGGCGAAGCGGCGCAAGTGCGATTCATGCCCGAGTGCTT GTGCTTCATCTTCAAGTGCGCCGACGACTACTATCGTTCGCCGGAGTGCCAGAA CAGGATGGAGCCGGTACCGGAGGGTCTCTACCTGAGGACGGTCGTAAAGCCG CTCTACAGATTTGTCCGGGATCAAGGCTATGAGGTGGTGGAGGGAAAATTCGTA CGGCGGGAACGGGATCACGACCAAATCATTGGTTACGATGACGTGAATCAGCT GTTCTGGTACCCGGAGGGAATTGCCCGTATCGTCCTGTCGGACAAGgtaagcacctc tgtgcatcttctgtgacatacagggctaattgtcgagcagAGTCGTCTAGTCGACCTCCCCCC AGCACAGCGCTTCATGAAGTTCGACCGTATCGAGTGGAATCGCGTCTTCTTCAAGACG TTTTACGAGACTCGATCCTTCACGCATCTTTTGGTCGACTTCAACCGTATCTGGG TCGTGCACATCGCTCTCTACTTCTTCTACACTGCATACAACTCCCCCACGATCTA CGCCATCAACGGCAACACACCGACGTCTCTGGCTTGGAGCGCGACTGCGCTCG GCGGTGCGGTAGCGACAGGTATCATGATCCTCGCCACGATCGCCGAGTTCTCG CACATCCCCACGACATGGAACAACACCTCGCATCTGACTCGCCGCCTCGCCTTC CTCCTCGTCACGCTCGGCCTCACATGTGGTCCGACGTTCTACGTCGCGATTGCA GAGAGCAACGGGAGCGGCGGCTCTTTGGCCTTGATTCTCGGTATCGTCCAGTT CTTCATCTCCGTCGTGGCAACTGCGCTCTTCACTATCATGCCTTCTGGTCGTAT GTTCGGCGACCGTGTCGCAGGCAAGAGTCGCAAGTATCTCGCCAGCCAGACGT TCACGGCCAGCTACCCGTCGTTGCCCAAGCACCAGCGGTTCGCCTCACTCCTG ATGTGGTTCCTCATCTTCGGGTGCAAGTTGACGGAGAGTTACTTCTTTCTGACG CTGTCCTTCCGCGACCCTATCCGCGTCATGGTCGGCATGAAGATCCAGAACTG CGAGGACAAGATTTTCGGCAGCGGCCTTTGCAGGAATCACGCAGCATTCACCC TCACGATCATGTACATCATGGACCTCGTCTTGTTCTTCCTCGACACCTTCCTTTG GTATGTCATCTGGAACTCGGTTTTCAGTATCGCACGCTCTTTCGTACTCGGCCTT TCGATCTGGACACCGTGGAGAGACATCTTCCAGCGTCTGCCGAAGCGGATCTA CGCGAAGCTTCTGGCGACTGGCGACATGGAGGTCAAGTACAAGCCCAAGgtatgc gttgagctcgccgtaaatccacttaaggctaacacgttcgcagGTCTTGGTCTCGCAAATCT GGAACGCCATCATCATCTCCATGTACCGCGAGCACTTGCTCTCTATTGAGCACGTCCAG AAGCTCCTGTACCACCAAGTGGACACTGGCGAAGCCGGCAAGCGGAGTCTTCG CGCGCCTCCGTTCTTCGTCGCGCAGGGCAGCAGCGGTGGCTCGGGCGAGTTC TTCCCGCCTGGCAGCGAGGCCGAGCGTCGTATCTCTTTCTTCGCGCAGTCGCT TTCTACGGAGATTCCTCAGCCCATCCCGGTCGACGCCATGCCGACGTTCACGG TGCTTACGCCTCACTACAGCGAGAAGgtacatgctccccttgtagccatatgacatcagctga ctgtcgtgcacagATCCTTCTCTCTCTCCGTGAAATTATCCGCGAGGAGGACCAGAACACT CGCGTTACGTTGCTCGAGTACCTGAAGCAGCTGCATCCGGTCGAGTGGGAGAA TTTCGTCAAGGACACTAAAATTTTGGCCGAGGAGTCCGCTATGTTTAACGGTCC GAGTCCTTTCGGCAACGACGAGAAGGGTCAGTCCAAGATGGACGATCTACCGT TCTACTGCATCGGTTTCAAGAGCGCCGCGCCCGAGTACACCCTCCGCACCCGT ATCTGGGCGTCCCTGCGCGCGCAGACGCTGTACCGCACGGTCTCCGGCATGAT GAACTATGCGAAGGCGATCAAGCTGCTCTACCGCGTTGAGAACCCGGAGGTCG TACAACAGTTCGGCGGCAACACGGACAAGCTCGAGCGCGAGTTGGAGCGGATG GCGCGACGGAAGTTCAAGTTCCTCGTGTCCATGCAGCGCTACTCGAAGTTCAAC AAGGAGGAGCACGAGAACGCCGAGTTCTTGCTCCGCGCGTACCCGGACTTGCA GATCGCGTACCTCGAGGAAGAGCCCCCTCGCAAGGAGGGCGGCGATCCACGC ATCTTCTCTGCCCTCGTCGACGGCCACAGCGACATCATCCCGGAGACCGGCAA GCGGCGCCCCAAGTTCCGTATCGAGCTGCCCGGTAACCCCATTCTCGGTGACG GTAAATCCGACAATCAGAACCACGCTATCGTCTTCTACCGCGGCGAGTACCTCC AGCTTATCGACGCCAACCAGGACAACTACCTCGAGGAGTGCTTGAAGATCCGTA ACGTGCTCGCCGAGTTTGAGGAGTACGACGTCTCCAGCCAGAGCCCGTACGCG CAGTGGAGTGTCAAGGAGTTCAAGCGCTCTCCGGTCGCCATCGTCGGTGCACG CGAGTACATCTTCTCAGAGCACATCGGTATCCTCGGTGATCTGGCGGCTGGCAA GGAACAGACGTTCGGTACGCTCACGGCACGCAACAACGCCTTCCTTGGCGGCA AGCTGCACTACGGTCACCCCGATTTCCTCAACGCCCTCTACATGAACACGCGCG GTGGTGTCTCCAAGGCGCAGAAGGGTCTCCATCTCAACGAGGATATCTACGCC GGTATGAACGCGGTCGGTCGCGGTGGACGCATTAAGCACAGCGAGTACTATCA GTGCGGCAAGGGTCGTGACCTCGGTTTCGGCACCATCTTGAACTTCCAGACCA AGATCGGTACGGGTATGGGCGAGCAGATCCTCTCGCGCGAGTACTACTATCTC

GGAACACAACTGCCCATCGATCGCTTCCTCACGTTCTACTACGCGCACCCGGGT TTCCAGATCAACAACATGCTGGTCATCCTCTCCGTGCAGGTCTTCATCGTTACCA gtacgttcaatgcatattgttagcctgacaacgtctgacgaatttccagTGGTCTTCCTCGGT ACCTTGAAGTCTTCGGTCACGATCTGCAAGTACACGTCCAGCGGTCAGTACATCGGTGGTCA ATCCGGTTGCTACAACCTCGTCCCGGTCTTCCAGTGGATCGAGCGCTGCATCAT CAGCATCTTCTTGGTGTTCATGATCGCTTTCATGCCGCTCTTCCTGCAAGgtaaga gcttgtcaacctgctcaaggggcttgcgctgatcatcatctcagAACTCGTCGAGCGCGGTACC TGGAGTGCCATCTGGCGTCTGCTCAAGCAGTTTATGTCGCTGTCGCCTGTCTTCGAGG TGTTCTCCACCCAGATTCAGACGCACTCCGTGTTGAGCAACTTGACGTTCGGTG GTGCGCGTTACATCGCTACCGGTCGTGGGTTCGCCACCAGTCGTATCAGCTTC AGCATCTTGTTCTCGCGTTTCGCAGGCCCGAGTATCTACCTCGGCATGCGCACG CTCATTATGCTGCTCTACGTGACGTTGACGATCTGGACGCCATGGGTCATTTAC TTCTGGGTTTCCATTCTCTCGCTCTGCATCGCGCCGTTCTTGTTCAACCCGCATC AATTCGTATTCTCGGACTTCCTCATCGACTACAGgtacgtcggacgagcgctgttccgcgacgt aagctgaccggttatacagGGAATACCTGCGGTGGATGTCGCGTGGCAACTCGCGCTCG CACAACAACTCCTGGATTGGGTACTGCCGGTTGTCCCGCACGATGATCACTGG GTACAAGAAGAAGAAGCTGGGCCACCCGTCGGAGAAGCTTTCCGGCGACGTTC CTCGTGCAGGCTGGCGCGCCGTCTTGTTCTCGGAGATCATCTTCCCGGCGTGC ATGGCCATCCTCTTCATCATCGCGTACATGTTCGTCAAGTCGTTCCCTCTCGAC GGCAAGCAGCCTCCCTCCGGCCTCGTTCGCATCGCCGTCGTGTCTATCGGCCC CATCGTGTGGAACGCCGCCATCCTGTTGACGCTCTTCCTTGTGTCGTTGTTCCT CGGCCCCATGCTCGACCCGGTCTTCCCCCTCTTCGGTTCCGTTATGGCCTTCAT CGCGCATTTCCTTGGCACAATCGGAATGATTGGGTTCTTCGAGTTCCTGgtatgtgc ccatacctttcattcgacttcaactatctaacagattcatagTGGTTCCTCGAGTCCTGGGAG GCGTCGCATGCCGTGCTGGGTCTCATCGCCGTCATCTCCATCCAGCGCGCCATTCACA AGATCCTTATCGCCGTTTTCCTCAGTCGCGAGTTCAAGCACGACGAGACGAACA GGGCCTGGTGGACTGGTCGCTGGTATGGCCGTGGCCTCGGCACGCACGCCAT GTCGCAGCCGGCGCGTGAGTTCGTCGTCAAGATCATCGAGTTGTCGCTTTGGA GCTCGGATCTCATACTCGGCCACATCCTGCTGTTCATGCTTACTCCGGCCGTCC TCATCCCGTACTTCGACCGTTTGCACGCCATGATGCTCTgtacgtcgtgtctcattgtctgtgt tggtcatactcttaccctctcttagTCTGGCTGCGTCCCTCGAAGCAAATCCGCGCGCCTCTG TACTCGATCAAGCAGAAGAGGCAAAGACGCTGGATTgtcagtgttcagtgccttattctatcag ctcttactaacgtcttcatagATCATGAAGTACGGTACTGTATACGTTACCGTCATCGCGAT CTTCGTCGCGCTCATCGCGCTTCgtgagtttccttgctatttttcgtacctgagcgtcgctgac ccctttcccagCCCTCGTATTCCGACACACTCTAAAGGTCGAGTGCTCCCTTTGCGACAGCTT GTAATATCGGACTCGTATATATCTAGACTTCTCCGCACCATGTGTAGCTGACGCT TGGGTATACTTCGCGGTGCCGAGCTAATTGTCGACGGACATTCTCCATCGTTGA GTGCAGCGACGTCGGGTGGTTTACGACACGGACACTTTTCATTGTACCCTCTAC GAATGCAAGAACTCTCTTACGACCAGTACCTATGTGCTAAGCCGTCGCCTGTTC AGGATCATACATACATACGTTTCTAGATACCTTACAGTTAGGCCTATTCAGGGAG AGTCTGCATAAAA translation of SEQ ID NO: 15 amino acid S. commune SEQ ID NO: 12 MPRPGGTSAEGGYASSPSMETTPSDPFGTANGAPRRYYDNDSEEYGPGRRDTYA SDSSNQGLTDPGYYDQNGAYDPYPTGDTDSDGDVYGQRYGPSAESLGTHKFGHS DSSTPTFVDYSASSGGRDSYPAWTAERNIPLSKEEIEDIFLDLTQKFGFQRDSMRN MFDFTMQLLDSRASRMTPNQALLTLHADYIGGQHANYRKVVYFAAQLDLDDAVGQT QNPGLNRLKSTRGSGKRPRHEKSLNTALERWRQAMNNMSQYDRLRQIALYLLCW GEAAQVRFMPECLCFIFKCADDYYRSPECQNRMEPVPEGLYLRTVVKPLYRFVRD QGYEWEGKFVRRERDHDQIIGYDDVNQLFWYPEGIARIVLSDKSRLVDLPPAQRF MKFDRIEWNRVFFKTFYETRSFTHLLVDFNRIVVWHIALYFFYTAYNSPTIYAINGNT PTSLAWSATALGGAVATGIMILATIAEFSHIPTTWNNTSHLTRRLAFLLVTLGLTCGPT FYVAIAESNGSGGSLALILGIVQFFISVVATALFTIMPSGRMFGDRVAGKSRKYLASQ TFTASYPSLPKHQRFASLLMWFLIFGCKLTESYFFLTLSFRDPIRVMVGMKIQNCED KIFGSGLCRNHAAFTLTIMYIMDLVLFFLDTFLWYVIWNSVFSIARSFVLGLSIWTPWR DIFQRLPKRIYAKLLATGDMEVKYKPKVLVSQIWNAIIISMYREHLLSIEHVQKLLYHQ VDTGEAGKRSLRAPPFFVAQGSSGGSGEFFPPGSEAERRISFFAQSLSTEIPQPIPV DAMPTFTVLTPNYSEKILLSLREIIREEDQNTRVTLLEYLKQLHPVEWENFVKDTKILA EESAMFNGPSPFGNDEKGQSKMDDLPFYCIGFKSAAPEYTLRTRIWASLRAQTLYR TVSGMMNYAKAIKLLYRVENPEVVQQFGGNTDKLERELERMARRKFKFLVSMQRY SKFNKEEHENAEFLLRAYPDLQIAYLEEEPPRKEGGDPRIFSALVDGHSDIIPETGKR RPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYLQLIDANQDNYLEECLKIRNVLAEF EEYDVSSQSPYAQWSVKEFKRSPVAIVGAREYIFSEHIGILGDLAAGKEQTFGTLTA RNNAFLGGKLHYGHPDFLNALYMNTRGGVSKAQKGLHLNEDIYAGMNAVGRGGRI KHSEYYQCGKGRDLGFGTILNFQTKIGTGMGEQILSREYYYLGTQLPIDRFLTFYYA HPGFQINNMLVILSVQVFIVTMVFLGTLKSSVTICKYTSSGQYIGGQSGCYNLVPVFQ WIERCIISIFLVFMIAFMPLFLQELVERGTWSAIWRLLKQFMSLSPVFEVFSTQIQTHS VLSNLTFGGARYIATGRGFATSRISFSILFSRFAGPSIYLGMRTLIMLLYVTLTIWTPW VIYFWVSILSLCIAPFLFNPHQFVFSDFLIDYREYLRWMSRGNSRSHNNSWIGYCRL SRTMITGYKKKKLGHPSEKLSGDVPRAGWRAVLFSEIIFPACMAILFIIAYMFVKSFPL DGKQPPSGLVRIAVVSIGPIVVVNAAILLTLFLVSLFLGPMLDPVFPLFGSVMAFIAHFL GTIGMIGFFEFLWFLESWEASHAVLGLIAVISIQRAIHKILIAVFLSREFKHDETNRAW WTGRVVYGRGLGTHAMSQPAREFVVKIIELSLWSSDLILGHILLFMLTPAVLIPYFDRL HAMMLFWLRPSKQIRAPLYSIKQKRQRRWIIMKYGTVYVTVIAIFVALIALPLVFRHTL KVECSLCDSL cDNA 1,3-13-D-glucan synthase I of S. commune strain Lu15634 DNA S. commune SEQ ID NO: 13 ATGTCCGGTCCAGGATATGGCAGGAATCCATTCGACAATCCCCCGCCCAACAG AGGTCCCTATGGCCAGCAGCCAGGTTTCCCGGGGCCCGGCCCTCGGCCTTAC GACTCGGACGCGGACATGAGCCAGACCTATGGCAGCACAACCAGGCTCGCCG GCAGTGCCGGTTACAGCGACAGAAACGGCAGCTTCGACGGCGACCGCTCCTAC GCGCCCTCAATTGACTCGCGCGCCAGCGTGCCCAGCATATCGCCCTTCGCAGA CCCGGGTATCGGCTCTAATGAGCCGTATCCCGCTTGGTCGGTCGAACGCCAGA TCCCCATGTCCACGGAGGAGATTGAGGATATCTTCCTCGACCTCACCCAAAAGT TTGGCTTCCAGCGCGACTCCATGCGGAATACGTTCGACTTCATGATGCACCTCC TTGATTCCCGTGCCTCGCGCATGACGCCCAACCAAGCTCTGCTCACGCTTCACG CCGACTACATTGGTGGCCAGCACGCCAACTATAGGAAGTGGTATTTCGCCGCTC AGCTCAACCTCGATGACGCGGTCGGGCAAACCAATAACCCCGGTATCCAGCGC TTGAAGACCATCAAGGGCGCTACGAAGACCAAGTCGCTCGACAGCGCACTCAA CCGCTGGCGCAATGCGATGAACAACATGAGCCAGTACGATCGCCTCCGGCAAA TTGCGCTCTATCTCCTCTGCTGGGGAGAAGCAGGCAACATCCGTCTGGCGCCC GAGTGCTTGTGCTTCATCTTCAAGTGCGCGGACGACTACTACAGAAGTCCCGAG TGTCAGAACCGGATGGACCCCGTGCCGGAAGGGCTGTACCTCCAGACGGTCAT CAAGCCGCTCTATCGCTTCCTACGTGATCAGGCGTACGAAGTCGTTGATGGGAA GCAAGTGAAGCGCGAGAAGGACCACGACCAGATTATCGGTTATGACGACGTCA ACCAGTTATTCTGGTATCCGGAAGGTTTGGCTAAGATCGTCATGTCGGACAACA CACGACTTGTAGATGTACCTCCGGCGCAGCGGTTCATGAAGTTCGCCAAGATC GAGTGGAACCGCGTCTTCTTCAAGACGTACTTTGAGAAGCGCTCTACTGCCCAT CTCCTGGTCAACTTCAACCGTATATGGATCCTCCACGTCTCGATGTACTTCTTCT ACACGGCATTCAACTCTCCACGAGTCTACGCGCCGCACGGCAAACTCGACCCC TCCCCTGAGATGACCTGGTCCGCGACTGCCCTTGGAGGCGCTGTGTCCACCAT GATCATGATCCTTGCCACTATCGCGGAGTACACCTACATCCCCACGACATGGAA CAATGCGTCGCACCTCACCACGCGGCTCATTTTCCTCCTGGTCATCCTCGCGCT CACTGCTGGACCAACATTCTATATCGCCATGATAGACGGACGCACGGACATCGG CCAAGTACCACTCATCGTGGCCATAGTGCAGTTCTTCATCTCCGTCGTCGCCAC CCTCGCTTTCGCTACCATCCCTTCTGGTCGCATGTTCGGCGACCGTGTGGCTG GCAAGTCAAGAAAGCACATGGCATCGCAGACGTTCACAGCGTCGTACCCGTCC ATGAAGCGGTCATCTCGCGTAGCGAGTATCATGCTGTGGCTTTTGGTCTTTGGC TGCAAATACGTCGAGTCTTACTTCTTCTTGACGTCCTCCTTCTCCAGCCCGATCG CGGTCATGGCGCGTACGAAGGTACAGGGCTGCAACGACCGTATCTTCGGCAGC CAGCTGTGCACGAATCAGGTCCCGTTCGCGCTGGCAATCATGTACGTGATGGA CCTGGTACTGTTCTTCCTGGACACGTACCTGTGGTACATCATCTGGCTGGTGAT CTTCTCGATGGTGCGCGCGTTCAAGCTTGGTATCTCGATCTGGACGCCCTGGA GCGAGATCTTCACCCGCATGCCGAAGCGTATCTACGCGAAGCTGCTGGCGACG GCCGAGATGGAGGTCAAGTATAAGCCCAAGGTGCTCGTCTCGCAAATCTGGAA CGCGGTCATCATCTCCATGTACCGGGAGCATCTCTTGTCCATCGAGCACGTCCA GCGCCTGCTATACCACCAGGTTGATGGTCCAGACGGTCGCCGCACCCTCAGGG CACCGCCGTTCTTCACCAGCCAGCGAACTGCGAAGCCAGGCCTGTTCTTCCCT CCTGGTGGCGAGGCTGAGCGCCGTATCTCGTTCTTTGCCTCATCGCTGACGAC CGCGCTCCCTGAGCCTCTGCCGATCGACGCCATGCCCACCTTCACCGTGCTCG TTCCCCATTACTCGGAGAAGATTCTGCTCAGTCTGCGCGAGATTATTCGCGAGG AGGACCAGAACACCCGCGTCACCTTGCTGGAGTACCTCAAGCAGCTCCACCCT GTCGAATGGGACAACTTCGTCAAGGACACCAAGATCTTGGCGGAAGAGTCGGG CGACGTCCAGGACGAGAAGCGCGCGCGCACGGACGACTTGCCGTTCTACTGC ATCGGGTTCAAGACCTCGTCACCAGAGTACACCCTGCGTACGCGTATCTGGGC

TTCACTGCGCGCACAGACGCTGTACCGCACGGTCTCCGGTATGATGAACTACTC CAAGGCGATCAAGCTCCTCTATCGCGTCGAGAACCCGGATGTCGTTCATGCCTT CGGTGGGAACACGGAACGTCTTGAACGCGAGCTTGAGCGCATGTCTCGCCGCA AGTTCAAGTTCGTCATCTCGATGCAGCGGTACTCTAAGTTCAACAAGGAGGAGC AAGAGAACGCCGAATTCCTTCTGCGCGCGTACCCGGATTTGCAGATCGCGTAC CTCGATGAAGAGCCCGGTCCCAGCAAGAGCGACGAGGTTCGGTTGTTTTCGAC ACTCATCGATGGACACTCCGAGGTGGATGAGAAGACCGGCCGCCGCAAGCCCA AGTTCCGCATTGAGCTGCCCGGTAACCCCATCCTCGGTGACGGGAAGTCGGAT AACCAGAACCACGCCATTGTCTTCTACCGCGGCGAGTACATCCAGGTCATCGAC GCTAACCAGGACAATTACCTGGAAGAGTGTCTCAAGATCCGTAACGTCCTGGGC GAGTTTGAGGAATACTCCGTGTCGAGCCAGAGCCCGTACGCACAGTGGGGCCA CAAGGAGTTCAACAAGTGCCCCGTCGCTATCCTGGGTTCTCGCGAGTACATCTT CTCGGAGAACATCGGTATCCTCGGTGACATCGCCGCCGGCAAGGAACAGACGT TCGGTACCATTACGGCGCGTGCGCTTGCGTGGATCGGCGGCAAGCTGCATTAC GGTCACCCGGATTTCCTCAATGCGACGTTCATGACGACGCGTGGTGGCGTGTC AAAAGCGCAGAAGGGCTTGCATCTCAACGAGGATATCTTCGCTGGTATGACCGC CGTGTCCCGCGGAGGGCGCATCAAGCACATGGAGTACTACCAGTGCGGCAAAG GTCGTGATCTCGGTTTCGGCACGATCTTGAACTTCCAGACGAAGATCGGTACTG GTATGGGCGAGCAGCTCCTCTCGCGCGAGTACTACTACCTGGGCACGCAATTG CCTATCGACCGGTTCTTGACGTTCTACTACGCGCACGCTGGTTTCCACGTCAAC AACATCCTGGTCATCTACTCCATCCAGGTCTTCATGGTCACCTTGCTGTACCTG GGCACATTGAACAAGCAGCTGTTCATCTGCAAGGTCAACTCCAATGGCCAGGTT CTTAGTGGACAAGCTGGGTGCTACAACCTCATCCCGGTCTTCGAGTGGATTCGC CGGAGTATCATCTCCATCTTCTTGGTGTTCTTCATCGCCTTCTTGCCTCTATTCTT GCAAGAGCTGTGCGAGCGCGGAACGGGAAAGGCGTTGCTGCGTCTCGGGAAG CACTTCTTGTCACTGTCGCCCATTTTCGAAGTGTTCTCCACCCAGATTTACTCGC AGGCGCTCTTGAACAACATGAGCTTCGGTGGTGCGCGCTACATCGCCACAGGT CGTGGTTTCGCGACTAGTCGCATACCCTTCAACATCCTCTACTCGCGTTTCGCG CCGCCAAGCATCTACATGGGCATGCGTAACCTGCTGCTCCTGCTGTACGCGAC GATGGCCATTTGGATCCCGCACCTGATCTACTTCTGGTTCTCCGTCCTCTCCCT CTGCATCGCGCCATTCATGTTCAATCCGCATCAATTCTCGTACGCCGACTTCATC ATCGACTACCGGGAGTTCTTGCGCTGGATGTCGCGCGGTAACTCGCGAACGAA GGCGAGCAGCTGGTACGGATACTGCCGTCTGTCGCGTACCGCGATTACTGGGT ACAAGAAGAAGAAGCTGGGACACCCGTCGGAGAAGCTGTCGGGCGACGTACC GCGTGCGCCGTGGAGGAACGTTATCTTCTCGGAGATCCTGTGGCCCATCGGCG CGTGCATCATCTTCATCGTCGCGTACATGTTCGTCAAGTCGTTCCCCGACGAGC AGGGCAACGCGCCGCCGAGCCCGCTGGTCCGGATTCTGCTCATCGCGGTTGG CCCTACTGTGTGGAACGCGGCGGTGCTCATAACGCTGTTCTTCCTGTCGCTCTT CCTGGGCCCGATGATGGATGGCTGGGTCAAGTTCGGCTCGGTCATGGCGGCC CTTGCGCATGGCCTGGCGCTTATAGGCATGCTCACGTTCTTTGAGTTCTTCTGG TTCCTTGAGCTCTGGGATGCCTCGCACGCCGTGCTCGGCGTCATCGCTATCATT GCCGTTCAGCGCGGGATCCAGAAGATCCTCATTGCCGTCTTCCTGACGCGTGA GTACAAGCACGACGAGACGAACCGCGCGTGGTGGACAGGTAAATGGTATGGAC GCGGGCTGGGTACCTCGGCCATGTCCCAGCCGGCGCGCGAGTTCATCGTGAA GATCGTGGAGATGTCGTTGTGGACGTCGGACTTCCTGCTTGCGCACCTGTTGCT CATCATCTTGACGGTGCCGCTACTGCTGCCGTTCTTCAACTCAATTCATTCGAC GATGCTTTTCTGGTTGCGCCCTTCGAAGCAGATTAGGCAACCTCTGTTCTCCAC CAAGCAGAAGCGGCAACGGCGATGGATTGTCATGAAGTATACCGTGGTATATCT CGTGGTGGTGGCTTTCCTCGTCGCGCTCATCGCTCTGCCCGCCCTCTTCCGCG AGAGCATCCACTTCAACTGCGAGATCTGCCAGAGTATATAG polypeptide sequence 1,3-13-D-glucan synthase I of S. commune strain Lu15634 amino acid S. commune SEQ ID NO: 14 MSGPGYGRNPFDNPPPNRGPYGQQPGFPGPGPRPYDSDADMSQTYGSTTRLAG SAGYSDRNGSFDGDRSYAPSIDSRASVPSISPFADPGIGSNEPYPAWSVERQIPMS TEEIEDIFLDLTQKFGFQRDSMRNTFDFMMHLLDSRASRMTPNQALLTLHADYIGGQ HANYRKWYFAAQLNLDDAVGQTNNPGIQRLKTIKGATKTKSLDSALNRWRNAMNN MSQYDRLRQIALYLLCWGEAGNIRLAPECLCFIFKCADDYYRSPECQNRMDPVPEG LYLQTVIKPLYRFLRDQAYEVVNDGKQVKREKDHDQIIGYDDVNQLFWYPEGLAKIVM SDNTRLVDVPPAQRFMKFAKIEWNRVFFKTYFEKRSTAHLLVNFNRIWILHVSMYFF YTAFNSPRVYAPHGKLDPSPEMTWSATALGGAVSTMIMILATIAEYTYIPTTWNNAS HLTTRLIFLLVILALTAGPTFYIAMIDGRTDIGQVPLIVAIVQFFISVVATLAFATIPSGRM FGDRVAGKSRKHMASQTFTASYPSMKRSSRVASIMLWLLVFGCKYVESYFFLTSSF SSPIAVMARTKVQGCNDRIFGSQLCTNQVPFALAIMYVMDLVLFFLDTYLWYIIWLVI FSMVRAFKLGISIWTPWSEIFTRMPKRIYAKLLATAEMEVKYKPKVLVSQIWNAVIISM YREHLLSIEHVQRLLYHQVDGPDGRRTLRAPPFFTSQRTAKPGLFFPPGGEAERRIS FFASSLTTALPEPLPIDAMPTFTVLVPHYSEKILLSLREIIREEDQNTRVTLLEYLKQLH PVEWDNFVKDTKILAEESGDVQDEKRARTDDLPFYCIGFKTSSPEYTLRTRIWASLR AQTLYRTVSGMMNYSKAIKLLYRVENPDVVHAFGGNTERLERELERMSRRKFKFVI SMQRYSKFNKEEQENAEFLLRAYPDLQIAYLDEEPGPSKSDEVRLFSTLIDGHSEVD EKTGRRKPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYIQVIDANQDNYLEECLKIR NVLGEFEEYSVSSQSPYAQWGHKEFNKCPVAILGSREYIFSENIGILGDIAAGKEQTF GTITARALAWIGGKLHYGHPDFLNATFMTTRGGVSKAQKGLHLNEDIFAGMTAVSR GGRIKHMEYYQCGKGRDLGFGTILNFQTKIGTGMGEQLLSREYYYLGTQLPIDRFLT FYYAHAGFHVNNILVIYSIQVFMVTLLYLGTLNKQLFICKVNSNGQVLSGQAGCYNLI PVFEWIRRSIISIFLVFFIAFLPLFLQELCERGTGKALLRLGKHFLSLSPIFEVFSTQIYS QALLNNMSFGGARYIATGRGFATSRIPFNILYSRFAPPSIYMGMRNLLLLLYATMAIW IPHLIYFWFSVLSLCIAPFMFNPHQFSYADFIIDYREFLRWMSRGNSRTKASSWYGY CRLSRTAITGYKKKKLGHPSEKLSGDVPRAPWRNVIFSEILWPIGACIIFIVAYMFVKS FPDEQGNAPPSPLVRILLIAVGPTVWNAAVLITLFFLSLFLGPMMDGVVVKFGSVMAA LAHGLALIGMLTFFEFFWFLELWDASHAVLGVIAIIAVQRGIQKILIAVFLTREYKHDET NRAVWVTGKWYGRGLGTSAMSQPAREFIVKIVEMSLWTSDFLLAHLLLIILTVPLLLP FFNSIHSTMLFWLRPSKQIRQPLFSTKQKRQRRWIVMKYTVVYLVVVAFLVALIALPA LFRESIHFNCEICQSI cDNA 1,3-.beta.-D-g I ucan synthase II of S. commune strain Lu15634 DNA S. commune SEQ ID NO: 15 ATGCCGAGGCCGGGCGGCACCAGCGCAGAAGGCGGCTACGCATCATCGCCGT CGATGGAGACGACCCCCAGCGATCCCTTCGGAACCGCGAACGGCGCGCCCCG CCGCTACTACGACAATGATTCTGAGGAGTACGGACCTGGCCGTAGAGACACCT ACGCGTCCGACAGCAGTAATCAGGGCCTCACGGACCCGGGCTACTACGACCAG AATGGCGCCTATGATCCCTATCCGACCGGGGACACCGATTCCGACGGCGACGT CTACGGCCAGCGATATGGACCCTCAGCAGAGTCGCTTGGCACCCACAAGTTCG GCCATTCCGATTCATCCACGCCGACTTTTGTCGACTACAGCGCATCCTCCGGCG GGAGGGATTCGTACCCTGCATGGACTGCCGAACGCAACATCCCGCTGTCCAAG GAGGAGATCGAGGACATCTTCCTCGATTTGACGCAGAAGTTTGGCTTTCAGCGG GATTCCATGCGGAATATGTTCGACTTCACCATGCAGCTGCTTGACAGCCGAGCG TCTCGTATGACCCCCAACCAGGCGCTCCTCACCCTCCACGCCGACTACATTGGT GGCCAGCATGCGAACTACCGGAAGTGGTACTTCGCGGCGCAGCTCGACCTTGA CGACGCCGTGGGACAAACTCAGAATCCGGGTCTCAACCGCCTCAAGTCCACTC GCGGATCGGGCAAGCGACCACGCCATGAAAAGTCGCTGAACACGGCATTGGAG CGCTGGCGGCAAGCCATGAACAACATGTCGCAGTATGACCGCTTACGCCAGAT CGCGCTCTACCTGCTCTGCTGGGGCGAAGCGGCGCAAGTGCGATTCATGCCCG AGTGCTTGTGCTTCATCTTCAAGTGCGCCGACGACTACTATCGTTCGCCGGAGT GCCAGAACAGGATGGAGCCGGTACCGGAGGGTCTCTACCTGAGGACGGTCGT AAAGCCGCTCTACAGATTTGTCCGGGATCAAGGCTATGAGGTGGTGGAGGGAA AATTCGTACGGCGGGAACGGGATCACGACCAAATCATTGGTTACGATGACGTGA ATCAGCTGTTCTGGTACCCGGAGGGAATTGCCCGTATCGTCCTGTCGGACAAG AGTCGTCTAGTCGACCTCCCCCCAGCACAGCGCTTCATGAAGTTCGACCGTATC GAGTGGAATCGCGTCTTCTTCAAGACGTTTTACGAGACTCGATCCTTCACGCAT CTTTTGGTCGACTTCAACCGTATCTGGGTCGTGCACATCGCTCTCTACTTCTTCT ACACTGCATACAACTCCCCCACGATCTACGCCATCAACGGCAACACACCGACGT CTCTGGCTTGGAGCGCGACTGCGCTCGGCGGTGCGGTAGCGACAGGTATCAT GATCCTCGCCACGATCGCCGAGTTCTCGCACATCCCCACGACATGGAACAACA CCTCGCATCTGACTCGCCGCCTCGCCTTCCTCCTCGTCACGCTCGGCCTCACAT GTGGTCCGACGTTCTACGTCGCGATTGCAGAGAGCAACGGGAGCGGCGGCTCT TTGGCCTTGATTCTCGGTATCGTCCAGTTCTTCATCTCCGTCGTGGCAACTGCG CTCTTCACTATCATGCCTTCTGGTCGTATGTTCGGCGACCGTGTCGCAGGCAAG AGTCGCAAGTATCTCGCCAGCCAGACGTTCACGGCCAGCTACCCGTCGTTGCC CAAGCACCAGCGGTTCGCCTCACTCCTGATGTGGTTCCTCATCTTCGGGTGCAA GTTGACGGAGAGTTACTTCTTTCTGACGCTGTCCTTCCGCGACCCTATCCGCGT CATGGTCGGCATGAAGATCCAGAACTGCGAGGACAAGATTTTCGGCAGCGGCC TTTGCAGGAATCACGCAGCATTCACCCTCACGATCATGTACATCATGGACCTCG TCTTGTTCTTCCTCGACACCTTCCTTTGGTATGTCATCTGGAACTCGGTTTTCAG TATCGCACGCTCTTTCGTACTCGGCCTTTCGATCTGGACACCGTGGAGAGACAT CTTCCAGCGTCTGCCGAAGCGGATCTACGCGAAGCTTCTGGCGACTGGCGACA TGGAGGTCAAGTACAAGCCCAAGGTCTTGGTCTCGCAAATCTGGAACGCCATCA TCATCTCCATGTACCGCGAGCACTTGCTCTCTATTGAGCACGTCCAGAAGCTCC

