U.S. patent application number 14/864655 was filed with the patent office on 2016-06-16 for pyrazolo pyrimidine derivatives and methods of use thereof.
The applicant listed for this patent is The Regents of the University of California. Invention is credited to Raynard L. Bateman, Alma L. Burlingame, Stephen G. DiMagno, Kirk Hansen, Kevan M. Shokat, Masahiro Tanaka, Chao Zhang.
Application Number | 20160168151 14/864655 |
Document ID | / |
Family ID | 34526201 |
Filed Date | 2016-06-16 |
United States Patent
Application |
20160168151 |
Kind Code |
A1 |
Tanaka; Masahiro ; et
al. |
June 16, 2016 |
PYRAZOLO PYRIMIDINE DERIVATIVES AND METHODS OF USE THEREOF
Abstract
This invention generally relates to pyrazolo pyrimidine
derivatives useful as, inter alia, inhibitors of short chain
dehydrogenase/reductase (SDR) family of NAD(P)(H) dependent
oxido-reductases. More specifically, the invention relates to
pyrazolo pyrimidine derivatives, including derivatives and analogs
of SDR inhibitors, pharmaceutical compositions containing
derivatives and analogs of SDR inhibitors, methods of making
derivatives and analogs of SDR inhibitors and methods of use
thereof.
Inventors: |
Tanaka; Masahiro; (San
Francisco, CA) ; Zhang; Chao; (San Francisco, CA)
; Shokat; Kevan M.; (San Francisco, CA) ;
Burlingame; Alma L.; (Sausalito, CA) ; Hansen;
Kirk; (San Mateo, CA) ; Bateman; Raynard L.;
(San Francisco, CA) ; DiMagno; Stephen G.;
(Lincoln, NE) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Regents of the University of California |
Oakland |
CA |
US |
|
|
Family ID: |
34526201 |
Appl. No.: |
14/864655 |
Filed: |
September 24, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14738169 |
Jun 12, 2015 |
|
|
|
14864655 |
|
|
|
|
14523581 |
Oct 24, 2014 |
|
|
|
14738169 |
|
|
|
|
14186486 |
Feb 21, 2014 |
|
|
|
14523581 |
|
|
|
|
13862348 |
Apr 12, 2013 |
|
|
|
14186486 |
|
|
|
|
13016957 |
Jan 28, 2011 |
|
|
|
13862348 |
|
|
|
|
12194469 |
Aug 19, 2008 |
|
|
|
13016957 |
|
|
|
|
10871732 |
Jun 18, 2004 |
7429596 |
|
|
12194469 |
|
|
|
|
60480501 |
Jun 20, 2003 |
|
|
|
Current U.S.
Class: |
514/262.1 ;
514/265.1; 544/262; 544/280 |
Current CPC
Class: |
A61P 3/00 20180101; A61P
35/04 20180101; A61P 35/00 20180101; A61P 3/04 20180101; A61P 3/10
20180101; C07D 487/04 20130101; A61P 29/00 20180101; A61P 35/02
20180101 |
International
Class: |
C07D 487/04 20060101
C07D487/04 |
Goverment Interests
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED
RESEARCH AND DEVELOPMENT
[0002] This invention was made with Government support under Grant
Nos. AI44009 and NCRR RR01614 awarded by the National Institutes of
Health. The Government has certain rights in the invention.
Claims
1. A compound of Formula I: ##STR00054## or a
pharmaceutically-acceptable salt thereof; wherein: Y is N; Z is
NR.sub.3R.sub.4, halo, H, OH, alkyl, alkyloxy, or haloalkyl;
R.sub.1a is benzyl or phenyl, wherein said benzyl or phenyl is
optionally substituted with one or two OH, --NR.sub.3R.sub.4,
--C(.dbd.O)NR.sub.6R.sub.7, --CN, NO.sub.2--C(.dbd.O)OH,
--C(.dbd.O)O-alkyl, (C.sub.1-C.sub.4)alkyl, haloalkyl or haloaryl;
R.sub.2 is C.sub.1-C.sub.6 alkyl or C.sub.4-C.sub.7 cycloalkyl,
wherein said alkyl or said cycloalkyl is optionally substituted
with mono- or di-alkoxy, mono- or di-halophenyl, mono- or
di-(C.sub.1-4)alkoxy phenyl, mono- or di-(C.sub.1-4)alkyl phenyl,
perhalo(C.sub.1-4)alkyl phenyl, carboxyl, tert-butyl carboxyl,
phosphoryl, (C.sub.1-6)alkyl, (C.sub.4-7)cycloalkyl, indolyl,
isoindolyl, pyridyl, naphthyl, pyrrolyl, imidazolyl, pyrazolyl,
pyridyl, pyrimidinyl, pyrazinyl, pyridazinyl, furyl, thienyl, or
alkylmorpholino; R.sub.3 and R.sub.4 are independently H,
C.sub.1-C.sub.6 alkyl, tert-butyloxycarbonyl,
morpholino(C.sub.1-C.sub.4)alkyl, carboxy(C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.4)alkoxycarbonyl(C.sub.1-C.sub.3)alkyl, aryl,
heteroaryl, aryloxy, heterocycle, cycloalkyl, alkenyl with the
proviso that the double bond of the alkenyl is not present at the
carbon atom that is directly linked to N, alkynyl with the proviso
that the triple bond of the alkynyl is not present at the carbon
atom that is directly linked to N, perfluoroalkyl,
--S(O).sub.2alkyl, --S(O).sub.2aryl, --(C.dbd.O)heteroaryl,
--(C.dbd.O)aryl, --(C.dbd.O)(C.sub.1-C.sub.6) alkyl,
--(C.dbd.O)cycloalkyl, --(C.dbd.O)heterocycle, alkyl-heterocycle,
aralkyl, arylalkenyl, --CON R.sub.6R.sub.7,
--SO.sub.2R.sub.6R.sub.7, arylalkoxyalkyl, arylalkylalkoxy,
heteroarylalkylalkoxy, aryloxyalkyl, heteroaryloxyalkyl,
aryloxyaryl, aryloxyheteroaryl, alkylaryloxyaryl,
alkylaryloxyheteroaryl, alkylaryloxyalkyamine, alkoxycarbonyl,
aryloxycarbonyl, or heteroaryloxycarbonyl; R.sub.6 and R.sub.7 are
independently H, alkyl, aryl, heteroaryl, alkylaryl, arylalkyl,
heteroarylalkyl, or alkylheteroaryl; provided the compound is not
1-tert-butyl-3-p-tolyl-1H-pyrazolo[3,4-d]pyrimidin-4-ylamine.
2. A compound according to claim 1, wherein R.sub.1a is benzyl
optionally substituted with mono, di or tri --OH.
3. A compound according to claim 1, wherein R.sub.1a is phenyl
optionally substituted with mono, di or tri-OH.
4. (canceled)
5. (canceled)
6. A compound according to claim 1, wherein R.sub.2 is
C.sub.1-C.sub.6 alkyl.
7. A compound according to claim 1, wherein Z is NR.sub.3R.sub.4;
and R.sub.3 and R.sub.4 are H.
8. A compound according to claim 1, wherein R.sub.2 is
C.sub.1-C.sub.6 alkyl optionally substituted with alkoxy.
9. A compound according to claim 1, wherein R.sub.6 is H and
R.sub.7 is methyl.
10. A compound according to claim 1, wherein, R.sub.1a is phenyl
optionally substituted with --CH.sub.3.
11. A compound according to claim 1, wherein R.sub.1a is phenyl
substituted with --NH.sub.2.
12.-14. (canceled)
15. A compound or pharmaceutically-acceptable salt according to
claim 1, wherein said compound has the formula: ##STR00055##
wherein R.sub.2 is isopropyl, tert-butyl, or ethoxyethyl.
16. A compound or pharmaceutically-acceptable salt according to
claim 15, wherein said compound has the formula: ##STR00056##
17. (canceled)
18.-19. (canceled)
20. A pharmaceutical composition, comprising: a pharmaceutically
acceptable carrier; and a compound or pharmaceutically-acceptable
salt according to claim 1.
21.-44. (canceled)
45. A compound or pharmaceutically-acceptable salt according to
claim 1, wherein said compound has the formula: ##STR00057##
wherein R.sub.2 is isopropyl, tert-butyl, or ethoxyethyl.
46. A compound or pharmaceutically-acceptable salt according to
claim 45, wherein said compound has the formula: ##STR00058##
47. A compound or pharmaceutically-acceptable salt according to
claim 1, wherein said compound has the formula: ##STR00059##
wherein R.sub.2 is isopropyl, tert-butyl, or ethoxyethyl.
48. A compound or pharmaceutically-acceptable salt according to
claim 47, wherein said compound has the formula: ##STR00060##
49. A compound or pharmaceutically-acceptable salt according to
claim 1, wherein said compound has the formula: ##STR00061##
Description
CROSS-REFERENCE TO RELATED APPLICATION
[0001] This application is a continuation of U.S. application Ser.
No. 14/738,169 filed Jun. 12, 2015, which is a continuation of U.S.
application Ser. No. 14/523,581 filed Oct. 24, 2014, which is a
continuation of U.S. application Ser. No. 14/186,486 filed Feb. 21,
2014, which is a continuation of U.S. application Ser. No.
13/862,348 filed Apr. 12, 2013, which is a continuation of U.S.
application Ser. No. 13/016,957 filed Jan. 28, 2011, which is a
continuation of U.S. application Ser. No. 12/194,469 filed Aug. 19,
2008, which is a continuation of U.S. application Ser. No.
10/871,732, filed Jun. 18, 2004, now U.S. Pat. No. 7,429,596, which
claims priority to U.S. Application No. 60/480,501, filed Jun. 20,
2003, the entire disclosures of which are incorporated herein by
reference.
REFERENCE TO A "SEQUENCE LISTING," A TABLE, OR A COMPUTER PROGRAM
LISTING APPENDIX SUBMITTED AS AN ASCII TEXT FILE
[0003] The Sequence Listing written in file 48536-504C07US
ST25.TXT, created Mar. 7, 2016, 12,171 bytes, machine format
IBM-PC, MS-Windows operating system, is hereby incorporated by
reference.
FIELD
[0004] This invention generally relates to pyrazolo pyrimidine
derivatives, including derivatives and analogs of inhibitors of
short chain dehydrogenase/reductase (SDR) family of NAD(P)(H)
dependent oxido-reductases. More specifically, the invention
relates to pyrazolo and pyrollo pyrimidine derivatives, including
derivatives and analogs of SDR inhibitors, pharmaceutical
compositions containing the pyrazolo pyrimidine derivatives, and
methods of making and methods of use thereof.
BACKGROUND
[0005] Cancer of the lung and bronchus (lung cancer) is the second
most common cancer among both men and women and is the leading
cause of cancer death in both sexes. Among men, age-adjusted lung
cancer incidence rates (per 100,000) range from a low of about 14
to a high of 117, an eight-fold difference, depending upon
ethnicity. The rates among men are about two to three times greater
than the rates among women in each of the racial/ethnic groups.
[0006] Leukemia and lymphoma are the most common fatal cancers in
young men under age 39. Leukemia, Hodgkin and non-Hodgkin lymphoma
and myeloma are cancers that originate in the bone marrow or
lymphatic tissues. An estimated 106,300 people in the United States
will be diagnosed with leukemia, lymphoma or myeloma in 2002. New
cases of leukemia, Hodgkin and non-Hodgkin lymphoma and myeloma
account for 8.3 percent of the 1,284,900 new cancer cases diagnosed
in the United States this year. See Surveillance, Epidemiology and
End Results (SEER) Program 1979-1998, National Cancer Institute;
American Cancer Society.
[0007] An estimated 616,695 Americans are currently living with
leukemia, Hodgkin and non-Hodgkin lymphoma and myeloma. Leukemia,
lymphoma and myeloma will cause the deaths of an estimated 58,300
people in the United States this year. These blood cancers will
account for nearly 10.5 percent of the deaths from cancer in 2002
based on the total of 555,500 cancer-related deaths (all
sites).
[0008] The short chain dehydrogenase/reductase (SDR) family of
NAD(P)(H) dependent oxido-reductases are believed to have a role in
disease, for example, cancer, inflammatory disease, and diabetes.
The SDR family represents a diverse family of >63 human proteins
(Oppermann, U. C., et al., Chem Biol Interact, 130-132: 699-705,
2001. Kallberg, Y., et al., Eur J Biochem, 269: 4409-17, 2002.
Kallberg, Y., et al., Protein Sci, 11: 636-41, 2002). These enzymes
are responsible for the oxidation or reduction of a wide range of
endogenous (prostaglandins, steroid hormones, retinal,
dihydropteridin, UDP, and trans 2-enoyl CoA) and exogenous
chemicals (anthracyclin drugs, quininones, and others). The SDR
family members thus control the cell specific
production/destruction of potent hormones as well as the
detoxification of important classes of drugs such as the
anti-cancer agent adriamycin (Forrest, G. L. et al., Chem Biot
Interact, 129: 21-40, 2000).
[0009] Carbonyl reductase (CBR) (NADPH: secondary-alcohol
oxidoreductase) is part of a group of NADPH-dependent cytosolic
enzymes called short chain dehydrogenase/reductase (SDR) that
catalyze the reduction of various carbonyl compounds to their
corresponding alcohols. The enzyme is ubiquitous in nature and acts
on a large number of biologically and pharmacologically active
compounds. Carbonyl reductase is believed to function
physiologically as a dehydrogenase or reductase of prostaglandins
or hydroxysteroids, as well as in drug metabolism.
[0010] Carbonyl reductase is primarily monomeric in structure, and
has been characterized in humans from placenta, liver, and breast
tissue. CBR bears a low overall degree of homology (24-36%) with
other SDR enzymes from mammalian sources such as mouse and pig
(Nakanishi, M. et al. Biochem. Biophys. Acta 194: 1311-16, 193).
However, all of these enzymes are linked by two common consensus
sequences; the sequence TGxxxGxG, found in the N-terminal portion
of the molecule and responsible for binding the NADPH co-enzyme,
and the sequence YxxxK, located close to the C-terminal end of the
molecule, and active in carbonyl reduction. Differences in amino
acid sequences between these enzymes can be responsible, in part,
for differences in their respective substrate specificities for
various carbonyl compounds.
[0011] The bioreduction of prostaglandin (PGE) by carbonyl
reductase serves to regulate cellular levels of PGE. A wide variety
of biological activities are ascribed to PGEs including smooth
muscle contraction, platelet aggregation, inflammation, inhibition
of insulin secretion, and lymphocyte function. Excessive PGE
production is associated with inflammatory diseases, diabetes, and
suppression of the immune response. Inhibitors of PGE biosynthesis,
such as indomethacin and ibuprofen, are commonly used to treat
inflammation and inflammatory diseases and depressed cellular
immunity in patients with conditions such as Hodgkin's disease
(Isselbacher K. J. et al. Harrison's Principles of Internal
Medicine, Vol. 1: 431-435, 1994, McGraw-Hill, New York City).
[0012] In human liver, carbonyl reductase also reduces quinones, an
important class of mutagens and carcinogens, and appears to be the
principle mechanism for detoxification of these compounds. CBR
production is stimulatedby carcinogens such as butyl hydroxyanisole
and beta-naphthoflavone that also induce other cancer-protective
enzymes (Forrest, G. L. et al. Biochim. Biophys. Acta 1048: 149-55,
1990).
[0013] Human carbonyl reductase 1 (CBR1) has been characterized as
having similarity to carbonyl reductases from porcine lung (GI
416425), mouse adipocytes (GI 50004), and human liver (GI 118519).
Human CBR1 is 85% identical to porcine carbonyl reductase. The role
of carbonyl reductase in cells is not understood.
[0014] Carbonyl reductase is also involved in the metabolism of
anthracyclines, a widely used class of anticancer chemotherapeutic
drugs. Daunorubicin (DNR) and Doxorubicin (DXR), the two principle
anthracyclines used in cancer chemotherapy, are reduced to their
respective alcohols by carbonyl reductase. The alcohol products are
much less effective antitumor agents than the parent compounds. In
fact, increased carbonyl reductase levels associated with some
anthracycline resistant tumors suggest that increased carbonyl
reductase activity may be responsible for drug resistance in these
cells (Soldan, M. et al. Biochem. Pharmacol. 51: 116-23, 1996;
Gonzalez, B. et al. Cancer Res. 55: 4646-50, 1995). Another problem
of anthracyclines is cardiotoxicity, but the causative agents are
suggested to be the alcohol products of carbonyl reductase
catalyzed reaction. (Forrest, G. L. et al., Chem Biot Interact,
129: 21-40, 2000.)
[0015] Daunorubicin is one of the family of anthracycline
antibiotic drugs that include daunorubicin, doxorubicin,
epirubicin, and idarubicin. These drugs are used in the treatment
of acute leukemia, lymphomas, and myeloma. Daunorubicin is used to
treat acute myeloid leukemia, acute lymphocytic leukemia, chronic
myelogenous leukemia, neuroblastoma. Liposomal daunorubicin belongs
to the general group of medicines known as antineoplastics. It is
used to treat advanced acquired immunodeficiency syndrome
(AIDS)--associated Kaposi's sarcoma (KS),
[0016] Molecules that inhibit short chain dehydrogenase/reductase
(SDR) family of NAD(P)(H) dependent oxido-reductases, for example,
carbonyl reductase, satisfy a need in the art by providing new
diagnostic or therapeutic compositions useful in the prevention and
treatment of inflammation, immunological disorders, cancer, and
drug resistance in cancerous cells, and reducing toxicity
associated with CBR catalyzed metabolites of known drugs.
SUMMARY
[0017] The invention is generally related to inhibitors of short
chain dehydrogenase/reductase (SDR) family of NAD(P)(H) dependent
oxido-reductases, and derivatives and analogs thereof. The
invention further relates to pharmaceutical compositions containing
the inhibitors of SDR family of NAD(P)(H) dependent
oxido-reductases, and derivatives and analogs thereof, methods of
making the inhibitors of SDR family of NAD(P)(H) dependent
oxido-reductases and derivatives and analogs thereof, and methods
of use thereof.
[0018] In one embodiment, the present invention is directed to a
compound of Formula I or II:
##STR00001##
[0019] or a pharmaceutically-acceptable salt or prodrug
thereof;
[0020] wherein: [0021] Y is N or CR.sub.5; [0022] Z is
NR.sub.3R.sub.4, halo, H, OH, alkyl, alkyloxy, or haloalkyl; [0023]
R.sub.1a is indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl,
pyrrolyl, or phenyl, wherein said phenyl is substituted with at
least one of OH, --NR.sub.3R.sub.4, --C(.dbd.O)NR.sub.6R.sub.7,
--CN, NO.sub.2--C(.dbd.O)OH, --C(.dbd.O)O-alkyl,
(C.sub.1-C.sub.4)alkyl, halo, haloalkyl or haloaryl; and wherein
said indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl, or
pyrrolyl is optionally substituted with OH, --NR.sub.3R.sub.4,
--C(.dbd.O)NR.sub.6R.sub.7, --CN, NO.sub.2, --C(.dbd.O)O--R.sub.3,
(C.sub.1-C.sub.4)alkyl, halo, haloalkyl or haloaryl; [0024]
R.sub.1b is indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl,
pyrrolyl, or phenyl wherein said indoyl, thiazolyl, benzyl,
biphenylyl, thiophenyl, pyrrolyl, phenyl is optionally substituted
with --OH, --NR.sub.3R.sub.4, --C(.dbd.O)NR.sub.6R.sub.7, --CN,
NO.sub.2, --C(.dbd.O)O--R.sub.3, (C.sub.1-C.sub.4)alkyl, halo,
haloalkyl, or haloaryl; [0025] R.sub.2 is C.sub.1-C.sub.6 alkyl or
C.sub.4-C.sub.7 cycloalkyl, wherein said alkyl or said cycloalkyl
is optionally substituted with mono- or di-alkoxy, mono- or
di-halophenyl, mono- or di-(C.sub.1-4)alkoxy phenyl, mono- or
di-(C.sub.1-4)alkyl phenyl, perhalo(C.sub.1-4)alkyl phenyl,
carboxyl, tert-butyl carboxyl, phosphoryl, (C.sub.1-6)alkyl,
(C.sub.4-7)cycloalkyl, indolyl, isoindolyl, pyridyl, naphthyl,
pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrimidinyl, pyrazinyl,
pyridazinyl, furyl, thienyl, or alkylmorpholino; [0026] R.sub.3 and
R.sub.4 are independently H, C.sub.1-C.sub.6 alkyl, t-Boc,
morpholino(C.sub.1-C.sub.4)alkyl, carboxy(C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.4)alkoxycarbonyl(C.sub.1-C.sub.3)alkyl, aryl,
heteroaryl, aryloxy, heterocycle, cycloalkyl, alkenyl with the
proviso that the double bond of the alkenyl is not present at the
carbon atom that is directly linked to N, alkynyl with the proviso
that the triple bond of the alkynyl is not present at the carbon
atom that is directly linked to N, perfluoroalkyl,
--S(O).sub.2alkyl, --S(O).sub.2aryl, --(C.dbd.O)heteroaryl,
--(C.dbd.O)aryl, --(C.dbd.O)(C.sub.1-C.sub.6) alkyl,
--(C.dbd.O)cycloalkyl, --(C.dbd.O)heterocycle, alkyl-heterocycle,
aralkyl, aryl alkenyl, --CON R.sub.6R.sub.7,
--SO.sub.2R.sub.6R.sub.7, arylalkoxyalkyl, arylalkylalkoxy,
heteroarylalkylalkoxy, aryloxyalkyl, heteroaryloxyalkyl,
aryloxyaryl, aryloxyheteroaryl, alkylaryloxyaryl,
alkylaryloxyheteroaryl, alkylaryloxyalkyamine, alkoxycarbonyl,
aryloxycarbonyl, or heteroaryloxycarbonyl; [0027] R.sub.5 are
independently H, --OH, halo, optionally monosubstituted
(C.sub.1-C.sub.6)alkyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkoxycarbonyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkanoyl, carbamoyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkyl carbamoyl, phenyl, halophenyl, optionally
monosubstituted (C.sub.1-C.sub.4)alkylphenyl, optionally
monosubstituted (C.sub.1-C.sub.4)alkoxyphenyl, or optionally
monosubstituted perhalo(C.sub.1-C.sub.4)alkylphenyl, wherein said
optional substitution is (C.sub.1-C.sub.4)alkyl, OH, or halogen;
[0028] R.sub.6 and R.sub.7 are independently H, alkyl, aryl,
heteroaryl, alkylaryl, arylalkyl, heteroarylalkyl, or
alkylheteroaryl; [0029] provided the compound is not
1-tert-butyl-3-p-tolyl-1H-pyrazolo[3,4-d]pyrimidin-4-ylamine.
