U.S. patent application number 14/820040 was filed with the patent office on 2016-06-02 for antibodies to cd40.
The applicant listed for this patent is Amgen Fremont Inc., Pfizer Inc.. Invention is credited to Vahe Bedian, Jose Corvalan, Xiao Feng, Ronald P. Gladue, Xiao-Chi Jia.
Application Number | 20160152713 14/820040 |
Document ID | / |
Family ID | 23370387 |
Filed Date | 2016-06-02 |
United States Patent
Application |
20160152713 |
Kind Code |
A1 |
Bedian; Vahe ; et
al. |
June 2, 2016 |
ANTIBODIES TO CD40
Abstract
The present invention relates to antibodies and antigen-binding
portions thereof that specifically bind to CD40, preferably human
CD40, and that function as CD40 agonists. The invention also
relates to human anti-CD40 antibodies and antigen-binding portions
thereof. The invention also relates to antibodies that are
chimeric, bispecific, derivatized, single chain antibodies or
portions of fusion proteins. The invention also relates to isolated
heavy and light chain immunoglobulins derived from human anti-CD40
antibodies and nucleic acid molecules encoding such
immunoglobulins. The present invention also relates to methods of
making human anti-CD40 antibodies, compositions comprising these
antibodies and methods of using the antibodies and compositions for
diagnosis and treatment. The invention also provides gene therapy
methods using nucleic acid molecules encoding the heavy and/or
light immunoglobulin molecules that comprise the human anti-CD40
antibodies. The invention also relates to transgenic animals
comprising nucleic acid molecules of the present invention.
Inventors: |
Bedian; Vahe; (East Lyme,
CT) ; Gladue; Ronald P.; (Stonington, CT) ;
Corvalan; Jose; (Foster City, CA) ; Jia;
Xiao-Chi; (San Mateo, CA) ; Feng; Xiao; (Union
City, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Amgen Fremont Inc.
Pfizer Inc. |
Thousand Oaks
New York |
CA
NY |
US
US |
|
|
Family ID: |
23370387 |
Appl. No.: |
14/820040 |
Filed: |
August 6, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13619954 |
Sep 14, 2012 |
|
|
|
14820040 |
|
|
|
|
13471395 |
May 14, 2012 |
8388971 |
|
|
13619954 |
|
|
|
|
12576459 |
Oct 9, 2009 |
|
|
|
13471395 |
|
|
|
|
12284605 |
Sep 22, 2008 |
7626012 |
|
|
12576459 |
|
|
|
|
11213575 |
Aug 26, 2005 |
7563442 |
|
|
12284605 |
|
|
|
|
10292088 |
Nov 8, 2002 |
7288251 |
|
|
11213575 |
|
|
|
|
60348980 |
Nov 9, 2001 |
|
|
|
Current U.S.
Class: |
800/6 ;
424/143.1; 435/252.3; 435/252.33; 435/252.35; 435/254.2;
435/254.21; 435/254.23; 435/320.1; 435/328; 435/417; 435/419;
435/69.6; 514/44R; 530/387.3; 530/388.22; 536/23.53; 800/13;
800/295 |
Current CPC
Class: |
A61K 39/3955 20130101;
C07K 2317/33 20130101; C07K 16/2866 20130101; A61P 35/02 20180101;
C07K 16/2878 20130101; C07K 2317/56 20130101; C07K 2317/75
20130101; A61N 5/062 20130101; A61K 48/00 20130101; C07K 2317/565
20130101; C07K 2317/34 20130101; A61K 45/06 20130101; A61P 37/04
20180101; C07K 2317/14 20130101; C07K 16/40 20130101; A61N 5/10
20130101; A61P 43/00 20180101; A61P 35/00 20180101; C07K 2317/92
20130101; C07K 2317/21 20130101; A61K 2039/505 20130101; A61P 37/00
20180101; A01K 2217/05 20130101; A61P 13/08 20180101; A61P 13/10
20180101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61N 5/10 20060101 A61N005/10; A61N 5/06 20060101
A61N005/06; A61K 39/395 20060101 A61K039/395; A61K 45/06 20060101
A61K045/06 |
Claims
1. A monoclonal antibody or an antigen-binding portion thereof that
specifically binds to and activates human CD40, wherein said
antibody or antigen-binding portion comprises: a) a heavy chain
comprising amino acid sequences of a heavy chain CDR1, a heavy
chain CDR2 and a heavy chain CDR3 from a heavy chain variable
region; wherein said amino acid sequences of the heavy chain CDR1
and the heavy chain CDR2 are independently selected from a CDR1 and
a CDR2 of a heavy chain variable region, respectively, wherein the
sequence of said heavy chain variable region comprises no more than
18 amino acid changes from the amino acid sequence encoded by a
germline V.sub.H 3-30+, 4-59, 1-02, 4.35 or 3-30.3 gene; wherein
said amino acid sequence of the heavy chain CDR3 is from a CDR3 of
a heavy chain variable region, wherein said heavy chain variable
region is selected from the group consisting of i) a heavy chain
variable region of an antibody selected from the group consisting
of 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 7.1.2, 10.8.3,
15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1,
23.28.1, 23.28.1H-D16E, 23.29.1 and 24.2.1; ii) a heavy chain
variable region comprising an amino acid sequence selected from the
group consisting of SEQ ID NOS: 2, 10, 18, 26, 34, 42, 50, 58, 66,
74 and 82, or a heavy chain variable region comprising an amino
acid sequence from the heavy chain amino acid sequence selected
from the group consisting of SEQ ID NOS: 90, 92, 96 and 98, or said
amino acid sequence lacking a signal sequence; and iii) a heavy
chain variable region encoded by a nucleic acid sequence selected
from the group consisting of SEQ ID NOS: 1, 9, 17, 25, 33, 41, 49,
57, 65, 73 and 81, or a heavy chain variable region comprising an
amino acid sequence encoded by the heavy chain nucleic acid
sequence selected from the group consisting of 89, 91, 95 and 97,
or said encoded heavy chain variable region lacking a signal
sequence; wherein the amino acid sequence of said heavy chain CDR3
may have up to two conservative amino acid substitutes and/or two
non-conservative amino acid insertions, deletions or substitutions
therefrom; or b) a light chain comprising amino acid sequences of a
light chain CDR1, a light chain CDR2 and a light chain CDR3 from a
light chain variable region, wherein said amino acid sequences of
the light chain CDR1 and the light chain CDR3 are independently
selected from CDR1 and a CDR3 of a light chain variable region,
respectively, wherein the light chain variable region comprises no
more than ten amino acid changes from the amino acid sequence
encoded by a germline V.kappa. A3/A19, L5 or A27 gene; and wherein
said amino acid sequence of the light chain CDR2 is from a light
chain variable region, wherein said light chain variable region is
selected from the group consisting of i) a light chain variable
region of an antibody selected from the group consisting of 3.1.1,
3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1,
23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A, 23.29.1 and 24.2.1; ii) a
light chain variable region comprising an amino acid sequence
selected from the group consisting of SEQ ID NOS: 4, 12, 20, 28,
36, 44, 52, 60, 68, 76 and 84, or a light chain variable region
comprising an amino acid sequence from the light chain amino acid
sequence selected from the group consisting of SEQ ID NOS: 94 and
100, or said amino acid sequence lacking a signal sequence; and
iii) a light chain variable region encoded by a nucleic acid
sequence selected from the group consisting of SEQ ID NOS: 3, 11,
19, 27, 35, 43, 51, 59, 67, 75 and 83, or a light chain variable
region comprising an amino acid sequence encoded by the light chain
nucleic sequence selected from the group consisting of SEQ ID NOS:
93 and 99, or said encoded light chain variable region lacking a
signal sequence; wherein the amino acid sequence of said light
chain CDR2 may have up to two conservative amino acid substitutes
and/or two non-conservative amino acid insertions, deletions or
substitutions therefrom.
2. The antibody or antigen-binding portion thereof according to
claim 1, wherein the antibody or portion thereof comprises a heavy
chain and a light chain, and wherein the amino acid sequences of
the heavy chain variable region of said heavy chain and the light
chain variable region of said light chain are respectively selected
from the group consisting of: a) the amino acid sequence selected
from the group consisting of SEQ ID NOS: 2, 90 and 92, and the
amino acid sequence selected from the group consisting of SEQ ID
NOS: 4 and 94; b) the amino acid sequence of SEQ ID NO: 10 and the
amino acid sequence of SEQ ID NO: 12; c) the amino acid sequence of
SEQ ID NO: 18 and the amino acid sequence of SEQ ID NO: 20; d) the
amino acid sequence of SEQ ID NO: 26 and the amino acid sequence of
SEQ ID NO: 28; e) the amino acid sequence of SEQ ID NO: 34 and the
amino acid sequence of SEQ ID NO: 36; f) the amino acid sequence of
SEQ ID NO: 42 and the amino acid sequence of SEQ ID NO: 44; g) the
amino acid sequence selected from the group consisting of SEQ ID
NOS: 50 and 96 and the amino acid sequence of SEQ ID NO: 52; h) the
amino acid sequence of SEQ ID NO: 58 and the amino acid sequence of
SEQ ID NO: 60; i) the amino acid sequence selected from the group
consisting of SEQ ID NOS: 66 and 98, and the amino acid sequence
selected from the group consisting of SEQ ID NOS: 68 and 100; and
j) the amino acid sequence of SEQ ID NO: 74 and the amino acid
sequence of SEQ ID NO: 78; wherein said amino acid sequences
optionally lack a signal sequence and wherein the amino acid
sequences of the heavy and light chains may each have up to six
conservative amino acid substitutions and/or four non-conservative
amino acid insertions, deletions or substitutions therefrom.
3. The antibody or antigen-binding portion according to claim 1,
wherein the amino acid sequences of the heavy chain and the light
chain are respectively selected from the group consisting of: a)
the amino acid sequence of SEQ ID NO: 6 and the amino acid sequence
of SEQ ID NO: 8; b) the amino acid sequence of SEQ ID NO: 14 and
the amino acid sequence of SEQ ID NO: 16; c) the amino acid
sequence of SEQ ID NO: 22 and the amino acid sequence of SEQ ID NO:
24; d) the amino acid sequence of SEQ ID NO: 30 and the amino acid
sequence of SEQ ID NO: 32; and e) the amino acid sequence of SEQ ID
NO: 46 and the amino acid sequence of SEQ ID NO: 48.
4. The antibody or antigen-binding portion according to claim 1,
wherein the antibody or portion has at least one property selected
from the group consisting of: a) does not bind to mouse, rat, dog
and/or rabbit B cells; b) binds to human, cynomolgus and/or rhesus
B cells; c) has a selectivity for CD40 that is at least 100 times
greater than its selectivity for receptor activator of nuclear
factor-kappa B (RANK), 4-1BB (CD137), tumor necrosis factor
receptor-1 (TNFR-1) and tumor necrosis factor receptor-2 (TNFR-2);
d) binds to CD40 with a K.sub.D of 4.times.10.sup.-10 M or less; e)
has an off rate for CD40 of K.sub.off of 2.times.10.sup.-4 or
smaller; f) inhibits tumor growth in vivo in the presence of human
T cells and/or human dendritic cells; g) inhibits the growth of
CD40-positive tumors in the absence of human immune cells; h)
increases expression of ICAM, MHC-II, B7-2, CD71, CD23 and/or CD71
on the surface of human B-cells; i) increases secretion of
IL-12p40, IL-12p70 and/or IL-8 by human dendritic cells; j)
increases expression of ICAM, MHC-II, B7-2 and/or CD83 on the
surface of human dendritic cells; k) increases expression of
interferon-gamma by human T cells during allogenic stimulation; l)
binds human CD40 in the presence of human CD40L; and m) binds to an
epitope of human CD40 contained in domain 1, domain 2, or domain 3
of the extracellular domain of CD40.
5. A monoclonal antibody or an antigen-binding portion thereof that
specifically binds to and activates human CD40, wherein the
antibody or portion has at least one property selected from the
group consisting of: a) cross-competes for binding to CD40 with an
antibody selected from the group consisting of 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1L-C92A, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1,
23.29.1L-R174K and 24.2.1; b) binds to the same epitope of CD40 as
an antibody selected from the group consisting of 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3,
15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1,
23.28.1, 23.28.1L-C92A, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1,
23.29.1L-R174K and 24.2.1; c) binds to CD40 with substantially the
same K.sub.D as an antibody selected from the group consisting of
3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2,
10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1,
23.25.1, 23.28.1, 23.28.1L-C92A, 23.28.1H-D16E, 23.28.1L-C92A,
23.29.1, 23.29.1L-R174K and 24.2.1; and d) binds to CD40 with
substantially the same off rate as an antibody selected from the
group consisting of 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A,
3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1,
22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A,
23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K and
24.2.1.
6. The antibody or antigen-binding portion thereof according to
claim 1 that is a) an immunoglobulin G (IgG), an IgM, an IgE, an
IgA or an IgD molecule, or is derived therefrom; or b) an Fab
fragment, an F(ab').sub.2 fragment, an F.sub.v fragment, a single
chain antibody, a humanized antibody, a chimeric antibody or a
bispecific antibody.