TGTACCACCAAGTGGACACTGGCGAAGCCGGCAAGCGGAGTCTTCGCGCGCCT CCGTTCTTCGTCGCGCAGGGCAGCAGCGGTGGCTCGGGCGAGTTCTTCCCGC CTGGCAGCGAGGCCGAGCGTCGTATCTCTTTCTTCGCGCAGTCGCTTTCTACG GAGATTCCTCAGCCCATCCCGGTCGACGCCATGCCGACGTTCACGGTGCTTAC GCCTCACTACAGCGAGAAGATCCTTCTCTCTCTCCGTGAAATTATCCGCGAGGA GGACCAGAACACTCGCGTTACGTTGCTCGAGTACCTGAAGCAGCTGCATCCGG TCGAGTGGGAGAATTTCGTCAAGGACACTAAAATTTTGGCCGAGGAGTCCGCTA TGTTTAACGGTCCGAGTCCTTTCGGCAACGACGAGAAGGGTCAGTCCAAGATG GACGATCTACCGTTCTACTGCATCGGTTTCAAGAGCGCCGCGCCCGAGTACAC CCTCCGCACCCGTATCTGGGCGTCCCTGCGCGCGCAGACGCTGTACCGCACG GTCTCCGGCATGATGAACTATGCGAAGGCGATCAAGCTGCTCTACCGCGTTGA GAACCCGGAGGTCGTACAACAGTTCGGCGGCAACACGGACAAGCTCGAGCGC GAGTTGGAGCGGATGGCGCGACGGAAGTTCAAGTTCCTCGTGTCCATGCAGCG CTACTCGAAGTTCAACAAGGAGGAGCACGAGAACGCCGAGTTCTTGCTCCGCG CGTACCCGGACTTGCAGATCGCGTACCTCGAGGAAGAGCCCCCTCGCAAGGAG GGCGGCGATCCACGCATCTTCTCTGCCCTCGTCGACGGCCACAGCGACATCAT CCCGGAGACCGGCAAGCGGCGCCCCAAGTTCCGTATCGAGCTGCCCGGTAAC CCCATTCTCGGTGACGGTAAATCCGACAATCAGAACCACGCTATCGTCTTCTAC CGCGGCGAGTACCTCCAGCTTATCGACGCCAACCAGGACAACTACCTCGAGGA GTGCTTGAAGATCCGTAACGTGCTCGCCGAGTTTGAGGAGTACGACGTCTCCA GCCAGAGCCCGTACGCGCAGTGGAGTGTCAAGGAGTTCAAGCGCTCTCCGGTC GCCATCGTCGGTGCACGCGAGTACATCTTCTCAGAGCACATCGGTATCCTCGGT GATCTGGCGGCTGGCAAGGAACAGACGTTCGGTACGCTCACGGCACGCAACAA CGCCTTCCTTGGCGGCAAGCTGCACTACGGTCACCCCGATTTCCTCAACGCCC TCTACATGAACACGCGCGGTGGTGTCTCCAAGGCGCAGAAGGGTCTCCATCTC AACGAGGATATCTACGCCGGTATGAACGCGGTCGGTCGCGGTGGACGCATTAA GCACAGCGAGTACTATCAGTGCGGCAAGGGTCGTGACCTCGGTTTCGGCACCA TCTTGAACTTCCAGACCAAGATCGGTACGGGTATGGGCGAGCAGATCCTCTCG CGCGAGTACTACTATCTCGGAACACAACTGCCCATCGATCGCTTCCTCACGTTC TACTACGCGCACCCGGGTTTCCAGATCAACAACATGCTGGTCATCCTCTCCGTG CAGGTCTTCATCGTTACCATGGTCTTCCTCGGTACCTTGAAGTCTTCGGTCACG ATCTGCAAGTACACGTCCAGCGGTCAGTACATCGGTGGTCAATCCGGTTGCTAC AACCTCGTCCCGGTCTTCCAGTGGATCGAGCGCTGCATCATCAGCATCTTCTTG GTGTTCATGATCGCTTTCATGCCGCTCTTCCTGCAAGAACTCGTCGAGCGCGGT ACCTGGAGTGCCATCTGGCGTCTGCTCAAGCAGTTTATGTCGCTGTCGCCTGTC TTCGAGGTGTTCTCCACCCAGATTCAGACGCACTCCGTGTTGAGCAACTTGACG TTCGGTGGTGCGCGTTACATCGCTACCGGTCGTGGGTTCGCCACCAGTCGTAT CAGCTTCAGCATCTTGTTCTCGCGTTTCGCAGGCCCGAGTATCTACCTCGGCAT GCGCACGCTCATTATGCTGCTCTACGTGACGTTGACGATCTGGACGCCATGGG TCATTTACTTCTGGGTTTCCATTCTCTCGCTCTGCATCGCGCCGTTCTTGTTCAA CCCGCATCAATTCGTATTCTCGGACTTCCTCATCGACTACAGGGAATACCTGCG GTGGATGTCGCGTGGCAACTCGCGCTCGCACAACAACTCCTGGATTGGGTACT GCCGGTTGTCCCGCACGATGATCACTGGGTACAAGAAGAAGAAGCTGGGCCAC CCGTCGGAGAAGCTTTCCGGCGACGTTCCTCGTGCAGGCTGGCGCGCCGTCTT GTTCTCGGAGATCATCTTCCCGGCGTGCATGGCCATCCTCTTCATCATCGCGTA CATGTTCGTCAAGTCGTTCCCTCTCGACGGCAAGCAGCCTCCCTCCGGCCTCG TTCGCATCGCCGTCGTGTCTATCGGCCCCATCGTGTGGAACGCCGCCATCCTG TTGACGCTCTTCCTTGTGTCGTTGTTCCTCGGCCCCATGCTCGACCCGGTCTTC CCCCTCTTCGGTTCCGTTATGGCCTTCATCGCGCATTTCCTTGGCACAATCGGA ATGATTGGGTTCTTCGAGTTCCTGTGGTTCCTCGAGTCCTGGGAGGCGTCGCAT GCCGTGCTGGGTCTCATCGCCGTCATCTCCATCCAGCGCGCCATTCACAAGAT CCTTATCGCCGTTTTCCTCAGTCGCGAGTTCAAGCACGACGAGACGAACAGGG CCTGGTGGACTGGTCGCTGGTATGGCCGTGGCCTCGGCACGCACGCCATGTC GCAGCCGGCGCGTGAGTTCGTCGTCAAGATCATCGAGTTGTCGCTTTGGAGCT CGGATCTCATACTCGGCCACATCCTGCTGTTCATGCTTACTCCGGCCGTCCTCA TCCCGTACTTCGACCGTTTGCACGCCATGATGCTCTTCTGGCTGCGTCCCTCGA AGCAAATCCGCGCGCCTCTGTACTCGATCAAGCAGAAGAGGCAAAGACGCTGG ATTATCATGAAGTACGGTACTGTATACGTTACCGTCATCGCGATCTTCGTCGCG CTCATCGCGCTTCCCCTCGTATTCCGACACACTCTAAAGGTCGAGTGCTCCCTT TGCGACAGCTTGTAA polypeptide sequence 1,3-.beta.-D-glucan synthase II of S. commune strain Lu15634 amino acid S. commune SEQ ID NO: 16 MPRPGGTSAEGGYASSPSMETTPSDPFGTANGAPRRYYDNDSEEYGPGRRDTYA SDSSNQGLTDPGYYDQNGAYDPYPTGDTDSDGDVYGQRYGPSAESLGTHKFGHS DSSTPTFVDYSASSGGRDSYPAWTAERNIPLSKEEIEDIFLDLTQKFGFQRDSMRN MFDFTMQLLDSRASRMTPNQALLTLHADYIGGQHANYRKVVYFAAQLDLDDAVGQT QNPGLNRLKSTRGSGKRPRHEKSLNTALERWRQAMNNMSQYDRLRQIALYLLCW GEAAQVRFMPECLCFIFKCADDYYRSPECQNRMEPVPEGLYLRTVVKPLYRFVRD QGYEWEGKFVRRERDHDQIIGYDDVNQLFWYPEGIARIVLSDKSRLVDLPPAQRF MKFDRIEWNRVFFKTFYETRSFTHLLVDFNRIWVVHIALYFFYTAYNSPTIYAINGNT PTSLAWSATALGGAVATGIMILATIAEFSHIPTTWNNTSHLTRRLAFLLVTLGLTCGPT FYVAIAESNGSGGSLALILGIVQFFISVVATALFTIMPSGRMFGDRVAGKSRKYLASQ TFTASYPSLPKHQRFASLLMWFLIFGCKLTESYFFLTLSFRDPIRVMVGMKIQNCED KIFGSGLCRNHAAFTLTIMYIMDLVLFFLDTFLWYVIWNSVFSIARSFVLGLSIWTPWR DIFQRLPKRIYAKLLATGDMEVKYKPKVLVSQIWNAIIISMYREHLLSIEHVQKLLYHQ VDTGEAGKRSLRAPPFFVAQGSSGGSGEFFPPGSEAERRISFFAQSLSTEIPQPIPV DAMPTFTVLTPNYSEKILLSLREIIREEDQNTRVTLLEYLKQLHPVEWENFVKDTKILA EESAMFNGPSPFGNDEKGQSKMDDLPFYCIGFKSAAPEYTLRTRIWASLRAQTLYR TVSGMMNYAKAIKLLYRVENPEVVQQFGGNTDKLERELERMARRKFKFLVSMQRY SKFNKEEHENAEFLLRAYPDLQIAYLEEEPPRKEGGDPRIFSALVDGHSDIIPETGKR RPKFRIELPGNPILGDGKSDNQNHAIVFYRGEYLQLIDANQDNYLEECLKIRNVLAEF EEYDVSSQSPYAQWSVKEFKRSPVAIVGAREYIFSEHIGILGDLAAGKEQTFGTLTA RNNAFLGGKLHYGHPDFLNALYMNTRGGVSKAQKGLHLNEDIYAGMNAVGRGGRI KHSEYYQCGKGRDLGFGTILNFQTKIGTGMGEQILSREYYYLGTQLPIDRFLTFYYA HPGFQINNMLVILSVQVFIVTMVFLGTLKSSVTICKYTSSGQYIGGQSGCYNLVPVFQ WIERCIISIFLVFMIAFMPLFLQELVERGTWSAIWRLLKQFMSLSPVFEVFSTQIQTHS VLSNLTFGGARYIATGRGFATSRISFSILFSRFAGPSIYLGMRTLIMLLYVTLTIWTPW VIYFWVSILSLCIAPFLFNPHQFVFSDFLIDYREYLRWMSRGNSRSHNNSWIGYCRL SRTMITGYKKKKLGHPSEKLSGDVPRAGWRAVLFSEIIFPACMAILFIIAYMFVKSFPL DGKQPPSGLVRIAVVSIGPIVVVNAAILLTLFLVSLFLGPMLDPVFPLFGSVMAFIAHFL GTIGMIGFFEFLWFLESWEASHAVLGLIAVISIQRAIHKILIAVFLSREFKHDETNRAW WTGRVVYGRGLGTHAMSQPAREFVVKIIELSLWSSDLILGHILLFMLTPAVLIPYFDRL HAMMLFWLRPSKQIRAPLYSIKQKRQRRWIIMKYGTVYVTVIAIFVALIALPLVFRHTL KVECSLCDSL teff promoter DNA S. commune SEQ ID NO: 17 ATCGCCATTGTAAGCCGCAGACGGGCACGCTTCCAACCCCCATCGATGGGCGC TCGATGTCCATCTCATCGGCGACTCATCATTGTATCTCGCGCAGTCCCATCCCT CGCCGCTCGCCTGTAGTTTATGCTATTTATCTTTGCACCAGTCGTTGTATTACTC CCTCGTCGTGTAGAAAGTACCAGATAAAATGCATGTAATCCTAATGAAATTTGCA CGACACGAAGATCCGGCAGGGTTGTGGGCAAGGGGCAGCGGGAACGAATGGA TGGCGGGGTACAGCGAGTACCCGGCAGTGCCACAGTCAGTGTCACACACGTGA CTGATTGTCCATTAGCGTGACCGATAACATCGATCAAAAATTTTATTTCAGAGGA CGATAAATAAGGGCCGACGGTGCGCGTCCGTCTTTCTCTCAACCCTCATCTTCC TCTCGTCTCTCACTCTTCCCCCCTCCACCACTACCAAGTAAGTTCAAACTTCCTC TCATCGCCTTTGCACACATCGCCTACGCCCCATCTCTCTCCATCTGCCTCGCGA ACGGCGCCCCCATCGTCGCTTTCCCGCGCGAGATCTTGTGCGATCTAGTTTACT GACAATCTCACCTAGAAAACATCAAA teff terminator DNA S. commune SEQ ID NO: 18 ATCCAAGTCCGGTGGCAAGGTCACCAAGTCCGCCGAGAAGGCCGCCAAGAAGA AGTAAATGTAGATGTACATATGTATTTTCTCATTCCGTTTCCTTCCTCTTGTTGTT GTTTCACTGGTCCTCTCGTGCTCGCTCGCATCGCATACAGCCATTGTTGTCACC ACTATAACTTCACGCATTCTGTATTTCATGCCAGGCGACGGGGTGTTCCTGCCA GGCCTGTCGCTTGTTGTAACGCTAATGAAAAGTCACGAGTAGTGGACGAACGAC GATGTATTTCTATGTGCTGTAGCGATTATCCATTTCGAGTTCGCCATCGAGCTCT CTTCAAACCTAGGTGCGACGTTGTGAATGCAGTAGCAAGTGCAGAGTATTGCAG ACTCGTCCATTGATGATAACTTCAAGCTACGTCAGAGCCAGATGCTACTGAACC CGGGCC Ura_forw (NotI) primer DNA artificial SEQ ID NO: 19 ATAAGAATGCGGCCGCTCCAGCTCGACCTTGCGCCG Ura_rev (XbaI) primer DNA artificial SEQ ID NO: 20 CTAGTCTAGAGGATCCGACGTGGAGGAGCC

TefP_forw (XbaI) primer DNA artificial SEQ ID NO. 21 CTAGTCTAGAATCGCCATTGTAAGCCGCAG TefP_rev (SpeI) primer DNA artificial SEQ ID NO: 22 CTAGACTAGTTTTGATGTTTTCTAGGTGAG TefT_forw (Sall) primer DNA artificial SEQ ID NO: 23 ACGCGTCGACCAAGTCCGGTGGCAAGGTCA TefT_rev (SalI) primer DNA artificial SEQ ID NO: 24 CCGACGTCGACGGGTTCAGTAGCATCTGGCT TefT_forw (EcoRV) primer DNA artificial SEQ ID NO: 25 CATGGTGATATCCAAGTCCGGTGGCAAGGTCA TefT_rev (ApaI) primer DNA artificial SEQ ID NO: 26 CCGTATGGGCCCGGGTTCAGTAGCATCTGGCT GS1_forw (SpeI) primer DNA artificial SEQ ID NO: 27 CTAGACTAGTCCCGTCCCTCAAGGCCGTTC GS1_rev (SalI) primer DNA artificial SEQ ID NO: 28 AATGGCCGACGTCGACATGGTATATGCAATGCTATG Fusion TefP_GS1_forw (XbaI) primer DNA artificial SEQ ID NO: 29 CTAGTCTAGAATCGCCATTGTAAGCCGCAG Fusion TefP_GS1_rev (SalI) primer DNA artificial SEQ ID NO: 30 AATGGCCGACGTCGACATGGTATATGCAATGCTATG GS2 forw (SpeI) primer DNA artificial SEQ ID NO: 31 CTAGACTAGTCTGTCCAAAGAAGAGATCGA GS2_rev (EcoRV) primer DNA artificial SEQ ID NO: 32 TACATGCGATATCTTTTATGCAGACTCTCCCTG ura gene DNA S. commune SEQ ID NO: 33 TCCAGCTCGACCTTGCGCCGCTTGGAGTAACGTTCAGCGTCTTCGTCGTCCTCG TCGCGCTCGTGTACGATGATGGGCTCAGCCATGGCAGGTATACAAGCTCAGAG TCAATGGGGGACGAGGTCTCAAGCCGTGAAAGTCGTCGTCGAACAACGTCAAG TTCGAGACGGACCAGAGTTGGATTTCGTGATTAGATCTACGCTCGATCACAGAA TGATCAAAGAACAAAGCTTGCCAAAAGGGGATCTCCCATCAACTTCAACTTGCC CCAAACCATCATGACCGCCGCTCATAAGCTCACATACGGTCAGCGCGCTGCAA GGTTCACCAATCCCGCGGCGAAAGCCCTGCTGGAAACCATGGAGCGCAAGAAG AGCAATCTATCCGTCAGCGTCGACGTCGTAAAATCCGCCGATCTGCTCGCTATT GTCGATACCGTCGGGCCCTATATCTGTCTGATAAAGGCATTGCACTGTCGCTTG CGGTCTTGGGATGCTGCTTATACTCTATGAAGACCCATGTGGATGTTGTCGAAG ACTTCGACTCGTCGCTCGTCACCAAGCTTCAGGCTCTGGCCGAGAAGCATGATT TCCTCATCTTTGAGGACAGAAAATTCGCCGACATAGGTCTGTCCGTCGAATCTC TATCGATGTCAACTCTGATGACTTGCACAGGCAACACCGTCGCTCTGCAGTACT CTAGTGGCGTGCACAAAATTGCCAGCTGGTCGCACATCACGAACGCACACCCT GTTCCAGGACCGTCAATCATCAGTGGCCTCGCATCGGTAGGACAACCCCTCGG TCGCGGACTCCTCCTGCTCGCAGAGATGAGCACGAAGGGCTCACTTGCGACAG GCGCGTACACTGAAGCCGCCGTCCAGATGGCAAGGGAGAACCGCGGCTTCGT CATCGGGTTCATCGCCCAACGGCGGATGGATGGTATTGGCGCGCCTCCAGGG GTGAATGTCGAGGACGAGGATTTTCTTGTCTTGACACCAGGTGTCGGACTCGAT GTGAAGGGCGATGGGATGGGGCAGCAATACAGGACGCCGAAGCAAGTGGTAC AGGAAGATGGGTGCGATGTAATCATCGTGGGTCGCGGGATTTATGGCAAGGAC CCATCGAAGGTGGAAGAGATACGGAGGCAGGCAGAGCGTTACCAGGCTGCAG GATGGGCGGCGTACATTGAGAGGGTCAACGCCTTGGTATAGCTAATCTGATCG GTGTTGTCTTGTTAAGCGTCAGGCTCAATGGAACGCTTTGGACGAGCGGAGAGT AACTTGAATTAGCAGTGTATACTTCGGGCAAATCAATCGTGATAAATACAAGAGC ACGCTCACGCACGTCCAATCTCCCTCAAAATCTCCATCTTTCTCGCCTCATTCAC CTTCCTGAACCCAGCCGGCGACATCTCGAACAGACCATGCCCACCCGACAGCG CACGCAGCCTATTCGAGTAGTCCAGCATCCGGCTGAGCGGCGCCACCGCCTGC ACCGCGCGCTTCATCTTCACGCCCGCCGCCTCCCTCGCCGCAGTGCCGCCAGA GGGCGACACCCACTCCGGGGGCACGTACACGCCGTCCGCAGGGTACGGCTCC TCCACGTCGGATCC Ura protein amino acid S. commune SEQ ID NO: 34 MTAAHKLTYGQRAARFTNPAAKALLETMERKKSNLSVSVDVVKSADLLAIVDTVGPY ICLIKTHVDVVEDFDSSLVTKLQALAEKHDFLIFEDRKFADIGNTVALQYSSGVHKIAS WSHITNAHPVPGPSIISGLASVGQPLGRGLLLLAEMSTKGSLATGAYTEAAVQMARE NRGFVIGFIAQRRMDGIGAPPGVNVEDEDFLVLTPGVGLDVKGDGMGQQYRTPKQ WQEDGCDVIIVGRGIYGKDPSKVEEIRRQAERYQAAGWAAYIERVNALV