[0030] In another embodiment, the present invention is directed to
a method for preventing or treating cancer in a mammal, comprising
the step of administering to the mammal an effective amount of a
compound of formula I or formula II, or a pharmaceutically
acceptable salt thereof.
[0031] In yet another embodiment, the present invention is directed
to a method for preventing or treating a disease or condition
associated with carbonyl reductase 1 in a mammal in need thereof,
comprising the steps of administering to the mammal a composition
comprising an effective amount of a compound of formula I or
formula II, or a pharmaceutically acceptable salt thereof.
[0032] In yet another embodiment, the present invention is directed
to a method of preventing or treating a disease or condition
associated with the synthesis of prostaglandin E in a mammal in
need thereof comprising the steps of administering to the mammal a
composition comprising an effective amount of a compound of formula
I or formula II, or a pharmaceutically acceptable salt thereof, and
inhibiting synthesis of prostaglandin E2.
[0033] In a further embodiment, the present invention is directed
to a method for preventing or treating a disease or condition
associated with short chain dehydrogenase/reductase (SDR) family of
NAD(P)(H) dependent oxido-reductases in a mammal in need thereof,
comprising the step of administering to the mammal an effective
amount of a composition comprising an effective amount of a
compound of formula I or formula II, or a pharmaceutically
acceptable salt thereof.
[0034] In a further embodiment, the present invention is directed
to a method for identifying a therapeutic cancer treatment,
comprising the steps of contacting a tumor cell culture with an
effective amount of a composition comprising an effective amount of
a compound of formula I or formula II, or a pharmaceutically
acceptable salt thereof, measuring growth inhibition of the tumor
cells in culture; and identifying a therapeutic cancer treatment
for a mammalian subject by inhibition of the tumor cell growth in
culture.
BRIEF DESCRIPTION OF THE DRAWINGS
[0035] FIG. 1 shows the role of CBR in the biosynthesis of
prostaglandins.
[0036] FIG. 2 shows enzymatic activity of 11.beta.-hydroxysteroid
dehydrogenase I and 11.beta.-hydroxysteroid dehydrogenase II.
[0037] FIG. 3 shows enzymatic activity of carbonyl reductase 1
(CBR1) on daunorubicin.
[0038] FIG. 4 shows AB129 inhibits menadione reducing activity of
carbonyl reductase 1 (CBR1).
[0039] FIG. 5 shows kinetic analysis of carbonyl reductase 1
(CBR1). Sequence listing Carbonyl reductase 1 cDNA gi:4502598):
TABLE-US-00001 (SEQ ID NO: 1)
cagactcgagcagtctctggaacacgctgcggggctcccgggcctgagc
caggtctgttctccacgcaggtgttccgcgcgccccgttcagccatgtc
gtccggcatccatgtagcgctggtgactggaggcaacaagggcatcggc
ttggccatcgtgcgcgacctgtgccggctgttctcgggggacgtggtgc
tcacggcgcgggacgtgacgcggggccaggcggccgtacagcagctgca
ggcggagggcctgagcccgcgcttccaccagctggacatcgacgatctg
cagagcatccgcgccctgcgcgacttcctgcgcaaggagtacgggggcc
tggacgtgctggtcaacaacgcgggcatcgccttcaaggttgctgatcc
cacaccctttcatattcaagctgaagtgacgatgaaaacaaatttcttt
ggtacccgagatgtgtgcacagaattactccctctaataaaaccccaag
ggagagtggtgaacgtatctagcatcatgagcgtcagagcccttaaaag
ctgcagcccagagctgcagcagaagttccgcagtgagaccatcactgag
gaggagctggtggggctcatgaacaagtttgtggaggatacaaagaagg
gagtgcaccagaaggagggctggcccagcagcgcatacggggtgacgaa
gattggcgtcaccgttctgtccaggatccacgccaggaaactgagtgag
cagaggaaaggggacaagatcctcctgaatgcctgctgcccagggtggg
tgagaactgacatggcgggacccaaggccaccaagagcccagaagaagg
tgcagagacccctgtgtacttggcccttttgcccccagatgctgagggt
ccccatggacaatttgtttcagagaagagagttgaacagtggtgagctg
ggctcacagctccatccatgggccccattttgtaccttgtcctgagttg
gtccaaagggcatttacaatgtcataaatatccttatataagaaaaaaa
atgatctcttatcaattagcactcactaatgtactactaattgagcaac
ctacgcactcagttgactacgtaaatctgtcaggtcttttgtgatttcc
tctgatgcaggagaggaaaaattgtaattgatgaaaataatgaatgaaa
atcaacagatgaataaatggttctttataagtg.
[0040] FIG. 6 shows selection of RNAi hairpins for targeting of
carbonyl reductase 1 (CBR1).
[0041] FIG. 7 shows carbonyl reductase 1 (CBR1) is required for
A549 lung carcinoma cell viability.
[0042] FIG. 8 shows the structure of glycyrrizic acid.
[0043] FIG. 9 shows the structure of (1) AB129, (2) PP1, (3) AB60,
and (4) AB61.
[0044] FIG. 10 shows that AB129 causes a morphological change in
human lung carcinoma cells.
[0045] FIG. 11 shows effects of AB129 on cell cycle of A549 lung
carcinoma cells.
[0046] FIG. 12 shows probes for an affinity experiment to identify
AB129 target.
[0047] FIG. 13 shows an affinity experiment using A549 lung
carcinoma cell lysate. Title: Pull-Down experimental using A549
cell lysate.
[0048] FIG. 14 shows protein identification by collision induced
dissociation mass spectrometry (LC/MS/MS). Title: Protein
identification by collision induced dissociation mass spectrometry
(LC/MS/MS). Sequence legend: LFSGDVVLTAR (SEQ ID NO:2);
VADPTPFHIQAEVTMK (SEQ ID NO:3).
[0049] FIG. 15 shows amino acid sequence identification of trypsin
digest by mass spectrometry. Sequence legends: GIGLAIVR (SEQ ID
NO:4); LFSGDVVLTAR (SEQ ID NO:5); GQAAVQQLQAEGLSPR (SEQ ID NO:6);
FHQLDIDDLQSIR (SEQ ID NO:7); ALRDFLR (SEQ ID NO:8);
VADPTPFHIQAEVTMK (SEQ ID NO:9); VADPTPFHIQAEVTM(Oxidized)K (SEQ ID
NO:10); VVNVSSIMSVR (SEQ ID NO:11); VVNVSSIM(oxidized)SVR (SEQ ID
NO:12); IGVTVLSR (SEQ ID NO:13).
[0050] FIG. 16 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of SIGVSNFNR (SEQ ID NO:14); found
in AKC3 HUMAN (P42330) Aldo-keto reductase family 1 member C3.
[0051] FIG. 17 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of TPALIALR (SEQ ID NO:15); found in
AKC3 HUMAN (P42330) Aldo-keto reductase family 1 member C3.
[0052] FIG. 18 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of VLSIQSHVIR (SEQ ID NO:16); found
in PDXK HUMAN (000764) Pyridoxal kinase (EC 2.7.1.35).
[0053] FIG. 19 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of TVSTLHHVLQR (SEQ ID NO:17); found
in PDXK HUMAN (000764) Pyridoxal kinase (EC 2.7.1.35).
[0054] FIG. 20 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of NPAGSVVMER (SEQ ID NO:18); found
in PDXK HUMAN (000764) Pyridoxal kinase (EC 2.7.1.35).
[0055] FIG. 21 shows mass spectrometric identification of protein
fragments. MS/MS fragmentation of VMLGETNPADSKPGTTR (SEQ ID NO:19);
found in NDKB HUMAN (P22392) Nucleoside diphosphate kinase B.
[0056] FIG. 22 kinetic parameters of AB129 inhibition of carbonyl
reductase 1 (CBR1).
[0057] FIG. 23 shows a molecular model for docking of AB129 within
porcine carbonyl reductase 1 (CBR1).
[0058] FIG. 24 shows conserved amino acid residues in short chain
dehydrogenase/reductase (SDR) enzymes. Sequence legend:
SSNTRVALVTGANKGIGFAIVRD (SEQ ID NO:20); SSGIHVALVTGGNKGIGLAIVRD
(SEQ ID NO:21); SSCSRVALVTGANRGIGLAIARE (SEQ ID NO:22);
ARTVVLITGCSSGIGLHLAVRLASD (SEQ ID NO:23);
YYSANEEFRPEMLQGKKVIVTGASKG (SEQ ID NO:24);
ARALLQLLRSDLRLGRPLLAALALLAALDW (SEQ ID NO:25);
LVNNAAIAFQLDNPTPFHIQAELTMKTNFMGT (SEQ ID NO:26);
LVNNAGIAFKVADPTPFHIQAEVTMKTNFFGT (SEQ ID NO:27);
LVNNAAVAFKSDDPMPFDIKAEMTLKTNFFAT (SEQ ID NO:28);
LVCNAGLGLLGPLEALGEDAVASVLDVNVVGT (SEQ ID NO:29);
LILNHITNTSLNLFHDDIHHVRKSMEVNFLSY (SEQ ID NO:30);
GLVNNAGHNEVVADAELSPVATFRSCMEVNFFGA (SEQ ID NO:31).
[0059] FIG. 25 shows sequence alignment of NADPH binding pocket in
SDR enzymes. Sequence legend: MSSGIHVALVTGGNKGTGLATVRDLC (SEQ ID
NO:32); ARTVVLITGCSSGIGLHLAVRLA (SEQ ID NO:33);
EMLQGKKVIVTGASKGIGREMAYHLA (SEQ ID NO:34); GGLDVLVNNAGI (SEQ ID
NO:35); GRVDVLVCNAGL (SEQ ID NO:36); GGLDMLILNHIT (SEQ ID NO:37);
NVSSIMSVRAAYGVTKI (SEQ ID NO:38); VTGSVGGLMGVYCASKF (SEQ ID NO:39);
VVSSLAGKVAAYSASKF (SEQ ID NO:40); VRTDMAG (SEQ ID NO:41); DRTDIHT
(SEQ ID NO:42); IDTETAM (SEQ ID NO:43).
[0060] FIG. 26 shows a Rossman fold of SDR enzymes.
[0061] FIG. 27 shows effects on inhibition by mutation at Asn90 of
carbonyl reductase 1 (CBR1). Asn90 is imporant for the binding of
AB129.
[0062] FIG. 28 shows Asn90 has a role for binding of AB129 to
carbonyl reductase 1 (CBR1).
[0063] FIG. 29 shows N90V mutant of carbonyl reductase 1 (CBR1) is
less sensitive to AB129 than wild type CBR1. PP1 did not inhibit
both enzymes at 16 uM.
[0064] FIG. 30 shows glutathione-modified eicosanoids.
[0065] FIG. 31 shows glutathione binding activity of wild type and
mutant carbonyl reductase 1 (CBR1).
[0066] FIG. 32 shows carbonyl reductase (CBR) can cause
anthracycline resistance.
[0067] FIG. 33 shows that AB129 reinforces the cytotoxicity of
daunorubicin.
[0068] FIG. 34 shows AB129 analogs display differing selectivities
for carbonyl reductase (CBR) and kinases.
[0069] FIG. 35 shows potential library substituents for inhibitors
of SDR enzymes.
[0070] FIG. 36 shows pyrrolopyrimidine scaffold validation. Analogs
of AB129 that possess an isopropyl group at R.sup.2 were prepared.
Compounds possessing identical substituents with both a
pyrazolopyrimidin *(RB2) and a pyrrolopyrimidine scaffold were
prepared.
[0071] FIG. 37 shows solid phase pyrrolopyrimidine library
synthesis.
[0072] FIG. 38 shows scaffold loading optimization.
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0073] With respect to pyrazolo pyrimidine or, "derivative" refers
to a compound of general formula I or II:
##STR00002##
[0074] where the variables are as defined herein.
[0075] With respect to pyrazolo pyrimidine or AB-129 compound,
"analog" or "functional analog" refers to a modified form of the
respective pyrazolo pyrimidine or AB-129 compound derivative in
which one or more chemically derivatized functional substituent
(R.sub.1a, R.sub.1b, R.sub.2, R.sub.3, R.sub.4 or Z) or a ring atom
(Y) has been modified such that the analog retains substantially
the same biological activity or improved biological activity as the
unmodified pyrazolo pyrimidine or AB-129 compound derivative in
vivo and/or in vitro.
[0076] The present invention is directed to pyrazolo pyrimidine
derivatives, compositions containing these derivatives, and methods
of their use for the prevention and treatment of, inter alia,
cancer, metastatic cancer, inflammation, and diabetes.
[0077] The following definitions are provided for the full
understanding of terms and abbreviations used in this
specification.
[0078] As used herein and in the appended claims, the singular
forms "a," "an," and "the" include the plural reference unless the
context clearly indicates otherwise. Thus, for example, a reference
to "an antagonist" or "an agonist" includes a plurality of such
antagonists or a plurality of such agonists, and a reference to "a
compound" is a reference to one or more compounds and equivalents
thereof known to those skilled in the art, and so forth.
[0079] The abbreviations in the specification correspond to units
of measure, techniques, properties, or compounds as follows: "min"
means minutes, "h" means hour(s), ".mu.L" means microliter(s), "mL"
means milliliter(s), "mM" means millimolar, "M" means molar,
"mmole" means millimole(s), "cm" means centimeters, "SEM" means
standard error of the mean and "IU" means International Units,
".degree. C." means degrees Celcius. "AED.sub.50 value" means dose
which results in 50% alleviation of the observed condition or
effect (50% mean maximum endpoint), ".DELTA.ID.sub.50" means dose
which results in 50% inhibition of an observed condition or effect
or biochemical process (50% mean maximum endpoint).
[0080] "Alkyl" refers to an optionally substituted, saturated
straight, branched, or cyclic hydrocarbon having from about 1 to
about 20 carbon atoms (and all combinations and subcombinations of
ranges and specific numbers of carbon atoms therein), with from
about 1 to about 8 carbon atoms, herein referred to as "lower
alkyl", being preferred. Alkyl groups include, but are not limited
to, methyl, ethyl, n-propyl, isopropyl, n-butyl, isobutyl, t-butyl,
n-pentyl, cyclopentyl, isopentyl, neopentyl, n-hexyl, isohexyl,
cyclohexyl, cyclooctyl, adamantyl, 3-methylpentyl,
2,2-dimethylbutyl, and 2,3-dimethylbutyl. Lower alkyl refers to
alkyl having 1 to 4 carbon atoms.
[0081] "Cycloalkyl" refers to an optionally substituted, alkyl
group having one or more rings in their structures having from
about 3 to about 20 carbon atoms (and all combinations and
subcombinations of ranges and specific numbers of carbon atoms
therein), with from about 3 to about 10 carbon atoms being
preferred. Multi-ring structures can be bridged or fused ring
structures. Groups include, but are not limited to, cyclopropyl,
cyclobutyl, cyclopentyl, cyclohexyl, cyclooctyl, and adamantyl.
Specifically included within the definition of "cyclic alkyl" are
those aliphatic hydrocarbon chains that are optionally
substituted.
[0082] "Perfluorinated alkyl" refers to an alkyl, as defined above,
in which the hydrogens directly attached to the carbon atoms are
completely replaced by fluorine.
[0083] "Alkenyl" refers to an alkyl group of at least two carbon
atoms having one or more double bonds, wherein alkyl is as defined
herein. Alkenyl groups can be optionally substituted.
[0084] "Alkynyl" refers to an alkyl group of at least two carbon
atoms having one or more triple bonds, wherein alkyl is as defined
herein. Alkynyl groups can be optionally substituted.
[0085] "Aryl" as used herein, refers to an optionally substituted,
mono-, di-, tri-, or other multicyclic aromatic ring system having
from about 5 to about 50 carbon atoms (and all combinations and
subcombinations of ranges and specific numbers of carbon atoms
therein), with from about 6 to about 10 carbons being preferred.
Non-limiting examples include, for example, phenyl, naphthyl,
anthracenyl, and phenanthrenyl.
[0086] "Heteroaryl" refers to an optionally substituted, mono-,
di-, tri-, or other multicyclic aromatic ring system that includes
at least one, and preferably from 1 to about 4 sulfur, oxygen, or
nitrogen heteroatom ring members. Heteroaryl groups can have, for
example, from about 3 to about 50 carbon atoms (and all
combinations and subcombinations of ranges and specific numbers of
carbon atoms therein), with from about 4 to about 10 carbons being
preferred. Non-limiting examples of heteroaryl groups include, for
example, pyrryl, furyl, pyridyl, 1,2,4-thiadiazolyl, pyrimidyl,
thienyl, isothiazolyl, imidazolyl, tetrazolyl, pyrazinyl,
pyrimidyl, quinolyl, isoquinolyl, thiophenyl, benzothienyl,
isobenzofuryl, pyrazolyl, indolyl, purinyl, carbazolyl,
benzimidazolyl, and isoxazolyl.
[0087] "Heterocyclic ring" refers to a stable 5- to 7-membered
monocyclic or bicyclic or 7- to 10-membered bicyclic heterocyclic
ring that is saturated, partially unsaturated or unsaturated
(aromatic), and which contains carbon atoms and from 1 to 4
heteroatoms independently selected from the group consisting of N,
O and S and including any bicyclic group in which any of the above
defined heterocyclic rings is fused to a benzene ring. The nitrogen
and sulfur heteroatoms may optionally be oxidized. The heterocyclic
ring may be attached to its pendant group at any heteroatom or
carbon atom that results in a stable structure. The heterocyclic
rings described herein may be substituted on carbon or on a
nitrogen atom if the resulting compound is stable. If specifically
noted, a nitrogen atom in the heterocycle may optionally be
quaternized. It is preferred that when the total number of S and O
atoms in the heterocycle exceeds one, then these heteroatoms are
not adjacent to one another. It is preferred that the total number
of S and O atoms in the heterocycle is not more than one. Examples
of heterocycles include, but are not limited to, 1H-indazole,
2-pyrrolidonyl, 2H,6H-1,5,2-dithiazinyl, 2H-pyrrolyl, 3H-indolyl,
4-piperidonyl, 4aH-carbazole, 4H-quinolizinyl,
6H-1,2,5-thiadiazinyl, acridinyl, azocinyl, benzimidazolyl,
benzofuranyl, benzothiofuranyl, benzothiophenyl, benzoxazolyl,
benzthiazolyl, benztriazolyl, benztetrazolyl, benzisoxazolyl,
benzisothiazolyl, benzimidazalonyl, carbazolyl, 4H-carbazolyl,
.alpha.-, .beta.-, or .gamma.-carbolinyl, chromanyl, chromenyl,
cinnolinyl, decahydroquinolinyl, 2H,6H-1,5,2-dithiazinyl,
dihydrofuro[2,3-b]tetrahydrofuran, furanyl, furazanyl,
imidazolidinyl, imidazolinyl, imidazolyl, 1H-indazolyl, indolenyl,
indolinyl, indolizinyl, indolyl, isobenzofuranyl, isochromanyl,
isoindazolyl, isoindolinyl, isoindolyl, isoquinolinyl,
isothiazolyl, isoxazolyl, morpholinyl, naphthyridinyl,
octahydroisoquinolinyl, oxadiazolyl, 1,2,3-oxadiazolyl,
1,2,4-oxadiazolyl, 1,2,5-oxadiazolyl, 1,3,4-oxadiazolyl,
oxazolidinyl, oxazolyl, oxazolidinylpyrimidinyl, phenanthridinyl,
phenanthrolinyl, phenoxazinyl, phenazinyl, phenothiazinyl,
phenoxathiinyl, phenoxazinyl, phthalazinyl, piperazinyl,
piperidinyl, pteridinyl, piperidonyl, 4-piperidonyl, pteridinyl,
purinyl, pyranyl, pyrazinyl, pyrazolidinyl, pyrazolinyl, pyrazolyl,
pyridazinyl, pyridooxazole, pyridoimidazole, pyridothiazole,
pyridinyl, pyridyl, pyrimidinyl, pyrrolidinyl, pyrrolinyl,
pyrrolyl, quinazolinyl, quinolinyl, 4H-quinolizinyl, quinoxalinyl,
quinuclidinyl, carbolinyl, tetrahydrofuranyl,
tetrahydroisoquinolinyl, tetrahydroquinolinyl,
6H-1,2,5-thiadiazinyl, 1,2,3-thiadiazolyl, 1,2,4-thiadiazolyl,
1,2,5-thiadiazolyl, 1,3,4-thiadiazolyl, thianthrenyl, thiazolyl,
thienyl, thienothiazolyl, thienooxazolyl, thienoimidazolyl,
thiophenyl, triazinyl, 1,2,3-triazolyl, 1,2,4-triazolyl,
1,2,5-triazolyl, 1,3,4-triazolyl, xanthenyl. Preferred heterocycles
include, but are not limited to, pyridinyl, furanyl, thienyl,
pyrrolyl, pyrazolyl, imidazolyl, indolyl, benzimidazolyl,
1H-indazolyl, oxazolidinyl, benzotriazolyl, benzisoxazolyl,
oxindolyl, benzoxazolinyl, or isatinoyl. Also included are fused
ring and spiro compounds containing, for example, the above
heterocycles.