7. A pharmaceutical composition comprising the antibody or
antigen-binding portion according to claim 1 and a pharmaceutically
acceptable carrier.
8. A method of treating a patient in need thereof with an anti-CD40
antibody or an antigen-binding portion thereof, comprising the step
of administering to the patient an effective amount of the antibody
or portion according to claim 1.
9. A method of treating cancer in a patient in need thereof with an
anti-CD40 antibody or an antigen-binding portion thereof,
comprising the step of administering to the patient an effective
amount of the antibody or portion according to claim 1.
10. The method according to claim 9, further comprising the step of
administering to the patient radiotherapy, chemotherapy,
photodynamic therapy, or surgery.
11. The method according to claim 9, further comprising the step of
administering to the patient an anti-cancer agent.
12. A method of enhancing an immune response in a patient in need
thereof with an anti-CD40 antibody or an antigen-binding portion
thereof, comprising the step of administering to the patient an
effective amount of the antibody or portion according to claim
1.
13. An isolated cell line that produces the antibody or
antigen-binding portion according to claim 1.
14. An isolated nucleic acid molecule that comprises a nucleic acid
sequence that encodes the heavy chain or an antigen-binding portion
thereof or the light chain or an antigen-binding portion thereof of
the antibody according to claim 1.
15. A vector comprising the nucleic acid molecule according to
claim 14, wherein the vector optionally comprises an expression
control sequence operably linked to the nucleic acid molecule.
16. A host cell comprising the nucleic acid molecule according to
claim 14.
17. A method of making an anti-CD40 antibody or an antigen-binding
portion thereof, comprising culturing the host cell according to
claim 16 under suitable conditions and recovering said antibody or
antigen-binding portion.
18. A non-human transgenic animal or transgenic plant comprising
the nucleic acid according to claim 14, wherein the non-human
transgenic animal or transgenic plant expresses said nucleic
acid.
19. A method of making an antibody or an antigen-binding portion
thereof that specifically binds to human CD40, comprising the step
of isolating the antibody or antigen-binding portion from the
non-human transgenic animal or transgenic plant according to claim
18.
20. A method of treating a subject in need thereof with an antibody
or an antigen-binding portion thereof that specifically binds to
and activates human CD40, comprising the steps of: (a)
administering an effective amount of an isolated nucleic acid
molecule encoding the heavy chain or an antigen-binding portion
thereof, an isolated nucleic acid molecule encoding the light chain
or an antigen-binding portion thereof, or both the nucleic acid
molecules encoding the light chain and the heavy chain or
antigen-binding portions thereof; and (b) expressing the nucleic
acid molecule(s).
Description
[0001] The present application is a continuation application of
U.S. patent application Ser. No. 13/619,954, filed Sep. 14, 2012,
which is a continuation application of U.S. patent application Ser.
No. 13/471,395, filed May 14, 2012 and issued as U.S. Pat. No.
8,388,971 on Mar. 5, 2013, which is a continuation application of
U.S. patent application Ser. No. 12/576,459, filed Oct. 9, 2009
(abandoned), which is a continuation application of U.S. patent
application Ser. No. 12/284,605, filed Sep. 22, 2008 and issued as
U.S. Pat. No. 7,626,012 on Dec. 1, 2009, which is a divisional
application of U.S. patent application Ser. No. 11/213,575, filed
Aug. 26, 2005 and issued as U.S. Pat. No. 7,563,442 on Jul. 21,
2009, which is a divisional application of U.S. patent application
Ser. No. 10/292,088, filed Nov. 8, 2002 and issued as U.S. Pat. No.
7,288,251 on Oct. 30, 2007, which claims the benefit of U.S.
Provisional Application 60/348,980, filed Nov. 9, 2001. The
disclosure, including the claims, of each of the aforementioned
priority applications is incorporated by reference in its entirety
herein.
[0002] The Sequence Listing associated with this application is
provided in text format in lieu of a paper copy, and is hereby
incorporated by reference into the specification. The name of the
text file containing the Sequence Listing is
"0006590045109sequencelisting.txt." The text file is 174,531 bytes
in size, was created on Aug. 5, 2015, and is being submitted
electronically via EFS Web.
BACKGROUND OF THE INVENTION
[0003] The CD40 antigen is a 50 kDa cell surface glycoprotein which
belongs to the Tumor Necrosis Factor Receptor (TNF-R) family.
(Stamenkovic et al., EMBO J. 8:1403-10 (1989).) CD40 is expressed
in many normal and tumor cell types, including B lymphocytes,
dendritic cells, monocytes, macrophages, thymic epithelium,
endothelial cells, fibroblasts, and smooth muscle cells. (Paulie S.
et al., Cancer Immunol. Immunother. 20:23-8 (1985); Banchereau J.
et al., Adv. Exp. Med. & Biol. 378:79-83 (1995); Alderson M. R.
et al., J. of Exp. Med. 178:669-74 (1993); Ruggiero G. et al., J.
of Immunol. 156:3737-46 (1996); Hollenbaugh D. et al., J. of Exp.
Med. 182:33-40 (1995); Yellin M. J. et al., J. of Leukocyte Biol.
58:209-16 (1995); and Lazaar A. L. et al., J. of Immunol.
161:3120-7 (1998).) CD40 is expressed in all B-lymphomas and in 70%
of all solid tumors. Although constitutively expressed, CD40 is
up-regulated in antigen presenting cells by maturation signals,
such as LPS, IL-1.beta., IFN-.gamma. and GM-CSF.
[0004] CD40 activation plays a critical role in regulating humoral
and cellular immune responses. Antigen presentation without CD40
activation can lead to tolerance, while CD40 signaling can reverse
such tolerance, enhance antigen presentation by all antigen
presenting cells (APCs), lead to secretion of helper cytokines and
chemokines, increase co-stimulatory molecule expression and
signaling, and stimulate cytolytic activity of immune cells.
[0005] CD40 plays a critical role in B cell proliferation,
maturation and class switching. (Foy T. M. et al., Ann. Rev. of
Immunol. 14:591-617 (1996).) Disruption of the CD40 signaling
pathway leads to abnormal serum immunoglobulin isotype
distribution, lack of CD4+ T cell priming, and defects in secondary
humoral responses. For example, the X-linked hyper-IgM syndrome is
a disease associated with a mutation in the human CD40L gene, and
it is characterized by the inability of affected individuals to
produce antibodies other than those of the IgM isotype, indicating
that the productive interaction between CD40 and CD40L is required
for an effective immune response.
[0006] CD40 engagement by CD40L leads to the association of the
CD40 cytoplasmic domain with TRAFs (TNF-R associated factors). (Lee
H. H. et al., Proc. Natl. Acad. Sci. USA 96:1421-6 (1999); Pullen
S. S. et al., Biochemistry 37:11836-45 (1998); Grammar A. C. et
al., J. of Immunol. 161:1183-93 (1998); Ishida T. K. et al., Proc.
Natl. Acad. Sci. USA 93:9437-42 (1996); Pullen S. S. et al., J. of
Biol. Chem. 274:14246-54 (1999)). The interaction with TRAFs can
culminate in the activation of both NF.kappa.B and Jun/AP1
pathways. (Tsukamoto N. et al., Proc. Natl. Acad. Sci. USA
96:1234-9 (1999); Sutherland C. L. et al., J. of Immunol.
162:4720-30 (1999).) Depending on cell type, this signaling leads
to enhanced secretion of cytokines such as IL-6 (Jeppson J. D. et
al., J. of Immunol. 161:1738-42 (1998); Uejima Y. et al., Int.
Arch. of Allergy & Immunol. 110:225-32, (1996), IL-8 (Gruss H.
J. et al., Blood 84:2305-14 (1994); von Leoprechting A. et al.,
Cancer Res. 59:1287-94 (1999); Denfeld R. W. et al., Europ. J. of
Immunol. 26:2329-34 (1996)), IL-12 (Cella M. et al., J. of Exp.
Med. 184:747-52 (1996); Ferlin W. G. et al., Europ. J. of Immunol.
28:525-31 (1998); Armant M. et al., Europ. J. of Immunol. 26:1430-4
(1996); Koch F. et al., J. of Exp. Med. 184:741-6 (1996); Seguin R.
and L. H. Kasper, J. of Infect. Diseases 179:467-74 (1999);
Chaussabel D. et al., Infection & Immunity 67:1929-34 (1999)),
IL-15 (Kuniyoshi J. S. et al., Cellular Immunol. 193:48-58 (1999))
and chemokines (MIP1.alpha., MIP1.beta., RANTES, and others)
(McDyer J. F. et al., J. of Immunol. 162:3711-7 (1999); Schaniel C.
et al., J. of Exp. Med. 188:451-63 (1998); Altenburg A. et al., J.
of Immunol. 162:4140-7 (1999); Deckers J. G. et al., J. of the Am.
Society of Nephrology 9:1187-93 (1998)), increased expression of
MHC class I and II (Santos-Argumedo L. et al., Cellular Immunol.
156:272-85 (1994)), and increased expression of adhesion molecules
(e.g., ICAM) (Lee H. H. et al., Proc. Natl. Acad. Sci. USA.
96:1421-6 (1999); Grousson J. et al., Archives of Dermatol. Res.
290:325-30 (1998); Katada Y. et al., Europ. J. of Immunol.
26:192-200 (1996); Mayumi M. et al., J. of Allergy & Clin.
Immunol. 96:1136-44 (1995); Flores-Romo L. et al., Immunol.
79:445-51 (1993)) and costimulatory molecules (e.g., B7) (Roy M. et
al., Europ. J. of Immunol. 25:596-603 (1995); Jones K. W. and C. J.
Hackett, Cellular Immunol. 174:42-53 (1996); Caux C. et al.,
Journal of Exp. Med. 180:1263-72 (1994); Kiener P. A. et al., J. of
Immunol. 155:4917-25 (1995)). Cytokines induced by CD40 engagement
enhance T cell survival and activation.
[0007] In addition to enhancement of cellular and immune function,
the effects of CD40 activation include: cell recruitment and
differentiation by chemokines and cytokines; activation of
monocytes; increased cytolytic activity of cytolytic T lymphocyte
(CTL) and natural killer (NK) cells; induction of apoptosis in CD40
positive tumors; enhancement of immunogenicity of CD40 positive
tumors; and tumor-specific antibody production. The role of CD40
activation in cell-mediated immune responses is also well
established, and it is reviewed in: Grewal et al., Ann. Rev. of
Immunol. 16:111-35 (1998); Mackey et al., J. of Leukocyte Biol.
63:418-28 (1998); and Noelle R. J., Agents & Actions--Suppl.
49:17-22 (1998).
[0008] Studies using a cross-priming model system showed that CD40
activation of APCs can replace helper T cell requirement for the
generation of cytolytic T lymphocyte (CTL). (Bennett et al., Nature
393:478-480 (1998).) Evidence from CD40L deficient mice indicates a
clear requirement for CD40 signaling in helper T cell priming.
(Grewal I. S. et al., Science 273:1864-7 (1996); Grewal I. S. et
al., Nature 378:617-20 (1995).) CD40 activation converts otherwise
tolerogenic, antigen bearing B cells into competent APCs. (Buhlmann
J. E. et al., Immunity 2:645-53 (1995).) CD40 activation induces
maturation and differentiation of cord blood progenitors into
dendritic cells. (Flores-Romo L. et al., J. of Exp. Med. 185:341-9
(1997); Mackey M. F. et al., J. of Immunol. 161:2094-8 (1998).)
CD40 activation also induces differentiation of monocytes into
functional dendritic cells. (Brossart P. et al., Blood 92:4238-47
(1998).) Further, CD40 activation enhances cytolytic activity of NK
cells through APC-CD40 induced cytokines. (Carbone E. et al., J. of
Exp. Med. 185:2053-60 (1997); Martin-Fontecha A. et al., J. of
Immunol. 162:5910-6 (1999).) These observations indicate that CD40
plays an essential role in the initiation and enhancement of immune
responses by inducing maturation of APCs, secretion of helper
cytokines, upregulation of costimulatory molecules, and enhancement
of effector functions.
[0009] The critical role of CD40 signaling in the initiation and
maturation of humoral and cytotoxic immune responses makes this
system an ideal target for immune enhancement. Such enhancement can
be particularly important for mounting effective immune responses
to tumor antigens, which are generally presented to the immune
system through cross-priming of activated APCs. (Huang A. Y. et
al., Ciba Foundation Symp. 187:229-44 (1994); Toes R. E. M. et al.,
Seminars in Immunol. 10:443-8 (1998); Albert M. L. et al., Nature
392:86-9 (1998); Bennett S. R. et al., J. of Exp. Med. 186:65-70
(1997).)
[0010] Several groups have demonstrated the effectiveness of CD40
activation for antitumor responses in vitro and in vivo. (Toes R.