Sequence CWU 1

1

3416100DNASchizophyllum commune 1cccgtccctc aaggccgttc tttcgctggc gaccgacccg gtgttcgcga gaacctgttg 60tttctgacga tcatcagccc tttcttctcg tcgctcttta gctctcccta gaccgtcttt 120tactctactc ttcgacgcac gccatgtccg gcccaggata tggcaggaat ccattcgaca 180atcccccgcc caacagaggt ccctatggcc agcagccagg tttcccgggg cccggccctc 240ggccttacga ctcggacgcg gacatgagcc agacctatgg cagcacaacc aggctcgccg 300gcagtgccgg ttacagcgac agaaacggtg cgcacgtcgc taccgtactt cctcgatcgt 360cgattcacat accatgcagg cagcttcgac ggcgaccgct cctacgcgcc ctcaattgac 420tcgcgcgcca gcgtgcccag catatcgccc ttcgcagacc cgggtatcgg ctctaatgag 480ccgtatcccg cttggtcggt cgaacgccag attcccatgt ccacggagga gattgaggac 540atcttcctcg acctcaccca aaagtttggc ttccagcgcg actccatgcg gaatacggtg 600cgtgaataag cagcccactc gaccgcggga acagcacaat tgacctgtca cccagttcga 660cttcatgatg cacctcctcg attcccgtgc ctcgcgcatg acgcccaacc aagctctgct 720cacgcttcac gccgactaca ttggtggcca gcatgccaat taccggaagt ggtatttcgc 780cgcacagctc aacctcgatg acgcggtcgg gcaaaccaat aaccccggta tccagcgctt 840gaagaccatc aagggcgcta cgaagaccaa gtcgctcgac agcgcactca accgctggcg 900caacgcgatg aacaacatga gccagtacga tcgcctccgg caaattgcgc tctacctcct 960ctgctggggt gaagcaggca acatccgtct ggcgcccgag tgcttgtgct tcatcttcaa 1020gtgcgcggac gactactaca gaagtcccga gtgtcagaac cggatggacc ccgtgccgga 1080agggctgtac ctgcagacgg tcatcaagcc gctctatcgc ttcctacgtg atcaggcgta 1140cgaagtcgtt gatgggaagc aagtgaagcg cgagaaggac cacgaccaga ttatcggtta 1200tgacgacgtc aaccagttat tctggtatcc ggaaggtttg gctaagatcg tcatgtcgga 1260caacgtgcgt atgatcttat cggttaaaat tcgtccgctc acatctttcc agacacgact 1320tgtagatgta cctccggcgc agcggttcat gaagttcgcc aagatcgagt ggaaccgcgt 1380cttcttcaag acgtactttg agaagcgctc tactgcccat ctcctggtca acttcaaccg 1440tatatggatc ctccacgtct cgatgtactt cttctacacg gcattcaact ctccacgagt 1500ctacgcgccg cacggcaaac tcgacccctc ccctgagatg acctggtccg cgactgccct 1560tggaggcgct gtgtccacca tgatcatgat ccttgccact atcgcggagt acacctacat 1620ccccacgaca tggaacaatg cgtcgcacct caccacgcgg ctcattttcc tcctggtcat 1680cctcgcgctc actgctggcc caacattcta tatcgccatg atagacggac gcacggacat 1740cggccaagta ccactcatcg tggccatagt gcagttcttc atctccgtcg tcgccaccct 1800cgctttcgct accatccctt ctggtcgcat gttcggcgac cgtgtggctg gcaagtcaag 1860aaagcacatg gcatcgcaga cgttcacagc gtcgtacccg tccatgaagc ggtcatctcg 1920cgtagcgagt atcatgctgt ggcttttggt ctttggctgc aaatacgtcg agtcttactt 1980cttcttgacg tcctccttct ccagcccgat cgcggtcatg gcgcgtacga aggtacaggg 2040ctgcaacgac cgtatcttcg gcagccagct gtgcacgaat caggtcccgt tcgcgctggc 2100aatcatgtac gtgatggacc tggtactgtt cttcctggac acgtacctgt ggtacatcat 2160ctggctggtg atcttctcga tggtgcgcgc gttcaagctt ggtatctcga tctggacgcc 2220ctggagcgag atcttcaccc gcatgccgaa gcgtatttac gcaaagctgc tggcgacggc 2280cgagatggag gtcaagtata agcccaaggt atgctgaatt caatctggtc aggtgaattc 2340accctcatat tgtggtacag gtgctcgtct cacaaatctg gaacgcggtc atcatctcca 2400tgtaccggga gcatctcttg tccatcgagc acgtccagcg cttgctttac caccaggttg 2460atggtcccga tggccgccgc accctcaggg caccgccgtt cttcaccagc cagcgaactg 2520cgaagccagg cctgttcttc cctcctggtg gcgaggctga gcgccgcatc tcgttctttg 2580cctcatcgct gacgaccgcg ctcccggagc ctctgccgat cgacgccatg cccaccttca 2640ccgtgctcgt tccccattac tccgagaaga ttctgctcag tctgcgcgag attatccgcg 2700aggaggacca gaacacccgc gttaccttac tggagtacct caagcagctc caccctgtcg 2760aatgggacaa tttcgtcaag gacaccaaga tcttggcgga agagtcggga gacgtccagg 2820acgagaagcg cgcgcgcacg gacgacttgc cgttctattg catcgggttc aagacctcgt 2880caccagagta caccctgcgt acgcgtatct gggcctcact gcgcgcacag acgctgtacc 2940gcacggtctc cggtatgatg aactactcca aggcgattaa gctcctctat cgcgtcgaga 3000acccggatgt cgttcatgcc ttcggtggga acacggaacg tcttgaacgc gagcttgagc 3060gcatgtctcg ccgcaagttc aagttcgtca tctcgatgca gcggtactcc aagttcaaca 3120aggaggagca ggagaacgcc gagttccttc tgcgcgcgta cccggatttg cagatcgcgt 3180acctcgatga agagcccggt cccagcaaga gcgacgaggt tcggttgttt tcgacactca 3240tcgacggaca ctccgaggtg gacgagaaga cgggccgccg caagcccaag ttccgcatcg 3300agctgcccgg taaccccatc ctcggtgacg ggaagtcgga taaccagaac cacgccatcg 3360tcttctaccg cggcgagtac attcaggtca ttgacgctaa ccaggacaat tacctggaag 3420agtgtctcaa gatccgtaat gtcctgggcg agtttgagga atactccgtg tcgagccaga 3480gcccgtacgc gcagtggggc cacaaggagt tcaacaagtg ccccgtcgct atcctgggtt 3540cccgcgagta catcttctcg gagaacatcg gtatcctcgg tgacatcgct gccggcaagg 3600aacagacgtt cggtaccatt acggcgcgtg cgcttgcgtg gatcggcggc aagctgcatt 3660acggtcaccc ggatttcctc aatgcgacgt tcatgacgac gcgtggtggc gtgtcaaaag 3720cgcagaaggg cttgcatctt aacgaggata tcttcgctgg tatgaccgcc gtgtcccgcg 3780gagggcgcat caagcacatg gagtactacc agtgcggcaa aggtcgtgat ctcggattcg 3840gcacgatctt gaacttccag accaagatcg gtactggtat gggcgagcag ctgctctcgc 3900gcgagtacta ctatctgggc acgcaattgc ctatcgaccg gttcttgacg ttctactacg 3960cgcacgctgg tttccatgtc aacaacatcc tggtcatcta ctccatccag gtcttcatgg 4020tcacccgtaa gtgcaggccc tcatgaccgc cgagcaagca gtctaacgga tgtgcagtgc 4080tgtacctggg cacattgaac aagcagctgt tcatctgcaa ggtcaactcc aatggccagg 4140ttcttagtgg acaagctggg tgctacaacc tcatcccggt cttcgagtgg attcgccgga 4200gtatcatctc catcttcttg gtgttcttca tcgccttctt gccgttgttc ttgcaaggta 4260tgttcacttc tcatgtgcca tttgtcaatc gctcactcgt acgacagagc tttgcgaacg 4320cggaacagga aaggcgttgc tgcgtctcgg gaagcacttc ctgtcactgt cgcccatctt 4380cgaagtgttc tccacccaaa tctactcgca ggcgctcttg aacaacatga gtttcggtgg 4440tgcgcgctac atcgctacag gacgcggttt cgcgacgagt cggataccct tcaacatcct 4500ctactcgcgt ttcgcgccgc cgagcatcta catgggcatg cgtaatctgc tgctcttgct 4560gtacgcgacg atggccattt ggatcccaca cctgatctac ttctggttct ccgtcctctc 4620cctctgcatc gcgccattca tgttcaatcc gcatcaattc tcgtacgctg acttcatcat 4680cgactaccgg gagttcttgc gctggatgtc gcgcggtaac tcgcggacga aggcgagtag 4740ctggtacgga tattgccgtc tgtcgcgtac cgcgattact gggtacaaga agaagaaact 4800gggacacccg tcggagaagc tgtcgggcga tgtgccgcgt gcgccgtgga ggaacgtcat 4860cttctcggag atcctttggc ccatcggcgc gtgcatcatc ttcatcgtcg cgtacatgtt 4920cgtcaaatcg ttccctgacg agcagggcaa cgcgccgccg agcccgctgg tccgcattct 4980gctcatcgcg gttggcccta ctgtgtggaa cgcggcggtg ctcatcacgc tgttcttcct 5040gtcgctcttc ctgggcccga tgatggatgg ctgggtcaag ttcggctcag tcatggcggc 5100acttgcgcat ggtctagcgc tcataggcat gctcacgttc ttcgagttct tcgtacgtcc 5160ttcgcgttgt tgtggtcgag tgctttgcta acaccgcctt cagtggttcc tcgagctctg 5220ggatgcctcg cacgccgtgc tcggcgtcat cgccattatt gccgttcagc gcgggatcca 5280gaagatcctc attgccgtct tcctgacgcg tgagtacaag cacgacgaga cgaaccgcgc 5340gtggtggaca ggtaaatggt atggacgcgg gctgggtacc tcggccatgt cccagccggc 5400gcgcgagttc atcgtgaaga tcgtggagat gtcgctgtgg acgtcggact tcctgcttgc 5460gcacctgttg ctcatcatct tgacggtgcc gctactgctg ccgttcttca actcgatcca 5520ttcgacgatg ctttgtgagt gatttgtagt cgttggtcac ggatgattgc tgactcgcgt 5580gcagtctggt tgcgcccttc gaagcagatt aggcaacctc tgttctccac taagcagaag 5640cggcaacggc gatggattgt aagttccttt gattgctctg gctaccgacc ttcgctcacc 5700tgtctcaggt catgaagtat accgtggtat atctcgtggt ggtggctttc ctcgttgcgc 5760tcatcgctct gcgtacgttt tctgtcgcgc tcaccctcta ttttcactaa cgtttcctcc 5820agccgcgctc ttccgcgaga gcatccactt caactgcgag atctgccaga gtatatagtc 5880atataacgac gtctatcgta tcgccggacg agagccccgt cgcctacaca ctgacatgga 5940attgctgtgt atacaatcga tcttctgacc gcgtcggggg cgttgccgtc tttctactat 6000caacttgctt gtgtatcaac atttcttctc tccaagccta cattgacata gagtaatagc 6060ccatgttcat acaacaatcg catagcattg catataccat 610021740PRTSchizophyllum commune 2Met Ser Gly Pro Gly Tyr Gly Arg Asn Pro Phe Asp Asn Pro Pro Pro 1 5 10 15 Asn Arg Gly Pro Tyr Gly Gln Gln Pro Gly Phe Pro Gly Pro Gly Pro 20 25 30 Arg Pro Tyr Asp Ser Asp Ala Asp Met Ser Gln Thr Tyr Gly Ser Thr 35 40 45 Thr Arg Leu Ala Gly Ser Ala Gly Tyr Ser Asp Arg Asn Gly Ser Phe 50 55 60 Asp Gly Asp Arg Ser Tyr Ala Pro Ser Ile Asp Ser Arg Ala Ser Val 65 70 75 80 Pro Ser Ile Ser Pro Phe Ala Asp Pro Gly Ile Gly Ser Asn Glu Pro 85 90 95 Tyr Pro Ala Trp Ser Val Glu Arg Gln Ile Pro Met Ser Thr Glu Glu 100 105 110 Ile Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg 115 120 125 Asp Ser Met Arg Asn Thr Phe Asp Phe Met Met His Leu Leu Asp Ser 130 135 140 Arg Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala 145 150 155 160 Asp Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala 165 170 175 Ala Gln Leu Asn Leu Asp Asp Ala Val Gly Gln Thr Asn Asn Pro Gly 180 185 190 Ile Gln Arg Leu Lys Thr Ile Lys Gly Ala Thr Lys Thr Lys Ser Leu 195 200 205 Asp Ser Ala Leu Asn Arg Trp Arg Asn Ala Met Asn Asn Met Ser Gln 210 215 220 Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp Gly Glu 225 230 235 240 Ala Gly Asn Ile Arg Leu Ala Pro Glu Cys Leu Cys Phe Ile Phe Lys 245 250 255 Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg Met Asp 260 265 270 Pro Val Pro Glu Gly Leu Tyr Leu Gln Thr Val Ile Lys Pro Leu Tyr 275 280 285 Arg Phe Leu Arg Asp Gln Ala Tyr Glu Val Val Asp Gly Lys Gln Val 290 295 300 Lys Arg Glu Lys Asp His Asp Gln Ile Ile Gly Tyr Asp Asp Val Asn 305 310 315 320 Gln Leu Phe Trp Tyr Pro Glu Gly Leu Ala Lys Ile Val Met Ser Asp 325 330 335 Asn Thr Arg Leu Val Asp Val Pro Pro Ala Gln Arg Phe Met Lys Phe 340 345 350 Ala Lys Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Tyr Phe Glu Lys 355 360 365 Arg Ser Thr Ala His Leu Leu Val Asn Phe Asn Arg Ile Trp Ile Leu 370 375 380 His Val Ser Met Tyr Phe Phe Tyr Thr Ala Phe Asn Ser Pro Arg Val 385 390 395 400 Tyr Ala Pro His Gly Lys Leu Asp Pro Ser Pro Glu Met Thr Trp Ser 405 410 415 Ala Thr Ala Leu Gly Gly Ala Val Ser Thr Met Ile Met Ile Leu Ala 420 425 430 Thr Ile Ala Glu Tyr Thr Tyr Ile Pro Thr Thr Trp Asn Asn Ala Ser 435 440 445 His Leu Thr Thr Arg Leu Ile Phe Leu Leu Val Ile Leu Ala Leu Thr 450 455 460 Ala Gly Pro Thr Phe Tyr Ile Ala Met Ile Asp Gly Arg Thr Asp Ile 465 470 475 480 Gly Gln Val Pro Leu Ile Val Ala Ile Val Gln Phe Phe Ile Ser Val 485 490 495 Val Ala Thr Leu Ala Phe Ala Thr Ile Pro Ser Gly Arg Met Phe Gly 500 505 510 Asp Arg Val Ala Gly Lys Ser Arg Lys His Met Ala Ser Gln Thr Phe 515 520 525 Thr Ala Ser Tyr Pro Ser Met Lys Arg Ser Ser Arg Val Ala Ser Ile 530 535 540 Met Leu Trp Leu Leu Val Phe Gly Cys Lys Tyr Val Glu Ser Tyr Phe 545 550 555 560 Phe Leu Thr Ser Ser Phe Ser Ser Pro Ile Ala Val Met Ala Arg Thr 565 570 575 Lys Val Gln Gly Cys Asn Asp Arg Ile Phe Gly Ser Gln Leu Cys Thr 580 585 590 Asn Gln Val Pro Phe Ala Leu Ala Ile Met Tyr Val Met Asp Leu Val 595 600 605 Leu Phe Phe Leu Asp Thr Tyr Leu Trp Tyr Ile Ile Trp Leu Val Ile 610 615 620 Phe Ser Met Val Arg Ala Phe Lys Leu Gly Ile Ser Ile Trp Thr Pro 625 630 635 640 Trp Ser Glu Ile Phe Thr Arg Met Pro Lys Arg Ile Tyr Ala Lys Leu 645 650 655 Leu Ala Thr Ala Glu Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 660 665 670 Ser Gln Ile Trp Asn Ala Val Ile Ile Ser Met Tyr Arg Glu His Leu 675 680 685 Leu Ser Ile Glu His Val Gln Arg Leu Leu Tyr His Gln Val Asp Gly 690 695 700 Pro Asp Gly Arg Arg Thr Leu Arg Ala Pro Pro Phe Phe Thr Ser Gln 705 710 715 720 Arg Thr Ala Lys Pro Gly Leu Phe Phe Pro Pro Gly Gly Glu Ala Glu 725 730 735 Arg Arg Ile Ser Phe Phe Ala Ser Ser Leu Thr Thr Ala Leu Pro Glu 740 745 750 Pro Leu Pro Ile Asp Ala Met Pro Thr Phe Thr Val Leu Val Pro His 755 760 765 Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg Glu Glu 770 775 780 Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln Leu His 785 790 795 800 Pro Val Glu Trp Asp Asn Phe Val Lys Asp Thr Lys Ile Leu Ala Glu 805 810 815 Glu Ser Gly Asp Val Gln Asp Glu Lys Arg Ala Arg Thr Asp Asp Leu 820 825 830 Pro Phe Tyr Cys Ile Gly Phe Lys Thr Ser Ser Pro Glu Tyr Thr Leu 835 840 845 Arg Thr Arg Ile Trp Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr 850 855 860 Val Ser Gly Met Met Asn Tyr Ser Lys Ala Ile Lys Leu Leu Tyr Arg 865 870 875 880 Val Glu Asn Pro Asp Val Val His Ala Phe Gly Gly Asn Thr Glu Arg 885 890 895 Leu Glu Arg Glu Leu Glu Arg Met Ser Arg Arg Lys Phe Lys Phe Val 900 905 910 Ile Ser Met Gln Arg Tyr Ser Lys Phe Asn Lys Glu Glu Gln Glu Asn 915 920 925 Ala Glu Phe Leu Leu Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu 930 935 940 Asp Glu Glu Pro Gly Pro Ser Lys Ser Asp Glu Val Arg Leu Phe Ser 945 950 955 960 Thr Leu Ile Asp Gly His Ser Glu Val Asp Glu Lys Thr Gly Arg Arg 965 970 975 Lys Pro Lys Phe Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp 980 985 990 Gly Lys Ser Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu 995 1000 1005 Tyr Ile Gln Val Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu 1010 1015 1020 Cys Leu Lys Ile Arg Asn Val Leu Gly Glu Phe Glu Glu Tyr Ser 1025 1030 1035 Val Ser Ser Gln Ser Pro Tyr Ala Gln Trp Gly His Lys Glu Phe 1040 1045 1050 Asn Lys Cys Pro Val Ala Ile Leu Gly Ser Arg Glu Tyr Ile Phe 1055 1060 1065 Ser Glu Asn Ile Gly Ile Leu Gly Asp Ile Ala Ala Gly Lys Glu 1070 1075 1080 Gln Thr Phe Gly Thr Ile Thr Ala Arg Ala Leu Ala Trp Ile Gly 1085 1090 1095 Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Thr Phe 1100 1105 1110 Met Thr Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His 1115 1120 1125 Leu Asn Glu Asp Ile Phe Ala Gly Met Thr Ala Val Ser Arg Gly 1130 1135 1140 Gly Arg Ile Lys His Met Glu Tyr Tyr Gln Cys Gly Lys Gly Arg 1145 1150 1155 Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly 1160 1165 1170 Thr Gly Met Gly Glu Gln Leu Leu Ser Arg Glu Tyr Tyr Tyr Leu 1175 1180 1185 Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala 1190 1195 1200 His Ala Gly Phe His Val Asn Asn Ile Leu Val Ile Tyr Ser Ile 1205 1210 1215 Gln Val Phe Met Val Thr Leu Leu Tyr Leu Gly Thr Leu Asn Lys 1220 1225 1230 Gln Leu Phe Ile Cys Lys Val Asn Ser Asn Gly Gln Val Leu Ser 1235 1240 1245 Gly Gln Ala Gly Cys Tyr Asn Leu Ile Pro Val Phe Glu Trp Ile 1250 1255 1260 Arg Arg Ser Ile Ile Ser Ile Phe Leu Val Phe Phe Ile Ala Phe 1265 1270 1275 Leu Pro Leu Phe Leu Gln Glu Leu Cys Glu Arg Gly Thr Gly Lys 1280 1285 1290 Ala Leu Leu Arg Leu Gly Lys His Phe Leu Ser Leu Ser Pro Ile 1295 1300 1305 Phe Glu Val Phe Ser Thr Gln Ile Tyr Ser Gln Ala Leu Leu Asn 1310 1315 1320 Asn Met Ser Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly 1325 1330 1335 Phe Ala Thr Ser Arg Ile Pro Phe Asn Ile

Leu Tyr Ser Arg Phe 1340 1345 1350 Ala Pro Pro Ser Ile Tyr Met Gly Met Arg Asn Leu Leu Leu Leu 1355 1360 1365 Leu Tyr Ala Thr Met Ala Ile Trp Ile Pro His Leu Ile Tyr Phe 1370 1375 1380 Trp Phe Ser Val Leu Ser Leu Cys Ile Ala Pro Phe Met Phe Asn 1385 1390 1395 Pro His Gln Phe Ser Tyr Ala Asp Phe Ile Ile Asp Tyr Arg Glu 1400 1405 1410 Phe Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Thr Lys Ala Ser 1415 1420 1425 Ser Trp Tyr Gly Tyr Cys Arg Leu Ser Arg Thr Ala Ile Thr Gly 1430 1435 1440 Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly 1445 1450 1455 Asp Val Pro Arg Ala Pro Trp Arg Asn Val Ile Phe Ser Glu Ile 1460 1465 1470 Leu Trp Pro Ile Gly Ala Cys Ile Ile Phe Ile Val Ala Tyr Met 1475 1480 1485 Phe Val Lys Ser Phe Pro Asp Glu Gln Gly Asn Ala Pro Pro Ser 1490 1495 1500 Pro Leu Val Arg Ile Leu Leu Ile Ala Val Gly Pro Thr Val Trp 1505 1510 1515 Asn Ala Ala Val Leu Ile Thr Leu Phe Phe Leu Ser Leu Phe Leu 1520 1525 1530 Gly Pro Met Met Asp Gly Trp Val Lys Phe Gly Ser Val Met Ala 1535 1540 1545 Ala Leu Ala His Gly Leu Ala Leu Ile Gly Met Leu Thr Phe Phe 1550 1555 1560 Glu Phe Phe Trp Phe Leu Glu Leu Trp Asp Ala Ser His Ala Val 1565 1570 1575 Leu Gly Val Ile Ala Ile Ile Ala Val Gln Arg Gly Ile Gln Lys 1580 1585 1590 Ile Leu Ile Ala Val Phe Leu Thr Arg Glu Tyr Lys His Asp Glu 1595 1600 1605 Thr Asn Arg Ala Trp Trp Thr Gly Lys Trp Tyr Gly Arg Gly Leu 1610 1615 1620 Gly Thr Ser Ala Met Ser Gln Pro Ala Arg Glu Phe Ile Val Lys 1625 1630 1635 Ile Val Glu Met Ser Leu Trp Thr Ser Asp Phe Leu Leu Ala His 1640 1645 1650 Leu Leu Leu Ile Ile Leu Thr Val Pro Leu Leu Leu Pro Phe Phe 1655 1660 1665 Asn Ser Ile His Ser Thr Met Leu Phe Trp Leu Arg Pro Ser Lys 1670 1675 1680 Gln Ile Arg Gln Pro Leu Phe Ser Thr Lys Gln Lys Arg Gln Arg 1685 1690 1695 Arg Trp Ile Val Met Lys Tyr Thr Val Val Tyr Leu Val Val Val 1700 1705 1710 Ala Phe Leu Val Ala Leu Ile Ala Leu Pro Ala Leu Phe Arg Glu 1715 1720 1725 Ser Ile His Phe Asn Cys Glu Ile Cys Gln Ser Ile 1730 1735 1740 3 5770DNASchizophyllum commune 3ctgtccaaag aagagatcga ggacatcttc ctcgatctga cgcagaagtt tggctttcag 60cgggattcca tgcggaacat ggtacgtggc gtatgcccat gtgcggcgtt ctgaggccta 120aacgttttcc gccagttcga cttcaccatg cagctgcttg acagccgagc gtctcgtatg 180acccccaacc aggcgctcct caccctccac gccgactaca ttggtggcca gcatgcgaac 240taccggaagt ggtacttcgc ggcgcagctc gaccttgacg acgccgtggg acaaactcag 300aatccgggtc tcaaccgcct caagtccact cgcggatcgg gcaagcgacc acgccatgaa 360aagtcgctga acacggcatt ggagcgctgg cggcaagcca tgaacaacat gtcgcagtat 420gaccgcttac gccagatcgc gctctacctg ctctgctggg gcgaagcggc gcaagtgcga 480ttcatgcccg agtgcttgtg cttcatcttc aagtgcgccg acgactatta tcgttcgccg 540gagtgccaga acaggatgga gccggtaccg gagggtctct acctgaggac ggtcgtaaag 600ccgctctaca gatttgtccg ggatcaaggc tatgaggtgg tggagggaaa attcgtacgg 660cgggaacggg atcacgacca aatcattggt tacgatgacg tgaatcagct gttctggtac 720ccggagggca ttgcccgtat cgtcctgtcg gacaaggtaa gcacctctgt gcatcttctg 780tgacatacag ggctaattgt cgagcagagt cgtctggtcg acctccctcc agcacagcgc 840ttcatgaagt tcgaccgtat cgagtggaat cgcgtcttct tcaagacgtt ctacgagact 900cgatccttta cgcatctttt ggtcgacttc aaccgtatct gggtcgtgca catcgctctc 960tacttcttct acaccgcata caactccccc acgatctacg ccatcaacgg caacactccg 1020acgtctctgg cttggagcgc gactgcgctc ggcggtgcgg tagcgacagg tatcatgatc 1080ctcgccacga tcgccgagtt ctcgcacatc cccacgacat ggaacaacac ctcgcatctg 1140actcgccgcc tcgccttcct cctcgtcacg ctcggcctca catgtggtcc gacgttctac 1200gtcgcgattg cagagagcaa cgggagcggc ggctctttgg ccttgattct cggcatcgtc 1260cagttcttca tctccgtcgt agcgactgcg ctcttcacta tcatgccttc tggtcgtatg 1320ttcggcgacc gcgtcgcagg caagagtcgc aagtatctcg ccagccagac gttcacggcc 1380agctacccgt cgttgcccaa gcaccagcgg ttcgcatcac tcctgatgtg gttcctcatc 1440ttcgggtgca agttgacgga gagttacttc ttcctgacgt tgtccttccg cgaccctatt 1500cgcgtcatgg tcggcatgaa gatccagaac tgcgaggaca agattttcgg cagcggcctt 1560tgcaggaatc acgcagcatt caccctcacg atcatgtaca tcatggacct cgtcttgttc 1620ttcctcgaca ccttcctttg gtatgtcatc tggaactcgg ttttcagtat cgcacgctct 1680ttcgtactcg gcctttcgat ctggacacca tggagggaca tcttccagcg tctgccgaag 1740cgtatctacg cgaagcttct agcgaccggc gacatggagg tcaagtacaa gcccaaggtg 1800tgtgaatagc tcgctgtaag gttcttgatt ctgactcatt cgcaggtctt ggtttcgcaa 1860atctggaacg ccatcatcat ctccatgtac cgcgagcact tgctctctat cgagcacgtt 1920caaaagctcc tgtaccatca agtggacact ggcgaagccg gcaagcggag tcttcgcgcg 1980cctccgttct tcgtcgcgca gggcagcagc ggtggctcgg gcgagttctt cccgcctggt 2040agcgaggctg agcgtcgtat ctctttcttc gcgcagtctc tatctacgga gattcctcag 2100cccatcccgg ttgacgccat gccgacgttc acagtgctta cgcctcacta cagcgagaag 2160gtgcgctttt tcctgggcgc attcaacatt agctgactgt cgtgcacaga tccttctttc 2220gctccgtgag attatccgcg aggaggacca gaacacccgc gtgacattgc ttgagtatct 2280caagcagctt cacccggtcg agtgggagaa cttcgtcaag gacaccaaga ttttggccga 2340ggagtccgct atgttcaacg gtccaagtcc tttcggcaac gatgagaagg gtcagtccaa 2400gatggacgat cttcctttct actgcatcgg tttcaagagc gccgcgcccg agtacaccct 2460ccgcacccgt atctgggcgt ccttgcgcgc gcagaccctc taccgcacgg tctccggcat 2520gatgaactat gcgaaggcga ttaagctgct ctaccgcgtc gagaaccccg aggtcgtgca 2580gcagttcggc ggtaacacgg acaagctcga gcgcgagttg gagcggatgg cccggcggaa 2640gttcaagttc ctggtgtcca tgcagcgcta ctcgaagttc aacaaggagg agcacgagaa 2700cgccgagttc ttgctccgcg cgtacccgga cctgcagatc gcgtacctgg aggaagagcc 2760tcctcgcaag gagggtggcg atccacgcat cttctctgcc ctcgtcgacg gccacagcga 2820catcatcccg gagaccggca agcggcgccc caagttccgc atcgagctgc ccggcaaccc 2880cattctcggt gacggcaagt cggacaacca gaaccacgcc atcgtcttct accgcggcga 2940gtacctccag cttatcgacg ccaaccagga caactacctc gaggagtgct tgaagatccg 3000taacgtactc gccgagttcg aggagtacga cgtctctagc cagagtccgt acgcgcagtg 3060gagtgtcaag gagttcaagc gctccccggt cgccatcgtc ggtgcacgcg agtatatctt 3120ctcggagcac atcggtattc tcggtgattt ggcggctggc aaggaacaga cgttcggtac 3180gctcacggca cgcaacaacg ccttccttgg cggcaagctg cactacggtc acccggattt 3240cctcaacgcc ctctacatga acacgcgcgg tggtgtctcc aaggcgcaga agggtctcca 3300tctcaacgag gatatttacg ccggtatgaa cgcggtcggt cgcggtggac gcatcaagca 3360tagcgaatac taccagtgcg gcaagggtcg tgacctcggt tttggcacca tcttgaactt 3420ccagaccaag atcggtacgg gtatgggcga gcagatcctc tcgcgcgagt actactacct 3480cggaacccaa ttgcccatcg atcgcttcct cacgttctac tacgcgcacc caggtttcca 3540gatcaacaac atgctggtta tcctatccgt gcaggtcttc atcgttacca gtacgttgat 3600tgcatatcgt tagcctgaca gcgtctgacg aattcccagt ggtcttcctc ggtaccttga 3660agtcttcggt cacgatctgc aagtacacgt ccagcggtca gtacatcggt ggtcaatccg 3720gttgctacaa cctcgtcccg gtcttccagt ggatcgagcg ctgcatcatc agcatcttct 3780tggtgttcat gatcgctttc atgccgctct tcctgcaagg taagagctcg tcaacctgct 3840caagggcctt gcgctgatca tcatctcaga actcgtcgag cgcggtacct ggagtgccat 3900ctggcgtctg ctcaagcagt ttatgtcgct gtcgcctgtc ttcgaggtgt tctccaccca 3960gattcagaca cactccgtgt tgagcaactt gacgttcggt ggtgcgcgtt acatcgctac 4020cggtcgtggg ttcgccacca gtcgtatcag cttcagcatc ttgttctcgc gtttcgcagg 4080cccgagtatc tacctcggca tgcgcacgct cattatgctg ctctacgtga cgttgacgat 4140ctggacgcca tgggtcattt acttctgggt ttccattctc tcgctctgca tcgcgccgtt 4200cttgttcaat ccgcatcaat tcgtcttctc ggatttcctc atcgactaca ggtacgtcgg 4260acgagcgctg ttccgcgacg taagctgacc ggttatacag ggaatacctc cggtggatgt 4320cgcgtggtaa ctcgcgctcg cacaacaact cctggattgg gtactgccgg ttgtcccgca 4380cgatgatcac tgggtacaag aagaagaagc tgggccaccc gtcggagaag ctttccggcg 4440acgttcctcg tgcaggctgg cgcgccgtct tattctcgga gatcatcttc ccggcatgca 4500tggccatcct cttcatcatc gcgtacatgt tcgtcaagtc gttccctctc gacggcaagc 4560agcctccctc cggcctcgtt cgcatcgccg tcgtgtctat cggccccatc gtgtggaacg 4620ccgccatcct gttgacgctc ttccttgtgt cgttgttcct cggccccatg ctcgacccgg 4680tcttccccct cttcggttcc gttatggcct tcatcgcgca tttcctcggc acaatcggaa 4740tgattgggtt cttcgagttc ctggtatgtg cccatacctt tcattcgtct tcaactatct 4800aacagattca tagtggttcc tcgagtcctg ggaggcgtcg catgccgtgc tgggtctcat 4860cgccgtcatc tccatccagc gcgccattca caaaattctt atcgccgttt tcctcagtcg 4920cgagttcaag cacgacgaga cgaacagggc ttggtggact ggtcgctggt atggccgtgg 4980cctcggcacg cacgccatgt cgcagccggc gcgtgagttc gtcgtcaaga tcatcgagtt 5040gtcgctctgg agctcggatc tcatactcgg ccacatcctg ctgttcatgc ttactccggc 5100tgtcctcatc ccgtacttcg accgtctgca cgccatgatg ctctgtacgt cgtgtctcat 5160tgtttgtgtt ggtcatactc ttaccctctc ttagtctggc tgcgcccctc aaagcaaatc 5220cgcgcgcctc tgtactcaat caagcagaag aggcaaagac gctggattgt cagtgttcag 5280tgccttattc tatcagctct tactgacgtc ttcatagatc atgaagtacg gtactgtata 5340cgttaccgtc atcgcgatct tcgtcgcgct catcgcgctt cgtgagtacc cttgctatct 5400ttcgtacctg agcgtcgctg acccctttcc cagccctcgt cttccgacac actctaaagg 5460tcgagtgctc cctttgcgac agcttgtaat atcggactcg tatatatcta gacttctccg 5520caccatgtgt agctgacgct tgggtatact tcgcggtgcc gagctaattg tcgacggaca 5580ttctccatcg ttgagtgcag cgacatcggg tggtttacga cacggacact tttcattgta 5640ccctctacga atgcaagaac tctcttacga ccagtaccta tgtgctaagc cgtcgcctgt 5700tcaggatcat acatacatac gtttctagat accttacagt taggcctatt cagggagagt 5760ctgcataaaa 577041622PRTSchizophyllum commune 4Met Arg Asn Met Phe Asp Phe Thr Met Gln Leu Leu Asp Ser Arg Ala 1 5 10 15 Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala Asp Tyr 20 25 30 Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala Ala Gln 35 40 45 Leu Asp Leu Asp Asp Ala Val Gly Gln Thr Gln Asn Pro Gly Leu Asn 50 55 60 Arg Leu Lys Ser Thr Arg Gly Ser Gly Lys Arg Pro Arg His Glu Lys 65 70 75 80 Ser Leu Asn Thr Ala Leu Glu Arg Trp Arg Gln Ala Met Asn Asn Met 85 90 95 Ser Gln Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp 100 105 110 Gly Glu Ala Ala Gln Val Arg Phe Met Pro Glu Cys Leu Cys Phe Ile 115 120 125 Phe Lys Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg 130 135 140 Met Glu Pro Val Pro Glu Gly Leu Tyr Leu Arg Thr Val Val Lys Pro 145 150 155 160 Leu Tyr Arg Phe Val Arg Asp Gln Gly Tyr Glu Val Val Glu Gly Lys 165 170 175 Phe Val Arg Arg Glu Arg Asp His Asp Gln Ile Ile Gly Tyr Asp Asp 180 185 190 Val Asn Gln Leu Phe Trp Tyr Pro Glu Gly Ile Ala Arg Ile Val Leu 195 200 205 Ser Asp Lys Ser Arg Leu Val Asp Leu Pro Pro Ala Gln Arg Phe Met 210 215 220 Lys Phe Asp Arg Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Phe Tyr 225 230 235 240 Glu Thr Arg Ser Phe Thr His Leu Leu Val Asp Phe Asn Arg Ile Trp 245 250 255 Val Val His Ile Ala Leu Tyr Phe Phe Tyr Thr Ala Tyr Asn Ser Pro 260 265 270 Thr Ile Tyr Ala Ile Asn Gly Asn Thr Pro Thr Ser Leu Ala Trp Ser 275 280 285 Ala Thr Ala Leu Gly Gly Ala Val Ala Thr Gly Ile Met Ile Leu Ala 290 295 300 Thr Ile Ala Glu Phe Ser His Ile Pro Thr Thr Trp Asn Asn Thr Ser 305 310 315 320 His Leu Thr Arg Arg Leu Ala Phe Leu Leu Val Thr Leu Gly Leu Thr 325 330 335 Cys Gly Pro Thr Phe Tyr Val Ala Ile Ala Glu Ser Asn Gly Ser Gly 340 345 350 Gly Ser Leu Ala Leu Ile Leu Gly Ile Val Gln Phe Phe Ile Ser Val 355 360 365 Val Ala Thr Ala Leu Phe Thr Ile Met Pro Ser Gly Arg Met Phe Gly 370 375 380 Asp Arg Val Ala Gly Lys Ser Arg Lys Tyr Leu Ala Ser Gln Thr Phe 385 390 395 400 Thr Ala Ser Tyr Pro Ser Leu Pro Lys His Gln Arg Phe Ala Ser Leu 405 410 415 Leu Met Trp Phe Leu Ile Phe Gly Cys Lys Leu Thr Glu Ser Tyr Phe 420 425 430 Phe Leu Thr Leu Ser Phe Arg Asp Pro Ile Arg Val Met Val Gly Met 435 440 445 Lys Ile Gln Asn Cys Glu Asp Lys Ile Phe Gly Ser Gly Leu Cys Arg 450 455 460 Asn His Ala Ala Phe Thr Leu Thr Ile Met Tyr Ile Met Asp Leu Val 465 470 475 480 Leu Phe Phe Leu Asp Thr Phe Leu Trp Tyr Val Ile Trp Asn Ser Val 485 490 495 Phe Ser Ile Ala Arg Ser Phe Val Leu Gly Leu Ser Ile Trp Thr Pro 500 505 510 Trp Arg Asp Ile Phe Gln Arg Leu Pro Lys Arg Ile Tyr Ala Lys Leu 515 520 525 Leu Ala Thr Gly Asp Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 530 535 540 Ser Gln Ile Trp Asn Ala Ile Ile Ile Ser Met Tyr Arg Glu His Leu 545 550 555 560 Leu Ser Ile Glu His Val Gln Lys Leu Leu Tyr His Gln Val Asp Thr 565 570 575 Gly Glu Ala Gly Lys Arg Ser Leu Arg Ala Pro Pro Phe Phe Val Ala 580 585 590 Gln Gly Ser Ser Gly Gly Ser Gly Glu Phe Phe Pro Pro Gly Ser Glu 595 600 605 Ala Glu Arg Arg Ile Ser Phe Phe Ala Gln Ser Leu Ser Thr Glu Ile 610 615 620 Pro Gln Pro Ile Pro Val Asp Ala Met Pro Thr Phe Thr Val Leu Thr 625 630 635 640 Pro His Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg 645 650 655 Glu Glu Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln 660 665 670 Leu His Pro Val Glu Trp Glu Asn Phe Val Lys Asp Thr Lys Ile Leu 675 680 685 Ala Glu Glu Ser Ala Met Phe Asn Gly Pro Ser Pro Phe Gly Asn Asp 690 695 700 Glu Lys Gly Gln Ser Lys Met Asp Asp Leu Pro Phe Tyr Cys Ile Gly 705 710 715 720 Phe Lys Ser Ala Ala Pro Glu Tyr Thr Leu Arg Thr Arg Ile Trp Ala 725 730 735 Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr Val Ser Gly Met Met Asn 740 745 750 Tyr Ala Lys Ala Ile Lys Leu Leu Tyr Arg Val Glu Asn Pro Glu Val 755 760 765 Val Gln Gln Phe Gly Gly Asn Thr Asp Lys Leu Glu Arg Glu Leu Glu 770 775 780 Arg Met Ala Arg Arg Lys Phe Lys Phe Leu Val Ser Met Gln Arg Tyr 785 790 795 800 Ser Lys Phe Asn Lys Glu Glu His Glu Asn Ala Glu Phe Leu Leu Arg 805 810 815 Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu Glu Glu Glu Pro Pro Arg 820 825 830 Lys Glu Gly Gly Asp Pro Arg Ile Phe Ser Ala Leu Val Asp Gly His 835 840 845 Ser Asp Ile Ile Pro Glu Thr Gly Lys Arg Arg Pro Lys Phe Arg Ile 850 855 860 Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp Gly Lys Ser Asp Asn Gln 865 870 875 880 Asn His Ala Ile Val Phe Tyr Arg Gly Glu Tyr Leu Gln Leu Ile Asp 885 890 895 Ala Asn Gln Asp Asn Tyr Leu Glu Glu Cys Leu Lys Ile Arg Asn Val 900 905 910 Leu Ala Glu Phe Glu Glu Tyr Asp Val Ser Ser Gln Ser Pro Tyr Ala 915 920 925 Gln Trp Ser Val Lys Glu Phe Lys Arg Ser Pro Val Ala Ile Val Gly 930 935 940 Ala Arg Glu Tyr Ile Phe Ser Glu His Ile Gly Ile Leu Gly Asp Leu 945 950 955 960 Ala Ala Gly Lys Glu Gln Thr Phe Gly Thr Leu Thr Ala Arg Asn Asn 965 970 975 Ala Phe Leu Gly Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn 980