[0088] "Alkoxy" refers to the group R--O-- where R is an alkyl
group as defined herein.
[0089] "Aryloxy" refers to the group R--O-- where R is an aryl
group, as defined herein.
[0090] "Heteroaryloxy" refers to the group R--O-- where R is a
heteroaryl group, as defined herein.
[0091] "Alkanoyl" refers to the group R--C(.dbd.O) where R is an
alkyl group of 1 to 5 carbon atoms.
[0092] "Alkanoyloxy" refers to the group R--C(.dbd.O)--O where R is
an alkyl group of 1 to 5 carbon atoms.
[0093] "Halo," refers to chloro, bromo, fluoro, and iodo.
[0094] "Haloalkyl," or "haloaryl" refers to an alkyl or aryl, as
defined above, in which one or more hydrogens directly attached to
the carbon atoms are replaced by one or more halo substituents.
[0095] "Optional" or "optionally" means that the subsequently
described event or circumstance may or may not occur, and that the
description includes instances in which it does not. For example,
optionally substituted phenyl indicates either unsubstituted
phenyl, or phenyl mono-di, or tri-substituted, independently, with
OH, COOH, lower alkyl, lower alkoxy, halo, nitro, amino,
alkylamino, dialkylamino, trifluoromethyl and/or cyano.
[0096] By "therapeutically effective dose" herein is meant a dose
that produces effects for which it is administered. The exact dose
will depend on the purpose of the treatment, and will be
ascertainable by one skilled in the art using known techniques
(see, e.g., Lieberman, Pharmaceutical Dosage Forms (Vols. 1-3,
1992); Lloyd, 1999, The Art, Science And Technology Of
Pharmaceutical Compounding; and Pickar, 1999, Dosage Calculations).
"Effective amount" refers to an amount of a compound that can be
therapeutically effective to inhibit, prevent or treat the symptoms
of particular disease, disorder or side effect.
[0097] "Pharmaceutically acceptable" refers to those compounds,
materials, compositions, and/or dosage forms which are, within the
scope of sound medical judgment, suitable for contact with the
tissues of human beings and animals without excessive toxicity,
irritation, allergic response, or other problem complications
commensurate with a reasonable benefit/risk ratio.
[0098] "In combination with", "combination therapy" and
"combination products" refer, in certain embodiments, to the
concurrent administration to a patient of a first therapeutic and
the compounds as used herein. When administered in combination,
each component can be administered at the same time or sequentially
in any order at different points in time. Thus, each component can
be administered separately but sufficiently closely in time so as
to provide the desired therapeutic effect.
[0099] "Dosage unit" refers to physically discrete units suited as
unitary dosages for the particular individual to be treated. Each
unit can contain a predetermined quantity of active compound(s)
calculated to produce the desired therapeutic effect(s) in
association with the required pharmaceutical carrier. The
specification for the dosage unit forms can be dictated by (a) the
unique characteristics of the active compound(s) and the particular
therapeutic effect(s) to be achieved, and (b) the limitations
inherent in the art of compounding such active compound(s).
[0100] "Stereoisomer, prodrug, pharmaceutically acceptable salt,
hydrate, solvate, acid salt hydrate, N-oxide or isomorphic
crystalline form thereof" refer to derivatives of the disclosed
compounds wherein the parent compound is modified by making acid or
base salts thereof.
[0101] Examples of stereoisomer, prodrug, pharmaceutically
acceptable salt, hydrate, solvate, acid salt hydrate, N-oxide or
isomorphic crystalline form thereof include, but are not limited
to, mineral or organic acid salts of basic residues such as amines;
alkali or organic salts of acidic residues such as carboxylic
acids; and the like. The stereoisomer, prodrug, pharmaceutically
acceptable salt, hydrate, solvate, acid salt hydrate, N-oxide or
isomorphic crystalline form thereof include the conventional
non-toxic salts or the quaternary ammonium salts of the parent
compound formed, for example, from non-toxic inorganic or organic
acids. For example, such conventional non-toxic salts include those
derived from inorganic acids such as hydrochloric, hydrobromic,
sulfuric, sulfamic, phosphoric, nitric and the like; and the salts
prepared from organic acids such as acetic, propionic, succinic,
glycolic, stearic, lactic, malic, tartaric, citric, ascorbic,
pamoic, maleic, hydroxymaleic, phenylacetic, glutamic, benzoic,
salicylic, sulfanilic, 2-acetoxybenzoic, fumaric, toluenesulfonic,
methanesulfonic, ethane disulfonic, oxalic, isethionic, and the
like. These physiologically acceptable salts are prepared by
methods known in the art, e.g., by dissolving the free amine bases
with an excess of the acid in aqueous alcohol, or neutralizing a
free carboxylic acid with an alkali metal base such as a hydroxide,
or with an amine.
[0102] Compounds described herein throughout, can be used or
prepared in alternate forms. For example, many amino-containing
compounds can be used or prepared as an acid addition salt. Often
such salts improve isolation and handling properties of the
compound. For example, depending on the reagents, reaction
conditions and the like, compounds as described herein can be used
or prepared, for example, as their hydrochloride or tosylate salts.
Isomorphic crystalline forms, all chiral and racemic forms,
N-oxide, hydrates, solvates, and acid salt hydrates, are also
contemplated to be within the scope of the present compositions and
methods.
[0103] Certain acidic or basic compounds can exist as zwitterions.
All forms of the compounds, including free acid, free base and
zwitterions, are contemplated to be within the scope of the present
compositions and methods. It is well known in the art that
compounds containing both amino and carboxyl groups often exist in
equilibrium with their zwitterionic forms. Thus, any of the
compounds described herein throughout that contain, for example,
both amino and carboxyl groups, also include reference to their
corresponding zwitterions.
[0104] The term "treating" includes the administration of the
compounds or agents of the present invention to prevent or delay
the onset of the symptoms, complications, or biochemical indicia of
a disease, alleviating the symptoms or arresting or inhibiting
further development of the disease, condition, or disorder (e.g.,
cancer). Treatment may be prophylactic (to prevent or delay the
onset of the disease, or to prevent the manifestation of clinical
or subclinical symptoms thereof) or therapeutic suppression or
alleviation of symptoms after the manifestation of the disease.
[0105] In general, the phrase "well tolerated" refers to the
absence of adverse changes in health status that occur as a result
of the treatment and would affect treatment decisions.
[0106] Except when noted, the terms "patient" or "subject" are used
interchangeably and refer to mammals such as human patients and
non-human primates, as well as experimental animals such as
rabbits, rats, and mice, and other animals.
[0107] "Prodrug" refers to compounds specifically designed to
maximize the amount of active species that reaches the desired site
of reaction which are of themselves typically inactive or minimally
active for the activity desired, but through biotransformation are
converted into biologically active metabolites.
[0108] "Stereoisomers" refers to compounds that have identical
chemical constitution, but differ as regards the arrangement of the
atoms or groups in space.
[0109] When any variable occurs more than one time in any
constituent or in any formula, its definition in each occurrence is
independent of its definition at every other occurrence.
Combinations of substituents and/or variables are permissible only
if such combinations result in stable compounds.
[0110] "Short chain dehydrogenase reductase (SDR)" refers to a
family of NAD(P)(H) dependent oxido-reductases represent a diverse
family of greater than 63 human proteins. These enzymes are
responsible for the oxidation or reduction of a wide range of
endogenous (prostaglandins, steroid hormones, retinal,
dihydropteridin, UDP, and trans 2-enoyl CoA) and exogenous
chemicals (e.g., anthracyclin drugs).
[0111] "Modulate" refers to the suppression, enhancement or
induction of a function or condition. For example, the pyrazolo
pyrimidine or AB-129 compounds, derivatives and analogs thereof of
the invention can modulate cancer by inhibition of short chain
dehydrogenase reductase (SDR) enzyme activity. For example, AB-129
compounds, derivatives and analogs thereof can inhibit carbonyl
reductase 1 (CBR1) activity in lung carcinoma cells thereby
alleviating lung cancer by inhibiting or reducing growth of lung
carcinoma cells.
[0112] "Carbonyl reductase" refers to a family of enzymes, for
example, carbonyl reductase 1 (NADPH: secondary-alcohol
oxidoreductase) which is part of a group of NADPH-dependent
cytosolic enzymes called short chain dehydrogenase/reductase (SDR)
that catalyze the reduction of various carbonyl compounds to their
corresponding alcohols. The enzyme is ubiquitous in nature and acts
on a large number of biologically and pharmacologically active
compounds. Carbonyl reductase is believed to function
physiologically as dehydrogenases of prostaglandins or
hydroxysteroids, as well as in drug metabolism.
[0113] "11.beta.-hydroxysteroid dehydrogenase (11.beta.-HSD)"
refers to 11.beta.-hydroxysteroid dehydrogenase I or
11.beta.-hydroxysteroid dehydrogenase II, or an enzyme with a
related activity.
[0114] "17.beta.-hydroxysteroid dehydrogenase (17.beta.-HSD)"
refers to 17.beta.-hydroxysteroid dehydrogenase I or
17.beta.-hydroxysteroid dehydrogenase II, or an enzyme with a
related activity.
[0115] "Anthracycline anti-cancer agent" refers to the family of
anthracycline antibiotic drugs that include, for example
daunorubicin, doxorubicin, epirubicin, and idarubicin.
[0116] "Cardiotoxic side effect" refers to acute or chronic
cardiomyopathy that can lead to congestive heart failure. The
development of chronic cardiotoxicity is clinically important.
Chronic cardiotoxicity can develop many years after treatment with
anthracyclines. Children and younger adults treated with
anthracyclines are exposed to a lifetime risk of developing serious
cardiomyopathy. Because cancer patients are not usually monitored
for more than 5-7 years, the number of these patients developing
late-onset cardiomyopathies can be expected to increase
substantially in the future.
[0117] "Cancer" or "malignancy" are used as synonymous terms and
refer to any of a number of diseases that are characterized by
uncontrolled, abnormal proliferation of cells, the ability of
affected cells to spread locally or through the bloodstream and
lymphatic system to other parts of the body (i.e., metastasize) as
well as any of a number of characteristic structural and/or
molecular features. A "cancerous" or "malignant cell" is understood
as a cell having specific structural properties, lacking
differentiation and being capable of invasion and metastasis.
Examples of cancers are kidney, colon, breast, prostate and liver
cancer. (see DeVita, V. et al. (eds.), 2001, CANCER PRINCIPLES AND
PRACTICE OF ONCOLOGY, 6th. Ed., Lippincott Williams & Wilkins,
Philadelphia, Pa.; this reference is herein incorporated by
reference in its entirety for all purposes).
[0118] "Cancer-associated" refers to the relationship of a nucleic
acids and its expression, or lack thereof, or a protein and its
level or activity, or lack thereof, to the onset of malignancy in a
subject cell. For example, cancer can be associated with expression
of a particular gene that is not expressed, or is expressed at a
lower level, in a normal healthy cell. Conversely, a
cancer-associated gene can be one that is not expressed in a
malignant cell (or in a cell undergoing transformation), or is
expressed at a lower level in the malignant cell than it is
expressed in a normal healthy cell.
[0119] "Neoplastic cells" and "neoplasia" refer to cells which
exhibit relatively autonomous growth, so that they exhibit an
aberrant growth phenotype characterized by a significant loss of
control of cell proliferation. Neoplastic cells comprise cells
which can be actively replicating or in a temporary non-replicative
resting state (G1 or G0); similarly, neoplastic cells can comprise
cells which have a well-differentiated phenotype, a
poorly-differentiated phenotype, or a mixture of both type of
cells. Thus, not all neoplastic cells are necessarily replicating
cells at a given timepoint. The set defined as neoplastic cells
consists of cells in benign neoplasms and cells in malignant (or
frank) neoplasms. Frankly neoplastic cells are frequently referred
to as cancer (discussed supra), typically termed carcinoma if
originating from cells of endodermal or ectodermal histological
origin, or sarcoma if originating from cell types derived from
mesoderm.
[0120] In the context of the invention, the term "transformation"
refers to the change that a normal cell undergoes as it becomes
malignant. In eukaryotes, the term "transformation" can be used to
describe the conversion of normal cells to malignant cells in cell
culture.
[0121] "Proliferating cells" are those which are actively
undergoing cell division and growing exponentially.
[0122] "Loss of cell proliferation control" refers to the property
of cells that have lost the cell cycle controls that normally
ensure appropriate restriction of cell division. Cells that have
lost such controls proliferate at a faster than normal rate,
without stimulatory signals, and do not respond to inhibitory
signals.
[0123] "Leukemia" refers to cancer of cells in the bloodstream or
lymphatic system. Types of leukemia include but are not limited to,
Acute Lymphoblastic Leukemia (Adult or Childhood), Acute Myeloid
Leukemia (Adult or Childhood), Chronic Lymphocytic Leukemia,
Chronic Myelogenous Leukemia, or Hairy Cell Leukemia.
[0124] "Kaposi's sarcoma (KS)" refers to a sarcoma that develops in
connective tissues such as cartilage, bone, fat, muscle, blood
vessels, or fibrous tissues (related to tendons or ligaments). The
vast majority of KS cases have developed in association with human
immunodeficiency virus (HIV) infection and the acquired
immunodeficiency syndrome (AIDS). KS tumors develop in the tissues
below the skin surface, or in the mucous membranes of the mouth,
nose, or anus.
[0125] "Inflammation" or "inflammatory response" refers to an
innate immune response that occurs when tissues are injured by
bacteria, trauma, toxins, heat, or any other cause. The damaged
tissue releases compounds including histamine, bradykinin, and
serotonin. Inflammation refers to both acute responses (i.e.,
responses in which the inflammatory processes are active) and
chronic responses (i.e., responses marked by slow progression and
formation of new connective tissue). Acute and chronic inflammation
can be distinguished by the cell types involved. Acute inflammation
often involves polymorphonuclear neutrophils; whereas chronic
inflammation is normally characterized by a lymphohistiocytic
and/or granulomatous response. Inflammation includes reactions of
both the specific and non-specific defense systems. A specific
defense system reaction is a specific immune system reaction
response to an antigen (possibly including an autoantigen). A
non-specific defense system reaction is an inflammatory response
mediated by leukocytes incapable of immunological memory. Such
cells include granulocytes, macrophages, neutrophils and
eosinophils. Examples of specific types of inflammation are diffuse
inflammation, focal inflammation, croupous inflammation,
interstitial inflammation, obliterative inflammation,
parenchymatous inflammation, reactive inflammation, specific
inflammation, toxic inflammation and traumatic inflammation.
[0126] "Diabetes mellitus" or "diabetes" refers to a disease or
condition that is generally characterized by metabolic defects in
production and utilization of glucose which result in the failure
to maintain appropriate blood sugar levels in the body. The result
of these defects is elevated blood glucose, referred to as
"hyperglycemia." Two major forms of diabetes are Type 1 diabetes
and Type 2 diabetes. As described above, Type 1 diabetes is
generally the result of an absolute deficiency of insulin, the
hormone which regulates glucose utilization. Type 2 diabetes often
occurs in the face of normal, or even elevated levels of insulin
and can result from the inability of tissues to respond
appropriately to insulin. Most Type 2 diabetic patients are insulin
resistant and have a relative deficiency of insulin, in that
insulin secretion can not compensate for the resistance of
peripheral tissues to respond to insulin. In addition, many Type 2
diabetics are obese. Other types of disorders of glucose
homeostasis include Impaired Glucose Tolerance, which is a
metabolic stage intermediate between normal glucose homeostasis and
diabetes, and Gestational Diabetes Mellitus, which is glucose
intolerance in pregnancy in women with no previous history of Type
1 or Type 2 diabetes.
[0127] "Secondary diabetes" is diabetes resulting from other
identifiable etiologies which include: genetic defects of .beta.
cell function (e.g., maturity onset-type diabetes of youth,
referred to as "MODY," which is an early-onset form of Type 2
diabetes with autosomal inheritance; see, e.g., Fajans S. et al.,
Diabet. Med. 9 Suppl 6: S90-5, 1996, and Bell, G. et al., Annu.
Rev. Physiol. 58: 171-86, 1996); genetic defects in insulin action;
diseases of the exocrine pancreas (e.g., hemochromatosis,
pancreatitis, and cystic fibrosis); certain endocrine diseases in
which excess hormones interfere with insulin action (e.g., growth
hormone in acromegaly and cortisol in Cushing's syndrome); certain
drugs that suppress insulin secretion (e.g., phenytoin) or inhibit
insulin action (e.g., estrogens and glucocorticoids); and diabetes
caused by infection (e.g., rubella, Coxsackie, and CMV); as well as
other genetic syndromes.
[0128] The guidelines for diagnosis for Type 2 diabetes, impaired
glucose tolerance, and gestational diabetes have been outlined by
the American Diabetes Association (see, e.g., The Expert Committee
on the Diagnosis and Classification of Diabetes Mellitus, Diabetes
Care, 2 (Suppl 1): S5-19, 1999).
Methods of Treatment
[0129] Short chain dehydrogenases/reductases (SDRs), for example,
carbonyl reductase 1 (CBR1) have a role in metabolism and disease.
AB129-type compounds and analogs thereof are inhibitors of the SDR
enzyme family. AB129-type compounds and analogs are useful for
medical treatment, for example, cancer therapy, and have been shown
to have biological activity.
[0130] (1) Human carbonyl reductase 1 (CBR1) is within the family
of short chain dehydrogenases/reductases (SDRs).
[0131] (2) The SDR enzyme family has more than 1600 members.
Greater than 63 SDR enzymes are found in human.
[0132] (3) SDR enzymes catalyze an NAD(P)(H)-dependent
oxidoreduction or dehydrogenation.
[0133] (4) The catalytic active site of the SDR enzyme comprises an
S/YxxxK catalytic triad.
[0134] (5) The function of SDR enzymes include intermediary
metabolism, lipid hormone metabolism (e.g., steroids,
prostaglandins, retinols/retinals) and enzymes of unknown
function.
[0135] (6) SDR enzymes are correlated with many genetic and
metabolic disorders.
[0136] (7) SDR enzymes can regulate the nuclear hormone switch
(e.g., cortisone, estradiol, prostaglandin) as an important
regulatory target by AB129-type compounds.
[0137] (8) AB129-type compounds and analogs thereof that inhibit
carbonyl reductase 1 (CBR1) activity are useful for treatment of
lung cancer, colon cancer, metastatic cancer, or cancer drug
resistance.
[0138] (9) AB129-type compounds and analogs thereof that inhibit
11.beta.-hydroxysteroid dehydrogenase activity and result in
decreased levels of cortisone are useful for treatment of diabetes
or obesity.
[0139] (10) AB 129-type compounds and analogs thereof that inhibit
17.beta.-hydroxysteroid dehydrogenase activity are useful for
treatment of inflammatory disease, ovarian cancer or breast
cancer.