E. M. et al., Seminars in Immunol. 10:443-8 (1998).) Two groups,
using lung metastatic model of renal cell carcinoma and
subcutaneous tumors by virally transformed cells, have
independently demonstrated that CD40 activation can reverse
tolerance to tumor-specific antigens, resulting in efficient
antitumor priming of T cells. (Sotomayor E. M. et al., Nature
Medicine 5:780-787 (1999); Diehl L. et al., Nature Medicine 5:774-9
(1999).) Antitumor activity in the absence of immune cells was also
reported by CD40L and anti-CD40 antibody treatment in a human
breast cancer line model in SCID mice. (Hirano A. et al., Blood
93:2999-3007 (1999).) CD40 activation by anti-CD40 antibody was
recently shown to eradicate CD40+ and CD40-lymphoma in mouse
models. (French R. R. et al., Nature Medicine 5:548-53 (1999).)
Furthermore, previous studies by Glennie and co-workers conclude
that signaling activity by anti-CD40 antibodies is more effective
for inducing in vivo tumor clearance than other anti-surface marker
antibodies capable of recruiting effectors. (Tutt A. L. et al., J.
of Immunol. 161:3176-85 (1998).) Consistent with these
observations, when anti-CD40 antibodies were tested for activity
against CD40+ tumor cells in vivo, most but not all of the
tumoricidal activity was associated with CD40 signaling rather than
ADCC. (Funakoshi S. et al., J. of Immunotherapy with Emphasis on
Tumor Immunol. 19:93-101 (1996).) In another study, bone marrow
dendritic cells were treated ex vivo with a variety of agents, and
tested for in vivo antitumor activity. These studies demonstrated
that CD40L stimulated DCs were the most mature and most effective
cells that mounting an antitumor response.
[0011] The essential role of CD40 in antitumor immunity has also
been demonstrated by comparing responses of wild-type and CD40-/-
mice to tumor vaccines. These studies show that CD40-/- mice are
incapable of achieving the tumor immunity observed in normal mice.
(Mackey M. F. et al., Cancer Research 57:2569-74 (1997).) In
another study, splenocytes from tumor bearing mice were stimulated
with tumor cells and treated with activating anti-CD40 antibodies
ex vivo, and were shown to have enhanced tumor specific CTL
activity. (Donepudi M. et al., Cancer Immunol. Immunother.
48:153-164 (1999).) These studies demonstrate that CD40 occupies a
critical position in antitumor immunity, in both CD40 positive and
negative tumors. Since CD40 is expressed in lymphomas, leukemias,
multiple myeloma, a majority of carcinomas of nasopharynx, bladder,
ovary, and liver, and some breast and colorectal cancers,
activation of CD40 can have a broad range of clinical
applications.
[0012] Anti-CD40 activating monoclonal antibodies can contribute to
tumor eradication via several important mechanisms. Foremost among
these is activation of host dendritic cells for enhanced tumor
antigen processing and presentation, as well as enhanced antigen
presentation or immunogenicity of CD40 positive tumor cells
themselves, leading to activation of tumor specific CD4.sup.+ and
CD8.sup.+ lymphocytes. Additional antitumor activity can be
mediated by other immune-enhancing effects of CD40 signaling
(production of chemokines and cytokines, recruitment and activation
monocytes, and enhanced CTL and NK cytolytic activity), as well as
direct killing of CD40.sup.+ tumors by induction of apoptosis or by
stimulating a humoral response leading to ADCC. Apoptotic and dying
tumor cells can also become an important source of tumor-specific
antigens that are processed and presented by CD40 activated
APCs.
[0013] Accordingly, there is a critical need for therapeutic,
clinically relevant anti-CD40 agonist antibodies.
SUMMARY OF THE INVENTION
[0014] The present invention provides an isolated antibody or
antigen-binding portion thereof that binds CD40 and acts as a CD40
agonist.
[0015] The invention provides a composition comprising the
anti-CD40 antibody, or antigen binding portion thereof, and a
pharmaceutically acceptable carrier. The composition may further
comprise another component, such as an anti-tumor agent or an
imaging agent. Diagnostic and therapeutic methods are also provided
by the invention.
[0016] The invention provides an isolated cell line, such as a
hybridoma, that produces an anti-CD40 antibody or antigen binding
portion thereof.
[0017] The invention also provides nucleic acid molecules encoding
the heavy and/or light chain, or antigen-binding portions thereof,
of an anti-CD40 antibody.
[0018] The invention provides vectors and host cells comprising the
nucleic acid molecules, as well as methods of recombinantly
producing the polypeptides encoded by nucleic acid molecules.
[0019] Non-human transgenic animals that express the heavy and/or
light chain, or antigen-binding portions thereof, of an anti-CD40
antibody are also provided.
[0020] The invention also provides a method for treating a subject
in need thereof with an effective amount of a nucleic acid molecule
encoding the heavy and/or light chain, or antigen-binding portions
thereof, of an anti-CD40 antibody.
BRIEF DESCRIPTION OF THE DRAWINGS
[0021] FIG. 1 contains sequence alignments of predicted amino acid
sequences of isolated anti-CD40 monoclonal antibody light and heavy
chain variable domains with the germline amino acid sequences of
the corresponding light and heavy chain genes). Differences between
the clones and the germline sequence are indicated by shading. The
germline CDR1, CDR2, and CDR3 sequences are underlined. In
alignments of heavy chain sequences, apparent insertions to the
CDR3 region are indicated by a dash (-) in the germline sequence
and apparent deletions in the CDR3 region are indicated by a dash
(-) in the clone sequence.
[0022] FIG. 1A: the predicted kappa light chain variable region
amino acid sequences of mAbs 3.1.1 (SEQ ID NO: 4) and 7.1.2 (SEQ ID
NO: 12) with the V.kappa.=A3/A19 and J=J.kappa.1 gene germline (SEQ
ID NO: 103) amino acid sequences.
[0023] FIG. 1B: the predicted kappa light chain variable region
amino acid sequence from clone 15.1.1 (SEQ ID NO: 28) and the
germline amino acid sequence (V.kappa.=A3/A19 and J=J.kappa.2) (SEQ
ID NO: 104);
[0024] FIG. 1C: the predicted kappa light chain variable region
amino acid sequences from mAbs 10.8.3 (SEQ ID NO: 20) and 21.4.1
(SEQ ID NO: 44) and the germline amino acid sequence (V.kappa.=L5
(DP5) and J=J.kappa.4) (SEQ ID NO: 105);
[0025] FIG. 1D: the predicted heavy chain variable region amino
acid sequence from mAb 3.1.1 (SEQ ID NO: 2) and the germline amino
acid sequence (V.sub.H=3-30+ (DP-49), D=D4+DIR3 and J=J.sub.H6)
(SEQ ID NO: 106);
[0026] FIG. 1E: the predicted heavy chain variable region amino
acid sequence from mAb 7.1.2 (SEQ ID NO: 10) and the germline amino
acid sequence (V.sub.H=3-30+(DP-49), D=DIR5+D1-26 and J=J.sub.H6)
(SEQ ID NO: 107);
[0027] FIG. 1F: the predicted heavy chain amino acid sequences from
mAb 10.8.3 (SEQ ID NO: 18) and the germline amino acid sequence
(V.sub.H=4.35 (VIV-4), D=DIR3 and J=J.sub.H6) (SEQ ID NO: 108);
[0028] FIG. 1G: the predicted heavy chain variable region amino
acid sequences from mAb 15.1.1 (SEQ ID NO: 26) and the germline
amino acid sequence (V.sub.H=4-59 (DP-71), D=D4-23 and J=J.sub.H4)
(SEQ ID NO: 109); and
[0029] FIG. 1H: the predicted heavy variable region chain amino
acid sequences from mAb 21.4.1 (SEQ ID NO: 42) and the germline
amino acid sequence (V.sub.H=1-02 (DP-75), D=DLR1 and J=J.sub.H4)
(SEQ ID NO: 110).
[0030] FIG. 2 contains sequence alignments of predicted amino acid
sequences of isolated anti-CD40 monoclonal antibody light and heavy
chain variable domains with the germline amino acid sequences of
the corresponding light and heavy chain genes). Differences between
the clones and the germline sequence are indicated in bold. The
germline CDR1, CDR2, and CDR3 sequences are underlined. In
alignments of heavy chain sequences, apparent insertions to the
CDR3 region are indicated by a dash (-) in the germline sequence
and apparent deletions in the CDR3 region are indicated by a dash
(-) in the clone sequence.
[0031] FIG. 2A: the predicted kappa light chain amino acid
sequences from mAbs 22.1.1 (SEQ ID NO: 52), 23.5.1 (SEQ ID NO: 60)
and 23.29.1 (SEQ ID NO: 76) and the germline amino acid sequence
(V.kappa.=A3/A19 and J=J.kappa.1) (SEQ ID NO: 111);
[0032] FIG. 2B: the predicted kappa light chain amino acid sequence
from mAb 21.2.1 (SEQ ID NO: 36) and the germline amino acid
sequence (V.kappa.=A3/A19 and J=J.kappa.3) (SEQ ID NO: 112);
[0033] FIG. 2C: the predicted kappa light chain amino acid
sequences from mAbs 23.28.1 (SEQ ID NO: 68), 23.28.1L-C92A (SEQ ID
NO: 100) and 24.2.1 (SEQ ID NO: 84) and the germline amino acid
sequence (V.kappa.=A27 and J=J.kappa.3) (SEQ ID NO: 113);
[0034] FIG. 2D: the predicted heavy chain amino acid sequence from
mAb 21.2.1 (SEQ ID NO: 34) and the germline amino acid sequence
(V.sub.H=3-30+, D=DIR3+D6-19 and J=J.sub.H4) (SEQ ID NO: 114);
[0035] FIG. 2E: the predicted heavy chain amino acid sequence from
mAbs 22.1.1 (SEQ ID NO: 50), 22.1.1H-C109A (SEQ ID NO: 96) and the
germline amino acid sequence (V.sub.H=3-30+, D=D1-1 and J=J.sub.H6)
(SEQ ID NO: 115);
[0036] FIG. 2F: the predicted heavy chain amino acid sequence from
mAb 23.5.1 (SEQ ID NO: 58) and the germline amino acid sequence
(V.sub.H=3-30+, D=D4-17 and J=J.sub.H6) (SEQ ID NO: 116);
[0037] FIG. 2G: the predicted heavy chain amino acid sequence from
mAb 23.29.1 (SEQ ID NO: 74) and the germline amino acid sequence
(V.sub.H=3-30.3, D=D4-17 and J=J.sub.H6) (SEQ ID NO: 117); and
[0038] FIG. 2H: the predicted heavy chain amino acid sequences from
mAb 23.28.1 (SEQ ID NO: 66), 23.28.1H-D16E (SEQ ID NO: 98) and
24.2.1 (SEQ ID NO: 82) and the germline amino acid sequence
(V.sub.H=4-59, D=DIR1+D4-17 and J=J.sub.HS) (SEQ ID NO: 142).
[0039] FIG. 3 is a dose-response curve that illustrates the ability
of an anti-CD40 antibody of the invention (21.4.1) to enhance
IL-12p40 production by human dendritic cells.
[0040] FIG. 4 is a dose-response curve that illustrates the ability
of an anti-CD40 antibody of the invention (21.4.1) to enhance
IL-12p70 production by human dendritic cells.
[0041] FIG. 5 is a graph that illustrates the ability of an
anti-CD40 antibody of the invention (21.4.1) to increase
immunogenicity of Jy stimulator cells and enhance CTL activity
against Jy target cells.
[0042] FIG. 6 is a tumor growth inhibition curve that illustrates
the reduced growth of CD40 positive Daudi tumors in SCID-beige mice
treated with an anti-CD40 antibody of the invention (21.4.1).
[0043] FIG. 7 is a tumor growth inhibition curve that illustrates
the reduced growth of CD40 negative K562 tumors in SCID-beige mice
treated with an anti-CD40 antibody of the invention (21.4.1) and
human dendritic cells and T cells.
[0044] FIG. 8 shows inhibition in the growth of CD40 negative K562
tumors in SCID mice by different concentrations of anti-CD40
agonist mAb 23.29.1.
[0045] FIG. 9 shows inhibition in the growth of CD40 negative K562
tumors in SCID mice by different concentrations of anti-CD40
agonist mAb 3.1.1.
[0046] FIG. 10 shows inhibition in the growth of CD40 positive Raji
tumors in the presence and absence of T cells and dendritic cells
in SCID mice by an anti-CD40 agonist mAb.
[0047] FIG. 11 shows inhibition in the growth of CD40 positive Raji
tumors in SCID mice by anti-CD40 agonist antibodies.
[0048] FIG. 12 shows inhibition in the growth of BT 474 breast
cancer cells in SCID-beige mice by anti-CD40 agonist
antibodies.
[0049] FIG. 13 shows inhibition in the growth of PC-3 prostate
tumors in SCID-beige mice by anti-CD40 agonist antibodies.
[0050] FIG. 14 is a survival curve for SCID-beige mice injected
(iv) with Daudi tumor cells and treated with anti-CD40 agonist
antibodies.