985 990 Ala Leu Tyr Met Asn Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly 995 1000 1005 Leu His Leu Asn Glu Asp Ile Tyr Ala Gly Met Asn Ala Val Gly 1010 1015 1020 Arg Gly Gly Arg Ile Lys His Ser Glu Tyr Tyr Gln Cys Gly Lys 1025 1030 1035 Gly Arg Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys 1040 1045 1050 Ile Gly Thr Gly Met Gly Glu Gln Ile Leu Ser Arg Glu Tyr Tyr 1055 1060 1065 Tyr Leu Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr 1070 1075 1080 Tyr Ala His Pro Gly Phe Gln Ile Asn Asn Met Leu Val Ile Leu 1085 1090 1095 Ser Val Gln Val Phe Ile Val Thr Met Val Phe Leu Gly Thr Leu 1100 1105 1110 Lys Ser Ser Val Thr Ile Cys Lys Tyr Thr Ser Ser Gly Gln Tyr 1115 1120 1125 Ile Gly Gly Gln Ser Gly Cys Tyr Asn Leu Val Pro Val Phe Gln 1130 1135 1140 Trp Ile Glu Arg Cys Ile Ile Ser Ile Phe Leu Val Phe Met Ile 1145 1150 1155 Ala Phe Met Pro Leu Phe Leu Gln Glu Leu Val Glu Arg Gly Thr 1160 1165 1170 Trp Ser Ala Ile Trp Arg Leu Leu Lys Gln Phe Met Ser Leu Ser 1175 1180 1185 Pro Val Phe Glu Val Phe Ser Thr Gln Ile Gln Thr His Ser Val 1190 1195 1200 Leu Ser Asn Leu Thr Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly 1205 1210 1215 Arg Gly Phe Ala Thr Ser Arg Ile Ser Phe Ser Ile Leu Phe Ser 1220 1225 1230 Arg Phe Ala Gly Pro Ser Ile Tyr Leu Gly Met Arg Thr Leu Ile 1235 1240 1245 Met Leu Leu Tyr Val Thr Leu Thr Ile Trp Thr Pro Trp Val Ile 1250 1255 1260 Tyr Phe Trp Val Ser Ile Leu Ser Leu Cys Ile Ala Pro Phe Leu 1265 1270 1275 Phe Asn Pro His Gln Phe Val Phe Ser Asp Phe Leu Ile Asp Tyr 1280 1285 1290 Arg Glu Tyr Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Ser His 1295 1300 1305 Asn Asn Ser Trp Ile Gly Tyr Cys Arg Leu Ser Arg Thr Met Ile 1310 1315 1320 Thr Gly Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu 1325 1330 1335 Ser Gly Asp Val Pro Arg Ala Gly Trp Arg Ala Val Leu Phe Ser 1340 1345 1350 Glu Ile Ile Phe Pro Ala Cys Met Ala Ile Leu Phe Ile Ile Ala 1355 1360 1365 Tyr Met Phe Val Lys Ser Phe Pro Leu Asp Gly Lys Gln Pro Pro 1370 1375 1380 Ser Gly Leu Val Arg Ile Ala Val Val Ser Ile Gly Pro Ile Val 1385 1390 1395 Trp Asn Ala Ala Ile Leu Leu Thr Leu Phe Leu Val Ser Leu Phe 1400 1405 1410 Leu Gly Pro Met Leu Asp Pro Val Phe Pro Leu Phe Gly Ser Val 1415 1420 1425 Met Ala Phe Ile Ala His Phe Leu Gly Thr Ile Gly Met Ile Gly 1430 1435 1440 Phe Phe Glu Phe Leu Trp Phe Leu Glu Ser Trp Glu Ala Ser His 1445 1450 1455 Ala Val Leu Gly Leu Ile Ala Val Ile Ser Ile Gln Arg Ala Ile 1460 1465 1470 His Lys Ile Leu Ile Ala Val Phe Leu Ser Arg Glu Phe Lys His 1475 1480 1485 Asp Glu Thr Asn Arg Ala Trp Trp Thr Gly Arg Trp Tyr Gly Arg 1490 1495 1500 Gly Leu Gly Thr His Ala Met Ser Gln Pro Ala Arg Glu Phe Val 1505 1510 1515 Val Lys Ile Ile Glu Leu Ser Leu Trp Ser Ser Asp Leu Ile Leu 1520 1525 1530 Gly His Ile Leu Leu Phe Met Leu Thr Pro Ala Val Leu Ile Pro 1535 1540 1545 Tyr Phe Asp Arg Leu His Ala Met Met Leu Phe Trp Leu Arg Pro 1550 1555 1560 Ser Lys Gln Ile Arg Ala Pro Leu Tyr Ser Ile Lys Gln Lys Arg 1565 1570 1575 Gln Arg Arg Trp Ile Ile Met Lys Tyr Gly Thr Val Tyr Val Thr 1580 1585 1590 Val Ile Ala Ile Phe Val Ala Leu Ile Ala Leu Pro Leu Val Phe 1595 1600 1605 Arg His Thr Leu Lys Val Glu Cys Ser Leu Cys Asp Ser Leu 1610 1615 1620 5 5223DNASchizophyllum commune 5atgtccggcc caggatatgg caggaatcca ttcgacaatc ccccgcccaa cagaggtccc 60tatggccagc agccaggttt cccggggccc ggccctcggc cttacgactc ggacgcggac 120atgagccaga cctatggcag cacaaccagg ctcgccggca gtgccggtta cagcgacaga 180aacggcagct tcgacggcga ccgctcctac gcgccctcaa ttgactcgcg cgccagcgtg 240cccagcatat cgcccttcgc agacccgggt atcggctcta atgagccgta tcccgcttgg 300tcggtcgaac gccagattcc catgtccacg gaggagattg aggacatctt cctcgacctc 360acccaaaagt ttggcttcca gcgcgactcc atgcggaata cgttcgactt catgatgcac 420ctcctcgatt cccgtgcctc gcgcatgacg cccaaccaag ctctgctcac gcttcacgcc 480gactacattg gtggccagca tgccaattac cggaagtggt atttcgccgc acagctcaac 540ctcgatgacg cggtcgggca aaccaataac cccggtatcc agcgcttgaa gaccatcaag 600ggcgctacga agaccaagtc gctcgacagc gcactcaacc gctggcgcaa cgcgatgaac 660aacatgagcc agtacgatcg cctccggcaa attgcgctct acctcctctg ctggggtgaa 720gcaggcaaca tccgtctggc gcccgagtgc ttgtgcttca tcttcaagtg cgcggacgac 780tactacagaa gtcccgagtg tcagaaccgg atggaccccg tgccggaagg gctgtacctg 840cagacggtca tcaagccgct ctatcgcttc ctacgtgatc aggcgtacga agtcgttgat 900gggaagcaag tgaagcgcga gaaggaccac gaccagatta tcggttatga cgacgtcaac 960cagttattct ggtatccgga aggtttggct aagatcgtca tgtcggacaa cacacgactt 1020gtagatgtac ctccggcgca gcggttcatg aagttcgcca agatcgagtg gaaccgcgtc 1080ttcttcaaga cgtactttga gaagcgctct actgcccatc tcctggtcaa cttcaaccgt 1140atatggatcc tccacgtctc gatgtacttc ttctacacgg cattcaactc tccacgagtc 1200tacgcgccgc acggcaaact cgacccctcc cctgagatga cctggtccgc gactgccctt 1260ggaggcgctg tgtccaccat gatcatgatc cttgccacta tcgcggagta cacctacatc 1320cccacgacat ggaacaatgc gtcgcacctc accacgcggc tcattttcct cctggtcatc 1380ctcgcgctca ctgctggccc aacattctat atcgccatga tagacggacg cacggacatc 1440ggccaagtac cactcatcgt ggccatagtg cagttcttca tctccgtcgt cgccaccctc 1500gctttcgcta ccatcccttc tggtcgcatg ttcggcgacc gtgtggctgg caagtcaaga 1560aagcacatgg catcgcagac gttcacagcg tcgtacccgt ccatgaagcg gtcatctcgc 1620gtagcgagta tcatgctgtg gcttttggtc tttggctgca aatacgtcga gtcttacttc 1680ttcttgacgt cctccttctc cagcccgatc gcggtcatgg cgcgtacgaa ggtacagggc 1740tgcaacgacc gtatcttcgg cagccagctg tgcacgaatc aggtcccgtt cgcgctggca 1800atcatgtacg tgatggacct ggtactgttc ttcctggaca cgtacctgtg gtacatcatc 1860tggctggtga tcttctcgat ggtgcgcgcg ttcaagcttg gtatctcgat ctggacgccc 1920tggagcgaga tcttcacccg catgccgaag cgtatttacg caaagctgct ggcgacggcc 1980gagatggagg tcaagtataa gcccaaggtg ctcgtctcac aaatctggaa cgcggtcatc 2040atctccatgt accgggagca tctcttgtcc atcgagcacg tccagcgctt gctttaccac 2100caggttgatg gtcccgatgg ccgccgcacc ctcagggcac cgccgttctt caccagccag 2160cgaactgcga agccaggcct gttcttccct cctggtggcg aggctgagcg ccgcatctcg 2220ttctttgcct catcgctgac gaccgcgctc ccggagcctc tgccgatcga cgccatgccc 2280accttcaccg tgctcgttcc ccattactcc gagaagattc tgctcagtct gcgcgagatt 2340atccgcgagg aggaccagaa cacccgcgtt accttactgg agtacctcaa gcagctccac 2400cctgtcgaat gggacaattt cgtcaaggac accaagatct tggcggaaga gtcgggagac 2460gtccaggacg agaagcgcgc gcgcacggac gacttgccgt tctattgcat cgggttcaag 2520acctcgtcac cagagtacac cctgcgtacg cgtatctggg cctcactgcg cgcacagacg 2580ctgtaccgca cggtctccgg tatgatgaac tactccaagg cgattaagct cctctatcgc 2640gtcgagaacc cggatgtcgt tcatgccttc ggtgggaaca cggaacgtct tgaacgcgag 2700cttgagcgca tgtctcgccg caagttcaag ttcgtcatct cgatgcagcg gtactccaag 2760ttcaacaagg aggagcagga gaacgccgag ttccttctgc gcgcgtaccc ggatttgcag 2820atcgcgtacc tcgatgaaga gcccggtccc agcaagagcg acgaggttcg gttgttttcg 2880acactcatcg acggacactc cgaggtggac gagaagacgg gccgccgcaa gcccaagttc 2940cgcatcgagc tgcccggtaa ccccatcctc ggtgacggga agtcggataa ccagaaccac 3000gccatcgtct tctaccgcgg cgagtacatt caggtcattg acgctaacca ggacaattac 3060ctggaagagt gtctcaagat ccgtaatgtc ctgggcgagt ttgaggaata ctccgtgtcg 3120agccagagcc cgtacgcgca gtggggccac aaggagttca acaagtgccc cgtcgctatc 3180ctgggttccc gcgagtacat cttctcggag aacatcggta tcctcggtga catcgctgcc 3240ggcaaggaac agacgttcgg taccattacg gcgcgtgcgc ttgcgtggat cggcggcaag 3300ctgcattacg gtcacccgga tttcctcaat gcgacgttca tgacgacgcg tggtggcgtg 3360tcaaaagcgc agaagggctt gcatcttaac gaggatatct tcgctggtat gaccgccgtg 3420tcccgcggag ggcgcatcaa gcacatggag tactaccagt gcggcaaagg tcgtgatctc 3480ggattcggca cgatcttgaa cttccagacc aagatcggta ctggtatggg cgagcagctg 3540ctctcgcgcg agtactacta tctgggcacg caattgccta tcgaccggtt cttgacgttc 3600tactacgcgc acgctggttt ccatgtcaac aacatcctgg tcatctactc catccaggtc 3660ttcatggtca ccctgctgta cctgggcaca ttgaacaagc agctgttcat ctgcaaggtc 3720aactccaatg gccaggttct tagtggacaa gctgggtgct acaacctcat cccggtcttc 3780gagtggattc gccggagtat catctccatc ttcttggtgt tcttcatcgc cttcttgccg 3840ttgttcttgc aagagctttg cgaacgcgga acaggaaagg cgttgctgcg tctcgggaag 3900cacttcctgt cactgtcgcc catcttcgaa gtgttctcca cccaaatcta ctcgcaggcg 3960ctcttgaaca acatgagttt cggtggtgcg cgctacatcg ctacaggacg cggtttcgcg 4020acgagtcgga tacccttcaa catcctctac tcgcgtttcg cgccgccgag catctacatg 4080ggcatgcgta atctgctgct cttgctgtac gcgacgatgg ccatttggat cccacacctg 4140atctacttct ggttctccgt cctctccctc tgcatcgcgc cattcatgtt caatccgcat 4200caattctcgt acgctgactt catcatcgac taccgggagt tcttgcgctg gatgtcgcgc 4260ggtaactcgc ggacgaaggc gagtagctgg tacggatatt gccgtctgtc gcgtaccgcg 4320attactgggt acaagaagaa gaaactggga cacccgtcgg agaagctgtc gggcgatgtg 4380ccgcgtgcgc cgtggaggaa cgtcatcttc tcggagatcc tttggcccat cggcgcgtgc 4440atcatcttca tcgtcgcgta catgttcgtc aaatcgttcc ctgacgagca gggcaacgcg 4500ccgccgagcc cgctggtccg cattctgctc atcgcggttg gccctactgt gtggaacgcg 4560gcggtgctca tcacgctgtt cttcctgtcg ctcttcctgg gcccgatgat ggatggctgg 4620gtcaagttcg gctcagtcat ggcggcactt gcgcatggtc tagcgctcat aggcatgctc 4680acgttcttcg agttcttctg gttcctcgag ctctgggatg cctcgcacgc cgtgctcggc 4740gtcatcgcca ttattgccgt tcagcgcggg atccagaaga tcctcattgc cgtcttcctg 4800acgcgtgagt acaagcacga cgagacgaac cgcgcgtggt ggacaggtaa atggtatgga 4860cgcgggctgg gtacctcggc catgtcccag ccggcgcgcg agttcatcgt gaagatcgtg 4920gagatgtcgc tgtggacgtc ggacttcctg cttgcgcacc tgttgctcat catcttgacg 4980gtgccgctac tgctgccgtt cttcaactcg atccattcga cgatgctttt ctggttgcgc 5040ccttcgaagc agattaggca acctctgttc tccactaagc agaagcggca acggcgatgg 5100attgtcatga agtataccgt ggtatatctc gtggtggtgg ctttcctcgt tgcgctcatc 5160gctctgcccg cgctcttccg cgagagcatc cacttcaact gcgagatctg ccagagtata 5220tag 522361740PRTSchizophyllum commune 6Met Ser Gly Pro Gly Tyr Gly Arg Asn Pro Phe Asp Asn Pro Pro Pro 1 5 10 15 Asn Arg Gly Pro Tyr Gly Gln Gln Pro Gly Phe Pro Gly Pro Gly Pro 20 25 30 Arg Pro Tyr Asp Ser Asp Ala Asp Met Ser Gln Thr Tyr Gly Ser Thr 35 40 45 Thr Arg Leu Ala Gly Ser Ala Gly Tyr Ser Asp Arg Asn Gly Ser Phe 50 55 60 Asp Gly Asp Arg Ser Tyr Ala Pro Ser Ile Asp Ser Arg Ala Ser Val 65 70 75 80 Pro Ser Ile Ser Pro Phe Ala Asp Pro Gly Ile Gly Ser Asn Glu Pro 85 90 95 Tyr Pro Ala Trp Ser Val Glu Arg Gln Ile Pro Met Ser Thr Glu Glu 100 105 110 Ile Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg 115 120 125 Asp Ser Met Arg Asn Thr Phe Asp Phe Met Met His Leu Leu Asp Ser 130 135 140 Arg Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala 145 150 155 160 Asp Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala 165 170 175 Ala Gln Leu Asn Leu Asp Asp Ala Val Gly Gln Thr Asn Asn Pro Gly 180 185 190 Ile Gln Arg Leu Lys Thr Ile Lys Gly Ala Thr Lys Thr Lys Ser Leu 195 200 205 Asp Ser Ala Leu Asn Arg Trp Arg Asn Ala Met Asn Asn Met Ser Gln 210 215 220 Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp Gly Glu 225 230 235 240 Ala Gly Asn Ile Arg Leu Ala Pro Glu Cys Leu Cys Phe Ile Phe Lys 245 250 255 Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg Met Asp 260 265 270 Pro Val Pro Glu Gly Leu Tyr Leu Gln Thr Val Ile Lys Pro Leu Tyr 275 280 285 Arg Phe Leu Arg Asp Gln Ala Tyr Glu Val Val Asp Gly Lys Gln Val 290 295 300 Lys Arg Glu Lys Asp His Asp Gln Ile Ile Gly Tyr Asp Asp Val Asn 305 310 315 320 Gln Leu Phe Trp Tyr Pro Glu Gly Leu Ala Lys Ile Val Met Ser Asp 325 330 335 Asn Thr Arg Leu Val Asp Val Pro Pro Ala Gln Arg Phe Met Lys Phe 340 345 350 Ala Lys Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Tyr Phe Glu Lys 355 360 365 Arg Ser Thr Ala His Leu Leu Val Asn Phe Asn Arg Ile Trp Ile Leu 370 375 380 His Val Ser Met Tyr Phe Phe Tyr Thr Ala Phe Asn Ser Pro Arg Val 385 390 395 400 Tyr Ala Pro His Gly Lys Leu Asp Pro Ser Pro Glu Met Thr Trp Ser 405 410 415 Ala Thr Ala Leu Gly Gly Ala Val Ser Thr Met Ile Met Ile Leu Ala 420 425 430 Thr Ile Ala Glu Tyr Thr Tyr Ile Pro Thr Thr Trp Asn Asn Ala Ser 435 440 445 His Leu Thr Thr Arg Leu Ile Phe Leu Leu Val Ile Leu Ala Leu Thr 450 455 460 Ala Gly Pro Thr Phe Tyr Ile Ala Met Ile Asp Gly Arg Thr Asp Ile 465 470 475 480 Gly Gln Val Pro Leu Ile Val Ala Ile Val Gln Phe Phe Ile Ser Val 485 490 495 Val Ala Thr Leu Ala Phe Ala Thr Ile Pro Ser Gly Arg Met Phe Gly 500 505 510 Asp Arg Val Ala Gly Lys Ser Arg Lys His Met Ala Ser Gln Thr Phe 515 520 525 Thr Ala Ser Tyr Pro Ser Met Lys Arg Ser Ser Arg Val Ala Ser Ile 530 535 540 Met Leu Trp Leu Leu Val Phe Gly Cys Lys Tyr Val Glu Ser Tyr Phe 545 550 555 560 Phe Leu Thr Ser Ser Phe Ser Ser Pro Ile Ala Val Met Ala Arg Thr 565 570 575 Lys Val Gln Gly Cys Asn Asp Arg Ile Phe Gly Ser Gln Leu Cys Thr 580 585 590 Asn Gln Val Pro Phe Ala Leu Ala Ile Met Tyr Val Met Asp Leu Val 595 600 605 Leu Phe Phe Leu Asp Thr Tyr Leu Trp Tyr Ile Ile Trp Leu Val Ile 610 615 620 Phe Ser Met Val Arg Ala Phe Lys Leu Gly Ile Ser Ile Trp Thr Pro 625 630 635 640 Trp Ser Glu Ile Phe Thr Arg Met Pro Lys Arg Ile Tyr Ala Lys Leu 645 650 655 Leu Ala Thr Ala Glu Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 660 665 670 Ser Gln Ile Trp Asn Ala Val Ile Ile Ser Met Tyr Arg Glu His Leu 675 680 685 Leu Ser Ile Glu His Val Gln Arg Leu Leu Tyr His Gln Val Asp Gly 690 695 700 Pro Asp Gly Arg Arg Thr Leu Arg Ala Pro Pro Phe Phe Thr Ser Gln 705 710 715 720 Arg Thr Ala Lys Pro Gly Leu Phe Phe Pro Pro Gly Gly Glu Ala Glu 725 730 735 Arg Arg Ile Ser Phe Phe Ala Ser Ser Leu Thr Thr Ala Leu Pro Glu 740 745 750 Pro Leu Pro Ile Asp Ala Met Pro Thr Phe Thr Val Leu Val Pro His 755 760 765 Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg Glu Glu 770 775 780 Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln Leu His 785 790 795 800 Pro Val Glu Trp Asp Asn Phe Val Lys Asp Thr Lys Ile Leu Ala Glu 805 810 815 Glu Ser Gly Asp Val Gln Asp Glu Lys Arg