[0140] In one embodiment, the present invention is directed to a
compound of Formula I or II:
##STR00003##
[0141] or a pharmaceutically-acceptable salt or prodrug
thereof;
[0142] wherein: [0143] Y is N or CR.sub.5; [0144] Z is
NR.sub.3R.sub.4, halo, H, OH, alkyl, alkyloxy, or haloalkyl; [0145]
R.sub.1a is indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl,
pyrrolyl, or phenyl, wherein said phenyl is substituted with at
least one of OH, --NR.sub.3R.sub.4, --C(.dbd.O)NR.sub.6R.sub.7,
--CN, NO.sub.2--C(.dbd.O)OH, --C(.dbd.O)O-alkyl,
(C.sub.1-C.sub.4)alkyl, halo, haloalkyl or haloaryl; and wherein
said indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl, or
pyrrolyl is optionally substituted with OH, --NR.sub.3R.sub.4,
--C(.dbd.O)NR.sub.6R.sub.7, --CN, NO.sub.2, --C(.dbd.O)O--R.sub.3,
(C.sub.1-C.sub.4)alkyl, halo, haloalkyl or haloaryl; [0146]
R.sub.1b is indolyl, thiazolyl, benzyl, biphenylyl, thiophenyl,
pyrrolyl, or phenyl wherein said indoyl, thiazolyl, benzyl,
biphenylyl, thiophenyl, pyrrolyl, phenyl is optionally substituted
with --OH, --NR.sub.3R.sub.4, --C(.dbd.O)NR.sub.6R.sub.7, --CN,
NO.sub.2, --C(.dbd.O)O--R.sub.3, (C.sub.1-C.sub.4)alkyl, halo,
haloalkyl, or haloaryl; [0147] R.sub.2 is C.sub.1-C.sub.6 alkyl or
C.sub.4-C.sub.7 cycloalkyl, wherein said alkyl or said cycloalkyl
is optionally substituted with mono- or di-alkoxy, mono- or
di-halophenyl, mono- or di-(C.sub.1-4)alkoxy phenyl, mono- or
di-(C.sub.1-4)alkyl phenyl, perhalo(C.sub.1-4)alkyl phenyl,
carboxyl, tert-butyl carboxyl, phosphoryl, (C.sub.1-6)alkyl,
(C.sub.4-7)cycloalkyl, indolyl, isoindolyl, pyridyl, naphthyl,
pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrimidinyl, pyrazinyl,
pyridazinyl, furyl, thienyl, or alkylmorpholino; [0148] R.sub.3 and
R.sub.4 are independently H, C.sub.1-C.sub.6 alkyl, t-Boc,
morpholino(C.sub.1-C.sub.4)alkyl, carboxy(C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.4)alkoxycarbonyl(C.sub.1-C.sub.3)alkyl, aryl,
heteroaryl, aryloxy, heterocycle, cycloalkyl, alkenyl with the
proviso that the double bond of the alkenyl is not present at the
carbon atom that is directly linked to N, alkynyl with the proviso
that the triple bond of the alkynyl is not present at the carbon
atom that is directly linked to N, perfluoroalkyl,
--S(O).sub.2alkyl, --S(O).sub.2aryl, --(C.dbd.O)heteroaryl,
--(C.dbd.O)aryl, --(C.dbd.O)(C.sub.1-C.sub.6) alkyl,
--(C.dbd.O)cycloalkyl, --(C.dbd.O)heterocycle, alkyl-heterocycle,
aralkyl, arylalkenyl, --CON R.sub.6R.sub.7,
--SO.sub.2R.sub.6R.sub.7, arylalkoxyalkyl, arylalkylalkoxy,
heteroarylalkylalkoxy, aryloxyalkyl, heteroaryloxyalkyl,
aryloxyaryl, aryloxyheteroaryl, alkylaryloxyaryl,
alkylaryloxyheteroaryl, alkylaryloxyalkyamine, alkoxycarbonyl,
aryloxycarbonyl, or heteroaryloxycarbonyl; [0149] R.sub.5 are
independently H, --OH, halo, optionally monosubstituted
(C.sub.1-C.sub.6)alkyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkoxycarbonyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkanoyl, carbamoyl, optionally monosubstituted
(C.sub.1-C.sub.4)alkyl carbamoyl, phenyl, halophenyl, optionally
monosubstituted (C.sub.1-C.sub.4)alkylphenyl, optionally
monosubstituted (C.sub.1-C.sub.4)alkoxyphenyl, or optionally
monosubstituted perhalo(C.sub.1-C.sub.4)alkylphenyl, wherein said
optional substitution is (C.sub.1-C.sub.4)alkyl, OH, or halogen;
[0150] R.sub.6 and R.sub.7 are independently H, alkyl, aryl,
heteroaryl, alkylaryl, arylalkyl, heteroarylalkyl, or
alkylheteroaryl; [0151] provided the compound is not
1-tert-butyl-3-p-tolyl-1H-pyrazolo[3,4-d]pyrimidin-4-ylamine.
[0152] In certain embodiments, Y is N.
[0153] In a detailed embodiment, R.sub.1a or R.sub.1b is phenyl
substituted with mono, di or tri-OH. In a further detailed
embodiment, the phenyl is further substituted with a halo. In a
further detailed embodiment, the halo is F.
[0154] In a detailed embodiment, R.sub.2 is 2-methyl-propane. In a
detailed embodiment, R.sub.3 and R.sub.4 are H. In a detailed
embodiment, R.sub.5 is H. In a detailed embodiment, R.sub.6 is H
and R.sub.7 is methyl.
[0155] In certain embodiments, R.sub.1a is, independently, phenyl
substituted at a meta position with --CH.sub.3, tert-butyl,
--CF.sub.3 or halo. In a detailed embodiment, R.sub.1a is,
independently, phenyl substituted at a meta position with halo,
alkyl, haloalkyl, haloaryl, aryl, O-alkyl, CN, NO.sub.2,
CO--O--R.sub.3, CO--N(R.sub.3).sub.2. In a detailed embodiment, Z
is F, Br Cl, or I
[0156] In a detailed embodiment, the compounds of formula I or
formula II include: [0157]
3-(4-amino-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phenol;
[0158]
3-(7-isopropyl-4-methylamino-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phenol;
[0159]
[5-(3-amino-phenyl)-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-4-yl]-m-
ethyl-amine; [0160]
3-(4-benzylamino-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phenol;
[0161]
3-(4-dibenzylamino-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-ph-
enol; [0162]
3-[5-(3-hydroxy-phenyl)-4-methylamino-pyrrolo[2,3-d]pyrimidin-7-yl]-propi-
onic acid tert-butyl ester; [0163]
3-[5-(3-hydroxy-phenyl)-4-methylamino-pyrrolo[2,3-d]pyrimidin-7-yl]-propi-
onic acid; [0164]
3-bromo-5-(7-isopropyl-4-methylamino-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phe-
nol; [0165]
3-(7-isopropyl-4-methylamino-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-5-methyl-ph-
enol; [0166]
3-tert-Butyl-5-(7-isopropyl-4-methylamino-7H-pyrrolo[2,3-d]pyrimidin-5-yl-
)-phenol; [0167]
3-(7-Isopropyl-4-methylamino-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-5-trifluoro-
methyl-phenol; [0168]
3-bromo-5-(4-chloro-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phenol;
[0169]
3-(4-chloro-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-5-methyl--
phenol; [0170]
3-tert-butyl-5-(4-chloro-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-phe-
nol; [0171]
3-(4-Chloro-7-isopropyl-7H-pyrrolo[2,3-d]pyrimidin-5-yl)-5-trifluoromethy-
l-phenol or a pharmaceutically-acceptable salt or prodrug
thereof.
[0172] In a further detailed embodiment, the compound has the
formula:
##STR00004##
[0173] In a further detailed embodiment, the compound has the
formula:
##STR00005##
[0174] In a further detailed embodiment, the compound has the
formula:
##STR00006##
[0175] In a further detailed embodiment, the compound has the
formula:
##STR00007##
[0176] In a further detailed embodiment, the compound has the
formula:
##STR00008##
[0177] In another embodiment, the pharmaceutical composition,
comprises a pharmaceutically acceptable carrier, and the compound.
In a detailed embodiment the pharmaceutical composition further
comprises at least one anthracycline compound, including but not
limited to, daunorubicin doxorubicin, epirubicin, idarubicin, or a
mixture thereof.
[0178] In another embodiment, methods for preventing or treating a
disease or condition associated with carbonyl reductase I in a
mammalian are provided, comprising the step of administering to the
mammal a composition comprising an effective amount of the
compound.
[0179] In a further embodiment, the disease state is cancer. In a
detailed embodiment, the cancer is lung cancer.
[0180] In another embodiment, methods for identifying a therapeutic
cancer treatment are provided, comprising contacting a tumor cell
culture with an effective amount of the compound.
[0181] In another embodiment, methods for alleviating a disease
state in a mammal believed to be responsive to treatment with an
inhibitor of carbonyl reductase 1 are provided, comprising
administering to the mammal an effective amount of the compound, in
combination with an effective amount of an anthracycline
anti-cancer agent, wherein the disease state of the mammal is
alleviated. In a detailed embodiment, the anthracycline anti-cancer
agent includes, but is not limited to, daunorubicin, doxorubicin,
epirubicin, or idarubicin. In a further detailed embodiment, the
potency of the anthracycline anti-cancer agent is maintained in the
absence of a cardiotoxic side effect. In a detailed embodiment, the
disease state is cancer. In a further detailed embodiment, the
disease state is selected from cancer, metastatic cancer, colon
cancer, ovarian cancer, leukemia, lymphoma, myeloma, acute myeloid
leukemia, acute lymphocytic leukemia, chronic myelogenous leukemia,
neuroblastoma, lung cancer, breast cancer, acquired
immunodeficiency syndrome (AIDS)-associated Kaposi's sarcoma (KS),
inflammation, obesity, or diabetes.
[0182] In another embodiment, methods of preventing or treating a
disease or condition associated with the synthesis of prostaglandin
E in a mammal comprises administering to the mammal a effective
amount of the compound wherein the disease state of the mammal is
alleviated. In a detailed embodiment, the disease state is
metastatic cancer. In a detailed embodiment, the disease state is
colon cancer.
[0183] In another embodiment, methods for alleviating a disease
state in a mammal believed to be responsive to treatment with an
inhibitor of short chain dehydrogenase/reductase (SDR) family of
NAD(P)(H) dependent oxido-reductases, comprise administering to the
mammal a effective amount of the compound wherein the disease state
of the mammal is alleviated. In a detailed embodiment, the
therapeutic amount of the compound inhibits 11.beta.-hydroxysteroid
dehydrogenase I. In a detailed embodiment, the therapeutic amount
of the compound inhibits 11.beta.-hydroxysteroid dehydrogenase
II.
[0184] In a detailed embodiment, the therapeutic amount of the
compound stimulates synthesis of cortisol. In a further detailed
embodiment, the disease state is inflammation.
[0185] In a detailed embodiment, the therapeutic amount of the
compound stimulates degradation of cortisone. In a further detailed
embodiment, the therapeutic amount of the compound alleviates the
disease state selected from obesity or diabetes.
[0186] In a detailed embodiment, the therapeutic amount of the
compound inhibits 17.beta.-hydroxysteroid dehydrogenases. In a
further detailed embodiment, the therapeutic amount of the compound
alleviates the disease state selected from inflammation, ovarian
cancer or breast cancer.
[0187] In another embodiment, methods for identifying a therapeutic
cancer treatment are provided comprising the steps of: contacting a
tumor cell culture with an effective amount of a according to claim
1; measuring growth inhibition of the tumor cells in culture; and
identifying a therapeutic cancer treatment for a mammalian subject
by inhibition of the tumor cell growth in culture
[0188] In another embodiment, methods for preventing or treating
cancer in a mammal are provided comprising the step of
administering to the mammal an effective amount of the compound. In
a detailed embodiment, the cancer is lung cancer, metastatic
cancer, colon cancer, ovarian cancer, leukemia, lymphoma, myeloma,
acute myeloid leukemia, acute lymphocytic leukemia, chronic
myelogenous leukemia, neuroblastoma, breast cancer, acquired
immunodeficiency syndrome (AIDS)-associated Kaposi's sarcoma
(KS).
Pharmaceutical Compositions
[0189] Inhibitors and modulators of SDR type enzymes, for example,
AB129-type compounds and analogs thereof, are useful in the present
compositions and methods and can be administered to a human patient
per se, in the form of a stereoisomer, prodrug, pharmaceutically
acceptable salt, hydrate, solvate, acid salt hydrate, N-oxide,
prodrug ester, or isomorphic crystalline form thereof, or in the
form of a pharmaceutical composition where the compound is mixed
with suitable carriers or excipient(s) in a therapeutically
effective amount, for example, lung cancer or colon cancer.
"Prodrug esters" as employed herein includes prodrug esters which
are known in the art for carboxylic and phosphorus acid esters such
as methyl, ethyl, benzyl and the like.
Routes of Administration
[0190] Pharmaceutical compositions of inhibitors and modulators of
SDR type enzymes, for example, AB129-type compounds and analogs
thereof, described herein can be administered by a variety of
routes. Suitable routes of administration can, for example, include
oral, rectal, transmucosal, or intestinal administration;
parenteral delivery, including intramuscular, subcutaneous,
intramedullary injections, as well as intrathecal, direct
intraventricular, intravenous, intraperitoneal, spinal, epidural,
intranasal, or intraocular injections. Alternatively, one can
administer the compound in a local rather than systemic manner, for
example via injection of the compound directly into the subject,
often in a depot or sustained release formulation. Furthermore, one
can administer the compound in a targeted drug delivery system, for
example, in a liposome coated vesicle. The liposomes can be
targeted to and taken up selectively by the tissue of choice. In a
further embodiment, the pharmaceutical compositions of AB129-type
compounds and analogs described herein are administered orally.
Composition/Formulation
[0191] The pharmaceutical compositions described herein can be
manufactured in a manner that is itself known, e.g., by means of
conventional mixing, dissolving, granulating, dragee-making,
levigating, emulsifying, encapsulating, entrapping or lyophilizing
processes. Pharmaceutical compositions for use as described herein
can be formulated in conventional manner using one or more
physiologically acceptable carriers comprising excipients and
auxiliaries which facilitate processing of the active compounds
into preparations which can be used pharmaceutically. Proper
formulation is dependent upon the route of administration chosen.
For injection, the agents can be formulated in aqueous solutions,
e.g., in physiologically compatible buffers such as Hanks'
solution, Ringer's solution, or physiological saline buffer. For
transmucosal administration, penetrants appropriate to the barrier
to be permeated are used in the formulation. Such penetrants are
generally known in the art. For oral administration, the compounds
can be formulated readily by combining with pharmaceutically
acceptable carriers that are well known in the art. Such carriers
enable the compounds to be formulated as tablets, pills, dragees,
capsules, liquids, gels, syrups, slurries, suspensions and the
like, for oral ingestion by a patient to be treated. Pharmaceutical
preparations for oral use can be obtained by mixing the compounds
with a solid excipient, optionally grinding a resulting mixture,
and processing the mixture of granules, after adding suitable
auxiliaries, if desired, to obtain tablets or dragee cores.
[0192] Suitable excipients are, in particular, fillers such as
sugars, including lactose, sucrose, mannitol, or sorbitol;
cellulose preparations such as, for example, maize starch, wheat
starch, rice starch, potato starch, gelatin, gum tragacanth, methyl
cellulose, hydroxypropylmethyl-cellulose, sodium
carboxymethylcellulose, and/or polyvinylpyrrolidone (PVP). If
desired, disintegrating agents can be added, such as the
cross-linked polyvinyl pyrrolidone, agar, or alginic acid or a salt
thereof such as sodium alginate. Dragee cores are provided with
suitable coatings. For this purpose, concentrated sugar solutions
can be used, which can optionally contain gum arabic, talc,
polyvinyl pyrrolidone, carbopol gel, polyethylene glycol, and/or
titanium dioxide, lacquer solutions, and suitable organic solvents
or solvent mixtures. Dyestuffs or pigments can be added to the
tablets or dragee coatings for identification or to characterize
different combinations of active compound doses.
[0193] Pharmaceutical preparations which can be used orally include
push-fit capsules made of gelatin, as well as soft, sealed capsules
made of gelatin and a plasticizer, such as glycerol or sorbitol.
The push-fit capsules can contain the active ingredients in
admixture with filler such as lactose, binders such as starches,
and/or lubricants such as talc or magnesium stearate and,
optionally, stabilizers. In soft capsules, the active compounds can
be dissolved or suspended in suitable liquids, such as fatty oils,
liquid paraffin, or liquid polyethylene glycols. In addition,
stabilizers can be added. All formulations for oral administration
should be in dosages suitable for such administration. For buccal
administration, the compositions can take the form of tablets or
lozenges formulated in conventional manner. For administration by
inhalation, the compounds for use are conveniently delivered in the
form of an aerosol spray presentation from pressurized packs or a
nebuliser, with the use of a suitable propellant, e.g.,
dichlorodifluoromethane, trichlorofluoromethane,
dichlorotetrafluoroethane, carbon dioxide or other suitable gas. In
the case of a pressurized aerosol the dosage unit can be determined
by providing a valve to deliver a metered amount. Capsules and
cartridges of e.g. gelatin for use in an inhaler or insufflator can
be formulated containing a powder mix of the compound and a
suitable powder base such as lactose or starch.
[0194] The compounds can be formulated for parenteral
administration by injection, e.g., by bolus injection or continuous
infusion. Formulations for injection can be presented in unit
dosage form, e.g., in ampules or in multi-dose containers, with an
added preservative. The compositions can take such forms as
suspensions, solutions or emulsions in oily or aqueous vehicles,
and can contain formulatory agents such as suspending, stabilizing
and/or dispersing agents. Pharmaceutical formulations for
parenteral administration include aqueous solutions of the active
compounds in water-soluble form. Additionally, suspensions of the
active compounds can be prepared as appropriate oily injection
suspensions. Suitable lipophilic solvents or vehicles include fatty
oils such as sesame oil, or synthetic fatty acid esters, such as
ethyl oleate or triglycerides, or liposomes. Aqueous injection
suspensions can contain substances which increase the viscosity of
the suspension, such as sodium carboxymethyl cellulose, sorbitol,
or dextran. Optionally, the suspension can also contain suitable
stabilizers or agents which increase the solubility of the
compounds to allow for the preparation of highly concentrated
solutions. Alternatively, the active ingredient can be in powder
form for constitution with a suitable vehicle, e.g., sterile
pyrogen-free water, before use.
[0195] The compounds can also be formulated in rectal compositions
such as suppositories or retention enemas, e.g., containing
conventional suppository bases such as cocoa butter or other
glycerides. In addition to the formulations described previously,
the compounds can also be formulated as a depot preparation. Such
long acting formulations can be administered by implantation (for
example subcutaneously or intramuscularly) or by intramuscular
injection. Thus, for example, the compounds can be formulated with
suitable polymeric or hydrophobic materials (for example as an
emulsion in an acceptable oil) or ion exchange resins, or as
sparingly soluble derivatives, for example, as a sparingly soluble
salt.
[0196] A suitable pharmaceutical carrier for hydrophobic compounds
is a cosolvent system comprising benzyl alcohol, a nonpolar
surfactant, a water-miscible organic polymer, and an aqueous phase.
The cosolvent system can be the VPD co-solvent system. VPD is a
solution of 3% (w/v) benzyl alcohol, 8% (w/v) of the nonpolar
surfactant polysorbate 80, and 65% (w/v) polyethylene glycol 300,
made up to volume in absolute ethanol. The VPD co-solvent system
(VPD:5W) consists of VPD diluted 1:1 with a 5% (w/v) dextrose in
water solution. This co-solvent system dissolves hydrophobic
compounds well, and itself produces low toxicity upon systemic
administration. Naturally, the proportions of a co-solvent system
can be varied considerably without destroying its solubility and
toxicity characteristics. Furthermore, the identity of the
co-solvent components can be varied: for example, other
low-toxicity nonpolar surfactants can be used instead of
polysorbate 80; the fraction size of polyethylene glycol can be
varied; other biocompatible polymers can replace polyethylene
glycol, e.g. polyvinyl pyrrolidone; and other sugars or
polysaccharides can substitute for dextrose. Alternatively, other
delivery systems for hydrophobic pharmaceutical compounds can be
employed. Liposomes and emulsions are well known examples of
delivery vehicles or carriers for hydrophobic drugs. Certain
organic solvents such as dimethylsulfoxide also can be employed,
although usually at the cost of greater toxicity.
[0197] Additionally, the compounds can be delivered using a
sustained-release system, such as semipermeable matrices of solid
hydrophobic polymers containing the therapeutic agent. Various
types of sustained-release materials have been established and are
well known by those skilled in the art. Sustained-release capsules
can, depending on their chemical nature, release the compounds for
a few weeks up to over 100 days. The pharmaceutical compositions
also can comprise suitable solid or gel phase carriers or
excipients. Examples of such carriers or excipients include but are
not limited to calcium carbonate, calcium phosphate, various
sugars, starches, cellulose derivatives, gelatin, and polymers such
as polyethylene glycols.
[0198] Pharmaceutically acceptable carriers are determined in part
by the particular composition being administered, as well as by the
particular method used to administer the composition. Accordingly,
there is a wide variety of suitable formulations of pharmaceutical
compositions for administering the AB 129 (see, e.g., Remington's
Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa. 18.sup.th
ed., 1990, incorporated herein by reference). The pharmaceutical
compositions generally comprise a differentially expressed protein,
agonist or antagonist in a form suitable for administration to a
patient. The pharmaceutical compositions are generally formulated
as sterile, substantially isotonic and in full compliance with all
Good Manufacturing Practice (GMP) regulations of the U.S. Food and
Drug Administration.
Effective Dosages
[0199] Pharmaceutical compositions suitable for use include
compositions wherein the AB129-type compounds and analogs are
contained in a therapeutically effective amount. Determination of
an effective amount is well within the capability of those skilled
in the art, especially in light of the detailed disclosure provided
herein. For any compound used in the present method, a
therapeutically effective dose can be estimated initially from cell
culture assays. For example, a dose can be formulated in animal
models to achieve a circulating concentration range that includes
the IC.sub.50 as determined in cell culture (i.e., the
concentration of test compound that is lethal to 50% of a cell
culture) or the IC.sub.50 as determined in cell culture (i.e., the
concentration of compound that is lethal to 100% of a cell
culture). Such information can be used to more accurately determine
useful doses in humans. Initial dosages can also be formulated by
comparing the effectiveness of the AB129-type compounds and analogs
described herein in cell culture assays with the effectiveness of
known cancer treatments. In this method an initial dosage can be
obtained by multiplying the ratio of effective concentrations
obtained in cell culture assay for the AB129-type compounds and
analogs and a known cancer treatment by the effective dosage of the
known cancer treatment. For example, if an AB 129-type compound or
analog is twice as effective in cell culture assay than the cancer
treatment (i.e., the IC.sub.50 of AB129 is equal to one half times
the IC.sub.50 cancer treatment in the same assay), an initial
effective dosage of the AB129-type compound or analog would be
one-half the known dosage for the cancer treatment. Using these
initial guidelines one having ordinary skill in the art could
determine an effective dosage in humans. Initial dosages can also
be estimated from in vivo data. One having ordinary skill in the
art could readily optimize administration to humans based on this
data. Dosage amount and interval can be adjusted individually to
provide plasma levels of the active compound which are sufficient
to maintain therapeutic effect. Usual patient dosages for oral
administration range from about 50-2000 mg/kg/day, typically from
about 250-1000 mg/kg/day, from about 500-700 mg/kg/day or from
about 350-550 mg/kg/day. Therapeutically effective serum levels
will be achieved by administering multiple doses each day. In cases
of local administration or selective uptake, the effective local
concentration of the drug can not be related to plasma
concentration. One having skill in the art will be able to optimize
therapeutically effective local dosages without undue
experimentation. The amount of composition administered will, of
course, be dependent on the subject being treated, on the subject's
weight, the severity of the affliction, the manner of
administration and the judgment of the prescribing physician. The
therapy can be repeated intermittently while lung cancer or colon
cancer is detectable or even when they are not detectable.