[0051] FIG. 15 is a Western blot analysis of anti-CD40 agonist
antibodies to reduced (R) and non-reduced (NR) human CD40.
[0052] FIG. 16 is an alignment of the D1-D4 domains of mouse and
human CD40.
[0053] FIG. 17 is an alignment of the mouse and human CD40 amino
acid sequences showing the location of the fusion sites of the
chimeras.
[0054] FIG. 18 is a group of schematic diagrams of the chimeric
CD40 constructs.
DETAILED DESCRIPTION OF THE INVENTION
Definitions and General Techniques
[0055] Unless otherwise defined herein, scientific and technical
terms used in connection with the present invention shall have the
meanings that are commonly understood by those of ordinary skill in
the art. Further, unless otherwise required by context, singular
terms shall include pluralities and plural terms shall include the
singular. Generally, nomenclatures used in connection with, and
techniques of, cell and tissue culture, molecular biology,
immunology, microbiology, genetics and protein and nucleic acid
chemistry and hybridization described herein are those well known
and commonly used in the art.
[0056] The methods and techniques of the present invention are
generally performed according to conventional methods well known in
the art and as described in various general and more specific
references that are cited and discussed throughout the present
specification unless otherwise indicated. See, e.g., Sambrook et
al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989) and
Ausubel et al., Current Protocols in Molecular Biology, Greene
Publishing Associates (1992), and Harlow and Lane Antibodies: A
Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. (1990), which are incorporated herein by reference.
Enzymatic reactions and purification techniques are performed
according to manufacturer's specifications, as commonly
accomplished in the art or as described herein. The nomenclatures
used in connection with, and the laboratory procedures and
techniques of, analytical chemistry, synthetic organic chemistry,
and medicinal and pharmaceutical chemistry described herein are
those well known and commonly used in the art. Standard techniques
are used for chemical syntheses, chemical analyses, pharmaceutical
preparation, formulation, and delivery, and treatment of
patients.
[0057] The following terms, unless otherwise indicated, shall be
understood to have the following meanings:
[0058] The term "polypeptide" encompasses native or artificial
proteins, protein fragments and polypeptide analogs of a protein
sequence. A polypeptide may be monomeric or polymeric.
[0059] The term "isolated protein", "isolated polypeptide" or
"isolated antibody" is a protein, polypeptide or antibody that by
virtue of its origin or source of derivation (1) is not associated
with naturally associated components that accompany it in its
native state, (2) is free of other proteins from the same species,
(3) is expressed by a cell from a different species, or (4) does
not occur in nature. Thus, a polypeptide that is chemically
synthesized or synthesized in a cellular system different from the
cell from which it naturally originates will be "isolated" from its
naturally associated components. A protein may also be rendered
substantially free of naturally associated components by isolation,
using protein purification techniques well known in the art.
[0060] Examples of isolated antibodies include an anti-CD40
antibody that has been affinity purified using CD40, an anti-CD40
antibody that has been synthesized by a hybridoma or other cell
line in vitro, and a human anti-CD40 antibody derived from a
transgenic mouse.
[0061] A protein or polypeptide is "substantially pure,"
"substantially homogeneous," or "substantially purified" when at
least about 60 to 75% of a sample exhibits a single species of
polypeptide. The polypeptide or protein may be monomeric or
multimeric. A substantially pure polypeptide or protein will
typically comprise about 50%, 60%, 70%, 80% or 90% W/W of a protein
sample, more usually about 95%, and preferably will be over 99%
pure. Protein purity or homogeneity may be indicated by a number of
means well known in the art, such as polyacrylamide gel
electrophoresis of a protein sample, followed by visualizing a
single polypeptide band upon staining the gel with a stain well
known in the art. For certain purposes, higher resolution may be
provided by using HPLC or other means well known in the art for
purification.
[0062] The term "polypeptide fragment" as used herein refers to a
polypeptide that has an amino-terminal and/or carboxy-terminal
deletion, but where the remaining amino acid sequence is identical
to the corresponding positions in the naturally-occurring sequence.
In some embodiments, fragments are at least 5, 6, 8 or 10 amino
acids long. In other embodiments, the fragments are at least 14, at
least 20, at least 50, or at least 70, 80, 90, 100, 150 or 200
amino acids long.
[0063] The term "polypeptide analog" as used herein refers to a
polypeptide that comprises a segment that has substantial identity
to a portion of an amino acid sequence and that has at least one of
the following properties: (1) specific binding to CD40 under
suitable binding conditions, (2) ability to activate CD40, (3) the
ability to upregulate the expression of cell surface molecules such
as ICAM, MHC-II, B7-1, B7-2, CD71, CD23 and CD83, or (4) the
ability to enhance the secretion of cytokines such as IFN-.beta.1,
IL-2, IL-8, IL-12, IL-15, IL-18 and IL-23. Typically, polypeptide
analogs comprise a conservative amino acid substitution (or
insertion or deletion) with respect to the naturally-occurring
sequence. Analogs typically are at least 20 or 25 amino acids long,
preferably at least 50, 60, 70, 80, 90, 100, 150 or 200 amino acids
long or longer, and can often be as long as a full-length
naturally-occurring polypeptide.
[0064] Preferred amino acid substitutions are those which: (1)
reduce susceptibility to proteolysis, (2) reduce susceptibility to
oxidation, (3) alter binding affinity for forming protein
complexes, and (4) confer or modify other physicochemical or
functional properties of such analogs. Analogs can include various
muteins of a sequence other than the naturally-occurring peptide
sequence. For example, single or multiple amino acid substitutions
(preferably conservative amino acid substitutions) may be made in
the naturally-occurring sequence (preferably in the portion of the
polypeptide outside the domain(s) forming intermolecular contacts).
A conservative amino acid substitution should not substantially
change the structural characteristics of the parent sequence (e.g.,
a replacement amino acid should not tend to break a helix that
occurs in the parent sequence, or disrupt other types of secondary
structure that characterizes the parent sequence). Examples of
art-recognized polypeptide secondary and tertiary structures are
described in Proteins, Structures and Molecular Principles
(Creighton, Ed., W. H. Freeman and Company, New York (1984));
Introduction to Protein Structure (C. Branden and J. Tooze, eds.,
Garland Publishing, New York, N.Y. (1991)); and Thornton et al.,
Nature 354:105 (1991), which are each incorporated herein by
reference.
[0065] Non-peptide analogs are commonly used in the pharmaceutical
industry as drugs with properties analogous to those of the
template peptide. These types of non-peptide compound are termed
"peptide mimetics" or "peptidomimetics." Fauchere, J. Adv. Drug
Res. 15:29 (1986); Veber and Freidinger, TINS p. 392 (1985); and
Evans et al., J. Med. Chem. 30:1229 (1987), which are incorporated
herein by reference. Such compounds are often developed with the
aid of computerized molecular modeling. Peptide mimetics that are
structurally similar to therapeutically useful peptides may be used
to produce an equivalent therapeutic or prophylactic effect.
Generally, peptidomimetics are structurally similar to a paradigm
polypeptide (i.e., a polypeptide that has a desired biochemical
property or pharmacological activity), such as a human antibody,
but have one or more peptide linkages optionally replaced by a
linkage selected from the group consisting of: --CH.sub.2NH--,
--CH.sub.2S--, --CH.sub.2--CH.sub.2--, --CH.dbd.CH-(cis and trans),
--COCH.sub.2--, --CH(OH)CH.sub.2--, and --CH.sub.2SO--, by methods
well known in the art. Systematic substitution of one or more amino
acids of a consensus sequence with a D-amino acid of the same type
(e.g., D-lysine in place of L-lysine) may also be used to generate
more stable peptides. In addition, constrained peptides comprising
a consensus sequence or a substantially identical consensus
sequence variation may be generated by methods known in the art
(Rizo and Gierasch, Ann. Rev. Biochem. 61:387 (1992), incorporated
herein by reference); for example, by adding internal cysteine
residues capable of forming intramolecular disulfide bridges which
cyclize the peptide.
[0066] An "antibody" refers to a complete antibody or to an
antigen-binding portion thereof, that competes with the intact
antibody for specific binding. See generally, Fundamental
Immunology, Ch. 7 (Paul, W., ed., 2nd ed. Raven Press, N.Y. (1989))
(incorporated by reference in its entirety for all purposes).
Antigen-binding portions may be produced by recombinant DNA
techniques or by enzymatic or chemical cleavage of intact
antibodies. Antigen-binding portions include, inter alia, Fab,
Fab', F(ab').sub.2, Fd, Fv, dAb, and complementarity determining
region (CDR) fragments, single-chain antibodies (scFv), chimeric
antibodies, diabodies and polypeptides that contain at least a
portion of an antibody that is sufficient to confer specific
antigen binding to the polypeptide.
[0067] From N-terminus to C-terminus, both light and heavy chain
variable domains comprise the regions FR1, CDR1, FR2, CDR2, FR3,
CDR3 and FR4. The assignment of amino acids to each domain is in
accordance with the definitions of Kabat, Sequences of Proteins of
Immunological Interest (National Institutes of Health, Bethesda,
Md. (1987 and 1991)), or Chothia & Lesk, J. Mol. Biol.
196:901-917 (1987); Chothia et al., Nature 342:878-883 (1989).
[0068] As used herein, an antibody that is referred to by number is
a monoclonal antibody that is obtained from the hybridoma of the
same number. For example, monoclonal antibody 3.1.1 is obtained
from hybridoma 3.1.1.
[0069] As used herein, a Fd fragment means an antibody fragment
that consists of the V.sub.H and C.sub.H 1 domains; an Fv fragment
consists of the V.sub.L and V.sub.H domains of a single arm of an
antibody; and a dAb fragment (Ward et al., Nature 341:544-546
(1989)) consists of a V.sub.H domain.
[0070] In some embodiments, the antibody is a single-chain antibody
(scFv) in which a V.sub.L and V.sub.H domains are paired to form a
monovalent molecules via a synthetic linker that enables them to be
made as a single protein chain. (Bird et al., Science 242:423-426
(1988) and Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883
(1988).) In some embodiments, the antibodies are diabodies, i.e.,
are bivalent antibodies in which V.sub.H and V.sub.L domains are
expressed on a single polypeptide chain, but using a linker that is
too short to allow for pairing between the two domains on the same
chain, thereby forcing the domains to pair with complementary
domains of another chain and creating two antigen binding sites.
(See e.g., Holliger P. et al., Proc. Natl. Acad. Sci. USA
90:6444-6448 (1993), and Poljak R. J. et al., Structure 2:1121-1123
(1994).) In some embodiments, one or more CDRs from an antibody of
the invention may be incorporated into a molecule either covalently
or noncovalently to make it an immunoadhesin that specifically
binds to CD40. In such embodiments, the CDR(s) may be incorporated
as part of a larger polypeptide chain, may be covalently linked to
another polypeptide chain, or may be incorporated
noncovalently.
[0071] In embodiments having one or more binding sites, the binding
sites may be identical to one another or may be different.
[0072] As used herein, the term "human antibody" means any antibody
in which all of the variable and constant domain sequences are
human sequences. These antibodies may be prepared in a variety of
ways, as described below.
[0073] The term "chimeric antibody" as used herein means an
antibody that comprises regions from two or more different
antibodies. In one embodiment, one or more of the CDRs are derived
from a human anti-CD40 antibody. In another embodiment, all of the
CDRs are derived from a human anti-CD40 antibody. In another
embodiment, the CDRs from more than one human anti-CD40 antibodies
are combined in a chimeric antibody. For instance, a chimeric
antibody may comprise a CDR1 from the light chain of a first human
anti-CD40 antibody, a CDR2 from the light chain of a second human
anti-CD40 antibody and a CDR3 and CDR3 from the light chain of a
third human anti-CD40 antibody, and the CDRs from the heavy chain
may be derived from one or more other anti-CD40 antibodies.
Further, the framework regions may be derived from one of the same
anti-CD40 antibodies or from one or more different human.
[0074] An "activating antibody" (also referred to herein as an
"agonist antibody" as used herein means an antibody that increases
one or more CD40 activities by at least about 20% when added to a
cell, tissue or organism expressing CD40. In some embodiments, the
antibody activates CD40 activity by at least 40%, 50%, 60%, 70%,
80%, 85%. In some embodiments, the activating antibody is added in
the presence of CD40L. In some embodiments, the activity of the
activating antibody is measured using a whole blood surface
molecule upregulation assay. See Example VII. In another
embodiment, the activity of the activating antibody is measured
using a dendritic cell assay to measure IL-12 release. See Example
VIII. In another embodiment the activity of the activating antibody
is measured using an in vivo tumor model. See Example X.
[0075] Fragments or analogs of antibodies or immunoglobulin
molecules can be readily prepared by those of ordinary skill in the
art following the teachings of this specification. Preferred amino-
and carboxy-termini of fragments or analogs occur near boundaries
of functional domains. Structural and functional domains can be
identified by comparison of the nucleotide and/or amino acid
sequence data to public or proprietary sequence databases.