Ala Arg Thr Asp Asp Leu 820 825 830 Pro Phe Tyr Cys Ile Gly Phe Lys Thr Ser Ser Pro Glu Tyr Thr Leu 835 840 845 Arg Thr Arg Ile Trp Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr 850 855 860 Val Ser Gly Met Met Asn Tyr Ser Lys Ala Ile Lys Leu Leu Tyr Arg 865 870 875 880 Val Glu Asn Pro Asp Val Val His Ala Phe Gly Gly Asn Thr Glu Arg 885 890 895 Leu Glu Arg Glu Leu Glu Arg Met Ser Arg Arg Lys Phe Lys Phe Val 900 905 910 Ile Ser Met Gln Arg Tyr Ser Lys Phe Asn Lys Glu Glu Gln Glu Asn 915 920 925 Ala Glu Phe Leu Leu Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu 930 935 940 Asp Glu Glu Pro Gly Pro Ser Lys Ser Asp Glu Val Arg Leu Phe Ser 945 950 955 960 Thr Leu Ile Asp Gly His Ser Glu Val Asp Glu Lys Thr Gly Arg Arg 965 970 975 Lys Pro Lys Phe Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp 980 985 990 Gly Lys Ser Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu 995 1000 1005 Tyr Ile Gln Val Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu 1010 1015 1020 Cys Leu Lys Ile Arg Asn Val Leu Gly Glu Phe Glu Glu Tyr Ser 1025 1030 1035 Val Ser Ser Gln Ser Pro Tyr Ala Gln Trp Gly His Lys Glu Phe 1040 1045 1050 Asn Lys Cys Pro Val Ala Ile Leu Gly Ser Arg Glu Tyr Ile Phe 1055 1060 1065 Ser Glu Asn Ile Gly Ile Leu Gly Asp Ile Ala Ala Gly Lys Glu 1070 1075 1080 Gln Thr Phe Gly Thr Ile Thr Ala Arg Ala Leu Ala Trp Ile Gly 1085 1090 1095 Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Thr Phe 1100 1105 1110 Met Thr Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His 1115 1120 1125 Leu Asn Glu Asp Ile Phe Ala Gly Met Thr Ala Val Ser Arg Gly 1130 1135 1140 Gly Arg Ile Lys His Met Glu Tyr Tyr Gln Cys Gly Lys Gly Arg 1145 1150 1155 Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly 1160 1165 1170 Thr Gly Met Gly Glu Gln Leu Leu Ser Arg Glu Tyr Tyr Tyr Leu 1175 1180 1185 Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala 1190 1195 1200 His Ala Gly Phe His Val Asn Asn Ile Leu Val Ile Tyr Ser Ile 1205 1210 1215 Gln Val Phe Met Val Thr Leu Leu Tyr Leu Gly Thr Leu Asn Lys 1220 1225 1230 Gln Leu Phe Ile Cys Lys Val Asn Ser Asn Gly Gln Val Leu Ser 1235 1240 1245 Gly Gln Ala Gly Cys Tyr Asn Leu Ile Pro Val Phe Glu Trp Ile 1250 1255 1260 Arg Arg Ser Ile Ile Ser Ile Phe Leu Val Phe Phe Ile Ala Phe 1265 1270 1275 Leu Pro Leu Phe Leu Gln Glu Leu Cys Glu Arg Gly Thr Gly Lys 1280 1285 1290 Ala Leu Leu Arg Leu Gly Lys His Phe Leu Ser Leu Ser Pro Ile 1295 1300 1305 Phe Glu Val Phe Ser Thr Gln Ile Tyr Ser Gln Ala Leu Leu Asn 1310 1315 1320 Asn Met Ser Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly 1325 1330 1335 Phe Ala Thr Ser Arg Ile Pro Phe Asn Ile Leu Tyr Ser Arg Phe 1340 1345 1350 Ala Pro Pro Ser Ile Tyr Met Gly Met Arg Asn Leu Leu Leu Leu 1355 1360 1365 Leu Tyr Ala Thr Met Ala Ile Trp Ile Pro His Leu Ile Tyr Phe 1370 1375 1380 Trp Phe Ser Val Leu Ser Leu Cys Ile Ala Pro Phe Met Phe Asn 1385 1390 1395 Pro His Gln Phe Ser Tyr Ala Asp Phe Ile Ile Asp Tyr Arg Glu 1400 1405 1410 Phe Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Thr Lys Ala Ser 1415 1420 1425 Ser Trp Tyr Gly Tyr Cys Arg Leu Ser Arg Thr Ala Ile Thr Gly 1430 1435 1440 Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly 1445 1450 1455 Asp Val Pro Arg Ala Pro Trp Arg Asn Val Ile Phe Ser Glu Ile 1460 1465 1470 Leu Trp Pro Ile Gly Ala Cys Ile Ile Phe Ile Val Ala Tyr Met 1475 1480 1485 Phe Val Lys Ser Phe Pro Asp Glu Gln Gly Asn Ala Pro Pro Ser 1490 1495 1500 Pro Leu Val Arg Ile Leu Leu Ile Ala Val Gly Pro Thr Val Trp 1505 1510 1515 Asn Ala Ala Val Leu Ile Thr Leu Phe Phe Leu Ser Leu Phe Leu 1520 1525 1530 Gly Pro Met Met Asp Gly Trp Val Lys Phe Gly Ser Val Met Ala 1535 1540 1545 Ala Leu Ala His Gly Leu Ala Leu Ile Gly Met Leu Thr Phe Phe 1550 1555 1560 Glu Phe Phe Trp Phe Leu Glu Leu Trp Asp Ala Ser His Ala Val 1565 1570 1575 Leu Gly Val Ile Ala Ile Ile Ala Val Gln Arg Gly Ile Gln Lys 1580 1585 1590 Ile Leu Ile Ala Val Phe Leu Thr Arg Glu Tyr Lys His Asp Glu 1595 1600 1605 Thr Asn Arg Ala Trp Trp Thr Gly Lys Trp Tyr Gly Arg Gly Leu 1610 1615 1620 Gly Thr Ser Ala Met Ser Gln Pro Ala Arg Glu Phe Ile Val Lys 1625 1630 1635 Ile Val Glu Met Ser Leu Trp Thr Ser Asp Phe Leu Leu Ala His 1640 1645 1650 Leu Leu Leu Ile Ile Leu Thr Val Pro Leu Leu Leu Pro Phe Phe 1655 1660 1665 Asn Ser Ile His Ser Thr Met Leu Phe Trp Leu Arg Pro Ser Lys 1670 1675 1680 Gln Ile Arg Gln Pro Leu Phe Ser Thr Lys Gln Lys Arg Gln Arg 1685 1690 1695 Arg Trp Ile Val Met Lys Tyr Thr Val Val Tyr Leu Val Val Val 1700 1705 1710 Ala Phe Leu Val Ala Leu Ile Ala Leu Pro Ala Leu Phe Arg Glu 1715 1720 1725 Ser Ile His Phe Asn Cys Glu Ile Cys Gln Ser Ile 1730 1735 1740 74869DNASchizophyllum commune 7atgcggaaca tgttcgactt caccatgcag ctgcttgaca gccgagcgtc tcgtatgacc 60cccaaccagg cgctcctcac cctccacgcc gactacattg gtggccagca tgcgaactac 120cggaagtggt acttcgcggc gcagctcgac cttgacgacg ccgtgggaca aactcagaat 180ccgggtctca accgcctcaa gtccactcgc ggatcgggca agcgaccacg ccatgaaaag 240tcgctgaaca cggcattgga gcgctggcgg caagccatga acaacatgtc gcagtatgac 300cgcttacgcc agatcgcgct ctacctgctc tgctggggcg aagcggcgca agtgcgattc 360atgcccgagt gcttgtgctt catcttcaag tgcgccgacg actattatcg ttcgccggag 420tgccagaaca ggatggagcc ggtaccggag ggtctctacc tgaggacggt cgtaaagccg 480ctctacagat ttgtccggga tcaaggctat gaggtggtgg agggaaaatt cgtacggcgg 540gaacgggatc acgaccaaat cattggttac gatgacgtga atcagctgtt ctggtacccg 600gagggcattg cccgtatcgt cctgtcggac aagagtcgtc tggtcgacct ccctccagca 660cagcgcttca tgaagttcga ccgtatcgag tggaatcgcg tcttcttcaa gacgttctac 720gagactcgat cctttacgca tcttttggtc gacttcaacc gtatctgggt cgtgcacatc 780gctctctact tcttctacac cgcatacaac tcccccacga tctacgccat caacggcaac 840actccgacgt ctctggcttg gagcgcgact gcgctcggcg gtgcggtagc gacaggtatc 900atgatcctcg ccacgatcgc cgagttctcg cacatcccca cgacatggaa caacacctcg 960catctgactc gccgcctcgc cttcctcctc gtcacgctcg gcctcacatg tggtccgacg 1020ttctacgtcg cgattgcaga gagcaacggg agcggcggct ctttggcctt gattctcggc 1080atcgtccagt tcttcatctc cgtcgtagcg actgcgctct tcactatcat gccttctggt 1140cgtatgttcg gcgaccgcgt cgcaggcaag agtcgcaagt atctcgccag ccagacgttc 1200acggccagct acccgtcgtt gcccaagcac cagcggttcg catcactcct gatgtggttc 1260ctcatcttcg ggtgcaagtt gacggagagt tacttcttcc tgacgttgtc cttccgcgac 1320cctattcgcg tcatggtcgg catgaagatc cagaactgcg aggacaagat tttcggcagc 1380ggcctttgca ggaatcacgc agcattcacc ctcacgatca tgtacatcat ggacctcgtc 1440ttgttcttcc tcgacacctt cctttggtat gtcatctgga actcggtttt cagtatcgca 1500cgctctttcg tactcggcct ttcgatctgg acaccatgga gggacatctt ccagcgtctg 1560ccgaagcgta tctacgcgaa gcttctagcg accggcgaca tggaggtcaa gtacaagccc 1620aaggtcttgg tttcgcaaat ctggaacgcc atcatcatct ccatgtaccg cgagcacttg 1680ctctctatcg agcacgttca aaagctcctg taccatcaag tggacactgg cgaagccggc 1740aagcggagtc ttcgcgcgcc tccgttcttc gtcgcgcagg gcagcagcgg tggctcgggc 1800gagttcttcc cgcctggtag cgaggctgag cgtcgtatct ctttcttcgc gcagtctcta 1860tctacggaga ttcctcagcc catcccggtt gacgccatgc cgacgttcac agtgcttacg 1920cctcactaca gcgagaagat ccttctttcg ctccgtgaga ttatccgcga ggaggaccag 1980aacacccgcg tgacattgct tgagtatctc aagcagcttc acccggtcga gtgggagaac 2040ttcgtcaagg acaccaagat tttggccgag gagtccgcta tgttcaacgg tccaagtcct 2100ttcggcaacg atgagaaggg tcagtccaag atggacgatc ttcctttcta ctgcatcggt 2160ttcaagagcg ccgcgcccga gtacaccctc cgcacccgta tctgggcgtc cttgcgcgcg 2220cagaccctct accgcacggt ctccggcatg atgaactatg cgaaggcgat taagctgctc 2280taccgcgtcg agaaccccga ggtcgtgcag cagttcggcg gtaacacgga caagctcgag 2340cgcgagttgg agcggatggc ccggcggaag ttcaagttcc tggtgtccat gcagcgctac 2400tcgaagttca acaaggagga gcacgagaac gccgagttct tgctccgcgc gtacccggac 2460ctgcagatcg cgtacctgga ggaagagcct cctcgcaagg agggtggcga tccacgcatc 2520ttctctgccc tcgtcgacgg ccacagcgac atcatcccgg agaccggcaa gcggcgcccc 2580aagttccgca tcgagctgcc cggcaacccc attctcggtg acggcaagtc ggacaaccag 2640aaccacgcca tcgtcttcta ccgcggcgag tacctccagc ttatcgacgc caaccaggac 2700aactacctcg aggagtgctt gaagatccgt aacgtactcg ccgagttcga ggagtacgac 2760gtctctagcc agagtccgta cgcgcagtgg agtgtcaagg agttcaagcg ctccccggtc 2820gccatcgtcg gtgcacgcga gtatatcttc tcggagcaca tcggtattct cggtgatttg 2880gcggctggca aggaacagac gttcggtacg ctcacggcac gcaacaacgc cttccttggc 2940ggcaagctgc actacggtca cccggatttc ctcaacgccc tctacatgaa cacgcgcggt 3000ggtgtctcca aggcgcagaa gggtctccat ctcaacgagg atatttacgc cggtatgaac 3060gcggtcggtc gcggtggacg catcaagcat agcgaatact accagtgcgg caagggtcgt 3120gacctcggtt ttggcaccat cttgaacttc cagaccaaga tcggtacggg tatgggcgag 3180cagatcctct cgcgcgagta ctactacctc ggaacccaat tgcccatcga tcgcttcctc 3240acgttctact acgcgcaccc aggtttccag atcaacaaca tgctggttat cctatccgtg 3300caggtcttca tcgttaccat ggtcttcctc ggtaccttga agtcttcggt cacgatctgc 3360aagtacacgt ccagcggtca gtacatcggt ggtcaatccg gttgctacaa cctcgtcccg 3420gtcttccagt ggatcgagcg ctgcatcatc agcatcttct tggtgttcat gatcgctttc 3480atgccgctct tcctgcaaga actcgtcgag cgcggtacct ggagtgccat ctggcgtctg 3540ctcaagcagt ttatgtcgct gtcgcctgtc ttcgaggtgt tctccaccca gattcagaca 3600cactccgtgt tgagcaactt gacgttcggt ggtgcgcgtt acatcgctac cggtcgtggg 3660ttcgccacca gtcgtatcag cttcagcatc ttgttctcgc gtttcgcagg cccgagtatc 3720tacctcggca tgcgcacgct cattatgctg ctctacgtga cgttgacgat ctggacgcca 3780tgggtcattt acttctgggt ttccattctc tcgctctgca tcgcgccgtt cttgttcaat 3840ccgcatcaat tcgtcttctc ggatttcctc atcgactaca gggaatacct ccggtggatg 3900tcgcgtggta actcgcgctc gcacaacaac tcctggattg ggtactgccg gttgtcccgc 3960acgatgatca ctgggtacaa gaagaagaag ctgggccacc cgtcggagaa gctttccggc 4020gacgttcctc gtgcaggctg gcgcgccgtc ttattctcgg agatcatctt cccggcatgc 4080atggccatcc tcttcatcat cgcgtacatg ttcgtcaagt cgttccctct cgacggcaag 4140cagcctccct ccggcctcgt tcgcatcgcc gtcgtgtcta tcggccccat cgtgtggaac 4200gccgccatcc tgttgacgct cttccttgtg tcgttgttcc tcggccccat gctcgacccg 4260gtcttccccc tcttcggttc cgttatggcc ttcatcgcgc atttcctcgg cacaatcgga 4320atgattgggt tcttcgagtt cctgtggttc ctcgagtcct gggaggcgtc gcatgccgtg 4380ctgggtctca tcgccgtcat ctccatccag cgcgccattc acaaaattct tatcgccgtt 4440ttcctcagtc gcgagttcaa gcacgacgag acgaacaggg cttggtggac tggtcgctgg 4500tatggccgtg gcctcggcac gcacgccatg tcgcagccgg cgcgtgagtt cgtcgtcaag 4560atcatcgagt tgtcgctctg gagctcggat ctcatactcg gccacatcct gctgttcatg 4620cttactccgg ctgtcctcat cccgtacttc gaccgtctgc acgccatgat gctcttctgg 4680ctgcgcccct caaagcaaat ccgcgcgcct ctgtactcaa tcaagcagaa gaggcaaaga 4740cgctggatta tcatgaagta cggtactgta tacgttaccg tcatcgcgat cttcgtcgcg 4800ctcatcgcgc ttcccctcgt cttccgacac actctaaagg tcgagtgctc cctttgcgac 4860agcttgtaa 486981622PRTSchizophyllum commune 8Met Arg Asn Met Phe Asp Phe Thr Met Gln Leu Leu Asp Ser Arg Ala 1 5 10 15 Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala Asp Tyr 20 25 30 Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala Ala Gln 35 40 45 Leu Asp Leu Asp Asp Ala Val Gly Gln Thr Gln Asn Pro Gly Leu Asn 50 55 60 Arg Leu Lys Ser Thr Arg Gly Ser Gly Lys Arg Pro Arg His Glu Lys 65 70 75 80 Ser Leu Asn Thr Ala Leu Glu Arg Trp Arg Gln Ala Met Asn Asn Met 85 90 95 Ser Gln Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp 100 105 110 Gly Glu Ala Ala Gln Val Arg Phe Met Pro Glu Cys Leu Cys Phe Ile 115 120 125 Phe Lys Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg 130 135 140 Met Glu Pro Val Pro Glu Gly Leu Tyr Leu Arg Thr Val Val Lys Pro 145 150 155 160 Leu Tyr Arg Phe Val Arg Asp Gln Gly Tyr Glu Val Val Glu Gly Lys 165 170 175 Phe Val Arg Arg Glu Arg Asp His Asp Gln Ile Ile Gly Tyr Asp Asp 180 185 190 Val Asn Gln Leu Phe Trp Tyr Pro Glu Gly Ile Ala Arg Ile Val Leu 195 200 205 Ser Asp Lys Ser Arg Leu Val Asp Leu Pro Pro Ala Gln Arg Phe Met 210 215 220 Lys Phe Asp Arg Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Phe Tyr 225 230 235 240 Glu Thr Arg Ser Phe Thr His Leu Leu Val Asp Phe Asn Arg Ile Trp 245 250 255 Val Val His Ile Ala Leu Tyr Phe Phe Tyr Thr Ala Tyr Asn Ser Pro 260 265 270 Thr Ile Tyr Ala Ile Asn Gly Asn Thr Pro Thr Ser Leu Ala Trp Ser 275 280 285 Ala Thr Ala Leu Gly Gly Ala Val Ala Thr Gly Ile Met Ile Leu Ala 290 295 300 Thr Ile Ala Glu Phe Ser His Ile Pro Thr Thr Trp Asn Asn Thr Ser 305 310 315 320 His Leu Thr Arg Arg Leu Ala Phe Leu Leu Val Thr Leu Gly Leu Thr 325 330 335 Cys Gly Pro Thr Phe Tyr Val Ala Ile Ala Glu Ser Asn Gly Ser Gly 340 345 350 Gly Ser Leu Ala Leu Ile Leu Gly Ile Val Gln Phe Phe Ile Ser Val 355 360 365 Val Ala Thr Ala Leu Phe Thr Ile Met Pro Ser Gly Arg Met Phe Gly 370 375 380 Asp Arg Val Ala Gly Lys Ser Arg Lys Tyr Leu Ala Ser Gln Thr Phe 385 390 395 400 Thr Ala Ser Tyr Pro Ser Leu Pro Lys His Gln Arg Phe Ala Ser Leu 405 410 415 Leu Met Trp Phe Leu Ile Phe Gly Cys Lys Leu Thr Glu Ser Tyr Phe 420 425 430 Phe Leu Thr Leu Ser Phe Arg Asp Pro Ile Arg Val Met Val Gly Met 435 440 445 Lys Ile Gln Asn Cys Glu Asp Lys Ile Phe Gly Ser Gly Leu Cys Arg 450 455 460 Asn His Ala Ala Phe Thr Leu Thr Ile Met Tyr Ile Met Asp Leu Val 465 470 475 480 Leu Phe Phe Leu Asp Thr Phe Leu Trp Tyr Val Ile Trp Asn Ser Val 485 490 495 Phe Ser Ile Ala Arg Ser Phe Val Leu Gly Leu Ser Ile Trp Thr Pro 500 505 510 Trp Arg Asp Ile Phe Gln Arg Leu Pro Lys Arg Ile Tyr Ala Lys Leu 515 520 525 Leu Ala Thr Gly Asp Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 530 535 540 Ser Gln Ile Trp Asn Ala Ile Ile Ile Ser Met Tyr Arg Glu His Leu 545 550 555 560 Leu Ser Ile Glu His Val Gln Lys Leu Leu Tyr His Gln Val Asp Thr 565 570 575 Gly Glu Ala Gly Lys Arg Ser Leu Arg Ala Pro Pro Phe Phe Val Ala 580 585

590 Gln Gly Ser Ser Gly Gly Ser Gly Glu Phe Phe Pro Pro Gly Ser Glu 595 600 605 Ala Glu Arg Arg Ile Ser Phe Phe Ala Gln Ser Leu Ser Thr Glu Ile 610 615 620 Pro Gln Pro Ile Pro Val Asp Ala Met Pro Thr Phe Thr Val Leu Thr 625 630 635 640 Pro His Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg 645 650 655 Glu Glu Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln 660 665 670 Leu His Pro Val Glu Trp Glu Asn Phe Val Lys Asp Thr Lys Ile Leu 675 680 685 Ala Glu Glu Ser Ala Met Phe Asn Gly Pro Ser Pro Phe Gly Asn Asp 690 695 700 Glu Lys Gly Gln Ser Lys Met Asp Asp Leu Pro Phe Tyr Cys Ile Gly 705 710 715 720 Phe Lys Ser Ala Ala Pro Glu Tyr Thr Leu Arg Thr Arg Ile Trp Ala 725 730 735 Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr Val Ser Gly Met Met Asn 740 745 750 Tyr Ala Lys Ala Ile Lys Leu Leu Tyr Arg Val Glu Asn Pro Glu Val 755 760 765 Val Gln Gln Phe Gly Gly Asn Thr Asp Lys Leu Glu Arg Glu Leu Glu 770 775 780 Arg Met Ala Arg Arg Lys Phe Lys Phe Leu Val Ser Met Gln Arg Tyr 785 790 795 800 Ser Lys Phe Asn Lys Glu Glu His Glu Asn Ala Glu Phe Leu Leu Arg 805 810 815 Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu Glu Glu Glu Pro Pro Arg 820 825 830 Lys Glu Gly Gly Asp Pro Arg Ile Phe Ser Ala Leu Val Asp Gly His 835 840 845 Ser Asp Ile Ile Pro Glu Thr Gly Lys Arg Arg Pro Lys Phe Arg Ile 850 855 860 Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp Gly Lys Ser Asp Asn Gln 865 870 875 880 Asn His Ala Ile Val Phe Tyr Arg Gly Glu Tyr Leu Gln Leu Ile Asp 885 890 895 Ala Asn Gln Asp Asn Tyr Leu Glu Glu Cys Leu Lys Ile Arg Asn Val 900 905 910 Leu Ala Glu Phe Glu Glu Tyr Asp Val Ser Ser Gln Ser Pro Tyr Ala 915 920 925 Gln Trp Ser Val Lys Glu Phe Lys Arg Ser Pro Val Ala Ile Val Gly 930 935 940 Ala Arg Glu Tyr Ile Phe Ser Glu His Ile Gly Ile Leu Gly Asp Leu 945 950 955 960 Ala Ala Gly Lys Glu Gln Thr Phe Gly Thr Leu Thr Ala Arg Asn Asn 965 970 975 Ala Phe Leu Gly Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn 980 985 990 Ala Leu Tyr Met Asn Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly 995 1000 1005 Leu His Leu Asn Glu Asp Ile Tyr Ala Gly Met Asn Ala Val Gly 1010 1015 1020 Arg Gly Gly Arg Ile Lys His Ser Glu Tyr Tyr Gln Cys Gly Lys 1025 1030 1035 Gly Arg Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys 1040 1045 1050 Ile Gly Thr Gly Met Gly Glu Gln Ile Leu Ser Arg Glu Tyr Tyr 1055 1060 1065 Tyr Leu Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr 1070 1075 1080 Tyr Ala His Pro Gly Phe Gln Ile Asn Asn Met Leu Val Ile Leu 1085 1090 1095 Ser Val Gln Val Phe Ile Val Thr Met Val Phe Leu Gly Thr Leu 1100 1105 1110 Lys Ser Ser Val Thr Ile Cys Lys Tyr Thr Ser Ser Gly Gln Tyr 1115 1120 1125 Ile Gly Gly Gln Ser Gly Cys Tyr Asn Leu Val Pro Val Phe Gln 1130 1135 1140 Trp Ile Glu Arg Cys Ile Ile Ser Ile Phe Leu Val Phe Met Ile 1145 1150 1155 Ala Phe Met Pro Leu Phe Leu Gln Glu Leu Val Glu Arg Gly Thr 1160 1165 1170 Trp Ser Ala Ile Trp Arg Leu Leu Lys Gln Phe Met Ser Leu Ser 1175 1180 1185 Pro Val Phe Glu Val Phe Ser Thr Gln Ile Gln Thr His Ser Val 1190 1195 1200 Leu Ser Asn Leu Thr Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly 1205 1210 1215 Arg Gly Phe Ala Thr Ser Arg Ile Ser Phe Ser Ile Leu Phe Ser 1220 1225 1230 Arg Phe Ala Gly Pro Ser Ile Tyr Leu Gly Met Arg Thr Leu Ile 1235 1240 1245 Met Leu Leu Tyr Val Thr Leu Thr Ile Trp Thr Pro Trp Val Ile 1250 1255 1260 Tyr Phe Trp Val Ser Ile Leu Ser Leu Cys Ile Ala Pro Phe Leu 1265 1270 1275 Phe Asn Pro His Gln Phe Val Phe Ser Asp Phe Leu Ile Asp Tyr 1280 1285 1290 Arg Glu Tyr Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Ser His 1295 1300 1305 Asn Asn Ser Trp Ile Gly Tyr Cys Arg Leu Ser Arg Thr Met Ile 1310 1315 1320 Thr Gly Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu 1325 1330 1335 Ser Gly Asp Val Pro Arg Ala Gly Trp Arg Ala Val Leu Phe Ser 1340 1345 1350 Glu Ile Ile Phe Pro Ala Cys Met Ala Ile Leu Phe Ile Ile Ala 1355 1360 1365 Tyr Met Phe Val Lys Ser Phe Pro Leu Asp Gly Lys Gln Pro Pro 1370 1375 1380 Ser Gly Leu Val Arg Ile Ala Val Val Ser Ile Gly Pro Ile Val 1385 1390 1395 Trp Asn Ala Ala Ile Leu Leu Thr Leu Phe Leu Val Ser Leu Phe 1400 1405 1410 Leu Gly Pro Met Leu Asp Pro Val Phe Pro Leu Phe Gly Ser Val 1415 1420 1425 Met Ala Phe Ile Ala His Phe Leu Gly Thr Ile Gly Met Ile Gly 1430 1435 1440 Phe Phe Glu Phe Leu Trp Phe Leu Glu Ser Trp Glu Ala Ser His 1445 1450 1455 Ala Val Leu Gly Leu Ile Ala Val Ile Ser Ile Gln Arg Ala Ile 1460 1465 1470 His Lys Ile Leu Ile Ala Val Phe Leu Ser Arg Glu Phe Lys His 1475 1480 1485 Asp Glu Thr Asn Arg Ala Trp Trp Thr Gly Arg Trp Tyr Gly Arg 1490 1495 1500 Gly Leu Gly Thr His Ala Met Ser Gln Pro Ala Arg Glu Phe Val 1505 1510 1515 Val Lys Ile Ile Glu Leu Ser Leu Trp Ser Ser Asp Leu Ile Leu 1520 1525 1530 Gly His Ile Leu Leu Phe Met Leu Thr Pro Ala Val Leu Ile Pro 1535 1540 1545 Tyr Phe Asp Arg Leu His Ala Met Met Leu Phe Trp Leu Arg Pro 1550 1555 1560 Ser Lys Gln Ile Arg Ala Pro Leu Tyr Ser Ile Lys Gln Lys Arg 1565 1570 1575 Gln Arg Arg Trp Ile Ile Met Lys Tyr Gly Thr Val Tyr Val Thr 1580 1585 1590 Val Ile Ala Ile Phe Val Ala Leu Ile Ala Leu Pro Leu Val Phe 1595 1600 1605 Arg His Thr Leu Lys Val Glu Cys Ser Leu Cys Asp Ser Leu 1610 1615 1620 9 6098DNASchizophyllum commune 9cccgtccctc aaggccgttc tttcgctggc gaccgacccg gtgttcgcga gaacctgttg 60tttctgacga tcatcaaccc tttcttctcg tcgctcttta gctctcccta gaccgtcttt 120tactctactc ttcgacgcac gccatgtccg gtccaggata tggcaggaat ccattcgaca 180atcccccgcc caacagaggt ccctatggcc agcagccagg tttcccgggg cccggccctc 240ggccttacga ctcggacgcg gacatgagcc agacctatgg cagcacaacc aggctcgccg 300gcagtgccgg ttacagcgac agaaacggtg cgaacgtcgc taccgtactt cctcgatcgt 360cgactcacat atcacgcagg cagcttcgac ggcgaccgct cctacgcgcc ctcaattgac 420tcgcgcgcca gcgtgcccag catatcgccc ttcgcagacc cgggtatcgg ctctaatgag 480ccgtatcccg cttggtcggt cgaacgccag atccccatgt ccacggagga gattgaggat 540atcttcctcg acctcaccca aaagtttggc ttccagcgcg actccatgcg gaatacggtg 600cgtgaataag cagcccactc gaccgcggga acagctcaat tgacctgtca cccagttcga 660cttcatgatg cacctccttg attcccgtgc ctcgcgcatg acgcccaacc aagctctgct 720cacgcttcac gccgactaca ttggtggcca gcacgccaac tataggaagt ggtatttcgc 780cgctcagctc aacctcgatg acgcggtcgg gcaaaccaat aaccccggta tccagcgctt 840gaagaccatc aagggcgcta cgaagaccaa gtcgctcgac agcgcactca accgctggcg 900caatgcgatg aacaacatga gccagtacga tcgcctccgg caaattgcgc tctatctcct 960ctgctgggga gaagcaggca acatccgtct ggcgcccgag tgcttgtgct tcatcttcaa 1020gtgcgcggac gactactaca gaagtcccga gtgtcagaac cggatggacc ccgtgccgga 1080agggctgtac ctccagacgg tcatcaagcc gctctatcgc ttcctacgtg atcaggcgta 1140cgaagtcgtt gatgggaagc aagtgaagcg cgagaaggac cacgaccaga ttatcggtta 1200tgacgacgtc aaccagttat tctggtatcc ggaaggtttg gctaagatcg tcatgtcgga 1260caacgtgcgt atgatcttat cggttacaat tcgtccgctc acatctttcc agacacgact 1320tgtagatgta cctccggcgc agcggttcat gaagttcgcc aagatcgagt ggaaccgcgt 1380cttcttcaag acgtactttg agaagcgctc tactgcccat ctcctggtca acttcaaccg 1440tatatggatc ctccacgtct cgatgtactt cttctacacg gcattcaact ctccacgagt 1500ctacgcgccg cacggcaaac tcgacccctc ccctgagatg acctggtccg cgactgccct 1560tggaggcgct gtgtccacca tgatcatgat ccttgccact atcgcggagt acacctacat 1620ccccacgaca tggaacaatg cgtcgcacct caccacgcgg ctcattttcc tcctggtcat 1680cctcgcgctc actgctggac caacattcta tatcgccatg atagacggac gcacggacat 1740cggccaagta ccactcatcg tggccatagt gcagttcttc atctccgtcg tcgccaccct 1800cgctttcgct accatccctt ctggtcgcat gttcggcgac cgtgtggctg gcaagtcaag 1860aaagcacatg gcatcgcaga cgttcacagc gtcgtacccg tccatgaagc ggtcatctcg 1920cgtagcgagt atcatgctgt ggcttttggt ctttggctgc aaatacgtcg agtcttactt 1980cttcttgacg tcctccttct ccagcccgat cgcggtcatg gcgcgtacga aggtacaggg 2040ctgcaacgac cgtatcttcg gcagccagct gtgcacgaat caggtcccgt tcgcgctggc 2100aatcatgtac gtgatggacc tggtactgtt cttcctggac acgtacctgt ggtacatcat 2160ctggctggtg atcttctcga tggtgcgcgc gttcaagctt ggtatctcga tctggacgcc 2220ctggagcgag atcttcaccc gcatgccgaa gcgtatctac gcgaagctgc tggcgacggc 2280cgagatggag gtcaagtata agcccaaggt atgctgaatg caatctggtc aggtgaattc 2340accctcatat tgttgtgcag gtgctcgtct cgcaaatctg gaacgcggtc atcatctcca 2400tgtaccggga gcatctcttg tccatcgagc acgtccagcg cctgctatac caccaggttg 2460atggtccaga cggtcgccgc accctcaggg caccgccgtt cttcaccagc cagcgaactg 2520cgaagccagg cctgttcttc cctcctggtg gcgaggctga gcgccgtatc tcgttctttg 2580cctcatcgct gacgaccgcg ctccctgagc ctctgccgat cgacgccatg cccaccttca 2640ccgtgctcgt tccccattac tcggagaaga ttctgctcag tctgcgcgag attattcgcg 2700aggaggacca gaacacccgc gtcaccttgc tggagtacct caagcagctc caccctgtcg 2760aatgggacaa cttcgtcaag gacaccaaga tcttggcgga agagtcgggc gacgtccagg 2820acgagaagcg cgcgcgcacg gacgacttgc cgttctactg catcgggttc aagacctcgt 2880caccagagta caccctgcgt acgcgtatct gggcttcact gcgcgcacag acgctgtacc 2940gcacggtctc cggtatgatg aactactcca aggcgatcaa gctcctctat cgcgtcgaga 3000acccggatgt cgttcatgcc ttcggtggga acacggaacg tcttgaacgc gagcttgagc 3060gcatgtctcg ccgcaagttc aagttcgtca tctcgatgca gcggtactct aagttcaaca 3120aggaggagca agagaacgcc gaattccttc tgcgcgcgta cccggatttg cagatcgcgt 3180acctcgatga agagcccggt cccagcaaga gcgacgaggt tcggttgttt tcgacactca 3240tcgatggaca ctccgaggtg gatgagaaga ccggccgccg caagcccaag ttccgcattg 3300agctgcccgg taaccccatc ctcggtgacg ggaagtcgga taaccagaac cacgccattg 3360tcttctaccg cggcgagtac atccaggtca tcgacgctaa ccaggacaat tacctggaag 3420agtgtctcaa gatccgtaac gtcctgggcg agtttgagga atactccgtg tcgagccaga 3480gcccgtacgc acagtggggc cacaaggagt tcaacaagtg ccccgtcgct atcctgggtt 3540ctcgcgagta catcttctcg gagaacatcg gtatcctcgg tgacatcgcc gccggcaagg 3600aacagacgtt cggtaccatt acggcgcgtg cgcttgcgtg gatcggcggc aagctgcatt 3660acggtcaccc ggatttcctc aatgcgacgt tcatgacgac gcgtggtggc gtgtcaaaag 3720cgcagaaggg cttgcatctc aacgaggata tcttcgctgg tatgaccgcc gtgtcccgcg 3780gagggcgcat caagcacatg gagtactacc agtgcggcaa aggtcgtgat ctcggtttcg 3840gcacgatctt gaacttccag acgaagatcg gtactggtat gggcgagcag ctcctctcgc 3900gcgagtacta ctacctgggc acgcaattgc ctatcgaccg gttcttgacg ttctactacg 3960cgcacgctgg tttccacgtc aacaacatcc tggtcatcta ctccatccag gtcttcatgg 4020tcacctgtaa gtgcaggcgc tcatgaccgc cgagaacgta gtctgacgga tgtgcagtgc 4080tgtacctggg cacattgaac aagcagctgt tcatctgcaa ggtcaactcc aatggccagg 4140ttcttagtgg acaagctggg tgctacaacc tcatcccggt cttcgagtgg attcgccgga 4200gtatcatctc catcttcttg gtgttcttca tcgccttctt gcctctattc ttgcaaggta 4260tgttcacttt ccatgtgtca tccgttagcc gctcaccata cgacagagct gtgcgagcgc 4320ggaacgggaa aggcgttgct gcgtctcggg aagcacttct tgtcactgtc gcccattttc 4380gaagtgttct ccacccagat ttactcgcag gcgctcttga acaacatgag cttcggtggt 4440gcgcgctaca tcgccacagg tcgtggtttc gcgactagtc gcataccctt caacatcctc 4500tactcgcgtt tcgcgccgcc aagcatctac atgggcatgc gtaacctgct gctcctgctg 4560tacgcgacga tggccatttg gatcccgcac ctgatctact tctggttctc cgtcctctcc 4620ctctgcatcg cgccattcat gttcaatccg catcaattct cgtacgccga cttcatcatc 4680gactaccggg agttcttgcg ctggatgtcg cgcggtaact cgcgaacgaa ggcgagcagc 4740tggtacggat actgccgtct gtcgcgtacc gcgattactg ggtacaagaa gaagaagctg 4800ggacacccgt cggagaagct gtcgggcgac gtaccgcgtg cgccgtggag gaacgttatc 4860ttctcggaga tcctgtggcc catcggcgcg tgcatcatct tcatcgtcgc gtacatgttc 4920gtcaagtcgt tccccgacga gcagggcaac gcgccgccga gcccgctggt ccggattctg 4980ctcatcgcgg ttggccctac tgtgtggaac gcggcggtgc tcataacgct gttcttcctg 5040tcgctcttcc tgggcccgat gatggatggc tgggtcaagt tcggctcggt catggcggcc 5100cttgcgcatg gcctggcgct tataggcatg ctcacgttct ttgagttctt cgtacgtcct 5160tcgcgttgtg tcgtcaagtg ctctgctaac gccgtcttca gtggttcctt gagctctggg 5220atgcctcgca cgccgtgctc ggcgtcatcg ctatcattgc cgttcagcgc gggatccaga 5280agatcctcat tgccgtcttc ctgacgcgtg agtacaagca cgacgagacg aaccgcgcgt 5340ggtggacagg taaatggtat ggacgcgggc tgggtacctc ggccatgtcc cagccggcgc 5400gcgagttcat cgtgaagatc gtggagatgt cgttgtggac gtcggacttc ctgcttgcgc 5460acctgttgct catcatcttg acggtgccgc tactgctgcc gttcttcaac tcaattcatt 5520cgacgatgct ttgtgagtgg tttgtagtcg ttggtcatgg atgatttctg actcgcgtgc 5580agtctggttg cgcccttcga agcagattag gcaacctctg ttctccacca agcagaagcg 5640gcaacggcga tggattgtga gttcctttga ttgctctggg taccgacctt cgctcacctt 5700tcttaggtca tgaagtatac cgtggtatat ctcgtggtgg tggctttcct cgtcgcgctc 5760atcgctctgc gtacgttttc cctcgcgctc accctgtatt ttcactaacg tttcctccag 5820ccgccctctt ccgcgagagc atccacttca actgcgagat ctgccagagt atatagtcat 5880ataacgacgt ctatcgtatc gccggacgag agccccgtcg cctacacact gacatggaat 5940cgctgtgtat acaatcgatc ttctgaccgc gtcgggggcg ttgccgtctt tctactatca 6000atttgcttgt gtatcaacat ttcttctctc caagcctaca ttgacataga gtaatagccc 6060atgttcatac aacaatcgca tagcattgca tataccat 6098101726PRTSchizophyllum commune 10Met Ser Gly Pro Gly Tyr Gly Arg Asn Pro Phe Asp Asn Pro Pro Pro 1 5 10 15 Asn Arg Gly Pro Tyr Gly Gln Gln Pro Gly Phe Pro Gly Pro Gly Pro 20 25 30 Arg Pro Tyr Asp Ser Asp Ala Asp Met Ser Gln Thr Tyr Gly Ser Thr 35 40 45 Thr Arg Leu Ala Gly Ser Ala Gly Tyr Ser Asp Arg Asn Gly Ser Phe 50 55 60 Asp Gly Asp Arg Ser Tyr Ala Pro Ser Ile Asp Ser Arg Ala Ser Val 65 70 75 80 Pro Ser Ile Ser Pro Phe Ala Asp Pro Gly Ile Gly Ser Asn Glu Pro 85 90 95 Tyr Pro Ala Trp Ser Val Glu Arg Gln Ile Pro Met Ser Thr Glu Glu 100 105 110 Ile Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg 115 120 125 Asp Ser Met Arg Asn Thr Phe Asp Phe Met Met His Leu Leu Asp Ser 130 135 140 Arg Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala 145 150 155 160 Asp Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala 165 170 175 Ala Gln Leu Asn Leu Asp Asp Ala Val Gly Gln Thr Asn Asn Pro Gly 180 185 190 Ile Gln Arg Leu Lys Thr Ile Lys Gly Ala Thr Lys Thr Lys Ser Leu 195 200 205 Asp Ser Ala Leu Asn Arg Trp Arg Asn Ala Met Asn Asn Met Ser Gln 210 215 220 Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp Gly Glu 225 230 235 240 Ala Gly Asn Ile Arg Leu Ala Pro Glu Cys Leu Cys Phe Ile Phe Lys 245 250 255 Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg Met Asp 260 265 270 Pro Val Pro Glu Gly Leu Tyr Leu Gln Thr Val Ile Lys Pro Leu Tyr 275 280 285 Arg Phe Leu Arg Asp Gln Ala Tyr Glu Val Val Asp Gly Lys