Moreover, due to its apparent nontoxicity, the therapy can be
provided alone or in combination with other drugs, such as for
example, anti-inflammatories, antibiotics, corticosteroids,
vitamins and the like. Possible synergism between the AB129-type
compounds or analogs described herein and other drugs can occur. In
addition, possible synergism between a plurality of AB 129-type
compounds or analogs can occur.
[0200] The typical daily dose of a pharmaceutical composition of
inhibitors and modulators of SDR type enzymes, for example,
AB129-type compounds and analogs thereof, varies according to
individual needs, the condition to be treated and with the route of
administration. Suitable doses are in the general range of from
0.001 to 10 mg/kg bodyweight of the recipient per day. Within this
general dosage range, doses can be chosen at which the
pharmaceutical composition of AB129-type compounds and analogs has
a positive effect on cancer treatment efficacy. In general, but not
exclusively, such doses will be in the range of from 0.5 to 10
mg/kg.
[0201] In addition, within the general dose range, doses can be
chosen at which the compounds pharmaceutical composition of AB
129-type compounds and analogs has a positive effect on cancer
treatment efficacy. In general, but not exclusively, such doses
will be in the range of from 0.001 to 0.5 mg/kg. It is to be
understood that the 2 sub ranges noted above are not mutually
exclusive and that the particular activity encountered at a
particular dose will depend on the nature of the pharmaceutical
composition of AB129-type compounds and analogs used.
[0202] The pharmaceutical composition of AB129-type compounds and
analogs can be in unit dosage form, for example, a tablet or a
capsule so that the patient can self-administer a single dose. In
general, unit doses contain in the range of from 0.05-100 mg of a
compound of the pharmaceutical composition of AB 129-type compounds
and analogs. Unit doses contain from 0.05 to 10 mg of the
pharmaceutical composition. The active ingredient can be
administered from 1 to 6 times a day. Thus daily doses are in
general in the range of from 0.05 to 600 mg per day. In an
embodiment, daily doses are in the range of from 0.05 to 100 mg per
day or from 0.05 to 5 mg per day.
Toxicity
[0203] Toxicity and therapeutic efficacy of inhibitors and
modulators of SDR type enzymes, for example, AB129-type compounds
and analogs thereof, described herein can be determined by standard
pharmaceutical procedures in cell cultures or experimental animals,
e.g., by determining the LD.sub.50 (the dose lethal to 50% of the
population) and the ED.sub.50 (the dose therapeutically effective
in 50% of the population). The dose ratio between toxic and
therapeutic effect is the therapeutic index and can be expressed as
the ratio between LD.sub.50 and ED.sub.50 Compounds which exhibit
high therapeutic indices are chosen. The data obtained from these
cell culture assays and animal studies can be used in formulating a
dosage range that is not toxic for use in human. The dosage of such
compounds lies within a range of circulating concentrations that
include the ED.sub.50 with little or no toxicity. The dosage can
vary within this range depending upon the dosage form employed and
the route of administration utilized. The exact formulation, route
of administration and dosage can be chosen by the individual
physician in view of the patient's condition. (See, e.g., Fingl et
al., 1975, In: The Pharmacological Basis of Therapeutics, Ch. 1, p.
1). One of the advantages, among others, of using the AB129-type
compounds and analogs described herein to treat disease, e.g., lung
cancer or colon cancer is their lack of toxicity. For example, it
has been found that repeated intraperitoneal doses of 75 mg/kg
produced no ill effects in mice (see Example 5). Since the i.v.
serum half-life (t.sub.1/2) of AB129 is about 2-2.5 hours, repeated
daily dosages of the AB129 described herein without ill effects is
predictable.
Diagnostic Methods
[0204] In addition to assays, the creation of animal models, and
nucleic acid based therepeutics, identification of important
differentially expressed genes allows the use of these genes in
diagnosis (e.g., diagnosis of cell states and abnormal epithelial
cell conditions). Disorders based on mutant or variant
differentially expressed genes can be determined. Methods for
identifying cells containing variant differentially expressed genes
comprising determining all or part of the sequence of at least one
endogenous differentially expressed genes in a cell are provided.
As will be appreciated by those in the art, this can be done using
any number of sequencing techniques. Methods of identifying the
differentially expressed genotype of an individual comprising
determining all or part of the sequence of at least one
differentially expressed gene of the individual are also provided.
This is generally done in at least one tissue of the individual,
and can include the evaluation of a number of tissues or different
samples of the same tissue. The method can include comparing the
sequence of the sequenced differentially expressed gene to a known
differentially expressed gene, i.e., a wild-type gene.
[0205] The sequence of all or part of the differentially expressed
gene can then be compared to the sequence of a known differentially
expressed gene to determine if any differences exist. This can be
done using any number of known sequence identity programs, such as
Bestfit, and others outlined herein. In some methods, the presence
of a difference in the sequence between the differentially
expressed gene of the patient and the known differentially
expressed gene is indicative of a disease state or a propensity for
a disease state, as outlined herein.
[0206] Similarly, diagnosis of epithelial cell states can be done
using the methods and compositions herein. By evaluating the gene
expression profile of epithelial cells from a patient, the
epithelial cell state can be determined. This is particularly
useful to verify the action of a drug, for example an
immunosuppressive drug. Other methods comprise administering the
drug to a patient and removing a cell sample, particularly of
epithelial cells, from the patient. The gene expression profile of
the cell is then evaluated, as outlined herein, for example by
comparing it to the expression profile from an equivalent sample
from a healthy individual. In this manner, both the efficacy (i.e.,
whether the correct expression profile is being generated from the
drug) and the dose (is the dosage correct to result in the correct
expression profile) can be verified.
[0207] The present discovery relating to the role of differentially
expressed in epithelial cells thus provides methods for inducing or
maintaining differing epithelial cell states. In one method, the
differentially expressed proteins, and particularly differentially
expressed fragments, are useful in the study or treatment of
conditions which are mediated by epithelial cell activity, i.e., to
diagnose, treat or prevent epithelial cell-mediated disorders.
Thus, "epithelial cell mediated disorders" or "disease states" can
include conditions involving, for example, arthritis, diabetes, or
multiple sclerosis.
[0208] Methods of modulating epithelial cell activity in cells or
organisms are provided. Some methods comprise administering to a
cell an anti-differentially expressed antibody or other agent
identified herein or by the methods provided herein, that reduces
or eliminates the biological activity of the endogenous
differentially expressed protein. Alternatively, the methods
comprise administering to a cell or organism a recombinant nucleic
acid encoding a differentially expressed protein or modulator
including anti-sense nucleic acids. As will be appreciated by those
in the art, this can be accomplished in any number of ways. In some
methods, the activity of differentially expressed is increased by
increasing the amount of differentially expressed in the cell, for
example by overexpressing the endogeneous differentially expressed
or by administering a differentially expressed gene, using known
gene therapy techniques, for example. In one method, the gene
therapy techniques include the incorporation of the exogenous gene
using enhanced homologous recombination (EHR), for example as
described in PCT/US93/03868, hereby incorporated by reference in
its entirety.
[0209] Methods for diagnosing an epithelial cell activity related
condition in an individual are provided. The methods comprise
measuring the activity of differentially expressed protein in a
tissue from the individual or patient, which can include a
measurement of the amount or specific activity of the protein. This
activity is compared to the activity of differentially expressed
from either an unaffected second individual or from an unaffected
tissue from the first individual. When these activities are
different, the first individual can be at risk for an epithelial
cell activity mediated disorder.
[0210] Furthermore, nucleotide sequences encoding a differentially
expressed protein can also be used to construct hybridization
probes for mapping the gene which encodes that differentially
expressed protein and for the genetic analysis of individuals with
genetic disorders. The nucleotide sequences provided herein can be
mapped to a chromosome and specific regions of a chromosome using
known techniques, such as in situ hybridization, linkage analysis
against known chromosomal markers, and hybridization screening with
libraries.
Kits
[0211] The differentially expressed protein, agonist or antagonist
or their homologs are useful tools for examining expression and
regulation of signaling in epithelial cells via the PAR1 pathway.
Reagents that specifically hybridize to nucleic acids encoding
differentially expressed proteins (including probes and primers of
the differentially expressed proteins), and reagents that
specifically bind to the differentially expressed proteins, e.g.,
antibodies, are used to examine expression and regulation.
[0212] Nucleic acid assays for the presence of differentially
expressed proteins in a sample include numerous techniques are
known to those skilled in the art, such as Southern analysis,
northern analysis, dot blots, RNase protection, Si analysis,
amplification techniques such as PCR and LCR, high density
oligonucleotide array analysis, and in situ hybridization. In in
situ hybridization, for example, the target nucleic acid is
liberated from its cellular surroundings in such as to be available
for hybridization within the cell while preserving the cellular
morphology for subsequent interpretation and analysis. The
following articles provide an overview of the art of in situ
hybridization: Singer et al., Biotechniques 4: 230-250, 1986; Haase
et al., Methods in Virology, vol. VII, pp. 189-226, 1984; and
Nucleic Acid Hybridization: A Practical Approach (Hames et al.,
eds. 1987), each incorporated herein by reference. In addition, a
differentially expressed protein can be detected with the various
immunoassay techniques described above. The test sample is
typically compared to both a positive control (e.g., a sample
expressing recombinant differentially expressed protein) and a
negative control.
[0213] Kits for screening epithelial cell activity modulators. Such
kits can be prepared from readily available materials and reagents
are provided. For example, such kits can comprise any one or more
of the following materials: the differentially expressed proteins,
agonists, or antagonists, reaction tubes, and instructions for
testing the activities of differentially expressed genes. A wide
variety of kits and components can be prepared depending upon the
intended user of the kit and the particular needs of the user. For
example, the kit can be tailored for in vitro or in vivo assays for
measuring the activity of a differentially expressed proteins or
epithelial cell activity modulators.
[0214] Kits comprising probe arrays as described above are
provided. Optional additional components of the kit include, for
example, other restriction enzymes, reverse-transcriptase or
polymerase, the substrate nucleoside triphosphates, means used to
label (for example, an avidin-enzyme conjugate and enzyme substrate
and chromogen if the label is biotin), and the appropriate buffers
for reverse transcription, PCR, or hybridization reactions.
[0215] Usually, the kits also contain instructions for carrying out
the methods.
Method of Preparation
[0216] The compounds of Formula I and II can be prepared in a
number of ways well known to those skilled in the art, including
both solid phase and solution techniques. The compounds can be
synthesized, for example, by the methods described below, or
variations thereof as appreciated by the skilled artisan. All
processes disclosed in association with the present invention are
contemplated to be practiced on any scale, including milligram,
gram, multigram, kilogram, multikilogram or commercial industrial
scale.
[0217] As discussed in detail above, compounds of Formula I or II
can contain one or more asymmetrically substituted carbon atoms,
and can be isolated in optically active or racemic forms. Thus, all
chiral, diastereomeric, racemic forms and all geometric isomeric
forms of a structure are intended, unless the specific
stereochemistry or isomeric form is specifically indicated. It is
well known in the art how to prepare and isolate such optically
active forms. For example, mixtures of stereoisomers can be
separated by standard techniques including, but not limited to,
resolution of racemic forms, normal, reverse-phase, and chiral
chromatography, preferential salt formation, recrystallization, and
the like, or by chiral synthesis either from chiral starting
materials or by deliberate synthesis of target chiral centers.
[0218] As will be readily understood, functional groups present can
contain protecting groups during the course of synthesis.
Protecting groups are known per se as chemical functional groups
that can be selectively appended to and removed from
functionalities, such as hydroxyl groups and carboxy groups. These
groups are present in a chemical compound to render such
functionality inert to chemical reaction conditions to which the
compound is exposed. Any of a variety of protecting groups can be
employed with the present invention. Preferred protecting groups
include the benzyloxycarbonyl group and the tert-butyloxycarbonyl
group. Other preferred protecting groups that can be employed in
accordance with the present invention are described in Greene, T.
W. and Wuts, P. G. M., Protective Groups in Organic Synthesis 3d.
Ed., Wiley & Sons, 1991.
[0219] The compounds of Formula I, where Y is CR.sup.5, can be
prepared as shown in Scheme 1.
##STR00009##
[0220] In Scheme 1, the pyrrolopyrimidine scaffold
4-chloro-5-iodo-7H-pyrrolo[2,3-d]pyrimidine, compound 5, can
prepared from ethyl cyanoacetate and bromoacetaldehyde diethyl
acetal in six steps (10% yield). R.sup.2 is introduced by Mitsunobu
alkylation of compound 5, using either solid-phase or
solution-phase chemistry, to form compound 6. R.sup.2 substituents
can also be introduced by anion alkylation or Michael addition. A
4-formyl-3,5-dimethoxyphenoxymethyl-functionalized (PAL) resin is
loaded with an R.sup.4 appended amine by reductive amination to
form compound 7, employing, for example, methylamine, ethylamine,
benzylamine or 2,4,6-trimethoxybenzylamine or a suitable salt
thereof (such as the hydrogen chloride salt). Compounds 6 and 7 are
contacted and heated to allow the S.sub.NAr capture of the
alkylated scaffold to form compound 8. Using a solid-phase Suzuki
coupling employing the appropriate boronic acid and catalyst (such
as palladium), R.sup.ia is introduced to form compound 9.
Alternatively, a solution-phase Suzuki coupling can be employed.
Compound 9 is then cleaved from the solid support with
trifluoroacetic acid. Scheme 1 can be carried out under similar
reaction conditions as a solution-phase synthesis.
[0221] When a primary amine at R.sup.4 is required, a protecting
strategy can be employed. An acid-labile protecting group, such as,
for example, 2,4,6-trimethoxybenzylamine, is preferred. Acid labile
protecting groups for R.sup.1 or R.sup.2 substituents can also be
employed. Other suitable acid labile-protecting groups commonly
used in the art can be found in Greene and Wuts, Protective Groups
in Organic Synthesis, 2d ed, John Wiley & Sons, New York, 1991,
the disclosure of which is hereby incorporated by reference in its
entirety.
[0222] The compounds of Formula I and the compounds of Formula II
of the invention can be prepared as shown in Scheme 2. The
compounds of Formula I, where Y is N, can be prepared as generally
described in Hanefeld, U., Rees, C. W., White, A. J. P., Williams,
D. J., "One-pot Synthesis of Tetrasubstituted Pyrazoles Proof of
Regiochemistry," J. Chem. Soc. Perkin Trans 1: 1545-1522, 1996, the
disclosure of which is incorporated herein by reference in its
entirety. Scheme 2 is also applicable where Z=halo or
Z=NR.sub.3R.sub.4, (wherein R.sub.3 and R.sub.4 are not hydrogen)
as demonstrated in Bishop, A. C. Chemical Genetic Approaches To
Highly Selective Protein Kinase Inhibitors, Ph.D. Doctoral
dissertation, Princeton University, 2000, the disclosure of which
is incorporated herein by reference in its entirety.
##STR00010##
General Scheme for Solution Phase Synthesis of Pyrrolopyrimidine
Inhibitors
##STR00011##
[0224] Solution phase synthesis of pyrrolopyrimidine derivatives is
carried out using the general scheme above. Reactions are analogous
to those employed during solid-phase synthesis. Mitsunobu
alkylation, anion alkylation or Michael addition type reactions can
be used to introduce R.sub.2 substituents in the production of 6.
S.sub.Naryl reaction of 6 with primary amines, secondary amines or
ammonia (R.sub.4=H), yields 9a. Suzuki coupling of an aryl boronic
acid or boronic ester yields 10. A subsequent deprotection step is
required when there are protecting groups as in the case for RB11
synthesis.
General Scheme for Solution Phase Synthesis of RB10 and RB11
##STR00012##
[0226] tert-Butyl
3-(4-chloro-5-iodo-4aH-pyrrolo[2,3-d]pyrimidin-7(7aH)-yl)propanoate:
The Michael addition was performed as follows:
4-Chloro-7,7a-dihydro-5-iodo-4aH-pyrrolo[2,3-d]pyrimidine (5, 3 g,
0.11 mol) and Cs.sub.2CO.sub.3 (5.25 g, 0.016 mol) were placed
within a 250 ml round bottom flask, and the contents were subject
to high vacuum for 20 min. The flask was purged with argon,
t-Butylacrylate (30 ml) was added and the reaction was left to stir
at room temperature overnight. The reaction was quenched with 100
ml 10% aqueous mono-sodium citrate, and the organic materials were
extracted into ethyl acetate (3.times.100 ml). The combined
organics were dried with sodium sulfate, and evaporated in vacuo to
yield a viscous oil. Silica gel chromatography (ethyl
acetate:hexanes) and evaporation of the requisite fractions yielded
0.7 g (17.2% yield) of the desired product as a white solid.
.sup.1H NMR (399.6 MHz, CDCl.sub.3) .delta. 1.38 (9H, s), 2.76 (2H,
t, J=6.4 Hz), 4.50 (2H, t, J=6.4 Hz), 7.47 (1H, s), 8.59 (1H,
s).
[0227] tert-butyl
3-(5-iodo-4-(methylamino)-4aH-pyrrolo[2,3-d]pyrimidin-7(7aH)-yl)
propanoate: t-Butyl
3-(4-chloro-5-iodo-4aH-pyrrolo[2,3-d]pyrimidin-7(7aH)-yl)propanoate
from above (0.05 g, 0.12 mmol) was placed in a 15 ml pressure tube.
2M methylamine in THF (7 ml) was added and the vessel was sealed
and left to stir overnight. The volatiles were evaporated in vacuo,
the resultant material was quenched with 20 ml 10% monosodium
citrate, and the solution was extracted with ethyl acetate
(3.times.20 ml). The combined organic extracts were dried with
sodium sulfate and evaporated in vacuo. The resultant product
(0.069 g, 140% yield) was used without further purification.
.sup.1H NMR (399.6 MHz, CDCl.sub.3) .delta. 1.38 (s), 2.71 (2H, t,
J=6.4 Hz), 3.15 (3H, d, J=4.8 Hz), 4.38 (2H, t, J=6.4 Hz), 6.04
(3H, app s), 7.04 (s), 8.33 (s).
tert-Butyl
3-(5-(3-hydroxyphenyl)-4-(methylamino)-4aH-pyrrolo[2,3-d]pyrimi-
din-7(7aH)-yl)propanoate (RB10)
[0228] t-butyl
3-(5-iodo-4-(methylamino)-4aH-pyrrolo[2,3-d]pyrimidin-7(7aH)-yl)propanoat-
e (123 mmol) from above was placed in a 25 ml round bottom flask,
whereupon 3.1 ml dimethoxy ethyleneglycol was added.
3-Hydroxyphenylboronic acid (492 mmol pre-dissolved in 0.66 ml
ethanol) was added at once, and was followed by 0.5 ml saturated
aqueous sodium carbonate. Pd.sup.0 (PPh.sub.3).sub.4 (14 mg, 12
umol) was added to the reaction, the vessel was purged with argon,
and set to stir at 80 C overnight. The reaction was subsequently
cooled, and filtered through a bed of celite. The filtrate was
evaporated in vacuo, and the residual material was adhered to
silica gel using ethyl acetate as solvent. Silica gel
chromatography (ethyl acetate:hexanes) and evaporation in vacuo of
the requisite fractions yielded the desired product. MS
m/z=369.22.
3-(5-(3-hydroxyphenyl)-4-(methylamino)-4aH-pyrrolo[2,3-d]pyrimidin-7(7aH)--
yl)propanoic acid (RB11)
[0229] RB10 (9.6 mg, 26 umol) was treated with 2 ml deprotection
solution (45% TFA, 45% CH.sub.2Cl.sub.2, 5% Me.sub.2S, 5% H.sub.2O)
for 1 hr at room temperature. The volatiles were evaporated in
vacuo, and 1 ml acetonitrile:water:TFA (1:1:0.002) was added. The
resultant solution was purified by reverse-phase HPLC using a
linear gradient of water to acetonitrile both containing 0.1% TFA.
The requisite fractions were pooled and lyophilized to give the
desired product 4.1 mg (79% yield) as a white powder. .sup.1H NMR
(399.6 MHz, d.sup.6-DMSO) .delta. 2.85 (2H, t, J=6.4 Hz), 3.0 (3H,
d, J=4.4 Hz), 4.3, t, J=6.4 Hz), 6.8 (3H, m), 7.27 (1H, app t,
J=7.6 Hz), 9.55 (1H, b s) The amino proton resonance was presumably
hidden due to the presence of water in the NMR sample.