Preferably, computerized comparison methods are used to identify
sequence motifs or predicted protein conformation domains that
occur in other proteins of known structure and/or function. Methods
to identify protein sequences that fold into a known
three-dimensional structure are known. See Bowie et al., Science
253:164 (1991).
[0076] The term "surface plasmon resonance", as used herein, refers
to an optical phenomenon that allows for the analysis of real-time
biospecific interactions by detection of alterations in protein
concentrations within a biosensor matrix, for example using the
BIAcore.TM. system (Pharmacia Biosensor AB, Uppsala, Sweden and
Piscataway, N.J.). For further descriptions, see Jonsson U. et al.,
Ann. Biol. Clin. 51:19-26 (1993); Jonsson U. et al., Biotechniques
11:620-627 (1991); Jonsson B. et al., J. Mol. Recognit. 8:125-131
(1995); and Johnsson B. et al., Anal. Biochem. 198:268-277
(1991).
[0077] The term "K.sub.D" refers to the equilibrium dissociation
constant of a particular antibody-antigen interaction.
[0078] The term "epitope" includes any protein determinant capable
of specific binding to an immunoglobulin or T-cell receptor.
Epitopic determinants usually consist of chemically active surface
groupings of molecules such as amino acids or sugar side chains and
usually have specific three dimensional structural characteristics,
as well as specific charge characteristics. An antibody is said to
specifically bind an antigen when the equilibrium dissociation
constant is .ltoreq.1 .mu.M, preferably .ltoreq.100 nM and most
preferably .ltoreq.10 nM.
[0079] As used herein, the twenty conventional amino acids and
their abbreviations follow conventional usage. See Immunology--A
Synthesis (2.sup.nd Edition, E. S. Golub and D. R. Gren, Eds.,
Sinauer Associates, Sunderland, Mass. (1991)), which is
incorporated herein by reference.
[0080] The term "polynucleotide" as referred to herein means a
polymeric form of nucleotides of at least 10 bases in length,
either ribonucleotides or deoxynucleotides or a modified form of
either type of nucleotide. The term includes single and double
stranded forms.
[0081] The term "isolated polynucleotide" as used herein means a
polynucleotide of genomic, cDNA, or synthetic origin or some
combination thereof, which by virtue of its origin the "isolated
polynucleotide" (1) is not associated with all or a portion of a
polynucleotides with which the "isolated polynucleotide" is found
in nature, (2) is operably linked to a polynucleotide to which it
is not linked in nature, or (3) does not occur in nature as part of
a larger sequence.
[0082] The term "oligonucleotide" as used herein includes naturally
occurring, and modified nucleotides linked together by naturally
occurring and non-naturally occurring oligonucleotide linkages.
Oligonucleotides are a polynucleotide subset generally comprising a
length of 200 bases or fewer. Preferably oligonucleotides are 10 to
60 bases in length and most preferably 12, 13, 14, 15, 16, 17, 18,
19, or 20 to 40 bases in length. Oligonucleotides are usually
single stranded, e.g. for primers and probes; although
oligonucleotides may be double stranded, e.g. for use in the
construction of a gene mutant. Oligonucleotides of the invention
can be either sense or antisense oligonucleotides.
[0083] The term "naturally occurring nucleotides" as used herein
includes deoxyribonucleotides and ribonucleotides. The term
"modified nucleotides" as used herein includes nucleotides with
modified or substituted sugar groups and the like. The term
"oligonucleotide linkages" referred to herein includes
oligonucleotides linkages such as phosphorothioate,
phosphorodithioate, phosphoroselenoate, phosphorodiselenoate,
phosphoroanilothioate, phoshoraniladate, phosphoroamidate, and the
like. See e.g., LaPlanche et al., Nucl. Acids Res. 14:9081 (1986);
Stec et al., J. Am. Chem. Soc. 106:6077 (1984); Stein et al., Nucl.
Acids Res. 16:3209 (1988); Zon et al., Anti-Cancer Drug Design
6:539 (1991); Zon et al., Oligonucleotides and Analogues: A
Practical Approach, pp. 87-108 (F. Eckstein, Ed., Oxford University
Press, Oxford England (1991)); U.S. Pat. No. 5,151,510; Uhlmann and
Peyman, Chemical Reviews 90:543 (1990), the disclosures of which
are hereby incorporated by reference. An oligonucleotide can
include a label for detection, if desired.
[0084] "Operably linked" sequences include both expression control
sequences that are contiguous with the gene of interest and
expression control sequences that act in trans or at a distance to
control the gene of interest. The term "expression control
sequence" as used herein means polynucleotide sequences that are
necessary to effect the expression and processing of coding
sequences to which they are ligated. Expression control sequences
include appropriate transcription initiation, termination, promoter
and enhancer sequences; efficient RNA processing signals such as
splicing and polyadenylation signals; sequences that stabilize
cytoplasmic mRNA; sequences that enhance translation efficiency
(i.e., Kozak consensus sequence); sequences that enhance protein
stability; and when desired, sequences that enhance protein
secretion. The nature of such control sequences differs depending
upon the host organism; in prokaryotes, such control sequences
generally include promoter, ribosomal binding site, and
transcription termination sequence; in eukaryotes, generally, such
control sequences include promoters and transcription termination
sequence. The term "control sequences" is intended to include, at a
minimum, all components whose presence is essential for expression
and processing, and can also include additional components whose
presence is advantageous, for example, leader sequences and fusion
partner sequences.
[0085] The term "vector", as used herein, means a nucleic acid
molecule capable of transporting another nucleic acid to which it
has been linked. In some embodiments, the vector is a plasmid,
i.e., a circular double stranded DNA loop into which additional DNA
segments may be ligated. In some embodiments, the vector is a viral
vector, wherein additional DNA segments may be ligated into the
viral genome. In some embodiments, the vectors are capable of
autonomous replication in a host cell into which they are
introduced (e.g., bacterial vectors having a bacterial origin of
replication and episomal mammalian vectors). In other embodiments,
the vectors (e.g., non-episomal mammalian vectors) can be
integrated into the genome of a host cell upon introduction into
the host cell, and thereby are replicated along with the host
genome. Moreover, certain vectors are capable of directing the
expression of genes to which they are operatively linked. Such
vectors are referred to herein as "recombinant expression vectors"
(or simply, "expression vectors").
[0086] The term "recombinant host cell" (or simply "host cell"), as
used herein, means a cell into which a recombinant expression
vector has been introduced. It should be understood that
"recombinant host cell" and "host cell" mean not only the
particular subject cell but also the progeny of such a cell.
Because certain modifications may occur in succeeding generations
due to either mutation or environmental influences, such progeny
may not, in fact, be identical to the parent cell, but are still
included within the scope of the term "host cell" as used
herein.
[0087] The term "selectively hybridize" referred to herein means to
detectably and specifically bind. Polynucleotides, oligonucleotides
and fragments thereof in accordance with the invention selectively
hybridize to nucleic acid strands under hybridization and wash
conditions that minimize appreciable amounts of detectable binding
to nonspecific nucleic acids. "High stringency" or "highly
stringent" conditions can be used to achieve selective
hybridization conditions as known in the art and discussed herein.
One example of "high stringency" or "highly stringent" conditions
is the incubation of a polynucleotide with another polynucleotide,
wherein one polynucleotide may be affixed to a solid surface such
as a membrane, in a hybridization buffer of 6.times.SSPE or SSC,
50% formamide, 5.times.Denhardt's reagent, 0.5% SDS, 100 .mu.g/ml
denatured, fragmented salmon sperm DNA at a hybridization
temperature of 42.degree. C. for 12-16 hours, followed by twice
washing at 55.degree. C. using a wash buffer of 1.times.SSC, 0.5%
SDS. See also Sambrook et al., supra, pp. 9.50-9.55.
[0088] The term "percent sequence identity" in the context of
nucleic acid sequences means the residues in two sequences that are
the same when aligned for maximum correspondence. The length of
sequence identity comparison may be over a stretch of at least
about nine nucleotides, usually at least about 18 nucleotides, more
usually at least about 24 nucleotides, typically at least about 28
nucleotides, more typically at least about 32 nucleotides, and
preferably at least about 36, 48 or more nucleotides. There are a
number of different algorithms known in the art which can be used
to measure nucleotide sequence identity. For instance,
polynucleotide sequences can be compared using FASTA, Gap or
Bestfit, which are programs in Wisconsin Package Version 10.0,
Genetics Computer Group (GCG), Madison, Wis. FASTA, which includes,
e.g., the programs FASTA2 and FASTA3, provides alignments and
percent sequence identity of the regions of the best overlap
between the query and search sequences (Pearson, Methods Enzymol.
183:63-98 (1990); Pearson, Methods Mol. Biol. 132:185-219 (2000);
Pearson, Methods Enzymol. 266:227-258 (1996); Pearson, J. Mol.
Biol. 276:71-84 (1998); herein incorporated by reference). Unless
otherwise specified, default parameters for a particular program or
algorithm are used. For instance, percent sequence identity between
nucleic acid sequences can be determined using FASTA with its
default parameters (a word size of 6 and the NOPAM factor for the
scoring matrix) or using Gap with its default parameters as
provided in GCG Version 6.1, herein incorporated by reference.
[0089] A reference to a nucleotide sequence encompasses its
complement unless otherwise specified. Thus, a reference to a
nucleic acid having a particular sequence should be understood to
encompass its complementary strand, with its complementary
sequence.
[0090] In the molecular biology art, researchers use the terms
"percent sequence identity", "percent sequence similarity" and
"percent sequence homology" interchangeably. In this application,
these terms shall have the same meaning with respect to nucleic
acid sequences only.
[0091] The term "substantial similarity" or "substantial sequence
similarity," when referring to a nucleic acid or fragment thereof,
means that when optimally aligned with appropriate nucleotide
insertions or deletions with another nucleic acid (or its
complementary strand), there is nucleotide sequence identity in at
least about 85%, preferably at least about 90%, and more preferably
at least about 95%, 96%, 97%, 98% or 99% of the nucleotide bases,
as measured by any well-known algorithm of sequence identity, such
as FASTA, BLAST or Gap, as discussed above.
[0092] As applied to polypeptides, the term "substantial identity"
means that two peptide sequences, when optimally aligned, such as
by the programs GAP or BESTFIT using default gap weights, share at
least 70, 75 or 80 percent sequence identity, preferably at least
90 or 95 percent sequence identity, and more preferably at least
97, 98 or 99 percent sequence identity. Preferably, residue
positions that are not identical differ by conservative amino acid
substitutions. A "conservative amino acid substitution" is one in
which an amino acid residue is substituted by another amino acid
residue having a side chain R group) with similar chemical
properties (e.g., charge or hydrophobicity). In general, a
conservative amino acid substitution will not substantially change
the functional properties of a protein. In cases where two or more
amino acid sequences differ from each other by conservative
substitutions, the percent sequence identity or degree of
similarity may be adjusted upwards to correct for the conservative
nature of the substitution. Means for making this adjustment are
well-known to those of skill in the art. See, e.g., Pearson,
Methods Mol. Biol. 243:307-31 (1994). Examples of groups of amino
acids that have side chains with similar chemical properties
include 1) aliphatic side chains: glycine, alanine, valine,
leucine, and isoleucine; 2) aliphatic-hydroxyl side chains: serine
and threonine; 3) amide-containing side chains: asparagine and
glutamine; 4) aromatic side chains: phenylalanine, tyrosine, and
tryptophan; 5) basic side chains: lysine, arginine, and histidine;
6) acidic side chains: aspartic acid and glutamic acid; and 7)
sulfur-containing side chains: cysteine and methionine. Preferred
conservative amino acids substitution groups are:
valine-leucine-isoleucine, phenylalanine-tyrosine, lysine-arginine,
alanine-valine, glutamate-aspartate, and asparagine-glutamine.
[0093] Alternatively, a conservative replacement is any change
having a positive value in the PAM250 log-likelihood matrix
disclosed in Gonnet et al., Science 256:1443-45 (1992), herein
incorporated by reference. A "moderately conservative" replacement
is any change having a nonnegative value in the PAM250
log-likelihood matrix.
[0094] Sequence similarity for polypeptides, which is also referred
to as sequence identity, is typically measured using sequence
analysis software. Protein analysis software matches similar
sequences using measures of similarity assigned to various
substitutions, deletions and other modifications, including
conservative amino acid substitutions. For instance, GCG contains
programs such as "Gap" and "Bestfit" which can be used with default
parameters to determine sequence homology or sequence identity
between closely related polypeptides, such as homologous
polypeptides from different species of organisms or between a wild
type protein and a mutein thereof. See, e.g., GCG Version 6.1.
Polypeptide sequences also can be compared using FASTA using
default or recommended parameters, a program in GCG Version 6.1.
FASTA (e.g., FASTA2 and FASTA3) provides alignments and percent
sequence identity of the regions of the best overlap between the
query and search sequences (Pearson, Methods Enzymol. 183:63-98
(1990); Pearson, Methods Mol. Biol. 132:185-219 (2000)). Another
preferred algorithm when comparing a sequence of the invention to a
database containing a large number of sequences from different
organisms is the computer program BLAST, especially blastp or
tblastn, using default parameters. See, e.g., Altschul et al., J.