Gln Val 290 295 300 Lys Arg Glu Lys Asp His Asp Gln Ile Ile Gly Tyr Asp Asp Val Asn 305 310 315 320 Gln Leu Phe Trp Tyr Pro Glu Gly Leu Ala Lys Ile Val Met Ser Asp 325 330 335 Asn Thr Arg Leu Val Asp Val Pro Pro Ala Gln Arg Phe Met Lys Phe 340 345 350 Ala Lys Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Tyr Phe Glu Lys 355 360 365 Arg Ser Thr Ala His Leu Leu Val Asn Phe Asn Arg Ile Trp Ile Leu 370 375 380 His Val Ser Met Tyr Phe Phe Tyr Thr Ala Phe Asn Ser Pro Arg Val 385 390 395 400 Tyr Ala Pro His Gly Lys Leu Asp Pro Ser Pro Glu Met Thr Trp Ser 405 410 415 Ala Thr Ala Leu Gly Gly Ala Val Ser Thr Met Ile Met Ile Leu Ala 420 425 430 Thr Ile Ala Glu Tyr Thr Tyr Ile Pro Thr Thr Trp Asn Asn Ala Ser 435 440 445 His Leu Thr Thr Arg Leu Ile Phe Leu Leu Val Ile Leu Ala Leu Thr 450 455 460 Ala Gly Pro Thr Phe Tyr Ile Ala Met Ile Asp Gly Arg Thr Asp Ile 465 470 475 480 Gly Gln Val Pro Leu Ile Val Ala Ile Val Gln Phe Phe Ile Ser Val 485 490 495 Val Ala Thr Leu Ala Phe Ala Thr Ile Pro Ser Gly Arg Met Phe Gly 500 505 510 Asp Arg Val Ala Gly Lys Ser Arg Lys His Met Ala Ser Gln Thr Phe 515 520 525 Thr Ala Ser Tyr Pro Ser Met Lys Arg Ser Ser Arg Val Ala Ser Ile 530 535 540 Met Leu Trp Leu Leu Val Phe Gly Cys Lys Tyr Val Glu Ser Tyr Phe 545 550 555 560 Phe Leu Thr Ser Ser Phe Ser Ser Pro Ile Ala Val Met Ala Arg Thr 565 570 575 Lys Val Gln Gly Cys Asn Asp Arg Ile Phe Gly Ser Gln Leu Cys Thr 580 585 590 Asn Gln Val Pro Phe Ala Leu Ala Ile Met Tyr Val Met Asp Leu Val 595 600 605 Leu Phe Phe Leu Asp Thr Tyr Leu Trp Tyr Ile Ile Trp Leu Val Ile 610 615 620 Phe Ser Met Val Arg Ala Phe Lys Leu Gly Ile Ser Ile Trp Thr Pro 625 630 635 640 Trp Ser Glu Ile Phe Thr Arg Met Pro Lys Arg Ile Tyr Ala Lys Leu 645 650 655 Leu Ala Thr Ala Glu Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 660 665 670 Ser Gln Ile Trp Asn Ala Val Ile Ile Ser Met Tyr Arg Glu His Leu 675 680 685 Leu Ser Ile Glu His Val Gln Arg Leu Leu Tyr His Gln Val Asp Gly 690 695 700 Pro Asp Gly Arg Arg Thr Leu Arg Ala Pro Pro Phe Phe Thr Ser Gln 705 710 715 720 Arg Thr Ala Lys Pro Gly Leu Phe Phe Pro Pro Gly Gly Glu Ala Glu 725 730 735 Arg Arg Ile Ser Phe Phe Ala Ser Ser Leu Thr Thr Ala Leu Pro Glu 740 745 750 Pro Leu Pro Ile Asp Ala Met Pro Thr Phe Thr Val Leu Val Pro His 755 760 765 Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg Glu Glu 770 775 780 Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln Leu His 785 790 795 800 Pro Val Glu Trp Asp Asn Phe Val Lys Asp Thr Lys Ile Leu Ala Glu 805 810 815 Glu Ser Gly Asp Val Gln Asp Glu Lys Arg Ala Arg Thr Asp Asp Leu 820 825 830 Pro Phe Tyr Cys Ile Gly Phe Lys Thr Ser Ser Pro Glu Tyr Thr Leu 835 840 845 Arg Thr Arg Ile Trp Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr 850 855 860 Val Ser Gly Met Met Asn Tyr Ser Lys Ala Ile Lys Leu Leu Tyr Arg 865 870 875 880 Val Glu Asn Pro Asp Val Val His Ala Phe Gly Gly Asn Thr Glu Arg 885 890 895 Leu Glu Arg Glu Leu Glu Arg Met Ser Arg Arg Lys Phe Lys Phe Val 900 905 910 Ile Ser Met Gln Arg Tyr Ser Lys Phe Asn Lys Glu Glu Gln Glu Asn 915 920 925 Ala Glu Phe Leu Leu Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu 930 935 940 Asp Glu Glu Pro Gly Pro Ser Lys Ser Asp Glu Val Arg Leu Phe Ser 945 950 955 960 Thr Leu Ile Asp Gly His Ser Glu Val Asp Glu Lys Thr Gly Arg Arg 965 970 975 Lys Pro Lys Phe Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp 980 985 990 Gly Lys Ser Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu 995 1000 1005 Tyr Ile Gln Val Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu 1010 1015 1020 Cys Leu Lys Ile Arg Asn Val Leu Gly Glu Phe Glu Glu Tyr Ser 1025 1030 1035 Val Ser Ser Gln Ser Pro Tyr Ala Gln Trp Gly His Lys Glu Phe 1040 1045 1050 Asn Lys Cys Pro Val Ala Ile Leu Gly Ser Arg Glu Tyr Ile Phe 1055 1060 1065 Ser Glu Asn Ile Gly Ile Leu Gly Asp Ile Ala Ala Gly Lys Glu 1070 1075 1080 Gln Thr Phe Gly Thr Ile Thr Ala Arg Ala Leu Ala Trp Ile Gly 1085 1090 1095 Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Thr Phe 1100 1105 1110 Met Thr Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His 1115 1120 1125 Leu Asn Glu Asp Ile Phe Ala Gly Met Thr Ala Val Ser Arg Gly 1130 1135 1140 Gly Arg Ile Lys His Met Glu Tyr Tyr Gln Cys Gly Lys Gly Arg 1145 1150 1155 Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly 1160 1165 1170 Thr Gly Met Gly Glu Gln Leu Leu Ser Arg Glu Tyr Tyr Tyr Leu 1175 1180 1185 Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala 1190 1195 1200 His Ala Gly Phe His Val Asn Asn Ile Leu Val Ile Tyr Ser Ile 1205 1210 1215 Gln Val Phe Met Val Thr Leu Leu Tyr Leu Gly Thr Leu Asn Lys 1220 1225 1230 Gln Leu Phe Ile Cys Lys Val Asn Ser Asn Gly Gln Val Leu Ser 1235 1240 1245 Gly Gln Ala Gly Cys Tyr Asn Leu Ile Pro Val Phe Glu Trp Ile 1250 1255 1260 Arg Arg Ser Ile Ile Ser Ile Phe Leu Val Phe Phe Ile Ala Phe 1265 1270 1275 Leu Pro Leu Phe Leu Gln Glu Leu Cys Glu Arg Gly Thr Gly Lys 1280 1285 1290 Ala Leu Leu Arg Leu Gly Lys His Phe Leu Ser Leu Ser Pro Ile 1295 1300 1305 Phe Glu Val Phe Ser Thr Gln Ile Tyr Ser Gln Ala Leu Leu Asn 1310 1315 1320 Asn Met Ser Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly 1325 1330 1335 Phe Ala Thr Ser Arg Ile Pro Phe Asn Ile Leu Tyr Ser Arg Phe 1340 1345 1350 Ala Pro Pro Ser Ile Tyr Met Gly Met Arg Asn Leu Leu Leu Leu 1355 1360 1365 Leu Tyr Ala Thr Met Ala Ile Trp Ile Pro His Leu Ile Tyr Phe 1370 1375 1380 Trp Phe Ser Val Leu Ser Leu Cys Ile Ala Pro Phe Met Phe Asn 1385 1390 1395 Pro His Gln Phe Ser Tyr Ala Asp Phe Ile Ile Asp Tyr Arg Glu 1400 1405 1410 Phe Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Thr Lys Ala Ser 1415 1420 1425 Ser Trp Tyr Gly Tyr Cys Arg Leu Ser Arg Thr Ala Ile Thr Gly 1430 1435 1440 Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly 1445 1450 1455 Asp Val Pro Arg Ala Pro Trp Arg Asn Val Ile Phe Ser Glu Ile 1460 1465 1470 Leu Trp Pro Ile Gly Ala Cys Ile Ile Phe Ile Val Ala Tyr Met 1475 1480 1485 Phe Val Lys Ser Phe Pro Asp Glu Gln Gly Asn Ala Pro Pro Ser 1490 1495 1500 Pro Leu Val Arg Ile Leu Leu Ile Ala Val Gly Pro Thr Val Trp 1505 1510 1515 Asn Ala Ala Val Leu Ile Thr Leu Phe Phe Leu Ser Leu Phe Leu 1520 1525 1530 Gly Pro Met Met Asp Gly Trp Val Lys Phe Gly Ser Val Met Ala 1535 1540 1545 Ala Leu Ala His Gly Leu Ala Leu Ile Gly Met Leu Thr Phe Phe 1550 1555 1560 Glu Phe Phe Trp Phe Leu Glu Leu Trp Asp Ala Ser His Ala Val 1565 1570 1575 Leu Gly Val Ile Ala Ile Ile Ala Val Gln Arg Gly Ile Gln Lys 1580 1585 1590 Ile Leu Ile Ala Val Phe Leu Thr Arg Lys Trp Tyr Gly Arg Gly 1595 1600 1605 Leu Gly Thr Ser Ala Met Ser Gln Pro Ala Arg Glu Phe Ile Val 1610 1615 1620 Lys Ile Val Glu Met Ser Leu Trp Thr Ser Asp Phe Leu Leu Ala 1625 1630 1635 His Leu Leu Leu Ile Ile Leu Thr Val Pro Leu Leu Leu Pro Phe 1640 1645 1650 Phe Asn Ser Ile His Ser Thr Met Leu Phe Trp Leu Arg Pro Ser 1655 1660 1665 Lys Gln Ile Arg Gln Pro Leu Phe Ser Thr Lys Gln Lys Arg Gln 1670 1675 1680 Arg Arg Trp Ile Val Met Lys Tyr Thr Val Val Tyr Leu Val Val 1685 1690 1695 Val Ala Phe Leu Val Ala Leu Ile Ala Leu Pro Ala Leu Phe Arg 1700 1705 1710 Glu Ser Ile His Phe Asn Cys Glu Ile Cys Gln Ser Ile 1715 1720 1725 11 5771DNASchizophyllum commune 11ctgtccaagg aggagatcga ggacatcttc ctcgatttga cgcagaagtt tggctttcag 60cgggattcca tgcggaatat ggtacgtggc gtgtgcccat gtgcggcgtt ctgaggccta 120acgttttccg ccagttcgac ttcaccatgc agctgcttga cagccgagcg tctcgtatga 180cccccaacca ggcgctcctc accctccacg ccgactacat tggtggccag catgcgaact 240accggaagtg gtacttcgcg gcgcagctcg accttgacga cgccgtggga caaactcaga 300atccgggtct caaccgcctc aagtccactc gcggatcggg caagcgacca cgccatgaaa 360agtcgctgaa cacggcattg gagcgctggc ggcaagccat gaacaacatg tcgcagtatg 420accgcttacg ccagatcgcg ctctacctgc tctgctgggg cgaagcggcg caagtgcgat 480tcatgcccga gtgcttgtgc ttcatcttca agtgcgccga cgactactat cgttcgccgg 540agtgccagaa caggatggag ccggtaccgg agggtctcta cctgaggacg gtcgtaaagc 600cgctctacag atttgtccgg gatcaaggct atgaggtggt ggagggaaaa ttcgtacggc 660gggaacggga tcacgaccaa atcattggtt acgatgacgt gaatcagctg ttctggtacc 720cggagggaat tgcccgtatc gtcctgtcgg acaaggtaag cacctctgtg catcttctgt 780gacatacagg gctaattgtc gagcagagtc gtctagtcga cctcccccca gcacagcgct 840tcatgaagtt cgaccgtatc gagtggaatc gcgtcttctt caagacgttt tacgagactc 900gatccttcac gcatcttttg gtcgacttca accgtatctg ggtcgtgcac atcgctctct 960acttcttcta cactgcatac aactccccca cgatctacgc catcaacggc aacacaccga 1020cgtctctggc ttggagcgcg actgcgctcg gcggtgcggt agcgacaggt atcatgatcc 1080tcgccacgat cgccgagttc tcgcacatcc ccacgacatg gaacaacacc tcgcatctga 1140ctcgccgcct cgccttcctc ctcgtcacgc tcggcctcac atgtggtccg acgttctacg 1200tcgcgattgc agagagcaac gggagcggcg gctctttggc cttgattctc ggtatcgtcc 1260agttcttcat ctccgtcgtg gcaactgcgc tcttcactat catgccttct ggtcgtatgt 1320tcggcgaccg tgtcgcaggc aagagtcgca agtatctcgc cagccagacg ttcacggcca 1380gctacccgtc gttgcccaag caccagcggt tcgcctcact cctgatgtgg ttcctcatct 1440tcgggtgcaa gttgacggag agttacttct ttctgacgct gtccttccgc gaccctatcc 1500gcgtcatggt cggcatgaag atccagaact gcgaggacaa gattttcggc agcggccttt 1560gcaggaatca cgcagcattc accctcacga tcatgtacat catggacctc gtcttgttct 1620tcctcgacac cttcctttgg tatgtcatct ggaactcggt tttcagtatc gcacgctctt 1680tcgtactcgg cctttcgatc tggacaccgt ggagagacat cttccagcgt ctgccgaagc 1740ggatctacgc gaagcttctg gcgactggcg acatggaggt caagtacaag cccaaggtat 1800gcgttgagct cgccgtaaat ccacttaagg ctaacacgtt cgcaggtctt ggtctcgcaa 1860atctggaacg ccatcatcat ctccatgtac cgcgagcact tgctctctat tgagcacgtc 1920cagaagctcc tgtaccacca agtggacact ggcgaagccg gcaagcggag tcttcgcgcg 1980cctccgttct tcgtcgcgca gggcagcagc ggtggctcgg gcgagttctt cccgcctggc 2040agcgaggccg agcgtcgtat ctctttcttc gcgcagtcgc tttctacgga gattcctcag 2100cccatcccgg tcgacgccat gccgacgttc acggtgctta cgcctcacta cagcgagaag 2160gtacatgctc cccttgtagc catatgacat cagctgactg tcgtgcacag atccttctct 2220ctctccgtga aattatccgc gaggaggacc agaacactcg cgttacgttg ctcgagtacc 2280tgaagcagct gcatccggtc gagtgggaga atttcgtcaa ggacactaaa attttggccg 2340aggagtccgc tatgtttaac ggtccgagtc ctttcggcaa cgacgagaag ggtcagtcca 2400agatggacga tctaccgttc tactgcatcg gtttcaagag cgccgcgccc gagtacaccc 2460tccgcacccg tatctgggcg tccctgcgcg cgcagacgct gtaccgcacg gtctccggca 2520tgatgaacta tgcgaaggcg atcaagctgc tctaccgcgt tgagaacccg gaggtcgtac 2580aacagttcgg cggcaacacg gacaagctcg agcgcgagtt ggagcggatg gcgcgacgga 2640agttcaagtt cctcgtgtcc atgcagcgct actcgaagtt caacaaggag gagcacgaga 2700acgccgagtt cttgctccgc gcgtacccgg acttgcagat cgcgtacctc gaggaagagc 2760cccctcgcaa ggagggcggc gatccacgca tcttctctgc cctcgtcgac ggccacagcg 2820acatcatccc ggagaccggc aagcggcgcc ccaagttccg tatcgagctg cccggtaacc 2880ccattctcgg tgacggtaaa tccgacaatc agaaccacgc tatcgtcttc taccgcggcg 2940agtacctcca gcttatcgac gccaaccagg acaactacct cgaggagtgc ttgaagatcc 3000gtaacgtgct cgccgagttt gaggagtacg acgtctccag ccagagcccg tacgcgcagt 3060ggagtgtcaa ggagttcaag cgctctccgg tcgccatcgt cggtgcacgc gagtacatct 3120tctcagagca catcggtatc ctcggtgatc tggcggctgg caaggaacag acgttcggta 3180cgctcacggc acgcaacaac gccttccttg gcggcaagct gcactacggt caccccgatt 3240tcctcaacgc cctctacatg aacacgcgcg gtggtgtctc caaggcgcag aagggtctcc 3300atctcaacga ggatatctac gccggtatga acgcggtcgg tcgcggtgga cgcattaagc 3360acagcgagta ctatcagtgc ggcaagggtc gtgacctcgg tttcggcacc atcttgaact 3420tccagaccaa gatcggtacg ggtatgggcg agcagatcct ctcgcgcgag tactactatc 3480tcggaacaca actgcccatc gatcgcttcc tcacgttcta ctacgcgcac ccgggtttcc 3540agatcaacaa catgctggtc atcctctccg tgcaggtctt catcgttacc agtacgttca 3600atgcatattg ttagcctgac aacgtctgac gaatttccag tggtcttcct cggtaccttg 3660aagtcttcgg tcacgatctg caagtacacg tccagcggtc agtacatcgg tggtcaatcc 3720ggttgctaca acctcgtccc ggtcttccag tggatcgagc gctgcatcat cagcatcttc 3780ttggtgttca tgatcgcttt catgccgctc ttcctgcaag gtaagagctt gtcaacctgc 3840tcaaggggct tgcgctgatc atcatctcag aactcgtcga gcgcggtacc tggagtgcca 3900tctggcgtct gctcaagcag tttatgtcgc tgtcgcctgt cttcgaggtg ttctccaccc 3960agattcagac gcactccgtg ttgagcaact tgacgttcgg tggtgcgcgt tacatcgcta 4020ccggtcgtgg gttcgccacc agtcgtatca gcttcagcat cttgttctcg cgtttcgcag 4080gcccgagtat ctacctcggc atgcgcacgc tcattatgct gctctacgtg acgttgacga 4140tctggacgcc atgggtcatt tacttctggg tttccattct ctcgctctgc atcgcgccgt 4200tcttgttcaa cccgcatcaa ttcgtattct cggacttcct catcgactac aggtacgtcg 4260gacgagcgct gttccgcgac gtaagctgac cggttataca gggaatacct gcggtggatg 4320tcgcgtggca actcgcgctc gcacaacaac tcctggattg ggtactgccg gttgtcccgc 4380acgatgatca ctgggtacaa gaagaagaag ctgggccacc cgtcggagaa gctttccggc 4440gacgttcctc gtgcaggctg gcgcgccgtc ttgttctcgg agatcatctt cccggcgtgc 4500atggccatcc tcttcatcat cgcgtacatg ttcgtcaagt cgttccctct cgacggcaag 4560cagcctccct ccggcctcgt tcgcatcgcc gtcgtgtcta tcggccccat cgtgtggaac 4620gccgccatcc tgttgacgct cttccttgtg tcgttgttcc tcggccccat gctcgacccg 4680gtcttccccc tcttcggttc cgttatggcc ttcatcgcgc atttccttgg cacaatcgga 4740atgattgggt tcttcgagtt cctggtatgt gcccatacct ttcattcgac ttcaactatc 4800taacagattc atagtggttc ctcgagtcct gggaggcgtc gcatgccgtg ctgggtctca 4860tcgccgtcat ctccatccag cgcgccattc acaagatcct tatcgccgtt ttcctcagtc 4920gcgagttcaa gcacgacgag acgaacaggg cctggtggac tggtcgctgg tatggccgtg 4980gcctcggcac gcacgccatg tcgcagccgg cgcgtgagtt cgtcgtcaag atcatcgagt 5040tgtcgctttg gagctcggat ctcatactcg gccacatcct gctgttcatg cttactccgg 5100ccgtcctcat cccgtacttc gaccgtttgc acgccatgat gctctgtacg tcgtgtctca 5160ttgtctgtgt tggtcatact cttaccctct cttagtctgg ctgcgtccct cgaagcaaat 5220ccgcgcgcct ctgtactcga tcaagcagaa gaggcaaaga cgctggattg tcagtgttca 5280gtgccttatt ctatcagctc ttactaacgt cttcatagat catgaagtac ggtactgtat 5340acgttaccgt catcgcgatc ttcgtcgcgc tcatcgcgct tcgtgagttt ccttgctatt 5400tttcgtacct gagcgtcgct gacccctttc

ccagccctcg tattccgaca cactctaaag 5460gtcgagtgct ccctttgcga cagcttgtaa tatcggactc gtatatatct agacttctcc 5520gcaccatgtg tagctgacgc ttgggtatac ttcgcggtgc cgagctaatt gtcgacggac 5580attctccatc gttgagtgca gcgacgtcgg gtggtttacg acacggacac ttttcattgt 5640accctctacg aatgcaagaa ctctcttacg accagtacct atgtgctaag ccgtcgcctg 5700ttcaggatca tacatacata cgtttctaga taccttacag ttaggcctat tcagggagag 5760tctgcataaa a 5771121783PRTSchizophyllum commune 12Met Pro Arg Pro Gly Gly Thr Ser Ala Glu Gly Gly Tyr Ala Ser Ser 1 5 10 15 Pro Ser Met Glu Thr Thr Pro Ser Asp Pro Phe Gly Thr Ala Asn Gly 20 25 30 Ala Pro Arg Arg Tyr Tyr Asp Asn Asp Ser Glu Glu Tyr Gly Pro Gly 35 40 45 Arg Arg Asp Thr Tyr Ala Ser Asp Ser Ser Asn Gln Gly Leu Thr Asp 50 55 60 Pro Gly Tyr Tyr Asp Gln Asn Gly Ala Tyr Asp Pro Tyr Pro Thr Gly 65 70 75 80 Asp Thr Asp Ser Asp Gly Asp Val Tyr Gly Gln Arg Tyr Gly Pro Ser 85 90 95 Ala Glu Ser Leu Gly Thr His Lys Phe Gly His Ser Asp Ser Ser Thr 100 105 110 Pro Thr Phe Val Asp Tyr Ser Ala Ser Ser Gly Gly Arg Asp Ser Tyr 115 120 125 Pro Ala Trp Thr Ala Glu Arg Asn Ile Pro Leu Ser Lys Glu Glu Ile 130 135 140 Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg Asp 145 150 155 160 Ser Met Arg Asn Met Phe Asp Phe Thr Met Gln Leu Leu Asp Ser Arg 165 170 175 Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala Asp 180 185 190 Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala Ala 195 200 205 Gln Leu Asp Leu Asp Asp Ala Val Gly Gln Thr Gln Asn Pro Gly Leu 210 215 220 Asn Arg Leu Lys Ser Thr Arg Gly Ser Gly Lys Arg Pro Arg His Glu 225 230 235 240 Lys Ser Leu Asn Thr Ala Leu Glu Arg Trp Arg Gln Ala Met Asn Asn 245 250 255 Met Ser Gln Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys 260 265 270 Trp Gly Glu Ala Ala Gln Val Arg Phe Met Pro Glu Cys Leu Cys Phe 275 280 285 Ile Phe Lys Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn 290 295 300 Arg Met Glu Pro Val Pro Glu Gly Leu Tyr Leu Arg Thr Val Val Lys 305 310 315 320 Pro Leu Tyr Arg Phe Val Arg Asp Gln Gly Tyr Glu Val Val Glu Gly 325 330 335 Lys Phe Val Arg Arg Glu Arg Asp His Asp Gln Ile Ile Gly Tyr Asp 340 345 350 Asp Val Asn Gln Leu Phe Trp Tyr Pro Glu Gly Ile Ala Arg Ile Val 355 360 365 Leu Ser Asp Lys Ser Arg Leu Val Asp Leu Pro Pro Ala Gln Arg Phe 370 375 380 Met Lys Phe Asp Arg Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Phe 385 390 395 400 Tyr Glu Thr Arg Ser Phe Thr His Leu Leu Val Asp Phe Asn Arg Ile 405 410 415 Trp Val Val His Ile Ala Leu Tyr Phe Phe Tyr Thr Ala Tyr Asn Ser 420 425 430 Pro Thr Ile Tyr Ala Ile Asn Gly Asn Thr Pro Thr Ser Leu Ala Trp 435 440 445 Ser Ala Thr Ala Leu Gly Gly Ala Val Ala Thr Gly Ile Met Ile Leu 450 455 460 Ala Thr Ile Ala Glu Phe Ser His Ile Pro Thr Thr Trp Asn Asn Thr 465 470 475 480 Ser His Leu Thr Arg Arg Leu Ala Phe Leu Leu Val Thr Leu Gly Leu 485 490 495 Thr Cys Gly Pro Thr Phe Tyr Val Ala Ile Ala Glu Ser Asn Gly Ser 500 505 510 Gly Gly Ser Leu Ala Leu Ile Leu Gly Ile Val Gln Phe Phe Ile Ser 515 520 525 Val Val Ala Thr Ala Leu Phe Thr Ile Met Pro Ser Gly Arg Met Phe 530 535 540 Gly Asp Arg Val Ala Gly Lys Ser Arg Lys Tyr Leu Ala Ser Gln Thr 545 550 555 560 Phe Thr Ala Ser Tyr Pro Ser Leu Pro Lys His Gln Arg Phe Ala Ser 565 570 575 Leu Leu Met Trp Phe Leu Ile Phe Gly Cys Lys Leu Thr Glu Ser Tyr 580 585 590 Phe Phe Leu Thr Leu Ser Phe Arg Asp Pro Ile Arg Val Met Val Gly 595 600 605 Met Lys Ile Gln Asn Cys Glu Asp Lys Ile Phe Gly Ser Gly Leu Cys 610 615 620 Arg Asn His Ala Ala Phe Thr Leu Thr Ile Met Tyr Ile Met Asp Leu 625 630 635 640 Val Leu Phe Phe Leu Asp Thr Phe Leu Trp Tyr Val Ile Trp Asn Ser 645 650 655 Val Phe Ser Ile Ala Arg Ser Phe Val Leu Gly Leu Ser Ile Trp Thr 660 665 670 Pro Trp Arg Asp Ile Phe Gln Arg Leu Pro Lys Arg Ile Tyr Ala Lys 675 680 685 Leu Leu Ala Thr Gly Asp Met Glu Val Lys Tyr Lys Pro Lys Val Leu 690 695 700 Val Ser Gln Ile Trp Asn Ala Ile Ile Ile Ser Met Tyr Arg Glu His 705 710 715 720 Leu Leu Ser Ile Glu His Val Gln Lys Leu Leu Tyr His Gln Val Asp 725 730 735 Thr Gly Glu Ala Gly Lys Arg Ser Leu Arg Ala Pro Pro Phe Phe Val 740 745 750 Ala Gln Gly Ser Ser Gly Gly Ser Gly Glu Phe Phe Pro Pro Gly Ser 755 760 765 Glu Ala Glu Arg Arg Ile Ser Phe Phe Ala Gln Ser Leu Ser Thr Glu 770 775 780 Ile Pro Gln Pro Ile Pro Val Asp Ala Met Pro Thr Phe Thr Val Leu 785 790 795 800 Thr Pro His Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile 805 810 815 Arg Glu Glu Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys 820 825 830 Gln Leu His Pro Val Glu Trp Glu Asn Phe Val Lys Asp Thr Lys Ile 835 840 845 Leu Ala Glu Glu Ser Ala Met Phe Asn Gly Pro Ser Pro Phe Gly Asn 850 855 860 Asp Glu Lys Gly Gln Ser Lys Met Asp Asp Leu Pro Phe Tyr Cys Ile 865 870 875 880 Gly Phe Lys Ser Ala Ala Pro Glu Tyr Thr Leu Arg Thr Arg Ile Trp 885 890 895 Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr Val Ser Gly Met Met 900 905 910 Asn Tyr Ala Lys Ala Ile Lys Leu Leu Tyr Arg Val Glu Asn Pro Glu 915 920 925 Val Val Gln Gln Phe Gly Gly Asn Thr Asp Lys Leu Glu Arg Glu Leu 930 935 940 Glu Arg Met Ala Arg Arg Lys Phe Lys Phe Leu Val Ser Met Gln Arg 945 950 955 960 Tyr Ser Lys Phe Asn Lys Glu Glu His Glu Asn Ala Glu Phe Leu Leu 965 970 975 Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu Glu Glu Glu Pro Pro 980 985 990 Arg Lys Glu Gly Gly Asp Pro Arg Ile Phe Ser Ala Leu Val Asp Gly 995 1000 1005 His Ser Asp Ile Ile Pro Glu Thr Gly Lys Arg Arg Pro Lys Phe 1010 1015 1020 Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp Gly Lys Ser 1025 1030 1035 Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu Tyr Leu 1040 1045 1050 Gln Leu Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu Cys Leu 1055 1060 1065 Lys Ile Arg Asn Val Leu Ala Glu Phe Glu Glu Tyr Asp Val Ser 1070 1075 1080 Ser Gln Ser Pro Tyr Ala Gln Trp Ser Val Lys Glu Phe Lys Arg 1085 1090 1095 Ser Pro Val Ala Ile Val Gly Ala Arg Glu Tyr Ile Phe Ser Glu 1100 1105 1110 His Ile Gly Ile Leu Gly Asp Leu Ala Ala Gly Lys Glu Gln Thr 1115 1120 1125 Phe Gly Thr Leu Thr Ala Arg Asn Asn Ala Phe Leu Gly Gly Lys 1130 1135 1140 Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Leu Tyr Met Asn 1145 1150 1155 Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His Leu Asn 1160 1165 1170 Glu Asp Ile Tyr Ala Gly Met Asn Ala Val Gly Arg Gly Gly Arg 1175 1180 1185 Ile Lys His Ser Glu Tyr Tyr Gln Cys Gly Lys Gly Arg Asp Leu 1190 1195 1200 Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly Thr Gly 1205 1210 1215 Met Gly Glu Gln Ile Leu Ser Arg Glu Tyr Tyr Tyr Leu Gly Thr 1220 1225 1230 Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala His Pro 1235 1240 1245 Gly Phe Gln Ile Asn Asn Met Leu Val Ile Leu Ser Val Gln Val 1250 1255 1260 Phe Ile Val Thr Met Val Phe Leu Gly Thr Leu Lys Ser Ser Val 1265 1270 1275 Thr Ile Cys Lys Tyr Thr Ser Ser Gly Gln Tyr Ile Gly Gly Gln 1280 1285 1290 Ser Gly Cys Tyr Asn Leu Val Pro Val Phe Gln Trp Ile Glu Arg 1295 1300 1305 Cys Ile Ile Ser Ile Phe Leu Val Phe Met Ile Ala Phe Met Pro 1310 1315 1320 Leu Phe Leu Gln Glu Leu Val Glu Arg Gly Thr Trp Ser Ala Ile 1325 1330 1335 Trp Arg Leu Leu Lys Gln Phe Met Ser Leu Ser Pro Val Phe Glu 1340 1345 1350 Val Phe Ser Thr Gln Ile Gln Thr His Ser Val Leu Ser Asn Leu 1355 1360 1365 Thr Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly Phe Ala 1370 1375 1380 Thr Ser Arg Ile Ser Phe Ser Ile Leu Phe Ser Arg Phe Ala Gly 1385 1390 1395 Pro Ser Ile Tyr Leu Gly Met Arg Thr Leu Ile Met Leu Leu Tyr 1400 1405 1410 Val Thr Leu Thr Ile Trp Thr Pro Trp Val Ile Tyr Phe Trp Val 1415 1420 1425 Ser Ile Leu Ser Leu Cys Ile Ala Pro Phe Leu Phe Asn Pro His 1430 1435 1440 Gln Phe Val Phe Ser Asp Phe Leu Ile Asp Tyr Arg Glu Tyr Leu 1445 1450 1455 Arg Trp Met Ser Arg Gly Asn Ser Arg Ser His Asn Asn Ser Trp 1460 1465 1470 Ile Gly Tyr Cys Arg Leu Ser Arg Thr Met Ile Thr Gly Tyr Lys 1475 1480 1485 Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly Asp Val 1490 1495 1500 Pro Arg Ala Gly Trp Arg Ala Val Leu Phe Ser Glu Ile Ile Phe 1505 1510 1515 Pro Ala Cys Met Ala Ile Leu Phe Ile Ile Ala Tyr Met Phe Val 1520 1525 1530 Lys Ser Phe Pro Leu Asp Gly Lys Gln Pro Pro Ser Gly Leu Val 1535 1540 1545 Arg Ile Ala Val Val Ser Ile Gly Pro Ile Val Trp Asn Ala Ala 1550 1555 1560 Ile Leu Leu Thr Leu Phe Leu Val Ser Leu Phe Leu Gly Pro Met 1565 1570 1575 Leu Asp Pro Val Phe Pro Leu Phe Gly Ser Val Met Ala Phe Ile 1580 1585 1590 Ala His Phe Leu Gly Thr Ile Gly Met Ile Gly Phe Phe Glu Phe 1595 1600 1605 Leu Trp Phe Leu Glu Ser Trp Glu Ala Ser His Ala Val Leu Gly 1610 1615 1620 Leu Ile Ala Val Ile Ser Ile Gln Arg Ala Ile His Lys Ile Leu 1625 1630 1635 Ile Ala Val Phe Leu Ser Arg Glu Phe Lys His Asp Glu Thr Asn 1640 1645 1650 Arg Ala Trp Trp Thr Gly Arg Trp Tyr Gly Arg Gly Leu Gly Thr 1655 1660 1665 His Ala Met Ser Gln Pro Ala Arg Glu Phe Val Val Lys Ile Ile 1670 1675 1680 Glu Leu Ser Leu Trp Ser Ser Asp Leu Ile Leu Gly His Ile Leu 1685 1690 1695 Leu Phe Met Leu Thr Pro Ala Val Leu Ile Pro Tyr Phe Asp Arg 1700 1705 1710 Leu His Ala Met Met Leu Phe Trp Leu Arg Pro Ser Lys Gln Ile 1715 1720 1725 Arg Ala Pro Leu Tyr Ser Ile Lys Gln Lys Arg Gln Arg Arg Trp 1730 1735 1740 Ile Ile Met Lys Tyr Gly Thr Val Tyr Val Thr Val Ile Ala Ile 1745 1750 1755 Phe Val Ala Leu Ile Ala Leu Pro Leu Val Phe Arg His Thr Leu 1760 1765 1770 Lys Val Glu Cys Ser Leu Cys Asp Ser Leu 1775 1780 13 5223DNASchizophyllum commune 13atgtccggtc caggatatgg caggaatcca ttcgacaatc ccccgcccaa cagaggtccc 60tatggccagc agccaggttt cccggggccc ggccctcggc cttacgactc ggacgcggac 120atgagccaga cctatggcag cacaaccagg ctcgccggca gtgccggtta cagcgacaga 180aacggcagct tcgacggcga ccgctcctac gcgccctcaa ttgactcgcg cgccagcgtg 240cccagcatat cgcccttcgc agacccgggt atcggctcta atgagccgta tcccgcttgg 300tcggtcgaac gccagatccc catgtccacg gaggagattg aggatatctt cctcgacctc 360acccaaaagt ttggcttcca gcgcgactcc atgcggaata cgttcgactt catgatgcac 420ctccttgatt cccgtgcctc gcgcatgacg cccaaccaag ctctgctcac gcttcacgcc 480gactacattg gtggccagca cgccaactat aggaagtggt atttcgccgc tcagctcaac 540ctcgatgacg cggtcgggca aaccaataac cccggtatcc agcgcttgaa gaccatcaag 600ggcgctacga agaccaagtc gctcgacagc gcactcaacc gctggcgcaa tgcgatgaac 660aacatgagcc agtacgatcg cctccggcaa attgcgctct atctcctctg ctggggagaa 720gcaggcaaca tccgtctggc gcccgagtgc ttgtgcttca tcttcaagtg cgcggacgac 780tactacagaa gtcccgagtg tcagaaccgg atggaccccg tgccggaagg gctgtacctc 840cagacggtca tcaagccgct ctatcgcttc ctacgtgatc aggcgtacga agtcgttgat 900gggaagcaag tgaagcgcga gaaggaccac gaccagatta tcggttatga cgacgtcaac 960cagttattct ggtatccgga aggtttggct aagatcgtca tgtcggacaa cacacgactt 1020gtagatgtac ctccggcgca gcggttcatg aagttcgcca agatcgagtg gaaccgcgtc 1080ttcttcaaga cgtactttga gaagcgctct actgcccatc tcctggtcaa cttcaaccgt 1140atatggatcc tccacgtctc gatgtacttc ttctacacgg cattcaactc tccacgagtc 1200tacgcgccgc acggcaaact cgacccctcc cctgagatga cctggtccgc gactgccctt 1260ggaggcgctg tgtccaccat gatcatgatc cttgccacta tcgcggagta cacctacatc 1320cccacgacat ggaacaatgc gtcgcacctc accacgcggc tcattttcct cctggtcatc 1380ctcgcgctca ctgctggacc aacattctat atcgccatga tagacggacg cacggacatc 1440ggccaagtac cactcatcgt ggccatagtg cagttcttca tctccgtcgt cgccaccctc 1500gctttcgcta ccatcccttc tggtcgcatg ttcggcgacc gtgtggctgg caagtcaaga 1560aagcacatgg catcgcagac gttcacagcg tcgtacccgt ccatgaagcg gtcatctcgc 1620gtagcgagta tcatgctgtg gcttttggtc tttggctgca aatacgtcga gtcttacttc 1680ttcttgacgt cctccttctc cagcccgatc gcggtcatgg cgcgtacgaa ggtacagggc 1740tgcaacgacc gtatcttcgg cagccagctg tgcacgaatc aggtcccgtt cgcgctggca 1800atcatgtacg tgatggacct ggtactgttc ttcctggaca cgtacctgtg gtacatcatc 1860tggctggtga tcttctcgat ggtgcgcgcg ttcaagcttg gtatctcgat ctggacgccc 1920tggagcgaga tcttcacccg catgccgaag cgtatctacg cgaagctgct ggcgacggcc 1980gagatggagg tcaagtataa gcccaaggtg ctcgtctcgc aaatctggaa cgcggtcatc 2040atctccatgt accgggagca tctcttgtcc atcgagcacg tccagcgcct gctataccac 2100caggttgatg gtccagacgg tcgccgcacc ctcagggcac cgccgttctt caccagccag 2160cgaactgcga agccaggcct gttcttccct cctggtggcg aggctgagcg ccgtatctcg 2220ttctttgcct catcgctgac gaccgcgctc cctgagcctc tgccgatcga cgccatgccc 2280accttcaccg tgctcgttcc ccattactcg gagaagattc tgctcagtct gcgcgagatt 2340attcgcgagg aggaccagaa cacccgcgtc accttgctgg agtacctcaa gcagctccac 2400cctgtcgaat gggacaactt cgtcaaggac accaagatct tggcggaaga gtcgggcgac 2460gtccaggacg agaagcgcgc gcgcacggac gacttgccgt tctactgcat cgggttcaag 2520acctcgtcac cagagtacac cctgcgtacg cgtatctggg cttcactgcg cgcacagacg 2580ctgtaccgca cggtctccgg tatgatgaac tactccaagg cgatcaagct cctctatcgc 2640gtcgagaacc cggatgtcgt tcatgccttc ggtgggaaca cggaacgtct tgaacgcgag 2700cttgagcgca