General Scheme for Solution Phase Synthesis of RB6
##STR00013##
[0231] The general solution phase synthetic strategy was used to
synthesize RB6 in 3 steps from compound 5. RB8 and RB9 were
produced in a similar manner, except benzyamine and dibenzyl amine
respectively were used during the S.sub.Naryl reaction.
[0232] Mitsunobu Alkylation of 5 with Isopropanol:
[0233] To a dry 50 ml round bottom flask was added 5 (0.5 g, 1.78
mmol) and PPh.sub.3 (0.84 g, 3.2 mmol). The materials were dried
under high vacuum for 20 m, and the flask was purged with argon.
THF (30 ml) and isopropanol (0.3 ml, 3.9 mmol) were added and the
flask was cooled in an ethylene glycol/dry ice bath whereupon DiAD
(0.47 g, 2.3 mmol) was added dropwise to the stirred solution.
After 18 h, the volatiles were evaporated in vacuo and the
resultant oil was dissolved in ethyl acetate (50 ml) and 50%
saturated sodium bicarbonate (50 ml). The organics were extracted
with ethyl acetate (3.times.50 ml), dried with sodium sulfate and
evaporated in vacuo to yield an orange oil. Silica gel
chromatography (ethyl acetate:hexanes) afforded the desired product
as a yellow solid (480 mg, 84% yield). .sup.1H NMR (399.6 MHz,
CDCl.sub.3) .delta. 1.5 (6H, d, J=6.4 Hz), 5.1 (1H, sp, J=6.8 Hz),
7.4 (1H, s), 8.6 (1H, s).
7,7a-Dihydro-5-iodo-7-isopropyl-N-methyl-4aH-pyrrolo[2,3-d]pyrimidin-4-ami-
ne
[0234]
4-Chloro-7,7a-dihydro-5-iodo-7-isopropyl-4aH-pyrrolo[2,3-d]pyrimidi-
ne (0.3 g, 0.93 mmol) from above was placed within a 15 ml pressure
tube. 2 M methylamine in THF (15 ml) was added, and the reaction
was left to stir overnight. The volatiles were removed in vacuo,
and the residue was dissolved in methanol, 5 ml silica gel were
added, and the volatiles were removed in vacuo. The adhered product
was purified by silica gel chromatography (ethyl acetate:hexanes),
and the requisite fractions were pooled and evaporated in vacuo to
yield the desired product (0.25 g, 85% yield). .sup.1H NMR (399.6
MHz, CDCl.sub.3) .delta. 1.43 (6H, d, J=6.8 Hz), 3.13 (3H, d, J=4.8
Hz), 5.0 (1H, sp, J=6.8 Hz), 7.02 (1H, s), 8.35 (1H, s).
7,7a-Dihydro-7-isopropyl-N-methyl-5-phenyl-4aH-pyrrolo[2,3-d]pyrimidin-4-a-
mine (RB6)
[0235]
7,7a-Dihydro-5-iodo-7-isopropyl-N-methyl-4aH-pyrrolo[2,3-d]pyrimidi-
n-4-amine (0.15 g, 0.475 mmol) from above was placed in a 50 ml
round bottom flask, whereupon 12 ml dimethoxy ethyleneglycol was
added. 3-Hydroxyphenylboronic acid (0.262 g, 1.9 mmol pre-dissolved
in 3.3 ml ethanol) was added at once, and was followed by 1.9 ml
saturated aqueous sodium carbonate. Pd.sup.0 (PPh.sub.3).sub.4 (55
mg, 47 umol) was added to the reaction, the vessel was purged with
argon, and set to stir at 80 C for 48 h. The reaction was
subsequently cooled, and filtered through a bed of celite. The
filtrate was evaporated in vacuo, and the residual material was
adhered to silica gel using ethyl acetate as solvent. Silica gel
chromatography (ethyl acetate:hexanes) and evaporation in vacuo of
the requisite fractions yielded the desired product (94.8 mg, 70.7%
yield). .sup.1H NMR (399.6 MHz, d.sup.6-DMSO) .delta. 1.76 (6H, d,
J=6.8 Hz), 5.03 (3H, d, J=4.8 Hz), 5.34 (1H, sp, J=6.4 Hz), 5.53
(1H, q, J=4.8 Hz), 6.73 (1H, m), 6.85 (1H, m), 7.25 (1H, app t,
J=7.6 Hz), 7.37 (1H, s), 7.59 (1H, s).
[0236] Anion Alkylation of 5 with Methyl Iodide:
[0237] To a dry 50 ml round bottom flask was added 5 (0.2 g, 0.7
mmol) and 15 ml dry acetonitrile. The reaction was cooled on ice,
and NaH (0.026 g, 1.1 mmol) was added at once. After stirring for 5
m, MeI (0.152 g, 1.07 mmol) was added dropwise. The reaction was
allowed to warm to room temperature overnight. The volatiles were
evaporated, the residue was dissolved in ethyl acetate:water, and
the organics were extracted with ethyl acetate (3.times.50 ml). The
organics were dried with sodium sulfate and evaporated in vacuo.
The residue was subject to silica gel chromatography (ethyl
acetate:hexanes). The requisite fractions were pooled and
evaporated to yield a granular solid (0.12 g, 56% yield). .sup.1H
NMR (399.6 MHz, CDCl.sub.3) .delta. 3.87 (1H, s), 7.35 (1H, s),
8.62 (1H, s).
General Scheme for Solution Phase Synthesis of Pyrrolopyrimidine
Inhibitors SD1 Through SD8
##STR00014##
[0238] Preparation of 3,5-disubstituted aryl borates
##STR00015##
[0240] 3-Substituted anisoles were either purchased from Aldrich
(X=CH.sub.3, CF.sub.3, Br) or synthesized from the corresponding
phenols (X=isopropyl, t-butyl). Direct borylation was performed
according to the general procedures described by Miyaura and
Hartwig. Ishiyama, T.; et al., J. Am. Chem. Soc., 124: 390-391,
2002; Ishiyama, T.; et al., Angew. Chem. Int. Ed, 41: 3056-3058,
2002. A typical experimental procedure is given below.
3-Trifluoromethyl-5-(4,4,5,5-Tetramethyl-1,3,2-dioxaborolan-2-yl)anisole
[0241] A flame-dried 100 mL Schlenk tube was charged with
bis(pinacolato)diboron (350 mg, 1.38 mmol), [Ir(COD)Cl].sub.z (12
mg, 0.018 mmol), sodium methoxide (5 mg, 0.09 mmol), and
4,4'-di-tert-butyl-2,2'-dipyridyl (8 mg, 0.03 mmol). The flask was
evacuated, placed under argon, and 3-trifluoromethylanisole (2.5
mL) was added. The flask was restoppered and evacuated (full
vacuum, 2 minutes). The flask was sealed under vacuum and
maintained at 90.degree. C. (oil bath) for 96 h. Thereafter, the
contents were transferred to a round bottom flask with the aid of
ethyl acetate and purified by Kugelrohr distillation. The product,
a viscous oil, distills at 120.degree. C. @ 10 p.m. Isolated yield
497 mg (1.65 mmol, 60%). .sup.1H NMR (400 MHz, CDCl.sub.3) .delta.
7.62 (s, 1H); 7.43 (s, 1H); 7.18 (s, 1H); 3.82 (s, 1H); 1.32 (s,
1H).
General Experimental Procedure for Coupling of 3,5-Disubstituted
Aryl Borates to Scaffolds
##STR00016##
[0243] The appropriate aryl pinacol borate (0.1 mmol) and iodinated
substrate (0.1 mmol) were dissolved in acetone and transferred to a
Schlenk flask. The solvent was evaporated and the flask was charged
with Pd(PPh.sub.3).sub.4 (3 mg) and K.sub.3PO.sub.4 (100 mg). The
flask was evacuated, placed under argon, and charged with 5 mL of
degassed anhydrous DMF. The resulting solution was heated at
60.degree. C. for 24 h under argon. Water was added and the mixture
was extracted (3.times.10 mL) with ethyl acetate. The combined
organic fractions were washed with water and saturated aqueous
NaCl, dried over Na.sub.2SO.sub.4, and evaporated. The remaining
material was loaded unto a small (0.5 cm.times.8 cm) silica gel
column and eluted with 1:4 ethyl acetate:hexane solution. Isolated
yields ranged from 50% to 90%.
[0244] X=CH.sub.3.sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.62 (s,
1H); 7.32 (s, 1H); 6.91 (s, 1H); 6.87 (s, 1H); 6.73 (s, 1H); 5.18
(septet, 1H, J=6.8 Hz); 3.82 (s, 3H); 2.37 (s, 3H); 1.54 (d, 6H,
J=6.8 Hz).
[0245] X=CF.sub.3.sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.64 (s,
1H); 7.37 (s, 1H); 7.34 (s, 1H); 7.23 (s, 1H); 7.11 (s, 1H); 5.19
(septet, 1H, J=6.7 Hz); 3.88 (s, 3H); 1.56 (d, 6H J=6.7 Hz).
[0246] X=Br .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.63 (s, 1H);
7.33 (s, 1H); 7.23 (s, 1H); 7.04 (s, 1H); 6.99 (s, 1H); 5.18
(septet, 1H, J=6.8 Hz); 3.83 (s, 3H); 1.55 (d, 6H, J=6.8 Hz).
[0247] X=tert-butyl .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.61
(s, 1H); 7.33 (s, 1H); 7.15 (s, 1H); 6.91 (s, 1H); 6.82 (s, 1H);
5.18 (septet, 1H, J=6.8 Hz); 3.81 (s, 3H); 1.56 (d, 6H, J=6.8 Hz);
1.35 (s, 9H).
[0248] X=CO.sub.2CH.sub.3.sup.1H NMR (400 MHz, CDCl.sub.3) .delta.
8.63 (s, 1H); 7.76 (t, 1H, J=1.4 Hz); 7.54 (dd, 1H, J.sub.1=2.4 Hz,
J.sub.1=1.4 Hz); 7.36 (s, 1H); 7.26 (dd, 1H, J.sub.1=2.4 Hz,
J.sub.1=1.4 Hz); 5.18 (septet, 1H, J=6.8 Hz); 3.91 (s, 3H); 3.88
(s, 3H); 1.55 (d, 6H, J=6.8 Hz).
General Experimental Procedure for Demethylation of Inhibitors
##STR00017##
[0250] General Procedure:
[0251] The anisole derivative (20 mg) was dissolved in methylene
chloride (5 mL) and transferred to an argon flushed Schlenk tube.
The solution was chilled to 0.degree. C. before 1 mL of a BBr3
solution (1 M in CH2Cl2) was added. The mixture was stirred at
0.degree. C. for 2 h. Saturated aqueous NaHCO3 was added, the
biphasic mixture was stirred for 15 min, extracted with CH2Cl2, and
the organic extracts were dried over Na2SO4. The solvent was
evaporated and the organic residue was purified by flash
chromatography on silica gel (1:1 hexane: ethyl acetate eluant).
Isolated yields were in excess of 80%.
[0252] X=CH3; 1H NMR (400 MHz, CDCl3) .delta. 8.62 (s, 1H); 7.31
(s, 1H); 6.87 (s, 1H); 6.81 (s, 1H); 6.69 (s, 1H); 5.77 (broad
singlet, 1H); 5.17 (septet, 1H, J=6.7 Hz); 2.34 (s, 3H); 1.54 (d,
6H, J=6.7 Hz).
[0253] X=CF3; 1H NMR (400 MHz, CDCl3) .delta. 8.66 (s, 1H); 7.40
(s, 1H); 7.28 (s, 1H); 7.20 (s, 1H); 7.11 (s, 1H); 5.19 (septet,
1H, J=6.8 Hz); 1.56 (d, 6H J=6.8 Hz).
[0254] X=Br; 1H NMR (400 MHz, CDCl3) .delta. 8.32 (s, 1H); 7.09 (s,
1H); 7.09 (s, 1H); 7.00 (s, 1H); 6.65 (s, 1H); 5.27 (broad quart.,
1H, J=4.6); 5.03 (septet, 1H, J=6.8 Hz); 3.12 (d, 3H, J=4.6 Hz);
1.48 (d, 6H, J=6.8 Hz).
[0255] X=tert-butyl; 1H NMR (400 MHz, CDCl3) .delta. 8.64 (s, 1H);
7.35 (s, 1H); 7.08 (s, 1H); 6.88 (s, 1H); 6.80 (s, 1H); 5.19
(septet, 1H, J=6.7 Hz); 3.19 (d, 3H, J=4.6 Hz) 1.52 (d, 6H, J=6.7
Hz); 1.34 (s, 9H).
General Experimental Procedure for Methylamination
##STR00018##
[0257] General Procedure:
[0258] Each compound (20 mg) was dissolved in 5 mL of a THF
solution containing methyl amine (1 M) and transferred to an argon
flushed 50 mL Schlenk storage tube. The vessel was sealed and
heated at 60.degree. C. for 24 h. The THF was evaporated and the
remainder was partitioned between ethyl acetate and aqueous
bicarbonate solution. The biphasic mixture was extracted with ethyl
acetate and the combined organic extracts were dried over
Na.sub.2SO.sub.4. The solvent was evaporated and the organic
residue was purified by flash chromatography on silica gel (1:3
hexane: ethyl acetate eluant). Isolated yields were in excess of
80%.
[0259] X=CH.sub.3.sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.38 (s,
1H); 7.02 (s, 1H); 6.75 (s, 1H); 6.75 (s, 1H); 6.71 (s, 1H); 5.67
(broad s, 1H); 5.07 (septet, 1H, J=6.7 Hz); 3.16 (broad d, 3H,
J=4.7 Hz); 2.34 (s, 3H) 1.48 (d, 6H, J=6.7 Hz).
[0260] X=CF.sub.3.sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.38 (s,
1H); 7.19 (s, 1H); 7.15 (s, 1H); 7.10 (s, 1H); 7.10 (s, 1H); 5.50
(broad s, 1H); 5.09 (septet, 1H, J=6.7 Hz); 3.20 (d, 3H, 4.9 Hz)
1.52 (d, 6H J=6.7 Hz).
[0261] X=Br .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.64 (s, 1H);
7.35 (s, 1H); 7.19 (t, 1H, J=1.5 Hz); 7.04 (t, 1H, J=2.0 Hz); 6.95
(dd, 1H, J.sub.1=2.0 Hz, J.sub.2=1.5 Hz); 5.17 (septet, 1H, J=6.8
Hz); 1.54 (d, 6H, J=6.8 Hz).
[0262] X=t-butyl .sup.1H NMR (400 MHz, CDCl.sub.3) .delta. 8.42 (s,
1H); 7.06 (s, 1H); 6.96 (s, 1H); 6.94 (s, 1H); 6.82 (s, 1H); 5.25
(broad s, 1H) 5.10 (septet, 1H, J=6.7 Hz); 3.81 (s, 3H); 1.55 (d,
6H, J=6.8 Hz); 1.32 (s, 9H).
[0263] Other embodiments and uses will be apparent to one skilled
in the art in light of the present disclosures.
EXEMPLARY EMBODIMENTS
[0264] Development of potent and selective inhibitors of individual
SDR family members have the potential to increase the local
concentration of endogenous hormones with important therapeutic
benefits such as cortisol as an anti-inflammatory agent
(11.beta.-hydroxysteroid dehydrogenase II), or to block production
of potent chemoattractants such as prostaglandin E2 for blocking
colon cancer or metastatic cancer (Carbonyl reductase 1; FIG. 1)
(Forrest, G. L. et al., Chem Biol Interact, 129: 21-40, 2000), or
for degradation of agents that cause obesity or glucose intolerance
leading to insulin resistant diabetes such as cortisone
(11.beta.-hydroxysteroid dehydrogenase I; FIG. 2) (Oppermann, U.
C., et al., Chem Bol Interact, 130-132(1-3): 699-705, 2001). Of
particular focus here is the potential for blocking the action of
Carbonyl Reductase 1, which is responsible for the reduction of the
C-13 keto group of the anthracycline anti-cancer agents
(daunorubicin: Cerubidin.RTM., DaunoXome.RTM.; doxorubicin:
Adriamycin.RTM.) (FIG. 3). The reduction of C-13 keto of
adriamycin, inactivates the anti-cancer activity of daunorubicin
and produces a product (daunorubicinol) which is known to be
cardiotoxic. Thus, blocking the action of CBR1 in patients treated
with adriamycin, would be predicted to enhance the potency of
adriamycin's anti-cancer activity and also to reduce the harmful
cardiotoxic effects of the adriamycin metabolite (daunorubicinol).
Thus, the SDR family members represent an important class of
enzymes critical for control of the biological activity of a wide
variety of endogenous and xenobiotics compounds. By designing
inhibitors of individual members of this family of enzymes new
therapies for lung cancer, breast cancer, obesity, diabetes, and
for improving the activity and decreasing the toxicity of existing
anti-cancer drugs should be possible.
[0265] Microarray studies (67 tumors from 56 patients) show that
CBR1 is upregulated in squamous cell lung carcinoma, but not in
small cell lung carcinoma, (M. E. Garber et al., Proc. Nat. Acad.
Sci USA, 98: 13784, 2001) leading to the hypothesis thatAB 129
kills such cells by inhibiting CBR1.
[0266] Inhibitory activity of AB129 has been demonstrated by
measuring reduction of menadione to mendadiol by carbonyl reductase
1 (CBR1). AB129 inhibits the CBR1 catalyzed reduction of menadione
by NADPH. The IC.sub.50 for AB129 was approximately 5 .mu.M. PP1
did not inhibit CBR1. (FIG. 4) At a concentration as high as 16
.mu.M. AB129 is a competitive inhibitor of CBR1, with respect to
NADPH (FIG. 5).
[0267] Experiments using interfering RNA (RNAi) downregulate CBR1
by inhibiting translation of mRNA in A549 lung carcinoma cells and
demonstrate that CBR1 has a role in development of lung cancer.
RNAi inhibition of CBR1 translation demonstrates a 60 to 70%
decrease in viability of A549 lung carcinoma cells compared to an
approximately 50% decrease in viability of A549 cells in the
presence of AB129. (FIGS. 6 and 7) This suggests that inhibition of
CBR1 expression in A549 cells decreases cell viability.
Example 1
[0268] The SDR Family Member 11B-Hydroxysteroid Dehydrogenase 2
(11(3-HSD2) Controls the Local Metabolism of Glucocorticoids and
Directly Regulates Tissue Specific Nuclear Hormone Signaling
[0269] Classical small molecule ligand/receptor pairs in biology
interact when both are present in the same tissue and are
structurally complementary to one another. An important exception
to this paradigm is that of the mineralcorticoid receptor which
binds both cortisol and aldosterone (Funder, J. W., et al.,
Science, 242: 583-5, 1988). In the kidney, the mineralcorticoid
receptor regulates K.sup.+ uptake and water absorption, in response
to the rennin-angiotensin-aldosterone signaling cascade. However,
since blood concentrations of cortisol are 100-1000 fold greater
than aldosterone, the mineralcorticoid receptor must be "protected"
from activation by cortisol in order to allow proper regulation by
aldosterone. This "protective" function is carried out by 110-HSD2
co-localized with the mineralcorticoid receptor, which converts
cortisol to cortisone, a steroid hormone which has no binding
affinity for the mineralcorticoid receptor (FIG. 2) (Funder, J. W.,
et al., Science, 242: 583-5, 1988). Congenital loss of this enzyme
causes apparent mineralcorticoid receptor excess, due to
overstimulation of the mineralcorticoid receptor by cortisol,
bypassing its normal regulation by aldosterone (White, P. C., et
al., Endocr Rev, 18: 135-56, 1997). This unusual mechanism of
nuclear receptor ligand regulation suggests a potentially new
therapeutic approach to treat asthma.
Example 2
Targeting 11B-Hydroxysteroid Dehydrogenase 2 (11B-HSD2) as a
Potential Alternative to Synthetic Corticosteroid Treatment of
Asthma
[0270] Tissue specific metabolism of steroids is an important
factor in regulating the properties of endogenous steroids, perhaps
drugs which inhibit these enzymes could effectively regulate the
local concentrations of beneficial endogenous hormones. In asthma,
local administration of an inhibitor of 11.beta.-HSD2 in the lung
would block conversion of the anti-inflammatory steroid, cortisol
to inactive cortisone, thus providing a larger concentration of the
body's own anti-inflammatory agent to reduce bronchial swelling in
this tissue. One potential benefit is that cortisol in the lung
would remain regulatable by tissue specific metabolizing enzymes
outside of the lung. Synthetic glucocorticoids currently used in
asthma therapy are not metabolized by these enzymes, and thus can
show pleiotropic effects in other tissues if dosages are not
controlled (Barnes, P. J. et al., Am Rev Respir Dis, 148: S1-26,
1993). Thus, the strategy proposed here, can avoid the
complications of administration of synthetic corticosteroids to
patients which can cause high blood pressure, swelling, changes of
mood and weight gain, all of which are known functions of cortisol
in the body, but which are unwanted side-effects for asthma
patients.