Mol. Biol. 215:403-410 (1990); Altschul et al., Nucleic Acids Res.
25:3389-402 (1997); herein incorporated by reference.
[0095] The length of polypeptide sequences compared for homology
will generally be at least about 16 amino acid residues, usually at
least about 20 residues, more usually at least about 24 residues,
typically at least about 28 residues, and preferably more than
about 35 residues. When searching a database containing sequences
from a large number of different organisms, it is preferable to
compare amino acid sequences.
[0096] As used herein, the terms "label" or "labeled" refers to
incorporation of another molecule in the antibody. In one
embodiment, the label is a detectable marker, e.g., incorporation
of a radiolabeled amino acid or attachment to a polypeptide of
biotinyl moieties that can be detected by marked avidin (e.g.,
streptavidin containing a fluorescent marker or enzymatic activity
that can be detected by optical or colorimetric methods). In
another embodiment, the label or marker can be therapeutic, e.g., a
drug conjugate or toxin. Various methods of labeling polypeptides
and glycoproteins are known in the art and may be used. Examples of
labels for polypeptides include, but are not limited to, the
following: radioisotopes or radionuclides (e.g., .sup.3H, .sup.14C,
.sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I,
.sup.131I), fluorescent labels (e.g., FITC, rhodamine, lanthanide
phosphors), enzymatic labels (e.g., horseradish peroxidase,
.beta.-galactosidase, luciferase, alkaline phosphatase),
chemiluminescent markers, biotinyl groups, predetermined
polypeptide epitopes recognized by a secondary reporter (e.g.,
leucine zipper pair sequences, binding sites for secondary
antibodies, metal binding domains, epitope tags), magnetic agents,
such as gadolinium chelates, toxins such as pertussis toxin, taxol,
cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin,
etoposide, tenoposide, vincristine, vinblastine, colchicin,
doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone,
mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids,
procaine, tetracaine, lidocaine, propranolol, and puromycin and
analogs or homologs thereof. In some embodiments, labels are
attached by spacer arms of various lengths to reduce potential
steric hindrance.
[0097] The term patient includes human and veterinary subjects.
[0098] Throughout this specification and claims, the word
"comprise," or variations such as "comprises" or "comprising," will
be understood to imply the inclusion of a stated integer or group
of integers but not the exclusion of any other integer or group of
integers.
Human Anti-CD40 Antibodies and Characterization Thereof
[0099] Human antibodies avoid certain of the problems associated
with antibodies that possess non-human (e.g., rodent) variable
and/or constant regions. Such problems include the rapid clearance
of the antibodies or immune response against the antibody.
Therefore, in one embodiment, the invention provides humanized
anti-CD40 antibodies. In another embodiment, the invention provides
human anti-CD40 antibodies. In some embodiments, human anti-CD40
antibodies are produced by immunizing a rodent whose genome
comprises human immunoglobulin genes so that the rodent produces
human antibodies. Human anti-CD40 antibodies are expected to
minimize the immunogenic and allergic responses intrinsic to
non-human or non-human-derivatized monoclonal antibodies (Mabs) and
thus to increase the efficacy and safety of the administered
antibodies. The use of fully human antibodies can be expected to
provide a substantial advantage in the treatment of chronic and
recurring human diseases, such as inflammation and cancer, which
may require repeated antibody administrations.
[0100] The invention provides eleven activating human anti-CD40
monoclonal antibodies (mAbs) and the hybridoma cell lines that
produce them. Table A lists the sequence identifiers (SEQ ID NOS:)
of the nucleic acids encoding the full-length heavy and light
chains (including leader sequence), the corresponding full-length
deduced amino acid sequences, and the nucleotide and deduced amino
acid sequence of the heavy and light chain variable regions.
TABLE-US-00001 TABLE A HUMAN ANTI-CD40 ANTIBODIES SEQUENCE
IDENTIFIER (SEQ ID NO:) Variable Region Full Length Heavy Light
Heavy Light Pro- Pro- Pro- Pro- MAb DNA tein DNA tein DNA tein DNA
tein 3.1.1 1 2 3 4 5 6 7 8 7.1.2 9 10 11 12 13 14 15 16 10.8.3 17
18 19 20 21 22 23 24 15.1.1 25 26 27 28 29 30 31 32 21.2.1 33 34 35
36 37 38 39 40 21.4.1 41 42 43 44 45 46 47 48 22.1.1 49 50 51 52 53
54 55 56 23.5.1 57 58 59 60 61 62 63 64 23.28.1 65 66 67 68 69 70
71 72 23.29.1 73 74 75 76 77 78 79 80 24.2.1 81 82 83 84 85 86 87
88
[0101] The invention further provides human anti-CD40 mAb 23.25.1
and the hybridoma cell line that produces it.
[0102] The invention further provides heavy and/or light chain
variants of certain of the above-listed human anti-CD40 mAbs,
comprising one or more amino acid substitutions. The invention
provides two variant heavy chains of mAb 3.1.1. In one, the alanine
at residue 78 is changed to threonine. In the second, the alanine
at residue 78 is changed to threonine, and the valines at residues
88 and 97 are changed to alanines. The invention also provides a
variant light chain of mAb 3.1.1 in which the leucine at residue 4
and the leucine at residue 83 are changed to methionine and valine,
respectively. Combination with a variant heavy or light chain with
a wild type light or heavy chain, respectively is designated by the
mutant chain. Thus, an antibody containing a wild type light chain
and a heavy chain comprising the alanine to threonine mutation at
residue 78 is designated as 3.1.1H-A78T. However, in other
embodiments of the invention, antibodies containing any combination
of a variant heavy chain and the variant light chain of 3.1.1 are
included.
[0103] Further, the invention provides a variant of the heavy chain
of mAb 22.1.1 in which the cysteine at residue 109 is changed to an
alanine. A monoclonal antibody comprising the variant heavy chain
and the 22.1.1 light chain is designated mAb 22.1.1 H-C109A. The
invention further provides two variant heavy chains and a variant
light chain of mAb 23.28.1. In one heavy chain variant, the
aspartic acid at residue 16 is changed to glutamic acid. A mAb
comprising the variant heavy chain variant and the 23.28.1 light
chain is designated 23.28.1 H-D16E. The invention also includes a
23.28.1 light chain variant in which the cysteine at residue 92 is
changed to an alanine. A mAb comprising the 23.28.1 heavy chain and
the variant light chain is designated 23.28.1 L C92A. The invention
also provides mAbs comprising either of the 23.28.1 heavy chain
variants with the 23.28.1 light chain variant.
[0104] The light chain produced by hybridoma 23.29.1 contains a
mutation in the constant region at residue 174. The light chain
produced by the hybridoma has arginine at this position instead of
the canonical lysine. Accordingly, the invention also provides a
23.29.1 light chain with the canonical lysine at residue 174 and a
mAb, designated 23.29.1L-R174K, comprising the 23.29.1 heavy chain
and the variant light chain.
[0105] In a preferred embodiment, the anti-CD40 antibody is 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3,
15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1,
23.28.1, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K and
24.2.1. In some embodiments, the anti-CD40 antibody comprises a
light chain comprising an amino acid sequence selected from SEQ ID
NO: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 94, 100 or 102 or
the variable region therefrom, or encoded by a nucleic acid
sequence selected from SEQ ID NO: 7, 15, 23, 31, 39, 47, 55, 63,
71, 79, 87, 93, 99 or 101. In some embodiments, the anti-CD40
antibody comprises a light chain comprising at least the CDR2 from
one of listed antibodies, one of the above-identified amino acid
sequences (as shown in FIGS. 1A-1C and 2A-2C) or encoded by one of
the above-identified nucleic acid sequences. In another embodiment,
the light chain further comprises a CDR1 and CDR3 independently
selected from a light chain variable region that comprises no more
than ten amino acids from the amino acid sequence encoded by a
germline V.kappa. A3/A19, L5 or A27 gene, or comprises a CDR1 and
CDR3 independently selected from one of a CDR1 and CDR3 of (1) an
antibody selected from 3.1.1, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3,
15.1.1, 21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1,
23.28.1L-C92A, 23.29.1, 23.29.1L-R174K or 24.2.1; (2) the amino
acid sequence of SEQ ID NO: 4, 12, 20, 28, 36, 44, 52, 60, 68, 76,
84, 94, 100 or 102 or (3) encoded by the nucleic acid sequence of
SEQ ID NO: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 93, 99 or
101.
[0106] In another preferred embodiment, the anti-CD40 antibody
comprises a heavy chain comprising an amino acid sequence selected
from SEQ ID NOS: 6, 14, 22, 30, 38, 46, 54, 62, 70, 78 or 86 or the
variable region therefrom or encoded by a nucleic acid sequence
selected from SEQ ID NOS: 5, 13, 21, 29, 37, 45, 53, 61, 69, 77 or
85. In some embodiments, the anti-CD40 antibody comprises a heavy
chain comprising at least the CDR3 from one of listed antibodies,
one of the above-identified amino acid sequences (as shown in FIGS.
1A-1C and 2A-2C) or encoded by one of the above-identified nucleic
acid sequences. In another embodiment, the heavy chain further
comprises a CDR1 and CDR2 independently selected from a heavy chain
variable region that comprises no more than eighteen amino acids
from the amino acid sequence encoded by a germline V.sub.H 3-30+,
4-59, 1-02, 4.35 or 3-30.3 gene, or comprises a CDR1 and CDR2
independently selected from one of a CDR1 and CDR2 of (1) an
antibody selected from 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A,
7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A,
23.5.1, 23.25.1, 23.28.1, 23.28.1H-D16E, 23.29.1 and 24.2.1; (2)
the amino acid sequence of SEQ ID NO: 2, 10, 18, 26, 34, 42, 50,
58, 66, 74, 82, 90, 92, 96 or 98 or (3) encoded by the nucleic acid
sequence of SEQ ID NO: 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81,
89, 91, 95 or 97. In another embodiment, the anti-CD40 antibody
comprises a heavy chain and a light chain as defined above.
[0107] As used herein, antibody 3.1.1H-A78T is identical to that of
3.1.1 except that residue 78 of the heavy chain is threonine
instead of alanine. Similarly, in antibody 3.1.1H-A78T-V88A-V97A,
residue 78 is changed to A, and residues 88 and 97 are changed from
valine to alanine in the heavy chain. Antibody 3.1.1L-L4M-L83V is
identical to that of 3.1.1 except that residue 4 is methionine
instead of leucine and residue 83 is valine instead of leucine in
the light chain. Antibody 22.1.1H-C109A is identical to that of
22.1.1 except that residue 109 of the heavy chain is changed from a
cysteine to an alanine. Antibodies 23.28.1H-D16E and 23.28.1L-C92A
are identical to that of 23.28.1 except that residue 16 of the
heavy chain is changed from aspartate to glutamate, and residue 92
of the light chain is changed from cysteine to alanine,
respectively. Antibody 23.29.1L-R174K is identical to that of
23.29.1 except that residue 174 of the light chain is changed from
arginine to lysine.
Class and Subclass of Anti-CD40 Antibodies
[0108] The class and subclass of anti-CD40 antibodies may be
determined by any method known in the art. In general, the class
and subclass of an antibody may be determined using antibodies that
are specific for a particular class and subclass of antibody. Such
antibodies are available commercially. The class and subclass can
be determined by ELISA, or Western Blot as well as other
techniques. Alternatively, the class and subclass may be determined
by sequencing all or a portion of the constant domains of the heavy
and/or light chains of the antibodies, comparing their amino acid
sequences to the known amino acid sequences of various class and
subclasses of immunoglobulins, and determining the class and
subclass of the antibodies.
[0109] In some embodiments, the anti-CD40 antibody is a monoclonal
antibody. The anti-CD40 antibody can be an IgG, an IgM, an IgE, an
IgA or an IgD molecule. In a preferred embodiment, the anti-CD40
antibody is an IgG and is an IgG1, IgG2, IgG3 or IgG4 subclass. In
another preferred embodiment, the anti-CD40 antibodies are subclass
IgG2.
Species and Molecule Selectivity
[0110] In another aspect of the invention, the anti-CD40 antibodies
demonstrate both species and molecule selectivity. In some
embodiments, the anti-CD40 antibody binds to primate and human
CD40. In some embodiments, the anti-CD40 antibody binds to human,
cynomolgus or rhesus CD40. In other embodiments, the anti-CD40
antibody does not bind to mouse, rat, dog or rabbit CD40. Following
the teachings of the specification, one can determine the species
selectivity for the anti-CD40 antibody using methods well known in
the art. For instance, one can determine species selectivity using
Western blot, FACS, ELISA or RIA. (See, e.g., Example IV.)