tgtctcgccg caagttcaag ttcgtcatct cgatgcagcg gtactctaag 2760ttcaacaagg aggagcaaga gaacgccgaa ttccttctgc gcgcgtaccc ggatttgcag 2820atcgcgtacc tcgatgaaga gcccggtccc agcaagagcg acgaggttcg gttgttttcg 2880acactcatcg atggacactc cgaggtggat gagaagaccg gccgccgcaa gcccaagttc 2940cgcattgagc tgcccggtaa ccccatcctc ggtgacggga agtcggataa ccagaaccac 3000gccattgtct tctaccgcgg cgagtacatc caggtcatcg acgctaacca ggacaattac 3060ctggaagagt gtctcaagat ccgtaacgtc ctgggcgagt ttgaggaata ctccgtgtcg 3120agccagagcc cgtacgcaca gtggggccac aaggagttca acaagtgccc cgtcgctatc 3180ctgggttctc gcgagtacat cttctcggag aacatcggta tcctcggtga catcgccgcc 3240ggcaaggaac agacgttcgg taccattacg gcgcgtgcgc ttgcgtggat cggcggcaag 3300ctgcattacg gtcacccgga tttcctcaat gcgacgttca tgacgacgcg tggtggcgtg 3360tcaaaagcgc agaagggctt gcatctcaac gaggatatct tcgctggtat gaccgccgtg 3420tcccgcggag ggcgcatcaa gcacatggag tactaccagt gcggcaaagg tcgtgatctc 3480ggtttcggca cgatcttgaa cttccagacg aagatcggta ctggtatggg cgagcagctc 3540ctctcgcgcg agtactacta cctgggcacg caattgccta tcgaccggtt cttgacgttc 3600tactacgcgc acgctggttt ccacgtcaac aacatcctgg tcatctactc catccaggtc 3660ttcatggtca ccttgctgta cctgggcaca ttgaacaagc agctgttcat ctgcaaggtc 3720aactccaatg gccaggttct tagtggacaa gctgggtgct acaacctcat cccggtcttc 3780gagtggattc gccggagtat catctccatc ttcttggtgt tcttcatcgc cttcttgcct 3840ctattcttgc aagagctgtg cgagcgcgga acgggaaagg cgttgctgcg tctcgggaag 3900cacttcttgt cactgtcgcc cattttcgaa gtgttctcca cccagattta ctcgcaggcg 3960ctcttgaaca acatgagctt cggtggtgcg cgctacatcg ccacaggtcg tggtttcgcg 4020actagtcgca tacccttcaa catcctctac tcgcgtttcg cgccgccaag catctacatg 4080ggcatgcgta acctgctgct cctgctgtac gcgacgatgg ccatttggat cccgcacctg 4140atctacttct ggttctccgt cctctccctc tgcatcgcgc cattcatgtt caatccgcat 4200caattctcgt acgccgactt catcatcgac taccgggagt tcttgcgctg gatgtcgcgc 4260ggtaactcgc gaacgaaggc gagcagctgg tacggatact gccgtctgtc gcgtaccgcg 4320attactgggt acaagaagaa gaagctggga cacccgtcgg agaagctgtc gggcgacgta 4380ccgcgtgcgc cgtggaggaa cgttatcttc tcggagatcc tgtggcccat cggcgcgtgc 4440atcatcttca tcgtcgcgta catgttcgtc aagtcgttcc ccgacgagca gggcaacgcg 4500ccgccgagcc cgctggtccg gattctgctc atcgcggttg gccctactgt gtggaacgcg 4560gcggtgctca taacgctgtt cttcctgtcg ctcttcctgg gcccgatgat ggatggctgg 4620gtcaagttcg gctcggtcat ggcggccctt gcgcatggcc tggcgcttat aggcatgctc 4680acgttctttg agttcttctg gttccttgag ctctgggatg cctcgcacgc cgtgctcggc 4740gtcatcgcta tcattgccgt tcagcgcggg atccagaaga tcctcattgc cgtcttcctg 4800acgcgtgagt acaagcacga cgagacgaac cgcgcgtggt ggacaggtaa atggtatgga 4860cgcgggctgg gtacctcggc catgtcccag ccggcgcgcg agttcatcgt gaagatcgtg 4920gagatgtcgt tgtggacgtc ggacttcctg cttgcgcacc tgttgctcat catcttgacg 4980gtgccgctac tgctgccgtt cttcaactca attcattcga cgatgctttt ctggttgcgc 5040ccttcgaagc agattaggca acctctgttc tccaccaagc agaagcggca acggcgatgg 5100attgtcatga agtataccgt ggtatatctc gtggtggtgg ctttcctcgt cgcgctcatc 5160gctctgcccg ccctcttccg cgagagcatc cacttcaact gcgagatctg ccagagtata 5220tag 5223141740PRTSchizophyllum commune 14Met Ser Gly Pro Gly Tyr Gly Arg Asn Pro Phe Asp Asn Pro Pro Pro 1 5 10 15 Asn Arg Gly Pro Tyr Gly Gln Gln Pro Gly Phe Pro Gly Pro Gly Pro 20 25 30 Arg Pro Tyr Asp Ser Asp Ala Asp Met Ser Gln Thr Tyr Gly Ser Thr 35 40 45 Thr Arg Leu Ala Gly Ser Ala Gly Tyr Ser Asp Arg Asn Gly Ser Phe 50 55 60 Asp Gly Asp Arg Ser Tyr Ala Pro Ser Ile Asp Ser Arg Ala Ser Val 65 70 75 80 Pro Ser Ile Ser Pro Phe Ala Asp Pro Gly Ile Gly Ser Asn Glu Pro 85 90 95 Tyr Pro Ala Trp Ser Val Glu Arg Gln Ile Pro Met Ser Thr Glu Glu 100 105 110 Ile Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg 115 120 125 Asp Ser Met Arg Asn Thr Phe Asp Phe Met Met His Leu Leu Asp Ser 130 135 140 Arg Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala 145 150 155 160 Asp Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala 165 170 175 Ala Gln Leu Asn Leu Asp Asp Ala Val Gly Gln Thr Asn Asn Pro Gly 180 185 190 Ile Gln Arg Leu Lys Thr Ile Lys Gly Ala Thr Lys Thr Lys Ser Leu 195 200 205 Asp Ser Ala Leu Asn Arg Trp Arg Asn Ala Met Asn Asn Met Ser Gln 210 215 220 Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys Trp Gly Glu 225 230 235 240 Ala Gly Asn Ile Arg Leu Ala Pro Glu Cys Leu Cys Phe Ile Phe Lys 245 250 255 Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn Arg Met Asp 260 265 270 Pro Val Pro Glu Gly Leu Tyr Leu Gln Thr Val Ile Lys Pro Leu Tyr 275 280 285 Arg Phe Leu Arg Asp Gln Ala Tyr Glu Val Val Asp Gly Lys Gln Val 290 295 300 Lys Arg Glu Lys Asp His Asp Gln Ile Ile Gly Tyr Asp Asp Val Asn 305 310 315 320 Gln Leu Phe Trp Tyr Pro Glu Gly Leu Ala Lys Ile Val Met Ser Asp 325 330 335 Asn Thr Arg Leu Val Asp Val Pro Pro Ala Gln Arg Phe Met Lys Phe 340 345 350 Ala Lys Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Tyr Phe Glu Lys 355 360 365 Arg Ser Thr Ala His Leu Leu Val Asn Phe Asn Arg Ile Trp Ile Leu 370 375 380 His Val Ser Met Tyr Phe Phe Tyr Thr Ala Phe Asn Ser Pro Arg Val 385 390 395 400 Tyr Ala Pro His Gly Lys Leu Asp Pro Ser Pro Glu Met Thr Trp Ser 405 410 415 Ala Thr Ala Leu Gly Gly Ala Val Ser Thr Met Ile Met Ile Leu Ala 420 425 430 Thr Ile Ala Glu Tyr Thr Tyr Ile Pro Thr Thr Trp Asn Asn Ala Ser 435 440 445 His Leu Thr Thr Arg Leu Ile Phe Leu Leu Val Ile Leu Ala Leu Thr 450 455 460 Ala Gly Pro Thr Phe Tyr Ile Ala Met Ile Asp Gly Arg Thr Asp Ile 465 470 475 480 Gly Gln Val Pro Leu Ile Val Ala Ile Val Gln Phe Phe Ile Ser Val 485 490 495 Val Ala Thr Leu Ala Phe Ala Thr Ile Pro Ser Gly Arg Met Phe Gly 500 505 510 Asp Arg Val Ala Gly Lys Ser Arg Lys His Met Ala Ser Gln Thr Phe 515 520 525 Thr Ala Ser Tyr Pro Ser Met Lys Arg Ser Ser Arg Val Ala Ser Ile 530 535 540 Met Leu Trp Leu Leu Val Phe Gly Cys Lys Tyr Val Glu Ser Tyr Phe 545 550 555 560 Phe Leu Thr Ser Ser Phe Ser Ser Pro Ile Ala Val Met Ala Arg Thr 565 570 575 Lys Val Gln Gly Cys Asn Asp Arg Ile Phe Gly Ser Gln Leu Cys Thr 580 585 590 Asn Gln Val Pro Phe Ala Leu Ala Ile Met Tyr Val Met Asp Leu Val 595 600 605 Leu Phe Phe Leu Asp Thr Tyr Leu Trp Tyr Ile Ile Trp Leu Val Ile 610 615 620 Phe Ser Met Val Arg Ala Phe Lys Leu Gly Ile Ser Ile Trp Thr Pro 625 630 635 640 Trp Ser Glu Ile Phe Thr Arg Met Pro Lys Arg Ile Tyr Ala Lys Leu 645 650 655 Leu Ala Thr Ala Glu Met Glu Val Lys Tyr Lys Pro Lys Val Leu Val 660 665 670 Ser Gln Ile Trp Asn Ala Val Ile Ile Ser Met Tyr Arg Glu His Leu 675 680 685 Leu Ser Ile Glu His Val Gln Arg Leu Leu Tyr His Gln Val Asp Gly 690 695 700 Pro Asp Gly Arg Arg Thr Leu Arg Ala Pro Pro Phe Phe Thr Ser Gln 705 710 715 720 Arg Thr Ala Lys Pro Gly Leu Phe Phe Pro Pro Gly Gly Glu Ala Glu 725 730 735 Arg Arg Ile Ser Phe Phe Ala Ser Ser Leu Thr Thr Ala Leu Pro Glu 740 745 750 Pro Leu Pro Ile Asp Ala Met Pro Thr Phe Thr Val Leu Val Pro His 755 760 765 Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile Arg Glu Glu 770 775 780 Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys Gln Leu His 785 790 795 800 Pro Val Glu Trp Asp Asn Phe Val Lys Asp Thr Lys Ile Leu Ala Glu 805 810 815 Glu Ser Gly Asp Val Gln Asp Glu Lys Arg Ala Arg Thr Asp Asp Leu 820 825 830 Pro Phe Tyr Cys Ile Gly Phe Lys Thr Ser Ser Pro Glu Tyr Thr Leu 835 840 845 Arg Thr Arg Ile Trp Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr 850 855 860 Val Ser Gly Met Met Asn Tyr Ser Lys Ala Ile Lys Leu Leu Tyr Arg 865 870 875 880 Val Glu Asn Pro Asp Val Val His Ala Phe Gly Gly Asn Thr Glu Arg 885 890 895 Leu Glu Arg Glu Leu Glu Arg Met Ser Arg Arg Lys Phe Lys Phe Val 900 905 910 Ile Ser Met Gln Arg Tyr Ser Lys Phe Asn Lys Glu Glu Gln Glu Asn 915 920 925 Ala Glu Phe Leu Leu Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu 930 935 940 Asp Glu Glu Pro Gly Pro Ser Lys Ser Asp Glu Val Arg Leu Phe Ser 945 950 955 960 Thr Leu Ile Asp Gly His Ser Glu Val Asp Glu Lys Thr Gly Arg Arg 965 970 975 Lys Pro Lys Phe Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp 980 985 990 Gly Lys Ser Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu 995 1000 1005 Tyr Ile Gln Val Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu 1010 1015 1020 Cys Leu Lys Ile Arg Asn Val Leu Gly Glu Phe Glu Glu Tyr Ser 1025 1030 1035 Val Ser Ser Gln Ser Pro Tyr Ala Gln Trp Gly His Lys Glu Phe 1040 1045 1050 Asn Lys Cys Pro Val Ala Ile Leu Gly Ser Arg Glu Tyr Ile Phe 1055 1060 1065 Ser Glu Asn Ile Gly Ile Leu Gly Asp Ile Ala Ala Gly Lys Glu 1070 1075 1080 Gln Thr Phe Gly Thr Ile Thr Ala Arg Ala Leu Ala Trp Ile Gly 1085 1090 1095 Gly Lys Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Thr Phe 1100 1105 1110 Met Thr Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His 1115 1120 1125 Leu Asn Glu Asp Ile Phe Ala Gly Met Thr Ala Val Ser Arg Gly 1130 1135 1140 Gly Arg Ile Lys His Met Glu Tyr Tyr Gln Cys Gly Lys Gly Arg 1145 1150 1155 Asp Leu Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly 1160 1165 1170 Thr Gly Met Gly Glu Gln Leu Leu Ser Arg Glu Tyr Tyr Tyr Leu 1175 1180 1185 Gly Thr Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala 1190 1195 1200 His Ala Gly Phe His Val Asn Asn Ile Leu Val Ile Tyr Ser Ile 1205 1210 1215 Gln Val Phe Met Val Thr Leu Leu Tyr Leu Gly Thr Leu Asn Lys 1220 1225 1230 Gln Leu Phe Ile Cys Lys Val Asn Ser Asn Gly Gln Val Leu Ser 1235 1240 1245 Gly Gln Ala Gly Cys Tyr Asn Leu Ile Pro Val Phe Glu Trp Ile 1250 1255 1260 Arg Arg Ser Ile Ile Ser Ile Phe Leu Val Phe Phe Ile Ala Phe 1265 1270 1275 Leu Pro Leu Phe Leu Gln Glu Leu Cys Glu Arg Gly Thr Gly Lys 1280 1285 1290 Ala Leu Leu Arg Leu Gly Lys His Phe Leu Ser Leu Ser Pro Ile 1295 1300 1305 Phe Glu Val Phe Ser Thr Gln Ile Tyr Ser Gln Ala Leu Leu Asn 1310 1315 1320 Asn Met Ser Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly 1325 1330 1335 Phe Ala Thr Ser Arg Ile Pro Phe Asn Ile Leu Tyr Ser Arg Phe 1340 1345 1350 Ala Pro Pro Ser Ile Tyr Met Gly Met Arg Asn Leu Leu Leu Leu 1355 1360 1365 Leu Tyr Ala Thr Met Ala Ile Trp Ile Pro His Leu Ile Tyr Phe 1370 1375 1380 Trp Phe Ser Val Leu Ser Leu Cys Ile Ala Pro Phe Met Phe Asn 1385 1390 1395 Pro His Gln Phe Ser Tyr Ala Asp Phe Ile Ile Asp Tyr Arg Glu 1400 1405 1410 Phe Leu Arg Trp Met Ser Arg Gly Asn Ser Arg Thr Lys Ala Ser 1415 1420 1425 Ser Trp Tyr Gly Tyr Cys Arg Leu Ser Arg Thr Ala Ile Thr Gly 1430 1435 1440 Tyr Lys Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly 1445 1450 1455 Asp Val Pro Arg Ala Pro Trp Arg Asn Val Ile Phe Ser Glu Ile 1460 1465 1470 Leu Trp Pro Ile Gly Ala Cys Ile Ile Phe Ile Val Ala Tyr Met 1475 1480 1485 Phe Val Lys Ser Phe Pro Asp Glu Gln Gly Asn Ala Pro Pro Ser 1490 1495 1500 Pro Leu Val Arg Ile Leu Leu Ile Ala Val Gly Pro Thr Val Trp 1505 1510 1515 Asn Ala Ala Val Leu Ile Thr Leu Phe Phe Leu Ser Leu Phe Leu 1520 1525 1530 Gly Pro Met Met Asp Gly Trp Val Lys Phe Gly Ser Val Met Ala 1535 1540 1545 Ala Leu Ala His Gly Leu Ala Leu Ile Gly Met Leu Thr Phe Phe 1550 1555 1560 Glu Phe Phe Trp Phe Leu Glu Leu Trp Asp Ala Ser His Ala Val 1565 1570 1575 Leu Gly Val Ile Ala Ile Ile Ala Val Gln Arg Gly Ile Gln Lys 1580 1585 1590 Ile Leu Ile Ala Val Phe Leu Thr Arg Glu Tyr Lys His Asp Glu 1595 1600 1605 Thr Asn Arg Ala Trp Trp Thr Gly Lys Trp Tyr Gly Arg Gly Leu 1610 1615 1620 Gly Thr Ser Ala Met Ser Gln Pro Ala Arg Glu Phe Ile Val Lys 1625 1630 1635 Ile Val Glu Met Ser Leu Trp Thr Ser Asp Phe Leu Leu Ala His 1640 1645 1650 Leu Leu Leu Ile Ile Leu Thr Val Pro Leu Leu Leu Pro Phe Phe 1655 1660 1665 Asn Ser Ile His Ser Thr Met Leu Phe Trp Leu Arg Pro Ser Lys 1670 1675 1680 Gln Ile Arg Gln Pro Leu Phe Ser Thr Lys Gln Lys Arg Gln Arg 1685 1690 1695 Arg Trp Ile Val Met Lys Tyr Thr Val Val Tyr Leu Val Val Val 1700 1705 1710 Ala Phe Leu Val Ala Leu Ile Ala Leu Pro Ala Leu Phe Arg Glu 1715 1720 1725 Ser Ile His Phe Asn Cys Glu Ile Cys Gln Ser Ile 1730 1735 1740 15 5352DNASchizophyllum commune 15atgccgaggc cgggcggcac cagcgcagaa ggcggctacg catcatcgcc gtcgatggag 60acgaccccca gcgatccctt cggaaccgcg aacggcgcgc cccgccgcta ctacgacaat 120gattctgagg agtacggacc tggccgtaga gacacctacg cgtccgacag cagtaatcag 180ggcctcacgg acccgggcta ctacgaccag aatggcgcct atgatcccta tccgaccggg 240gacaccgatt ccgacggcga cgtctacggc cagcgatatg gaccctcagc agagtcgctt 300ggcacccaca agttcggcca ttccgattca tccacgccga cttttgtcga ctacagcgca 360tcctccggcg ggagggattc gtaccctgca tggactgccg aacgcaacat cccgctgtcc 420aaggaggaga tcgaggacat cttcctcgat ttgacgcaga agtttggctt tcagcgggat 480tccatgcgga atatgttcga cttcaccatg cagctgcttg acagccgagc gtctcgtatg 540acccccaacc aggcgctcct caccctccac gccgactaca ttggtggcca gcatgcgaac 600taccggaagt ggtacttcgc ggcgcagctc gaccttgacg acgccgtggg acaaactcag 660aatccgggtc tcaaccgcct caagtccact cgcggatcgg gcaagcgacc acgccatgaa 720aagtcgctga acacggcatt ggagcgctgg cggcaagcca tgaacaacat gtcgcagtat 780gaccgcttac gccagatcgc