[0271] The strategy of regulating the metabolism of cortisol
through 11.beta.-HSD2 inhibition in the lung is less prone to
unwanted side-effects than synthetic glucocorticoid therapy, even
though both act through glucocorticoid receptors which are present
throughout the body. Vastly different levels of 11.beta.-HSD2 are
expressed in the lung compared to other organs, providing an avenue
for potent inhibition in the lung without significant inhibition
systemically. 11.beta.-HSD2 is expressed at significantly lower
levels in the lung compared to the kidney, adrenal and colon
(Romero, D. G., et al., J Steroid Biochem Mot Blot, 72: 231-7,
2000). One caveat is that only the mRNA levels have been reported
which may not directly correspond to a difference in 110-HSD2
protein levels. By administering a relatively low dose of an
11.beta.-HSD2 inhibitor directly in the lung (intratracheal in the
mouse, or with a nebulizer in patients), a significant inhibition
of 11.beta.-HSD2 is achieved in the lung, resulting in a
significant increase of cortisol concentration. Any of the
inhibitor which is absorbed systemically will encounter much larger
concentrations of 11.beta.-HSD2, and thus will be unable to
significantly perturb 11.beta.-HSD2 function in these tissues,
resulting in less severe side-effects compared to synthetic
glucocorticoid therapy. Thus, the different levels of 11.beta.-HSD2
expression in the lung can provide additional control over unwanted
systemic glucocorticoid stimulation in asthma patients.
Example 3
Evidence Linking 11B-Hydroxysteroid Dehydrogenase 2 (11(3-HSD2)
Inhibition as a Therapy for Asthma
[0272] Schleimer and coworkers have suggested 11.beta.-HSD2 is an
attractive target for treatment of asthma (Feinstein, M. B. et al.,
Am J Respir Cell Mol Biol, 21: 403-8, 1999). They point out that a
natural product isolated from licorice is an ancient therapy for
asthma and many other inflammatory diseases such as eczema and
Addison's disease (Persson, C. G., Pulm Pharmacol, 2: 163-6, 1989).
The major bioactive component of licorice, glycyrrhizic acid is in
fact an inhibitor of 11.beta.-HSD2 (IC.sub.50=8 nM) (FIG. 8)
(Diederich, S., et al., Eur J Endocrinol, 142: 200-7, 2000).
Schleimer and coworkers first confirmed that 11.beta.-HSD2 is
present in lung epithelial cells, and that cortisol is rapidly
oxidized to cortisone in this tissue. Next, they confirmed that
glycyrrhizic acid's anti-inflammatory activity in cells is
dependent on the presence of 11.beta.-HSD2, further supporting the
link between this natural product and 11.beta.-HSD2. Unfortunately,
glycyrrhizic acid is not likely to be a very good asthma therapy
because of its non-selective nature. It inhibits 11.beta.-HSD1,
which blocks production of cortisol from cortisone, resulting in a
reduction of anti-inflammatory cortisol concentration, at almost
equivalent potency to its inhibition of 11.beta.-HSD1 (IC.sub.50=40
nM) (Diederich, S., e al., Eur J Endocrinol, 142: 200-7, 2000). In
fact, recent studies with a derivative of glycyrrhizic acid,
carbenoxolone, with similar potency and specificity for
11.beta.-HSD1 and 2 (FIG. 2), has shown potent inhibition of
11.beta.-HSD2 in men with type 2 diabetes (11.beta.-HSD2 inhibition
was not measured) (Andrews, R. C., et al., J Clin Endocrinol Metab,
88: 285-91, 2003).
[0273] Glycyrrhizic acid's non-selective nature is due to its
interaction with the glucocorticoid binding pocket of 11.beta.-HSD
1 & 2 which is conserved between the two enzymes. In fact, both
enzymes can operate as a reductase or an oxidase, catalyzing both
formation and degradation of cortisol. In the body, the
directionality of each enzyme is controlled by regulation of re-dox
cofactor concentration with NADPH preferred by 11.beta.-HSD1 and
NAD.sup.+ preferred by 11.beta.-HSD2 (Diederich, S., e al., Eur J
Endocrinol, 142: 200-7, 2000). A highly selective 11.beta.-HSD2
inhibitor is developed by targeting the NAD.sup.+ binding pocket of
11.beta.-HSD2 which is differentiated from that of 11.beta.-HSD1 by
the preference of 11.beta.-HSD2 for NAD.sup.+ as a cofactor and
preference of 11.beta.-HSD1 for NADPH. In fact, a similar approach
has been successfully used to design selective inhibitors of
11.beta.-HSD1, which is an attractive drug target for treatment of
obesity and insulin resistant diabetes (Barf, T., et al., J Med
Chem, 45: 3813-5, 2002). The same strategy is applied for treatment
of asthma by targeting 11.beta.-HSD2.
Example 4
Discovery of an Inhibitor of the SDR Family Member, Carbonyl
Reductase 1 (CBR1)
[0274] Three structurally similar compounds (AB129, 1, AB60, 3, and
AB61, 4), but not PP1, 2 (FIG. 9) were found to cause mild to
severe cell killing in the human lung cancer cell line, A549. (FIG.
10) AB129 affects the cell cycle in A549 cells with approximately
12% of A549 cells in G2/M phase, whereas PP1-treated A549 cells
have approximately 5.6% of cells in G2/M phase. AB129 treated cells
show a proportion of cells that may be polyploid. (FIG. 11). Many
small molecules with cell killing activity on cancer cell lines
have been described to date (REFs) yet often the targets of the
small molecules cannot be identified because the compounds bind
poorly (>1 .mu.M Kd) to the targets, or the targets are
expressed at very low abundance (<100,000 copies/cell), or
derivatization of the small molecule necessary for attachment of an
affinity tag (biotin) or attachment to a bead (for affinity
purification of the target protein) reduces the cellular activity
and thus ability to bind the target. A strategy was pursued to
identify the target or targets of the AB129, AB60, and AB61
compounds based on affinity chromatography.
[0275] A derivatized form of AB129 was synthesized. The AB129
compound produced the most potent A549 cell killing response. The
derivatized compound was bound to an agarose bead (P in FIG. 12)
and cell lysates were passed over the beads, hoping to retain the
true target of AB129 and eliminate all non-interacting proteins.
Importantly, a control resin (C in FIG. 12) was used to determine
if any interacting proteins were truly specific for AB129, or were
common binders of the pyrazolopyrimidine scaffold. The results of
the affinity purification (pull-down) experiment are shown in FIG.
13. This type of approach is successful in cases when the target
affinity is high (<1 .mu.M) and when the site of attachment to
the bead does not perturb the binding to the cellular target
(Mayer, T. U., et al., Science, 286: 971-4, 1999; Kwok, B. H., et
al., Chem Biol, 8: 759-66, 2001). Typically, hits from forward
chemical genetic screens are of poor potency (>20 and thus the
affinity capture strategy is unsuccessful.
[0276] Using mass spectrometry the proteins retained on the AB129
beads were analyzed and three proteins identified, including
carbonyl reductase 1 (CBR1) (FIG. 14-21). To confirm that CBR1 is
inhibited by AB129 CBR1 was expressed in bacteria. It was shown
that AB129 is a pure NADPH competitive inhibitor of CBR1, with a Ki
of 400 nM (FIG. 22). This is a very potent compound for an initial
hit in a broad based screen. Importantly, the known kinase
inhibitor, PP1, (FIG. 4) does not inhibit CBR1, in this in vitro
assay, nor does CBR1 bind to control PP1-agarose beads, used as a
control for affinity purification of the targets of AB 129 (FIG.
13).
[0277] To understand the basis for the potency of AB 129 against
CBR1, a computer algorithm was used for molecular docking of AB129
to an available crystal structure of porcine CBR1 to produce a
model of the bound structure of AB129 (FIG. 23). This modeled
co-structure was experimentally validated by site-directed
mutagenesis of multiple amino acids in the proposed AB129 binding
pocket (including a conserved Asn residue common to all SDR family
members--FIG. 24-26) and identification of AB129 resistant mutants
of CBR1 (FIG. 27-29). This binding model also potentially explains
the importance of the hydroxyl moiety attached to the phenyl ring
of AB129, as being critical for a H-bonding interaction with an
active site Asn. Since PP1 lacks this key hydroxyl group, this
model potentially explains the structure activity relationship
difference between PP1 and AB129 in terms of CBR1 inhibition. A
conclusion from these data is that AB129 is a potent inhibitor of
CBR1, a member of the SDR family of enzymes, which are responsible
for a number of important small molecule metabolic steps in a
variety of organs and cell types.
[0278] GSH modified prostaglandins were recently discovered in
colorectal cancer cells. (FIG. 30; Biochim Biophys Acta 1584:
37-45, 2002) CBR1 has a glutathione binding site distinct from the
AB129 binding site. Glutathione binding activity of wild type and
N90V mutant CBR1 was tested. The results demonstrate that
glutathione binding activity is separate from the AB129 binding
activity as demonstrated for the N90V mutant CBR1. FIG. 31. These
results indicate that a mechanism exists for inhibition of CBR1 and
prostaglandin synthesis which can be effective in inhibition of
proliferation of colorectal cancer cells.
Example 5
Does Inhibition of CBR1 with AB129, Increase the Cell Killing
Potency of Daunorubicin
[0279] One important cellular function of CBR1 is to metabolize
xenobiotics such as the anticancer agent daunorubicin, a member of
the anthracyclin antibiotic agents including adriamycin.
Experiments were performed to test whether daunorubicin and AB129
treated cells were capable of exhibiting cell toxicity at
concentrations lower than that needed for each individual compound
to induce cell death alone. In agreement with this therapeutic
strategy, A549 cells were treated with 0.4.sub.11. M of AB129 which
led to a 15% loss of viability after two days of treatment (FIG.
32-33). Similarly, daunorubicin, as a single agent, when added to
A549 cells at 0.8 .mu.M let to a similar 15% loss of viability of
A549 cells. However, when the two drugs, AB129 and daunorubicin
were added in combination at 0.4 .mu.M and 0.8 respectively, a
decrease in almost 70% of A549 cell viability was observed (FIG.
32-33). This experiment suggests that AB129 is capable of enhancing
the potency of daunorubicin mediated cancer cell killing. Moreover,
since AB129 does this through inhibition of CBR1, the toxic
metabolite of daunorubicin, daunorubicinol is not produced and thus
in vivo the cardiotoxic effects of daunorubicinol, or other
anthracyclin anti-cancer therapy should be enhanced.
Example 6
Other Targets of AB129, Including Potential Protein Kinases
[0280] AB129 is an analog of PP 1, the Src family protein kinase
inhibitor. Experiments were performed to determine whether AB129
was capable of inhibiting the Src family kinase, Fyn. In fact AB129
is a potent (10 nM IC.sub.50) inhibitor of Fyn. While the ability
of AB129 to inhibit protein kinases as well as CBR1 could be
important for its biological activity in some settings, AB129
compound was modified to produce a pure CBR1 inhibitor. Such a
compound would serve as a test compound for determining the
importance of dual inhibition of CBR1 and protein kinases. The
crystal structure of PP1 bound to Hck, a Src family kinase, shows
that the exocyclic amine of PPI makes a key H-bond interaction with
a back-bone carbonyl group of Hck in the ATP binding pocket. It was
predicted that addition of a methyl group to this amine of AB129
would disrupt this H-bond interaction because it would point away
from the phenyl ring, thus eliminating the H-bond donor of AB129.
In fact, the resulting analog of AB129, RB6 (FIG. 34) was found to
be equipotent as a CBR1 inhibitor, yet is predicted to be >100
fold less potent as an inhibitor of Fyn. Anti-Fyn IC.sub.50 for RB6
was 70 .mu.M. Anti-Fyn IC.sub.50 for AB129 was 10 nM The ability to
generate inhibitors for protein kinases (PP1), or CBR1 (RB6), or
both targets (AB 129) (FIG. 34), should help in distinguishing
between the cellular effects of CBR1 and/or kinase inhibition.
Example 7
Designing New Potent and Selective Inhibitors of SDR Family Members
Including Carbonyl Reductase 1 (CBR1), and 11B-Hydroxysteroid
Dehydrogenase 1 and 2 (11(3-HSD1 and 2)
[0281] Incorporating SAR data obtained from a small set of
synthesized compounds, and allowing as yet untried diversity
elements, a library of putative CBR inhibitors was envisioned that
conserves the putative pharmacophore but introduces structural
diversity elements that might increase the affinity and specificity
of the library members toward various SDR enzymes. The proposed
library utilizes a pyrrolopyrimidine scaffold as opposed to the
pyrrazolopyrimidine scaffold of AB129, and the compounds
synthesized thus far indicate the anti-CBR activity of both of
these scaffold types are comparable. The docked AB129-CBR structure
was used to inform the choice of library substituents indicated in
FIG. 35.
[0282] Diversity element R.sup.3 or R.sup.4 (Formula I) include
either proton or alkyl substituents. Compounds with H-bond donors
at this position can inhibit kinases, as does AB129, so the
presence of alkyl substituents at this position should shift
affinity away from kinases. AB129 and the analogs synthesized thus
far possess saturated alkyl substituents at R.sup.2. In addition to
such substituents, the library will also include negatively charged
substituents or planar aromatic groups at this position. The
docking model indicates the t-butyl group (analogous to the
position of R.sup.2) of AB129 is solvent exposed, and in close
proximity to one lysine and two arginine residues forming the
binding cavity for the NADP(H) phosphate. To elicit potential
ion-pairing interactions, negatively charged groups
likep-cyclohexanoic acid will be included. Also adjacent to the
t-butyl group of AB129 is the NADP(H) adenine binding cavity. A
substituent at R.sup.2 favors an orientation allowing access to
this cavity. Thus, planar aromatic substituents such as indole
could be accommodated resulting in increased affinity. Diversity
elements at R.sup.1 will include substituted phenyl, indole and
thiophene moieties selected for potential H-bonding and charge
interactions with specific active site residues. Substituents
larger than the AB129 phenoxy may gain additional affinity by
exploiting van der Walls interactions deeper within the NADPH
binding channel. Although all H-bond interactions predicted between
AB129 and CBR are made to conserved residues, the binding
orientation and adjacent residue identity can vary throughout the
SDR family. These interactions can be of particular interest for
tailoring the specificity of these compounds to different enzymes
of the SDR class.
[0283] As mentioned above, it was postulated that both
pyrazolopyrimidines like AB 129 and analogous pyrrolopyrimidines
would have comparable anti-CBR activity. In order to verify this
assumption, the pyrazolopyrimidine RB2 and the analogous
pyrrolopyrimidine RB5 were synthesized (FIG. 36). These compounds
employ an R.sup.2 isopropyl as opposed to the AB129 t-butyl because
the Mitsunobu reaction used for RB5 synthesis is not amenable to
t-butyl alkylation. Both of these compounds inhibit CBR with
similar affinity (IC.sub.50 values comparable to AB129) and kill
adenocarcinoma cells in culture.
[0284] The library of pyrrolopyrimidines well suited for SDR
inhibition is constructed using the following solution and
solid-phase reactions (FIG. 37). The pyrrolopyrimidine scaffold
4-chloro-5-iodo-7H-pyrrolo[2,3-d]pyrimidine, 5, was chosen for its
synthetic utility and literature precedent. This scaffold has been
synthesized previously (Pudlo, J. S., et al., J Med Chem, 33:
1984-92, 1990. Haslam, R., in U.K. Patent 812,336. 1956: U.K), and
was synthesized in our laboratory from ethyl cyanoacetate and
bromoacetaldehyde diethyl acetal in six steps (10% yield). The
library synthesis will involve introduction of R.sup.2 by Mitsunobu
alkylation of the scaffold, 5, using solution-phase chemistry, and
a resin will be loaded with an R.sup.3 or R.sup.4 appended primary
amine by reductive amination. Combining these materials and heating
will allow S.sub.NAr capture of the alkylated scaffold. Finally, a
solid-phase Suzuki coupling to introduce R.sup.3 and TFA mediated
cleavage should yield the library members. Similar reaction
conditions and the use of the scaffold, 5, are also amenable to
solution-phase syntheses.
[0285] Primary amines containing diversity element R.sup.1 will be
coupled to 4-formyl-3,5-dimethoxyphenoxymethyl-functionalized (PAL)
resin to yield 7 in a manner analogous to published conditions
(Moon, H. S., et al., Journal of the American Chemical Society,
124: 11608-11609, 2002). When a primary amine at R.sup.3 or R.sup.4
is required, a protecting strategy can be employed. Thus,
acid-labile 2,4,6-trimethoxybenzylamine should be suitable for this
use. This amine mirrors the structure of the functionalized resin
and should be equally acid sensitive during the cleavage reaction.
Separately, in solution phase, diversity element R.sup.2 will be
introduced by Mitsunobu alkylation (Ding, S., et al., J Org Chem,
66: 8273-6, 2001) of 5 to produce 6. Although Mitsunobu alkylation
has been demonstrated on solid phase (Ding, S., et al., J Am Chem
Soc, 124: 1594-6, 2002. Ding, S., et al., J Comb Chem, 4: 183-6,
2002), 6 was prepared in solution. A similar coupling and reductive
amination strategy using a purine scaffold has been developed for
the synthesis of derivatized purines used as kinase inhibitors
(Ugarkar, B. G., et al., J Med Chem, 43: 2894-905, 2000). In
parallel, each of the resultant products 6 will be reacted with the
resin bound amine 7 to yield compound 8 on solid support. Again in
a manner analogous to that used for the preparation of kinase
inhibitors, 8 will be treated with commercially available boronic
acids using Suzuki coupling conditions to introduce the diversity
element Similar reactions have been carried out in solution phase
(Ugarkar, B. G., et al., J Med Chem, 43: 2894-905, 2000). The
compounds can then be cleaved from the PAL resin using
trifluoroacetic acid.
[0286] Optimizations of both reductive amination and scaffold
loading (FIG. 19) have been performed using a number of conditions,
and good results have been obtained. The reductive amination
reactions to produce 7 have utilized methylamine, ethylamine,
benzylamine and 2,4,6-trimethoxybenzylamine (FIG. 38). The
reactions were carried out in peptide synthesis cartridges using
the reducing agent NaBH(OAc).sub.3 in a manner analogous to that
previously reported (Moon, H. S., et al., Journal of the American
Chemical Society, 124: 11608-11609, 2002). When using
2,4,6-trimethoxybenzylamine the HCl salt was used, and a
stoichiometric quantity of DIEA was also included. Comparable
yields were obtained using 5 and 20 eq. (0.1 and 0.4 M
respectively) of amine with either THF or 1:1 THF:DMF as evidenced
by FMOC quantitation (Bunin, B., The Combinatorial Index, ed. San
Diego: Academic Press, 1998).
[0287] Loading of the scaffold with resin bound primary amine 7 was
also attempted using each of the amine-loaded resins. Either THF or
n-BuOH at 60 or 90.degree. C. respectively in the presence of 10%
DIEA was employed. The values reported (FIG. 38) represent
conversion at 90.degree. C. for 18 h, as determined by FMOC
quantification.
[0288] The conditions for both reductive amination and resin
loading appear to work well for the conditions tested.
[0289] The pyrrolopyrimidine scaffold 5 was also used as starting
material for the solution phase synthesis of RB5 and RB6 (FIG. 9)
with greater than 50% overall yield. Thus, should library members
demonstrate activity in vitro and larger quantities of material are
needed, a solution-phase strategy can be more efficient. RB5
synthesis commenced with Mitsunobu alkylation of 5 with 2-propanol
resulted in the preparation of 6 in greater than 90% yield.
Mitsunobu reactions of pyrrolopyrimidines are scarce in the
literature; however, the utility of the transformation has been
demonstrated with purines. Therefore, an analogous procedure using
DiAD, PPh.sub.3 and 2-propanol was employed (Ding, S., et al., J
Org Chem, 66: 8273-6, 2001). Compound 6 was subsequently aminolyzed
at elevated temperature in a sealed vessel using a saturated
methanolic ammonia solution. As expected, this reaction was
selective for the 4-chloro position of 6 for both ammonia and
methylamine used during the synthesis of RB5 and RB6 respectively.
Treatment of the products with 3-(hydroxyphenyl)boronic acid
afforded RB5 and RB6 using available Suzuki coupling conditions
(Moon, H. S., et al., Journal of the American Chemical Society,
124: 11608-11609, 2002). These conditions do not require the
protection of hydroxylic or amino substituents of the boronic
acids.
[0290] In vitro assays for the measurement of CBR activity have
been developed (Bohren, K. M., et al., J Mot Biol, 244: 659-64,
1994) and used in our laboratories. CBR was expressed in E. coli
and purified using glutathione beads; CBR has a naturally occurring
glutathione binding site. An N-terminal 6-His tagged protein was
prepared to allow purification by metal affinity. Our CBR assay
employs the synthetic substrate Menadione
(2-methyl-1,4-naphthoquinone). Reaction progress is monitored by
the decrease in NADPH absorbance at 340 nm. Saturating
concentrations of Menadione with variable concentrations of NADPH
are employed in order to ascertain K.sub.1 values.
[0291] A high-throughput assay will be optimized for analyzing
library compounds. A 96-well format will be employed, and the
disappearance of NADPH will be monitored either by fluorescence or
absorbance. Using fixed substrate and enzyme concentrations,
IC.sub.50 values for library members can be obtained. Cell culture
assays for CBR inhibition can also be developed, as CBR inhibitors
in the presence of daunorubicin would be expected to lead to a
further decrease in cell proliferation rate than either compound
alone.
[0292] In addition to the use of CBR activity for screening library
compounds, recombinant 11B-HSD1 is prepared (Nobel, C. S., et al.,
Protein Expr Purif, 26: 349-56, 2002). This enzyme is a
membrane-bound glycoprotein, and previous reports indicate that the
isolation of active enzyme is not trivial. An expression system
using Pichia pastoris has been described. A yeast expression vector
for 11B-HSD1 incorporating an N-terminal 6-His tag and a
picornavirus protease cleavage site. Following characterization of
the enzyme activity, an assay similar to that used for detecting
CBR activity is developed. An expression system for 17B-HSD1 is
developed to allow the specificity of these compounds to be further
investigated.