[0111] In some embodiments, the anti-CD40 antibody has a
selectivity for CD40 that is more than 100 times greater than its
selectivity for RANK (receptor activator of nuclear factor-kappa
B), 4-1BB (CD137), TNFR-1 (Tumor Necrosis Factor Receptor-1) and
TNFR-2 (Tumor Necrosis Factor Receptor-2). In some embodiments, the
anti-CD40 antibody does not exhibit any appreciable specific
binding to any other protein other than CD40. One can determine the
selectivity of the anti-CD40 antibody for CD40 using methods well
known in the art following the teachings of the specification. For
instance, one can determine the selectivity using Western blot,
FACS, ELISA or RIA. (See, e.g., Example V.)
Identification of CD40 Epitopes Recognized by Anti-CD40
Antibody
[0112] Further, the invention provides a human anti-CD40 monoclonal
antibody that binds CD40 and cross-competes with and/or binds the
same epitope and/or binds to CD40 with the same K.sub.D as a human
anti-CD40 antibody selected from an antibody 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K or 24.2.1; or
a human anti-CD40 antibody that comprises a heavy chain variable
region having an amino acid sequence of SEQ ID NO: 2, 10, 18, 26,
34, 42, 50, 58, 66, 74, 82, 90, 92, 96 or 98 or a human anti-CD40
antibody that comprises a light chain variable region having an
amino acid sequence of SEQ ID NO: 4, 12, 20, 28, 36, 44, 52, 60,
68, 76, 84, 94, 100 or 102.
[0113] One can determine whether an antibody binds to the same
epitope as or cross competes for binding with an anti-CD40 antibody
by using any method known in the art. In one embodiment, one can
allow the anti-CD40 antibody of the invention to bind to CD40 under
saturating conditions and then measure the ability of the test
antibody to bind to CD40. If the test antibody is able to bind to
the CD40 at the same time as the anti-CD40 antibody, then the test
antibody binds to a different epitope as the anti-CD40 antibody.
However, if the test antibody is not able to bind to the CD40 at
the same time, then the test antibody binds to the same epitope, an
overlapping epitope, or an epitope that is in close proximity to
the epitope bound by the human anti-CD40 antibody. This experiment
can be performed using ELISA, RIA, FACS or surface plasmon
resonance. (See, e.g., Example VI.) In a preferred embodiment, the
experiment is performed using surface plasmon resonance. In a more
preferred embodiment, BIAcore is used.
Binding Affinity of Anti-CD40 Antibodies to CD40
[0114] In some embodiments of the invention, the anti-CD40 antibody
binds to CD40 with high affinity. In some embodiments, the
anti-CD40 antibody binds to CD40 with a K.sub.D of
2.times.10.sup.-8 M or less. In another preferred embodiments, the
antibody binds to CD40 with a K.sub.D of 2.times.10.sup.-9,
2.times.10.sup.-10, 4.0.times.10.sup.-11 M or less. In an even more
preferred embodiment, the antibody binds to CD40 with a K.sub.D of
2.5.times.10.sup.-12 M or less. In some embodiments, the antibody
binds to CD40 with substantially the same K.sub.D as an antibody
selected from 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A,
3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1,
22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1, 23.28.1H-D16E,
23.28.1L-C92A, 23.29.1, 23.29.1L-R174K or 24.2.1. In another
preferred embodiment, the antibody binds to CD40 with substantially
the same K.sub.D as an antibody that comprises a CDR2 of a light
chain, and/or a CDR3 of a heavy chain from an antibody selected
from 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V,
7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A,
23.5.1, 23.25.1, 23.28.1, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1,
23.29.1L-R174K and 24.2.1. In still another preferred embodiment,
the antibody binds to CD40 with substantially the same K.sub.D as
an antibody that comprises a heavy chain variable region having an
amino acid sequence of SEQ ID NO: 2, 10, 18, 26, 34, 42, 50, 58,
66, 74, 82, 90, 92, 96 or 98 or that comprises a light chain having
an amino acid sequence of SEQ ID NO: 4, 12, 20, 28, 36, 44, 52, 60,
68, 76, 84, 94, 100 or 102. In another preferred embodiment, the
antibody binds to CD40 with substantially the same K.sub.D as an
antibody that comprises a CDR2 of a light chain variable region
having an amino acid sequence of SEQ ID NO: 4, 12, 20, 28, 36, 44,
52, 60, 68, 76, 84, 94, 100 or 102 or a CDR3 of a heavy chain
variable region having an amino acid sequence of SEQ ID NO: 2, 10,
18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 92, 96 or 98.
[0115] In some embodiments, the anti-CD40 antibody has a low
dissociation rate. In some embodiments, the anti-CD40 antibody has
an K.sub.off of 2.0.times.10.sup.-4 or lower. In some embodiments,
the K.sub.off is 2.0.times.10.sup.-7 or lower. In some embodiments,
the K.sub.off is substantially the same as an antibody described
herein, including an antibody selected from 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K and 24.2.1.
In some embodiments, the antibody binds to CD40 with substantially
the same K.sub.off as an antibody that comprises a CDR3 of a heavy
chain or a CDR2 of a light chain from an antibody selected from
3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2,
10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1,
23.25.1, 23.28.1, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1,
23.29.1L-R174K and 24.2.1. In some embodiments, the antibody binds
to CD40 with substantially the same K.sub.off as an antibody that
comprises a heavy chain variable region having an amino acid
sequence of SEQ ID NO: 2, 10, 18, 26, 34, 42, 50, 58, 66, 74, 82,
90, 92, 96 or 98 or that comprises a light chain variable region
having an amino acid sequence of SEQ ID NO: 4, 12, 20, 28, 36, 44,
52, 60, 68, 76, 84, 94, 100 or 102. In another preferred
embodiment, the antibody binds to CD40 with substantially the same
K.sub.off as an antibody that comprises a CDR2 of a light chain
variable region having an amino acid sequence of SEQ ID NO: 4, 12,
20, 28, 36, 44, 52, 60, 68, 76, 84, 94, 100 or 102 or a CDR3 of a
heavy chain variable region having an amino acid sequence of SEQ ID
NO: 6, 14, 22, 30, 38, 46, 54, 62, 70, 78, 86, 90, 92, 96 or
98.
[0116] The binding affinity and dissociation rate of an anti-CD40
antibody to CD40 can be determined by any method known in the art.
The binding affinity can be measured by competitive ELISAs, RIAs or
surface plasmon resonance, such as BIAcore. The dissociation rate
also can be measured by surface plasmon resonance. Preferably, the
binding affinity and dissociation rate is measured by surface
plasmon resonance. More preferably, the binding affinity and
dissociation rate are measured using a BIAcore.TM.. See, e.g.,
Example XIV.
Light and Heavy Chain Gene Usage
[0117] An anti-CD40 antibody of the invention can comprise a human
kappa or a human lambda light chain or an amino acid sequence
derived therefrom. In some embodiments comprising a kappa light
chain, the light chain variable domain (V.sub.L) is encoded in part
by a human A3/A19 (DPK-15), L5 (DP5), or A27 (DPK-22) V.kappa.
gene.
[0118] In some embodiments, the V.sub.L of the anti-CD40 antibody
contains one or more amino acid substitutions relative to the
germline amino acid sequence. In some embodiments, the V.sub.L of
the anti-CD40 antibody comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10
amino acid substitutions relative to the germline amino acid
sequence. In some embodiments, one or more of those substitutions
from germline is in the CDR regions of the light chain. In some
embodiments, the amino acid substitutions relative to germline are
at one or more of the same positions as the substitutions relative
to germline in any one or more of the V.sub.L of antibodies 3.1.1,
3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1,
23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K
and 24.2.1. For example, the V.sub.L of the anti-CD40 antibody may
contain one or more amino acid substitutions compared to germline
found in antibody 21.4.1, and other amino acid substitutions
compared to germline found in antibody 10.8.3 which utilizes the
same V.sub.K gene as antibody 21.4.1. In some embodiments, the
amino acid changes are at one or more of the same positions but
involve a different mutation than in the reference antibody.
[0119] In some embodiments, amino acid changes relative to germline
occur at one or more of the same positions as in any of the V.sub.L
of antibodies 3.1.1, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A,
23.29.1, 23.29.1L-R174K and 24.2.1, but the changes may represent
conservative amino acid substitutions at such position(s) relative
to the amino acid in the reference antibody. For example, if a
particular position in one of these antibodies is changed relative
to germline and is glutamate, one may conservatively substitute
aspartate at that position. Similarly, if an amino acid
substitution compared to germline is serine, one may conservatively
substitute threonine for serine at that position. Conservative
amino acid substitutions are discussed supra.
[0120] In some embodiments, the light chain of the human anti-CD40
antibody comprises the amino acid sequence that is the same as the
amino acid sequence of the V.sub.L of antibody 3.1.1 (SEQ. ID NO:
4), 3.1.1L-L4M-L83V (SEQ ID NO: 94), 7.1.2 (SEQ. ID NO: 12), 10.8.3
(SEQ. ID NO: 20), 15.1.1 (SEQ. ID NO: 28), 21.4.1 (SEQ. ID NO:),
21.2.1 (SEQ. ID NO: 36), 21.4.1 (SEQ ID NO: 44), 22.1.1 (SEQ. ID
NO: 52), 23.5.1 (SEQ. ID NO: 60), 23.28.1 (SEQ. ID NO: 68),
23.28.1L-C92A (SEQ. ID NO: 100), 23.29.1 (SEQ. ID NO: 76),
23.29.1L-R174K (SEQ ID NO: 102) or 24.2.1 (SEQ. ID NO: 84), or said
amino acid sequence having up to 1, 2, 3, 4, 6, 8 or 10
conservative amino acid substitutions and/or a total of up to 3
non-conservative amino acid substitutions.
[0121] In some embodiments, the light chain of the anti-CD40
antibody comprises at least the light chain CDR2, and may also
comprise the CDR1 and CDR3 regions of a germline sequence, as
described herein. In another embodiment, the light chain may
comprise a CDR1 and CDR2 of an antibody independently selected from
3.1.1, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1,
22.1.1, 23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A, 23.29.1 and
24.2.1, or CDR regions each having less than 8, less than 6, less
than 4 or less than 3 conservative amino acid substitutions and/or
a total of three or fewer non-conservative amino acid
substitutions. In other embodiments, the light chain of the
anti-CD40 antibody comprises at least the light chain CDR2, and may
also comprise the CDR1 and CDR3 regions, each of which are
independently selected from the CDR1 and CDR3 regions of an
antibody having a light chain variable region comprising the amino
acid sequence selected from SEQ ID NOS: 4, 12, 20, 28, 36, 44, 52,
60, 68, 76, 84, 94 or 100, or encoded by a nucleic acid molecule
selected from SEQ ID NOS: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75,
83, 93 or 99.
[0122] With regard to the heavy chain, in some embodiments, the
variable region of the heavy chain amino acid sequence is encoded
in part by a human V.sub.H 3-30+, V.sub.H 4-59, V.sub.H 1-02,
V.sub.H 4.35 or V.sub.H 3-30.3 gene. In some embodiments, the
V.sub.H of the anti-CD40 antibody contains one or more amino acid
substitutions, deletions or insertions (additions) relative to the
germline amino acid sequence. In some embodiments, the variable
domain of the heavy chain comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17 or 18 mutations from the germline amino
acid sequence. In some embodiments, the mutation(s) are
non-conservative substitutions compared to the germline amino acid
sequence. In some embodiments, the mutations are in the CDR regions
of the heavy chain. In some embodiments, the amino acid changes are
made at one or more of the same positions as the mutations from
germline in any one or more of the V.sub.H of antibodies 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 7.1.2, 10.8.3, 15.1.1, 21.4.1,
21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.29.1 and 24.2.1. In other embodiments, the amino
acid changes are at one or more of the same positions but involve a
different mutation than in the reference antibody.
[0123] In some embodiments, the heavy chain comprises an amino acid
sequence of the variable domain (V.sub.H) of antibody 3.1.1 (SEQ ID
NO: 2), 3.1.1H-A78T (SEQ ID NO: 90), 3.1.1H-A78T-V88A-V97A (SEQ ID
NO: 92), 7.1.2 (SEQ ID NO: 10), 10.8.3 (SEQ ID NO: 18), 15.1.1 (SEQ
ID NO: 26), 21.2.1 (SEQ ID NO: 34), 21.4.1 (SEQ ID NO: 42), 22.1.1
(SEQ ID NO: 50), 22.1.1H-C109A (SEQ ID NO: 96), 23.5.1 (SEQ ID NO:
58), 23.28.1 (SEQ ID NO: 66), 23.28.1H-D16E (SEQ ID NO: 98),
23.29.1 (SEQ ID NO: 74) and 24.2.1 (SEQ ID NO: 82), or said amino
acid sequence having up to 1, 2, 3, 4, 6, 8 or 10 conservative
amino acid substitutions and/or a total of up to 3 non-conservative
amino acid substitutions.
[0124] In some embodiments, the heavy chain comprises the heavy
chain CDR1, CDR2 and CDR3 regions of antibody 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1,
22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1, 23.28.1H-D16E,
23.29.1 and 24.2.1 (as shown in FIG. 1D-1H or 2D-2H), or said CDR
regions each having less than 8, less than 6, less than 4, or less
than 3 conservative amino acid substitutions and/or a total of
three or fewer non-conservative amino acid substitutions.