gctctacctg ctctgctggg gcgaagcggc gcaagtgcga 840ttcatgcccg agtgcttgtg cttcatcttc aagtgcgccg acgactacta tcgttcgccg 900gagtgccaga acaggatgga gccggtaccg gagggtctct acctgaggac ggtcgtaaag 960ccgctctaca gatttgtccg ggatcaaggc tatgaggtgg tggagggaaa attcgtacgg 1020cgggaacggg atcacgacca aatcattggt tacgatgacg tgaatcagct gttctggtac 1080ccggagggaa ttgcccgtat cgtcctgtcg gacaagagtc gtctagtcga cctcccccca 1140gcacagcgct tcatgaagtt cgaccgtatc gagtggaatc gcgtcttctt caagacgttt 1200tacgagactc gatccttcac gcatcttttg gtcgacttca accgtatctg ggtcgtgcac 1260atcgctctct acttcttcta cactgcatac aactccccca cgatctacgc catcaacggc 1320aacacaccga cgtctctggc ttggagcgcg actgcgctcg gcggtgcggt agcgacaggt 1380atcatgatcc tcgccacgat cgccgagttc tcgcacatcc ccacgacatg gaacaacacc 1440tcgcatctga ctcgccgcct cgccttcctc ctcgtcacgc tcggcctcac atgtggtccg 1500acgttctacg tcgcgattgc agagagcaac gggagcggcg gctctttggc cttgattctc 1560ggtatcgtcc agttcttcat ctccgtcgtg gcaactgcgc tcttcactat catgccttct 1620ggtcgtatgt tcggcgaccg tgtcgcaggc aagagtcgca agtatctcgc cagccagacg 1680ttcacggcca gctacccgtc gttgcccaag caccagcggt tcgcctcact cctgatgtgg 1740ttcctcatct tcgggtgcaa gttgacggag agttacttct ttctgacgct gtccttccgc 1800gaccctatcc gcgtcatggt cggcatgaag atccagaact gcgaggacaa gattttcggc 1860agcggccttt gcaggaatca cgcagcattc accctcacga tcatgtacat catggacctc 1920gtcttgttct tcctcgacac cttcctttgg tatgtcatct ggaactcggt tttcagtatc 1980gcacgctctt tcgtactcgg cctttcgatc tggacaccgt ggagagacat cttccagcgt 2040ctgccgaagc ggatctacgc gaagcttctg gcgactggcg acatggaggt caagtacaag 2100cccaaggtct tggtctcgca aatctggaac gccatcatca tctccatgta ccgcgagcac 2160ttgctctcta ttgagcacgt ccagaagctc ctgtaccacc aagtggacac tggcgaagcc 2220ggcaagcgga gtcttcgcgc gcctccgttc ttcgtcgcgc agggcagcag cggtggctcg 2280ggcgagttct tcccgcctgg cagcgaggcc gagcgtcgta tctctttctt cgcgcagtcg 2340ctttctacgg agattcctca gcccatcccg gtcgacgcca tgccgacgtt cacggtgctt 2400acgcctcact acagcgagaa gatccttctc tctctccgtg aaattatccg cgaggaggac 2460cagaacactc gcgttacgtt gctcgagtac ctgaagcagc tgcatccggt cgagtgggag 2520aatttcgtca aggacactaa aattttggcc gaggagtccg ctatgtttaa cggtccgagt 2580cctttcggca acgacgagaa gggtcagtcc aagatggacg atctaccgtt ctactgcatc 2640ggtttcaaga gcgccgcgcc cgagtacacc ctccgcaccc gtatctgggc gtccctgcgc 2700gcgcagacgc tgtaccgcac ggtctccggc atgatgaact atgcgaaggc gatcaagctg 2760ctctaccgcg ttgagaaccc ggaggtcgta caacagttcg gcggcaacac ggacaagctc 2820gagcgcgagt tggagcggat ggcgcgacgg aagttcaagt tcctcgtgtc catgcagcgc 2880tactcgaagt tcaacaagga ggagcacgag aacgccgagt tcttgctccg cgcgtacccg 2940gacttgcaga tcgcgtacct cgaggaagag ccccctcgca aggagggcgg cgatccacgc 3000atcttctctg ccctcgtcga cggccacagc gacatcatcc cggagaccgg caagcggcgc 3060cccaagttcc gtatcgagct gcccggtaac cccattctcg gtgacggtaa atccgacaat 3120cagaaccacg ctatcgtctt ctaccgcggc gagtacctcc agcttatcga cgccaaccag 3180gacaactacc tcgaggagtg cttgaagatc cgtaacgtgc tcgccgagtt tgaggagtac 3240gacgtctcca gccagagccc gtacgcgcag tggagtgtca aggagttcaa gcgctctccg 3300gtcgccatcg tcggtgcacg cgagtacatc ttctcagagc acatcggtat cctcggtgat 3360ctggcggctg gcaaggaaca gacgttcggt acgctcacgg cacgcaacaa cgccttcctt 3420ggcggcaagc tgcactacgg tcaccccgat ttcctcaacg ccctctacat gaacacgcgc 3480ggtggtgtct ccaaggcgca gaagggtctc catctcaacg aggatatcta cgccggtatg 3540aacgcggtcg gtcgcggtgg acgcattaag cacagcgagt actatcagtg cggcaagggt 3600cgtgacctcg gtttcggcac catcttgaac ttccagacca agatcggtac gggtatgggc 3660gagcagatcc tctcgcgcga gtactactat ctcggaacac aactgcccat cgatcgcttc 3720ctcacgttct actacgcgca cccgggtttc cagatcaaca acatgctggt catcctctcc 3780gtgcaggtct tcatcgttac catggtcttc ctcggtacct tgaagtcttc ggtcacgatc 3840tgcaagtaca cgtccagcgg tcagtacatc ggtggtcaat ccggttgcta caacctcgtc 3900ccggtcttcc agtggatcga gcgctgcatc atcagcatct tcttggtgtt catgatcgct 3960ttcatgccgc tcttcctgca agaactcgtc gagcgcggta cctggagtgc catctggcgt 4020ctgctcaagc agtttatgtc gctgtcgcct gtcttcgagg tgttctccac ccagattcag 4080acgcactccg tgttgagcaa cttgacgttc ggtggtgcgc gttacatcgc taccggtcgt 4140gggttcgcca ccagtcgtat cagcttcagc atcttgttct cgcgtttcgc aggcccgagt 4200atctacctcg gcatgcgcac gctcattatg ctgctctacg tgacgttgac gatctggacg 4260ccatgggtca tttacttctg ggtttccatt ctctcgctct gcatcgcgcc gttcttgttc 4320aacccgcatc aattcgtatt ctcggacttc ctcatcgact acagggaata cctgcggtgg 4380atgtcgcgtg gcaactcgcg ctcgcacaac aactcctgga ttgggtactg ccggttgtcc 4440cgcacgatga tcactgggta caagaagaag aagctgggcc acccgtcgga gaagctttcc 4500ggcgacgttc ctcgtgcagg ctggcgcgcc gtcttgttct cggagatcat cttcccggcg 4560tgcatggcca tcctcttcat catcgcgtac atgttcgtca agtcgttccc tctcgacggc 4620aagcagcctc cctccggcct cgttcgcatc gccgtcgtgt ctatcggccc catcgtgtgg 4680aacgccgcca tcctgttgac gctcttcctt gtgtcgttgt tcctcggccc catgctcgac 4740ccggtcttcc ccctcttcgg ttccgttatg gccttcatcg cgcatttcct tggcacaatc 4800ggaatgattg ggttcttcga gttcctgtgg ttcctcgagt cctgggaggc gtcgcatgcc 4860gtgctgggtc tcatcgccgt catctccatc cagcgcgcca ttcacaagat ccttatcgcc 4920gttttcctca gtcgcgagtt caagcacgac gagacgaaca gggcctggtg gactggtcgc 4980tggtatggcc gtggcctcgg cacgcacgcc atgtcgcagc cggcgcgtga gttcgtcgtc 5040aagatcatcg agttgtcgct ttggagctcg gatctcatac tcggccacat cctgctgttc 5100atgcttactc cggccgtcct catcccgtac ttcgaccgtt tgcacgccat gatgctcttc 5160tggctgcgtc cctcgaagca aatccgcgcg cctctgtact cgatcaagca gaagaggcaa 5220agacgctgga ttatcatgaa gtacggtact gtatacgtta ccgtcatcgc gatcttcgtc 5280gcgctcatcg cgcttcccct cgtattccga cacactctaa aggtcgagtg ctccctttgc 5340gacagcttgt aa 5352161783PRTSchizophyllum commune 16Met Pro Arg Pro Gly Gly Thr Ser Ala Glu Gly Gly Tyr Ala Ser Ser 1 5 10 15 Pro Ser Met Glu Thr Thr Pro Ser Asp Pro Phe Gly Thr Ala Asn Gly 20 25 30 Ala Pro Arg Arg Tyr Tyr Asp Asn Asp Ser Glu Glu Tyr Gly Pro Gly 35 40 45 Arg Arg Asp Thr Tyr Ala Ser Asp Ser Ser Asn Gln Gly Leu Thr Asp 50 55 60 Pro Gly Tyr Tyr Asp Gln Asn Gly Ala Tyr Asp Pro Tyr Pro Thr Gly 65 70 75 80 Asp Thr Asp Ser Asp Gly Asp Val Tyr Gly Gln Arg Tyr Gly Pro Ser 85 90 95 Ala Glu Ser Leu Gly Thr His Lys Phe Gly His Ser Asp Ser Ser Thr 100 105 110 Pro Thr Phe Val Asp Tyr Ser Ala Ser Ser Gly Gly Arg Asp Ser Tyr 115 120 125 Pro Ala Trp Thr Ala Glu Arg Asn Ile Pro Leu Ser Lys Glu Glu Ile 130 135 140 Glu Asp Ile Phe Leu Asp Leu Thr Gln Lys Phe Gly Phe Gln Arg Asp 145 150 155 160 Ser Met Arg Asn Met Phe Asp Phe Thr Met Gln Leu Leu Asp Ser Arg 165 170 175 Ala Ser Arg Met Thr Pro Asn Gln Ala Leu Leu Thr Leu His Ala Asp 180 185 190 Tyr Ile Gly Gly Gln His Ala Asn Tyr Arg Lys Trp Tyr Phe Ala Ala 195 200 205 Gln Leu Asp Leu Asp Asp Ala Val Gly Gln Thr Gln Asn Pro Gly Leu 210 215 220 Asn Arg Leu Lys Ser Thr Arg Gly Ser Gly Lys Arg Pro Arg His Glu 225 230 235 240 Lys Ser Leu Asn Thr Ala Leu Glu Arg Trp Arg Gln Ala Met Asn Asn 245 250 255 Met Ser Gln Tyr Asp Arg Leu Arg Gln Ile Ala Leu Tyr Leu Leu Cys 260 265 270 Trp Gly Glu Ala Ala Gln Val Arg Phe Met Pro Glu Cys Leu Cys Phe 275 280 285 Ile Phe Lys Cys Ala Asp Asp Tyr Tyr Arg Ser Pro Glu Cys Gln Asn 290 295 300 Arg Met Glu Pro Val Pro Glu Gly Leu Tyr Leu Arg Thr Val Val Lys 305 310 315 320 Pro Leu Tyr Arg Phe Val Arg Asp Gln Gly Tyr Glu Val Val Glu Gly 325 330 335 Lys Phe Val Arg Arg Glu Arg Asp His Asp Gln Ile Ile Gly Tyr Asp 340 345 350 Asp Val Asn Gln Leu Phe Trp Tyr Pro Glu Gly Ile Ala Arg Ile Val 355 360 365 Leu Ser Asp Lys Ser Arg Leu Val Asp Leu Pro Pro Ala Gln Arg Phe 370 375 380 Met Lys Phe Asp Arg Ile Glu Trp Asn Arg Val Phe Phe Lys Thr Phe 385 390 395 400 Tyr Glu Thr Arg Ser Phe Thr His Leu Leu Val Asp Phe Asn Arg Ile 405 410 415 Trp Val Val His Ile Ala Leu Tyr Phe Phe Tyr Thr Ala Tyr Asn Ser 420 425 430 Pro Thr Ile Tyr Ala Ile Asn Gly Asn Thr Pro Thr Ser Leu Ala Trp 435 440 445 Ser Ala Thr Ala Leu Gly Gly Ala Val Ala Thr Gly Ile Met Ile Leu 450 455 460 Ala Thr Ile Ala Glu Phe Ser His Ile Pro Thr Thr Trp Asn Asn Thr 465 470 475 480 Ser His Leu Thr Arg Arg Leu Ala Phe Leu Leu Val Thr Leu Gly Leu 485 490 495 Thr Cys Gly Pro Thr Phe Tyr Val Ala Ile Ala Glu Ser Asn Gly Ser 500 505 510 Gly Gly Ser Leu Ala Leu Ile Leu Gly Ile Val Gln Phe Phe Ile Ser 515 520 525 Val Val Ala Thr Ala Leu Phe Thr Ile Met Pro Ser Gly Arg Met Phe 530 535 540 Gly Asp Arg Val Ala Gly Lys Ser Arg Lys Tyr Leu Ala Ser Gln Thr 545 550 555 560 Phe Thr Ala Ser Tyr Pro Ser Leu Pro Lys His Gln Arg Phe Ala Ser 565 570 575 Leu Leu Met Trp Phe Leu Ile Phe Gly Cys Lys Leu Thr Glu Ser Tyr 580 585 590 Phe Phe Leu Thr Leu Ser Phe Arg Asp Pro Ile Arg Val Met Val Gly 595 600 605 Met Lys Ile Gln Asn Cys Glu Asp Lys Ile Phe Gly Ser Gly Leu Cys 610 615 620 Arg Asn His Ala Ala Phe Thr Leu Thr Ile Met Tyr Ile Met Asp Leu 625 630 635 640 Val Leu Phe Phe Leu Asp Thr Phe Leu Trp Tyr Val Ile Trp Asn Ser 645 650 655 Val Phe Ser Ile Ala Arg Ser Phe Val Leu Gly Leu Ser Ile Trp Thr 660 665 670 Pro Trp Arg Asp Ile Phe Gln Arg Leu Pro Lys Arg Ile Tyr Ala Lys 675 680 685 Leu Leu Ala Thr Gly Asp Met Glu Val Lys Tyr Lys Pro Lys Val Leu 690 695 700 Val Ser Gln Ile Trp Asn Ala Ile Ile Ile Ser Met Tyr Arg Glu His 705 710 715 720 Leu Leu Ser Ile Glu His Val Gln Lys Leu Leu Tyr His Gln Val Asp 725 730 735 Thr Gly Glu Ala Gly Lys Arg Ser Leu Arg Ala Pro Pro Phe Phe Val 740 745 750 Ala Gln Gly Ser Ser Gly Gly Ser Gly Glu Phe Phe Pro Pro Gly Ser 755 760 765 Glu Ala Glu Arg Arg Ile Ser Phe Phe Ala Gln Ser Leu Ser Thr Glu 770 775 780 Ile Pro Gln Pro Ile Pro Val Asp Ala Met Pro Thr Phe Thr Val Leu 785 790 795 800 Thr Pro His Tyr Ser Glu Lys Ile Leu Leu Ser Leu Arg Glu Ile Ile 805 810 815 Arg Glu Glu Asp Gln Asn Thr Arg Val Thr Leu Leu Glu Tyr Leu Lys 820 825 830 Gln Leu His Pro Val Glu Trp Glu Asn Phe Val Lys Asp Thr Lys Ile 835 840 845 Leu Ala Glu Glu Ser Ala Met Phe Asn Gly Pro Ser Pro Phe Gly Asn 850 855 860 Asp Glu Lys Gly Gln Ser Lys Met Asp Asp Leu Pro Phe Tyr Cys Ile 865 870 875 880 Gly Phe Lys Ser Ala Ala Pro Glu Tyr Thr Leu Arg Thr Arg Ile Trp 885 890 895 Ala Ser Leu Arg Ala Gln Thr Leu Tyr Arg Thr Val Ser Gly Met Met 900 905 910 Asn Tyr Ala Lys Ala Ile Lys Leu Leu Tyr Arg Val Glu Asn Pro Glu 915 920 925 Val Val Gln Gln Phe Gly Gly Asn Thr Asp Lys Leu Glu Arg Glu Leu 930 935 940 Glu Arg Met Ala Arg Arg Lys Phe Lys Phe Leu Val Ser Met Gln Arg 945 950 955 960 Tyr Ser Lys Phe Asn Lys Glu Glu His Glu Asn Ala Glu Phe Leu Leu 965 970 975 Arg Ala Tyr Pro Asp Leu Gln Ile Ala Tyr Leu Glu Glu Glu Pro Pro 980 985 990 Arg Lys Glu Gly Gly Asp Pro Arg Ile Phe Ser Ala Leu Val Asp Gly 995 1000 1005 His Ser Asp Ile Ile Pro Glu Thr Gly Lys Arg Arg Pro Lys Phe 1010 1015 1020 Arg Ile Glu Leu Pro Gly Asn Pro Ile Leu Gly Asp Gly Lys Ser 1025 1030 1035 Asp Asn Gln Asn His Ala Ile Val Phe Tyr Arg Gly Glu Tyr Leu 1040 1045 1050 Gln Leu Ile Asp Ala Asn Gln Asp Asn Tyr Leu Glu Glu Cys Leu 1055 1060 1065 Lys Ile Arg Asn Val Leu Ala Glu Phe Glu Glu Tyr Asp Val Ser 1070 1075 1080 Ser Gln Ser Pro Tyr Ala Gln Trp Ser Val Lys Glu Phe Lys Arg 1085 1090 1095 Ser Pro Val Ala Ile Val Gly Ala Arg Glu Tyr Ile Phe Ser Glu 1100 1105 1110 His Ile Gly Ile Leu Gly Asp Leu Ala Ala Gly Lys Glu Gln Thr 1115 1120 1125 Phe Gly Thr Leu Thr Ala Arg Asn Asn Ala Phe Leu Gly Gly Lys 1130 1135 1140 Leu His Tyr Gly His Pro Asp Phe Leu Asn Ala Leu Tyr Met Asn 1145 1150 1155 Thr Arg Gly Gly Val Ser Lys Ala Gln Lys Gly Leu His Leu Asn 1160 1165 1170 Glu Asp Ile Tyr Ala Gly Met Asn Ala Val Gly Arg Gly Gly Arg 1175 1180 1185 Ile Lys His Ser Glu Tyr Tyr Gln Cys Gly Lys Gly Arg Asp Leu 1190 1195 1200 Gly Phe Gly Thr Ile Leu Asn Phe Gln Thr Lys Ile Gly Thr Gly 1205 1210 1215 Met Gly Glu Gln Ile Leu Ser Arg Glu Tyr Tyr Tyr Leu Gly Thr 1220 1225 1230 Gln Leu Pro Ile Asp Arg Phe Leu Thr Phe Tyr Tyr Ala His Pro 1235 1240 1245 Gly Phe Gln Ile Asn Asn Met Leu Val Ile Leu Ser Val Gln Val 1250 1255 1260 Phe Ile Val Thr Met Val Phe Leu Gly Thr Leu Lys Ser Ser Val 1265 1270 1275 Thr Ile Cys Lys Tyr Thr Ser Ser Gly Gln Tyr Ile Gly Gly Gln 1280 1285 1290 Ser Gly Cys Tyr Asn Leu Val Pro Val Phe Gln Trp Ile Glu Arg 1295 1300 1305 Cys Ile Ile Ser Ile Phe Leu Val Phe Met Ile Ala Phe Met Pro 1310 1315 1320 Leu Phe Leu Gln Glu Leu Val Glu Arg Gly Thr Trp Ser Ala Ile 1325 1330 1335 Trp Arg Leu Leu Lys Gln Phe Met Ser Leu Ser Pro Val Phe Glu 1340 1345 1350 Val Phe Ser Thr Gln Ile Gln Thr His Ser Val Leu Ser Asn Leu 1355 1360 1365 Thr Phe Gly Gly Ala Arg Tyr Ile Ala Thr Gly Arg Gly Phe Ala 1370 1375 1380 Thr Ser Arg Ile Ser Phe Ser Ile Leu Phe Ser Arg Phe Ala Gly 1385 1390 1395 Pro Ser Ile Tyr Leu Gly Met Arg Thr Leu Ile Met Leu Leu Tyr 1400 1405 1410 Val Thr Leu Thr Ile Trp Thr Pro Trp Val Ile Tyr Phe Trp Val 1415 1420 1425 Ser Ile Leu Ser Leu Cys Ile Ala Pro Phe Leu Phe Asn Pro His 1430 1435 1440 Gln Phe Val Phe Ser Asp Phe Leu Ile Asp Tyr Arg Glu Tyr Leu 1445 1450 1455 Arg Trp Met Ser Arg Gly Asn Ser Arg Ser His Asn Asn Ser Trp 1460 1465 1470 Ile Gly Tyr Cys Arg Leu Ser Arg Thr Met Ile Thr Gly Tyr Lys 1475 1480 1485 Lys Lys Lys Leu Gly His Pro Ser Glu Lys Leu Ser Gly Asp Val 1490 1495 1500 Pro Arg Ala Gly Trp Arg Ala Val Leu Phe Ser Glu Ile Ile Phe 1505 1510 1515 Pro Ala Cys Met Ala Ile Leu Phe Ile Ile Ala Tyr Met Phe Val 1520 1525 1530 Lys Ser Phe Pro Leu Asp Gly Lys Gln Pro Pro Ser Gly Leu Val 1535 1540 1545 Arg Ile Ala Val Val Ser Ile Gly Pro Ile Val Trp Asn Ala Ala 1550 1555 1560 Ile Leu Leu Thr Leu Phe Leu Val Ser Leu Phe Leu

Gly Pro Met 1565 1570 1575 Leu Asp Pro Val Phe Pro Leu Phe Gly Ser Val Met Ala Phe Ile 1580 1585 1590 Ala His Phe Leu Gly Thr Ile Gly Met Ile Gly Phe Phe Glu Phe 1595 1600 1605 Leu Trp Phe Leu Glu Ser Trp Glu Ala Ser His Ala Val Leu Gly 1610 1615 1620 Leu Ile Ala Val Ile Ser Ile Gln Arg Ala Ile His Lys Ile Leu 1625 1630 1635 Ile Ala Val Phe Leu Ser Arg Glu Phe Lys His Asp Glu Thr Asn 1640 1645 1650 Arg Ala Trp Trp Thr Gly Arg Trp Tyr Gly Arg Gly Leu Gly Thr 1655 1660 1665 His Ala Met Ser Gln Pro Ala Arg Glu Phe Val Val Lys Ile Ile 1670 1675 1680 Glu Leu Ser Leu Trp Ser Ser Asp Leu Ile Leu Gly His Ile Leu 1685 1690 1695 Leu Phe Met Leu Thr Pro Ala Val Leu Ile Pro Tyr Phe Asp Arg 1700 1705 1710 Leu His Ala Met Met Leu Phe Trp Leu Arg Pro Ser Lys Gln Ile 1715 1720 1725 Arg Ala Pro Leu Tyr Ser Ile Lys Gln Lys Arg Gln Arg Arg Trp 1730 1735 1740 Ile Ile Met Lys Tyr Gly Thr Val Tyr Val Thr Val Ile Ala Ile 1745 1750 1755 Phe Val Ala Leu Ile Ala Leu Pro Leu Val Phe Arg His Thr Leu 1760 1765 1770 Lys Val Glu Cys Ser Leu Cys Asp Ser Leu 1775 1780 17620DNASchizophyllum commune 17atcgccattg taagccgcag acgggcacgc ttccaacccc catcgatggg cgctcgatgt 60ccatctcatc ggcgactcat cattgtatct cgcgcagtcc catccctcgc cgctcgcctg 120tagtttatgc tatttatctt tgcaccagtc gttgtattac tccctcgtcg tgtagaaagt 180accagataaa atgcatgtaa tcctaatgaa atttgcacga cacgaagatc cggcagggtt 240gtgggcaagg ggcagcggga acgaatggat ggcggggtac agcgagtacc cggcagtgcc 300acagtcagtg tcacacacgt gactgattgt ccattagcgt gaccgataac atcgatcaaa 360aattttattt cagaggacga taaataaggg ccgacggtgc gcgtccgtct ttctctcaac 420cctcatcttc ctctcgtctc tcactcttcc cccctccacc actaccaagt aagttcaaac 480ttcctctcat cgcctttgca cacatcgcct acgccccatc tctctccatc tgcctcgcga 540acggcgcccc catcgtcgct ttcccgcgcg agatcttgtg cgatctagtt tactgacaat 600ctcacctaga aaacatcaaa 62018440DNASchizophyllum commune 18atccaagtcc ggtggcaagg tcaccaagtc cgccgagaag gccgccaaga agaagtaaat 60gtagatgtac atatgtattt tctcattccg tttccttcct cttgttgttg tttcactggt 120cctctcgtgc tcgctcgcat cgcatacagc cattgttgtc accactataa cttcacgcat 180tctgtatttc atgccaggcg acggggtgtt cctgccaggc ctgtcgcttg ttgtaacgct 240aatgaaaagt cacgagtagt ggacgaacga cgatgtattt ctatgtgctg tagcgattat 300ccatttcgag ttcgccatcg agctctcttc aaacctaggt gcgacgttgt gaatgcagta 360gcaagtgcag agtattgcag actcgtccat tgatgataac ttcaagctac gtcagagcca 420gatgctactg aacccgggcc 4401936DNAArtificial sequenceUra_forw (NotI) primer 19ataagaatgc ggccgctcca gctcgacctt gcgccg 362030DNAArtificial sequenceUra_rev (XbaI) primer 20ctagtctaga ggatccgacg tggaggagcc 302130DNAArtificial sequenceTefP_forw (XbaI) primer 21ctagtctaga atcgccattg taagccgcag 302230DNAArtificial sequenceTefP_rev (SpeI) primer 22ctagactagt tttgatgttt tctaggtgag 302330DNAArtificial sequenceTefT_forw (SalI) primer 23acgcgtcgac caagtccggt ggcaaggtca 302431DNAArtificial sequenceTefT_rev (SalI) primer 24ccgacgtcga cgggttcagt agcatctggc t 312532DNAArtificial sequenceTefT_forw (EcoRV) primer 25catggtgata tccaagtccg gtggcaaggt ca 322632DNAArtificial sequenceTefT_rev (ApaI) primer 26ccgtatgggc ccgggttcag tagcatctgg ct 322730DNAArtificial sequenceGS1_forw (SpeI) primer 27ctagactagt cccgtccctc aaggccgttc 302836DNAArtificial sequenceGS1_rev (SalI) primer 28aatggccgac gtcgacatgg tatatgcaat gctatg 362930DNAArtificial sequenceFusion TefP_GS1_forw (XbaI) primer 29ctagtctaga atcgccattg taagccgcag 303036DNAArtificial sequenceFusion TefP_GS1_rev (SalI) primer 30aatggccgac gtcgacatgg tatatgcaat gctatg 363130DNAArtificial sequenceGS2_forw (SpeI) primer 31ctagactagt ctgtccaaag aagagatcga 303233DNAArtificial sequenceGS2_rev (EcoRV) primer 32tacatgcgat atcttttatg cagactctcc ctg 33331614DNASchizophyllum commune 33tccagctcga ccttgcgccg cttggagtaa cgttcagcgt cttcgtcgtc ctcgtcgcgc 60tcgtgtacga tgatgggctc agccatggca ggtatacaag ctcagagtca atgggggacg 120aggtctcaag ccgtgaaagt cgtcgtcgaa caacgtcaag ttcgagacgg accagagttg 180gatttcgtga ttagatctac gctcgatcac agaatgatca aagaacaaag cttgccaaaa 240ggggatctcc catcaacttc aacttgcccc aaaccatcat gaccgccgct cataagctca 300catacggtca gcgcgctgca aggttcacca atcccgcggc gaaagccctg ctggaaacca 360tggagcgcaa gaagagcaat ctatccgtca gcgtcgacgt cgtaaaatcc gccgatctgc 420tcgctattgt cgataccgtc gggccctata tctgtctgat aaaggcattg cactgtcgct 480tgcggtcttg ggatgctgct tatactctat gaagacccat gtggatgttg tcgaagactt 540cgactcgtcg ctcgtcacca agcttcaggc tctggccgag aagcatgatt tcctcatctt 600tgaggacaga aaattcgccg acataggtct gtccgtcgaa tctctatcga tgtcaactct 660gatgacttgc acaggcaaca ccgtcgctct gcagtactct agtggcgtgc acaaaattgc 720cagctggtcg cacatcacga acgcacaccc tgttccagga ccgtcaatca tcagtggcct 780cgcatcggta ggacaacccc tcggtcgcgg actcctcctg ctcgcagaga tgagcacgaa 840gggctcactt gcgacaggcg cgtacactga agccgccgtc cagatggcaa gggagaaccg 900cggcttcgtc atcgggttca tcgcccaacg gcggatggat ggtattggcg cgcctccagg 960ggtgaatgtc gaggacgagg attttcttgt cttgacacca ggtgtcggac tcgatgtgaa 1020gggcgatggg atggggcagc aatacaggac gccgaagcaa gtggtacagg aagatgggtg 1080cgatgtaatc atcgtgggtc gcgggattta tggcaaggac ccatcgaagg tggaagagat 1140acggaggcag gcagagcgtt accaggctgc aggatgggcg gcgtacattg agagggtcaa 1200cgccttggta tagctaatct gatcggtgtt gtcttgttaa gcgtcaggct caatggaacg 1260ctttggacga gcggagagta acttgaatta gcagtgtata cttcgggcaa atcaatcgtg 1320ataaatacaa gagcacgctc acgcacgtcc aatctccctc aaaatctcca tctttctcgc 1380ctcattcacc ttcctgaacc cagccggcga catctcgaac agaccatgcc cacccgacag 1440cgcacgcagc ctattcgagt agtccagcat ccggctgagc ggcgccaccg cctgcaccgc 1500gcgcttcatc ttcacgcccg ccgcctccct cgccgcagtg ccgccagagg gcgacaccca 1560ctccgggggc acgtacacgc cgtccgcagg gtacggctcc tccacgtcgg atcc 161434278PRTSchizophyllum commune 34Met Thr Ala Ala His Lys Leu Thr Tyr Gly Gln Arg Ala Ala Arg Phe 1 5 10 15 Thr Asn Pro Ala Ala Lys Ala Leu Leu Glu Thr Met Glu Arg Lys Lys 20 25 30 Ser Asn Leu Ser Val Ser Val Asp Val Val Lys Ser Ala Asp Leu Leu 35 40 45 Ala Ile Val Asp Thr Val Gly Pro Tyr Ile Cys Leu Ile Lys Thr His 50 55 60 Val Asp Val Val Glu Asp Phe Asp Ser Ser Leu Val Thr Lys Leu Gln 65 70 75 80 Ala Leu Ala Glu Lys His Asp Phe Leu Ile Phe Glu Asp Arg Lys Phe 85 90 95 Ala Asp Ile Gly Asn Thr Val Ala Leu Gln Tyr Ser Ser Gly Val His 100 105 110 Lys Ile Ala Ser Trp Ser His Ile Thr Asn Ala His Pro Val Pro Gly 115 120 125 Pro Ser Ile Ile Ser Gly Leu Ala Ser Val Gly Gln Pro Leu Gly Arg 130 135 140 Gly Leu Leu Leu Leu Ala Glu Met Ser Thr Lys Gly Ser Leu Ala Thr 145 150 155 160 Gly Ala Tyr Thr Glu Ala Ala Val Gln Met Ala Arg Glu Asn Arg Gly 165 170 175 Phe Val Ile Gly Phe Ile Ala Gln Arg Arg Met Asp Gly Ile Gly Ala 180 185 190 Pro Pro Gly Val Asn Val Glu Asp Glu Asp Phe Leu Val Leu Thr Pro 195 200 205 Gly Val Gly Leu Asp Val Lys Gly Asp Gly Met Gly Gln Gln Tyr Arg 210 215 220 Thr Pro Lys Gln Val Val Gln Glu Asp Gly Cys Asp Val Ile Ile Val 225 230 235 240 Gly Arg Gly Ile Tyr Gly Lys Asp Pro Ser Lys Val Glu Glu Ile Arg 245 250 255 Arg Gln Ala Glu Arg Tyr Gln Ala Ala Gly Trp Ala Ala Tyr Ile Glu 260 265 270 Arg Val Asn Ala Leu Val 275

Claims

1. A genetically modified microorganism capable of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, characterized in that said genetically modified microorganism overexpresses (i) a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase activity, wherein said polynucleotide comprises a nucleotide sequence having at least 70% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15, and/or (ii) a polypeptide having 1,3-.beta.-D-glucan synthase activity, wherein said polypeptide comprises an amino acid sequence having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16, compared to a corresponding non-modified control microorganism of the same strain.

2. The genetically modified microorganism of claim 1, wherein said polymer is selected from the group consisting of schizophyllan, scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran.

3. The genetically modified microorganism of claim 1, wherein said polynucleotide is a 1,3-.beta.-D-glucan synthase gene.

4. The genetically modified microorganism of claim 1, wherein said polynucleotide comprises a nucleotide sequence having at least 80% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15.

5. The genetically modified microorganism of claim 1, wherein said polynucleotide comprises a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15.

6. The genetically modified microorganism of claim 1, wherein said polypeptide is a 1,3-.beta.-D-glucan synthase.

7. The genetically modified microorganism of claim 1, wherein said polypeptide comprises an amino acid sequence having at least 80% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16.

8. The genetically modified microorganism of claim 1, wherein said polypeptide comprises an amino acid sequence having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16.

9. The genetically modified microorganism of claim 1, wherein said polynucleotide comprises the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15, or wherein said polynucleotide encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, or SEQ ID NO: 16.

10. The genetically modified microorganism of claim 1, wherein said microorganism is selected from the group consisting of Schizophyllum commune, Sclerotium rolfsii, Sclerotium glucanicum, Sclerotium delphinii, Porodisculus pendulus, Botrytis cinerea, Laminaria sp., Lentinula edoles, and Monilinia fructigena.

11. The genetically modified microorganism of claim 1, wherein said modified microorganism is able to produce at least 1.5 times more of said polymer compared to said non-modified control microorganism.

12. A method of producing a polymer consisting of a linear main chain of .beta.-D-(1-3)-glucopyranosyl units having a single .beta.-D-glucopyranosyl unit (1-6) linked to a .beta.-D-glucopyranosyl unit of the linear main chain with an average branching degree of about 0.3, said method comprising the steps of: (a) introducing a polynucleotide encoding a polypeptide having 1,3-.beta.-D-glucan synthase-activity into a microorganism being able to synthesize said polymer, wherein said polynucleotide comprises: (i) a nucleotide sequence having at least 70% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15; or (ii) a nucleotide sequence encoding a polypeptide having at least 70% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16, and wherein said polynucleotide is optionally downstream of a strong promoter thereby increasing the expression of said polynucleotide; (b) culturing said microorganism of (a) in a medium, thereby allowing said microorganism to produce said polymer; and (c) optionally recovering said polymer from the medium.

13. The method of claim 12, wherein said polymer is selected from the group consisting of schizophyllan, scleroglucan, pendulan, cinerian, laminarin, lentinan and pleuran.

14. The method of claim 12, wherein said polynucleotide is a 1,3-.beta.-D-glucan synthase gene.

15. The method of claim 12, wherein said polynucleotide comprises a nucleotide sequence having at least 80% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15.

16. The method of claim 12, wherein said polynucleotide encodes a 1,3-.beta.-D-glucan synthase.

17. The method of claim 12, wherein said polynucleotide encodes a polypeptide having at least 80% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16.

18. The method of claim 12, wherein said polynucleotide comprises: (a) a nucleotide sequence having at least 90% sequence identity to the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15; or (b) a nucleotide sequence encoding a polypeptide having at least 90% sequence identity to the amino acid sequence of SEQ ID NO: 8 or SEQ ID NO: 16.

19. The method of claim 12, wherein said polynucleotide comprises the nucleotide sequence of SEQ ID NO: 3, SEQ ID NO: 7, SEQ ID NO: 11, or SEQ ID NO: 15, or wherein said polynucleotide encodes a polypeptide comprising the amino acid sequence of SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 12, or SEQ ID NO: 16.

20. The method of claim 12, wherein said microorganism is selected from the group consisting of Schizophyllum commune, Sclerotium rolfsii, Sclerotium glucanicum, Sclerotium delphinii, Porodisculus pendulus, Botrytis cinerea, Laminaria sp., Lentinula edoles, and Monilinia fructigena.