[0293] The inhibitor screening results should provide valuable SAR
data for the pyrrolopyrimidine pharmacophore, and provide valuable
information for producing even more effective inhibitors in the
future. Continuing studies to assess the selectivity of these
analogs among different SDR enzymes and associated cellular
phenotypes will be pursued. Differential activity of the library
members toward CBR and other SDR members when coupled with
available crystallographic and sequence data, should help to
identify important structural and electronic features that lead to
effective and specific inhibition of SDR enzymes.
[0294] Chemical genetic screens for small molecules which target
disease related biological processes hold great promise for
development of future medicines. A well designed chemical genetic
screen like a well designed genetic screen requires manipulation of
the pathway of interest such that early-low potency "hits" can be
identified. This precludes the simultaneous screening of more than
one pathway in each assay. Since a limited portion of chemical
space is probed in any library of small molecules, there is a
limited chance that a potent and selective agent targeting a
pathway of interest will be present. Consequently the frequency of
identifying true drug-leads in such screens has been relatively
low. Chemical-genetic screens have an additional challenge,
compared with genetic screens, that of target identification.
Identification of the target of a small molecule lead compound is
difficult because the affinity of such early hits are often low,
and thus not amenable to successful affinity purification
strategies which require tight, or irreversible inhibitors (usually
only found in natural products or advanced drug development
candidates). To overcome these problems, the traditional format of
chemical genetic screens was inverted. Rather than screening a very
large collection of small molecules for antagonists or agonists of
a single pathway, a small panel of compounds was screened for the
ability to perturb any pathway in a panel of cell lines with high
potency and selectivity. A strategy was exploited utilizing a cell
morphology-microscopy based assay coupled with an automated image
analysis algorithm designed to detect perturbations to a great many
cell processes simultaneously including, for example, cell cycle
arrest point, cytoskeletal structure, cell adhesion status,
organelle organization. This approach allowed phenotypic effects of
all members of the library to be scored, and showed that almost
every compound in the library at the highest doses analyzed (10
.mu.M), produced some phenotypic effects. AB129 was selected, which
potently produced a novel phenotype, (several controls were
included such as, Taxol and K252a, to define known phenotype
signatures), in a single cell line--the lung cancer A549 line, but
not other cell lines. Using traditional target identification
methods applied to natural products, but rarely applied to first
generation hits from chemical genetic screens the target of AB129
in A549 lysates was identified as an NADPH dependent reductase,
carbonyl reductase 1 (CBR1). CBR1 serves a dual role of
prostaglandin biosynthesis and xenobiotic metabolism. In vitro
assays demonstrated AB129 is an NADPH competitive inhibitor of CBR1
with a Ki of approximately 300 to 400 nM, validating the overall
approach to be successful at identification of potent lead
compounds. The relevance of CBR1 to lung cancer was explored
through analysis of transcriptional profiling data of various lung
cancer cell lines. This analysis revealed CBR1 to be a highly
upregulated transcript in adenocarcinomas suggesting it might play
an important role in producing prostaglandins as autocrine factors
for A549 cell survival. siRNA studies confirm that CBR1 is
essential for A549 cell viability, confirming the mode of action of
AB129 at inducing A549 cell death. To independently confirm the
ability of AB129 to inhibit CBR1 in A549 cells, an assay based on
the role of CBR1 in attenuating the anti-cancer action of
daunorubicin was employed. Indeed, AB129 is able to potentiate
daunorubicin action in A549 cells, suggesting the former can be an
attractive combination therapy with daunorubicin. Moreover, AB129
is able to block production of the cardiotoxic metabolite
daunorubicinol from daunorubicin. Thus, a new broad based phenotype
profiling method allowed for system wide screening of chemical
libraries allowed for the discovery of a potent small molecule
capable of selective killing of lung cancer A549 cells and
potentiating the action of daunorubicin.
Example 8
New Potent and Selective Inhibitors of SDR Family Members Including
Carbonyl Reductase 1 (CBR1), and 11B-Hydroxysteroid Dehydrogenase 1
and 2 (11(3-HSD1 and 2)
##STR00019##
[0296] Compound RB8 employs a substituent, benzyl, at the exocyclic
amine on the pyrrolopyrinidine/pyrazolopyrimidine scaffold. The
anti-CBR IC.sub.50=4.4 .mu.M, and the anti-Fyn IC.sub.50=20
.mu.M.
##STR00020##
[0297] Compound RB11 employs a carboxy alkyl substituent at N-9 of
the pyrrolopyrinidine/pyrazolopyrimidine scaffold. Compound RB11
demonstrates an improved anti-CBR IC.sub.50 activity. An increased
affinity can be attributed to potential hydrogen bond interactions
between the carboxylate and charged residues including Asn 13, Arg
41, and Arg 37 of CBR. These residues would otherwise interact with
the NADPH 3'-OPO.sub.3.sup.2- phosphate upon substrate binding, and
can provide specificity for short chain dehydrogenase/reductase
(SDR) utilizing NADP(H) rather than NAD(H). The anti-CBR IC.sub.50
for compound RB11 is 220 nM.
##STR00021##
[0298] RB10 is an intermediate in the synthesis of RB11. The
anti-CBR IC.sub.50=1.15 .mu.M. An improved IC.sub.50 for compound
RB10 may be due to its inability to hydrogen bond to residues
including Asn 13, Arg 41, and Arg 37 of CBR1.
[0299] Substituents at N-9 of the
pyrrolopyrimidine/pyrazolopyrimidine scaffold can further include
alkyl chains substituted with carboxyl and/or phosphoryl, e.g.,
R.sub.2 substituents of compounds of Formulas I, II, or III.
[0300] In addition to the above compounds, the effect of
substituents at the meta position of the phenyl ring have been
studied (see below, Compound A, as an example of a compound derived
from Formula I). Potency as anti-CBR activity can be increased with
electron withdrawing groups (Br, CF.sub.3) at the 5-position of the
pyrrolopyrinidine/pyrazolopyrimidine scaffold. The CBR binding can
be tolerant of even large substituents (tert-butyl) at this
position.
[0301] Substituting a halo substituent, for example, chloro or
bromo, in place of the exocyclic amine (see below, Compound B, as
an example of a compound derived from Formula III) provides an
increased affinity for CBR binding. Compounds of the present
invention can employ an exocyclic amine or a halo substituent as
part of the pyrrolopyrinidine/pyrazolopyrimidine scaffold.
Substituting a chloro substituent for a methylamino substituent on
the pyrrolopyrinidine/pyrazolopyrimidine ring gives a roughly
10-fold increase in potency. For substituents of chloro or bromo,
the IC.sub.50 is approximately 30 nM.
##STR00022##
Example 8
New Potent and Selective Inhibitors of SDR Family Members Including
Carbonyl Reductase 1 (CBR1), and Src Family Protein Kinase, Fyn
[0302] A chloro substituent in place of the exocyclic amine on the
pyrrolopyrimidine/pyrazolopyrimidine scaffold provides increased
affinity. See SD1 and SD5 below. The switch from methylamino to
chloro substituents on the pyrimidine ring gives a roughly 10-fold
increase in potency in all cases. For SD1 compound, having
methylamino and bromo substituents, the anti-CBR IC.sub.50 is 220
nM. For SD5 compound, having chloro and bromo substituents, the
anti-CBR IC.sub.50 is 27 nM.
##STR00023##
[0303] Because replacement of the exocyclic amine with a more
hydrophobic, electron-withdrawing substituent (Cl) increases
potency, these results suggest that exocyclic methlyamino can be
substituted with halogens (F, Cl, Br, I), hydrogen, small
electron-withdrawing groups (NO.sub.2, CN, etc.), or small alkyl
and haloalkyl groups at this position.
[0304] In addition the effect of substituents at the meta position
of the phenyl ring increases potency as a CBR1 inhibitor (see
below). Potency as a CBR1 inhibitor increases with electron
withdrawing groups (Br, CF.sub.3) at the 5-position and the CBR
seems tolerant of even large substituents (t-butyl) at this
position. substituents at the meta position include electron
withdrawing groups, for example, ester and amide linkages (--COOR,
--CONHR).
##STR00024##
[0305] The anti-CBR IC.sub.50 for SD2 is 3.04 The anti-CBR
IC.sub.50 for SD6 is 193 nM
##STR00025##
[0306] The anti-CBR IC.sub.50 for SD3 is 7.65 The anti-CBR
IC.sub.50 for SD7 is 376 nM.
##STR00026##
[0307] The anti-CBR IC.sub.50 for SD4 is 416 nM. The anti-CBR
IC.sub.50 for SD8 is 67 nM.
Example 9
[0308] New potent and selective inhibitors of SDR family members
including carbonyl reductase 1 (CBR1), and Src family protein
kinase, Fyn.
[0309] Table 1 shows compounds of the present invention that are
inhibitors of the Src family knase, Fyn, and are inhibitors of
carbonyl reductase 1 (CBR1). AB129 is a potent (10 nM IC.sub.50)
inhibitor of Fyn. While the ability of AB129 to inhibit protein
kinases as well as CBR1 could be important for its biological
activity in some settings. AB129 compound was further modified to
produce compounds of the present invention which are CBR1
inhibitors with reduced inhibitory activity for Fyn.
TABLE-US-00002 TABLE 1 IC.sub.50 for anti cFYN and anti-hCBR1
IC.sub.50 IC.sub.50 Com- anti-c- anti- pound Structure Fyn-wt hCBR1
AB001 ##STR00027## 110 nM >20 .mu.M AB060 ##STR00028## 50 nM
>20 .mu.M AB061 ##STR00029## 50 nM >20 .mu.M AB129
##STR00030## 8 nM 790 nM PP1 ##STR00031## 50 nM >20 .mu.M MT13
##STR00032## 5 .mu.M >20 .mu.M MT15 ##STR00033## 0.2 .mu.M 930
nM MS01 ##STR00034## 3 nM 1 .mu.M RB01 ##STR00035## 1.2 .mu.M
>20 .mu.M RB02 ##STR00036## 11 nM 1 .mu.M RB03 ##STR00037## ~20
.mu.M >20 .mu.M RB04 ##STR00038## 120 nM >20 .mu.M RB05
##STR00039## 12 nM 760 nM RB06 ##STR00040## 70 .mu.M 590 nM RB07
##STR00041## not deter- mined (n/d) >20 .mu.M RB08 ##STR00042##
20 .mu.M 4.4 .mu.M RB09 ##STR00043## n/d >20 .mu.M RB10
##STR00044## n/d 1.15 .mu.M RB11 ##STR00045## n/d 220 nM SD1
##STR00046## n/d 220 nM SD2 ##STR00047## n/d 3.04 .mu.M SD3
##STR00048## n/d 7.65 .mu.M SD4 ##STR00049## n/d 416 nM SD5
##STR00050## n/d 28 nM SD6 ##STR00051## n/d 193 nM SD7 ##STR00052##
n/d 376 nM SD8 ##STR00053## n/d 67 nM
[0310] When ranges are used herein for physical properties, such as
molecular weight, or chemical properties, such as chemical
formulae, all combinations and subcombinations of ranges and
specific embodiments therein are intended to be included.
[0311] The disclosures of each patent, patent application and
publication cited or described in this document are hereby
incorporated herein by reference, in their entirety.
[0312] Those skilled in the art will appreciate that numerous
changes and modifications can be made to the embodiments of the
invention and that such changes and modifications can be made
without departing from the spirit of the invention. It is,
therefore, intended that the appended claims cover all such
equivalent variations as fall within the true spirit and scope of
the invention.
Sequence CWU 1
1
4611209DNAHomo sapiens 1cagactcgag cagtctctgg aacacgctgc ggggctcccg
ggcctgagcc aggtctgttc 60tccacgcagg tgttccgcgc gccccgttca gccatgtcgt
ccggcatcca tgtagcgctg 120gtgactggag gcaacaaggg catcggcttg
gccatcgtgc gcgacctgtg ccggctgttc 180tcgggggacg tggtgctcac
ggcgcgggac gtgacgcggg gccaggcggc cgtacagcag 240ctgcaggcgg
agggcctgag cccgcgcttc caccagctgg acatcgacga tctgcagagc
300atccgcgccc tgcgcgactt cctgcgcaag gagtacgggg gcctggacgt
gctggtcaac 360aacgcgggca tcgccttcaa ggttgctgat cccacaccct
ttcatattca agctgaagtg 420acgatgaaaa caaatttctt tggtacccga
gatgtgtgca cagaattact ccctctaata 480aaaccccaag ggagagtggt
gaacgtatct agcatcatga gcgtcagagc ccttaaaagc 540tgcagcccag
agctgcagca gaagttccgc agtgagacca tcactgagga ggagctggtg
600gggctcatga acaagtttgt ggaggataca aagaagggag tgcaccagaa
ggagggctgg 660cccagcagcg catacggggt gacgaagatt ggcgtcaccg
ttctgtccag gatccacgcc 720aggaaactga gtgagcagag gaaaggggac
aagatcctcc tgaatgcctg ctgcccaggg 780tgggtgagaa ctgacatggc
gggacccaag gccaccaaga gcccagaaga aggtgcagag 840acccctgtgt
acttggccct tttgccccca gatgctgagg gtccccatgg acaatttgtt
900tcagagaaga gagttgaaca gtggtgagct gggctcacag ctccatccat
gggccccatt 960ttgtaccttg tcctgagttg gtccaaaggg catttacaat
gtcataaata tccttatata 1020agaaaaaaaa tgatctctta tcaattagca
ctcactaatg tactactaat tgagcaacct 1080acgcactcag ttgactacgt
aaatctgtca ggtcttttgt gatttcctct gatgcaggag 1140aggaaaaatt
gtaattgatg aaaataatga atgaaaatca acagatgaat aaatggttct
1200ttataagtg 1209211PRTHomo sapiens 2Leu Phe Ser Gly Asp Val Val
Leu Thr Ala Arg 1 5 10 316PRTHomo sapiens 3Val Ala Asp Pro Thr Pro
Phe His Ile Gln Ala Glu Val Thr Met Lys 1 5 10 15 48PRTHomo sapiens
4Gly Ile Gly Leu Ala Ile Val Arg 1 5 511PRTHomo sapiens 5Leu Phe
Ser Gly Asp Val Val Leu Thr Ala Arg 1 5 10 616PRTHomo sapiens 6Gly
Gln Ala Ala Val Gln Gln Leu Gln Ala Glu Gly Leu Ser Pro Arg 1 5 10
15 713PRTHomo sapiens 7Phe His Gln Leu Asp Ile Asp Asp Leu Gln Ser
Ile Arg 1 5 10 87PRTHomo sapiens 8Ala Leu Arg Asp Phe Leu Arg 1 5
916PRTHomo sapiens 9Val Ala Asp Pro Thr Pro Phe His Ile Gln Ala Glu
Val Thr Met Lys 1 5 10 15 1016PRTHomo sapiensVARIANT(15)..(15)Met
is methionine sulfoxide 10Val Ala Asp Pro Thr Pro Phe His Ile Gln
Ala Glu Val Thr Met Lys 1 5 10 15 1111PRTHomo sapiens 11Val Val Asn
Val Ser Ser Ile Met Ser Val Arg 1 5 10 1211PRTHomo
sapiensVARIANT(8)..(8)Met is methionine sulfoxide 12Val Val Asn Val
Ser Ser Ile Met Ser Val Arg 1 5 10 138PRTHomo sapiens 13Ile Gly Val
Thr Val Leu Ser Arg 1 5 149PRTHomo sapiens 14Ser Ile Gly Val Ser
Asn Phe Asn Arg 1 5 158PRTHomo sapiens 15Thr Pro Ala Leu Ile Ala
Leu Arg 1 5 1610PRTHomo sapiens 16Val Leu Ser Ile Gln Ser His Val
Ile Arg 1 5 10 1711PRTHomo sapiens 17Thr Val Ser Thr Leu His His
Val Leu Gln Arg 1 5 10 1810PRTHomo sapiens 18Asn Pro Ala Gly Ser
Val Val Met Glu Arg 1 5 10 1917PRTHomo sapiens 19Val Met Leu Gly
Glu Thr Asn Pro Ala Asp Ser Lys Pro Gly Thr Ile 1 5 10 15 Arg
2023PRTPig 20Ser Ser Asn Thr Arg Val Ala Leu Val Thr Gly Ala Asn
Lys Gly Ile 1 5 10 15 Gly Phe Ala Ile Val Arg Asp 20 2123PRTHomo
sapiens 21Ser Ser Gly Ile His Val Ala Leu Val Thr Gly Gly Asn Lys
Gly Ile 1 5 10 15 Gly Leu Ala Ile Val Arg Asp 20 2223PRTHomo
sapiens 22Ser Ser Cys Ser Arg Val Ala Leu Val Thr Gly Ala Asn Arg
Gly Ile 1 5 10 15 Gly Leu Ala Ile Ala Arg Glu 20 2325PRTHomo
sapiens 23Ala Arg Thr Val Val Leu Ile Thr Gly Cys Ser Ser Gly Ile
Gly Leu 1 5 10 15 His Leu Ala Val Arg Leu Ala Ser Asp 20 25
2426PRTHomo sapiens 24Tyr Tyr Ser Ala Asn Glu Glu Phe Arg Pro Glu
Met Leu Gln Gly Lys 1 5 10 15 Lys Val Ile Val Thr Gly Ala Ser Lys
Gly 20 25 2530PRTHomo sapiens 25Ala Arg Ala Leu Leu Gln Leu Leu Arg
Ser Asp Leu Arg Leu Gly Arg 1 5 10 15 Pro Leu Leu Ala Ala Leu Ala
Leu Leu Ala Ala Leu Asp Trp 20 25 30 2632PRTHomo sapiens 26Leu Val
Asn Asn Ala Ala Ile Ala Phe Gln Leu Asp Asn Pro Thr Pro 1 5 10 15
Phe His Ile Gln Ala Glu Leu Thr Met Lys Thr Asn Phe Met Gly Thr 20
25 30 2732PRTHomo sapiens 27Leu Val Asn Asn Ala Gly Ile Ala Phe Lys
Val Ala Asp Pro Thr Pro 1 5 10 15 Phe His Ile Gln Ala Glu Val Thr
Met Lys Thr Asn Phe Phe Gly Thr 20 25 30 2832PRTHomo sapiens 28Leu
Val Asn Asn Ala Ala Val Ala Phe Lys Ser Asp Asp Pro Met Pro 1 5 10
15 Phe Asp Ile Lys Ala Glu Met Thr Leu Lys Thr Asn Phe Phe Ala Thr
20 25 30 2932PRTHomo sapiens 29Leu Val Cys Asn Ala Gly Leu Gly Leu
Leu Gly Pro Leu Glu Ala Leu 1 5 10 15 Gly Glu Asp Ala Val Ala Ser
Val Leu Asp Val Asn Val Val Gly Thr 20 25 30 3032PRTHomo sapiens
30Leu Ile Leu Asn His Ile Thr Asn Thr Ser Leu Asn Leu Phe His Asp 1
5 10 15 Asp Ile His His Val Arg Lys Ser Met Glu Val Asn Phe Leu Ser
Tyr 20 25 30 3134PRTHomo sapiens 31Gly Leu Val Asn Asn Ala Gly His
Asn Glu Val Val Ala Asp Ala Glu 1 5 10 15 Leu Ser Pro Val Ala Thr
Phe Arg Ser Cys Met Glu Val Asn Phe Phe 20 25 30 Gly Ala
3226PRTHomo sapiens 32Met Ser Ser Gly Ile His Val Ala Leu Val Thr
Gly Gly Asn Lys Gly 1 5 10 15 Ile Gly Leu Ala Ile Val Arg Asp Leu
Cys 20 25 3323PRTHomo sapiens 33Ala Arg Thr Val Val Leu Ile Thr Gly
Cys Ser Ser Gly Ile Gly Leu 1 5 10 15 His Leu Ala Val Arg Leu Ala
20 3426PRTHomo sapiens 34Glu Met Leu Gln Gly Lys Lys Val Ile Val
Thr Gly Ala Ser Lys Gly 1 5 10 15 Ile Gly Arg Glu Met Ala Tyr His
Leu Ala 20 25 3512PRTHomo sapiens 35Gly Gly Leu Asp Val Leu Val Asn
Asn Ala Gly Ile 1 5 10 3612PRTHomo sapiens 36Gly Arg Val Asp Val
Leu Val Cys Asn Ala Gly Leu 1 5 10 3712PRTHomo sapiens 37Gly Gly
Leu Asp Met Leu Ile Leu Asn His Ile Thr 1 5 10 3810PRTHomo sapiens
38Asn Val Ser Ser Ile Met Ser Val Arg Ala 1 5 10 3910PRTHomo
sapiens 39Val Thr Gly Ser Val Gly Gly Leu Met Gly 1 5 10
4010PRTHomo sapiens 40Val Val Ser Ser Leu Ala Gly Lys Val Ala 1 5
10 417PRTHomo sapiens 41Val Arg Thr Asp Met Ala Gly 1 5 427PRTHomo
sapiens 42Asp Arg Thr Asp Ile His Thr 1 5 437PRTHomo sapiens 43Ile
Asp Thr Glu Thr Ala Met 1 5 447PRTHomo sapiens 44Ala Tyr Gly Val
Thr Lys Ile 1 5 457PRTHomo sapiens 45Val Tyr Cys Ala Ser Lys Phe 1
5 467PRTHomo sapiens 46Ala Tyr Ser Ala Ser Lys Phe 1 5
* * * * *