[0125] In some embodiments, the heavy chain comprises a CDR3, and
may also comprise the CDR1 and CDR2 regions of a germline sequence,
as described above, or may comprise a CDR1 and CDR2 of an antibody,
each of which are independently selected from an antibody
comprising a heavy chain of an antibody selected from 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 7.1.2, 10.8.3, 15.1.1, 21.4.1,
21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.29.1 and 24.2.1. In another embodiment, the heavy
chain comprises a CDR3, and may also comprise the CDR1 and CDR2
regions, each of which are independently selected from a CDR1 and
CDR2 region of a heavy chain variable region comprising an amino
acid sequence selected from SEQ ID NOS: 2, 10, 18, 26, 34, 42, 50,
58, 66, 74, 82, 90, 92, 96 or 98 (as shown in FIG. 1D-1H or FIGS.
2D-2H) or encoded by a nucleic acid sequence selected from SEQ ID
NOS: 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81, 89, 91, 95 or 97. In
another embodiment, the antibody comprises a heavy chain as
disclosed above and a light chain as disclosed above.
[0126] One type of amino acid substitution that may be made is to
change one or more cysteines in the antibody, which may be
chemically reactive, to another residue, such as, without
limitation, alanine or serine. In one embodiment, the cysteine
substitution is made in a framework region of a variable domain or
in the constant domain of an antibody. In another embodiment, the
cysteine is in a non-canonical region of the antibody. Another type
of amino acid substitution that may be made is to change any
potential proteolytic sites in the antibody, particularly those
that are in a framework region of a variable domain, in the
constant domain of an antibody, or in a non-canonical region of the
antibody Substitution of cysteine residues and removal of
proteolytic sites may decrease the risk of any heterogeneity in the
antibody product and thus increase its homogeneity. Another type of
amino acid substitution is to eliminate asparagine-glycine pairs,
which form potential deamidation sites, by altering one or both of
the residues. This is preferably done in framework regions, the
constant domain or non-canonical regions of the antibody.
Activation of CD40 by Anti-CD40 Antibody
[0127] Another aspect of the present invention involves an
anti-CD40 antibody that is an activating antibody, i.e., a CD40
agonist. An activating antibody amplifies or substitutes for the
effects of CD40L on CD40. In some embodiments, the activating
antibody is essentially a mimic of CD40L, and competes with CD40L
for binding to CD40. In some embodiments, the antibody does not
compete with CD40L for binding to CD40, but amplifies the effect of
CD40L binding to CD40. In some embodiments, the anti-CD40 antibody
activates CD40 in the presence or absence of CD40L.
Inhibition of Tumor Growth In Vivo by Anti-CD40 Antibodies
[0128] According to some embodiments, the invention provides an
anti-CD40 antibody that inhibits the proliferation of tumor cells
in vitro or tumor growth in vivo.
[0129] In some embodiments, the antibody inhibits tumor growth by
at least 50%, 55%, 60%, 65%, 70%, 75%. In some embodiments, the
antibody inhibits tumor growth by 75%. In one embodiment, the
inhibition of tumor growth is detectable 14 days after initial
treatment with the antibody. In other embodiments, the inhibition
of tumor growth is detectable 7 days after initial treatment with
the antibody. In some embodiments, another antineoplastic agent is
administered to the animal with the anti-CD40 antibody. In some
embodiments, the antineoplastic agent further inhibits tumor
growth. In some embodiments, the antineoplastic agent is adriamycin
or taxol. In some embodiments, the co-administration of an
antineoplastic agent and the anti-CD40 antibody inhibits tumor
growth by at least 50%, after a period of 22-24 days from
initiation of treatment compared to tumor growth on an untreated
animal.
Induction of Apoptosis by Anti-CD40 Antibodies
[0130] Another aspect of the invention provides an anti-CD40
antibody that induces cell death of CD40 positive cells. In some
embodiments, the antibody causes apoptosis of CD40 positive cells
either in vivo or in vitro.
Enhancement of Expression of Cell Surface Molecules
[0131] In some embodiments, the anti-CD40 antibody enhances the
expression of B cell surface molecules, including but not limited
to ICAM, MHC-II, B7-2, CD71, CD23 and CD83. In some embodiments, 1
.mu.g/ml of the antibody enhances ICAM expression in a whole blood
B-cell surface molecule up-regulation assay by at least 2 fold, or
more preferably by at least 4 fold. In some embodiments, 1 .mu.g/ml
of the antibody enhances MHC-II expression in a whole blood B-cell
surface molecule upregulation assay by at least 2 fold, or more
preferably by at least 3 fold. In some embodiments, 1 .mu.g/ml of
the antibody enhances CD23 expression in whole blood B-cell surface
molecule up-regulation assay by at least 2 fold, or more preferably
by at least 5 fold. See, e.g., Example VII, Table 25.
[0132] In some embodiments, the anti-CD40 antibody enhances the
expression of dendritic cell surface molecules including but not
limited to MHC-II, ICAM, B7-2, CD83 and B7-1. In some embodiments
the range of upregulation is similar to the range of upregulation
observed in B cells. See, e.g., Tables 25 and 26, infra. In some
embodiments, the antibody preferentially upregulates the expression
of dendritic cell surface molecules, such as B7-2 and MHC-II,
compared to B cell expression of these molecules. See, e.g., Table
27.
Enhancement of Secretion of Cellular Cytokines
[0133] In some embodiments the antibody enhances cellular secretion
of cytokines including but not limited to IL-8, IL-12, IL-15, IL-18
and IL-23.
[0134] In some embodiments the antibody enhances cytokine secretion
by dendritic cells and adherent monocytes. In some embodiments
cytokine production is further enhanced by co-stimulation with one
or more of LPS, IFN-.gamma. or IL-10. In yet another aspect of the
invention, the antibody with LPS co-stimulation enhances IL-12p70
production in a dendritic cell assay with an EC.sub.50 of about
0.48 .mu.g/ml. In some embodiments, the antibody enhances IL-12p40
production in dendritic cells with an EC.sub.50 of about 0.21
.mu.g/ml. (See, e.g., Example VIII.)
[0135] In some embodiments, the antibody enhances secretion of
IFN-gamma by T cells in an allogenic T cell/dendritic cell assay,
as described in Example VIII. In some embodiments, the antibody
enhances IFN-gamma secretion in an allogenic T cell/dendritic cell
assay with an EC.sub.50 of about 0.3 .mu.g/ml. In some embodiments,
the antibody enhances IFN-gamma secretion in an allogenic T
cell/dendritic cell assay with an EC.sub.50 of about 0.2 .mu.g/ml.
In one embodiment, the antibody enhances IFN-gamma secretion in an
allogenic T cell/dendritic cell assay with an EC.sub.50 of about
0.03 .mu.g/ml.
Methods of Producing Antibodies and Antibody-Producing Cell
Lines
Immunization
[0136] In some embodiments, human antibodies are produced by
immunizing a non-human animal comprising in its genome some or all
of human immunoglobulin heavy chain and light chain loci with a
CD40 antigen. In a preferred embodiment, the non-human animal is a
XenoMouse.TM. animal.
[0137] XenoMouse.TM. mice are engineered mouse strains that
comprise large fragments of human immunoglobulin heavy chain and
light chain loci and are deficient in mouse antibody production.
See, e.g., Green et al., Nature Genetics 7:13-21 (1994) and U.S.
Pat. Nos. 5,916,771, 5,939,598, 5,985,615, 5,998,209, 6,075,181,
6,091,001, 6,114,598, 6,130,364, 6,162,963 and 6,150,584. See also
WO 91/10741, WO 94/02602, WO 96/34096, WO 96/33735, WO 98/16654, WO
98/24893, WO 98/50433, WO 99/45031, WO 99/53049, WO 00/09560, and
WO 00/037504.
[0138] In another aspect, the invention provides a method for
making anti-CD40 antibodies from non-human, non-mouse animals by
immunizing non-human transgenic animals that comprise human
immunoglobulin loci with a CD40 antigen. One can produce such
animals using the methods described in the above-cited documents.
The methods disclosed in these documents can be modified as
described in U.S. Pat. No. 5,994,619. In preferred embodiments, the
non-human animals are rats, sheep, pigs, goats, cattle or
horses.
[0139] XenoMouse.TM. mice produce an adult-like human repertoire of
fully human antibodies and generate antigen-specific human
antibodies. In some embodiments, the XenoMouse.TM. mice contain
approximately 80% of the human antibody V gene repertoire through
introduction of megabase sized, germline configuration yeast
artificial chromosome (YAC) fragments of the human heavy chain loci
and kappa light chain loci. See Mendez et al., Nature Genetics
15:146-156 (1997), Green and Jakobovits, J. Exp. Med. 188:483-495
(1998), and WO 98/24893, the disclosures of which are hereby
incorporated by reference.
[0140] In some embodiments, the non-human animal comprising human
immunoglobulin genes are animals that have a human immunoglobulin
"minilocus". In the minilocus approach, an exogenous Ig locus is
mimicked through the inclusion of individual genes from the Ig
locus. Thus, one or more V.sub.H genes, one or more D.sub.H genes,
one or more J.sub.H genes, a mu constant domain, and a second
constant domain (preferably a gamma constant domain) are formed
into a construct for insertion into an animal. This approach is
described, inter alia, in U.S. Pat. Nos. 5,545,807, 5,545,806,
5,569,825, 5,625,126, 5,633,425, 5,661,016, 5,770,429, 5,789,650,
5,814,318, 5,591,669, 5,612,205, 5,721,367, 5,789,215, and
5,643,763, hereby incorporated by reference.
[0141] An advantage of the minilocus approach is the rapidity with
which constructs including portions of the Ig locus can be
generated and introduced into animals. However, a potential
disadvantage of the minilocus approach is that there may not be
sufficient immunoglobulin diversity to support full B-cell
development, such that there may be lower antibody production.
[0142] In another aspect, the invention provides a method for
making humanized anti-CD40 antibodies. In some embodiments,
non-human animals are immunized with a CD40 antigen as described
below under conditions that permit antibody production.
Antibody-producing cells are isolated from the animals, fused with
myelomas to produce hybridomas, and nucleic acids encoding the
heavy and light chains of an anti-CD40 antibody of interest are
isolated. These nucleic acids are subsequently engineered using
techniques known to those of skill in the art and as described
further below to reduce the amount of non-human sequence, i.e., to
humanize the antibody to reduce the immune response in humans
[0143] In some embodiments, the CD40 antigen is isolated and/or
purified CD40. In a preferred embodiment, the CD40 antigen is human
CD40. In some embodiments, the CD40 antigen is a fragment of CD40.
In some embodiments, the CD40 fragment is the extracellular domain
of CD40. In some embodiments, the CD40 fragment comprises at least
one epitope of CD40. In other embodiments, the CD40 antigen is a
cell that expresses or overexpresses CD40 or an immunogenic
fragment thereof on its surface. In some embodiments, the CD40
antigen is a CD40 fusion protein.
[0144] Immunization of animals can be by any method known in the
art. See, e.g., Harlow and Lane, Antibodies: A Laboratory Manual,
New York: Cold Spring Harbor Press, 1990. Methods for immunizing
non-human animals such as mice, rats, sheep, goats, pigs, cattle
and horses are well known in the art. See, e.g., Harlow and Lane,
supra, and U.S. Pat. No. 5,994,619. In a preferred embodiment, the
CD40 antigen is administered with an adjuvant to stimulate the
immune response. Exemplary adjuvants include complete or incomplete
Freund's adjuvant, RIBI (muramyl dipeptides) or ISCOM
(immunostimulating complexes). Such adjuvants may protect the
polypeptide from rapid dispersal by sequestering it in a local
deposit, or they may contain substances that stimulate the host to
secrete factors that are chemotactic for macrophages and other
components of the immune system. Preferably, if a polypeptide is
being administered, the immunization schedule will involve two or
more administrations of the polypeptide, spread out over several
weeks.
[0145] Example I describes the production of anti-CD40 monoclonal
antibodies.
Production of Antibodies and Antibody-Producing Cell Lines
[0146] After immunization of an animal with a CD40 antigen,
antibodies and/or antibody-producing cells can be obtained from the
animal. In some embodiments, anti-CD40 antibody-containing serum is
obtained from the animal by bleeding or sacrificing the animal. The
serum may be used as it is obtained from the animal, an
immunoglobulin fraction may be obtained from the serum, or the
anti-CD40 antibodies may be purified from the serum. It is well
known to one of ordinary skill in the art that serum or
immunoglobulins obtained in this manner will be polyclonal. The
disadvantage is using polyclonal antibodies prepared from serum is
that the amount of antibodies that can be obtained is limited and
the polyclonal antibody has a heterogeneous array of
properties.
[0147] In some embodiments, antibody-producing immortalized cell
lines are prepared from cells isolated from the immunized animal.
After immunization, the animal is sacrificed and lymph node and/or
splenic B cells are immortalized. Methods of immortalizing cells
include, but are not limited to, transferring them with oncogenes,
inflecting them with the oncogenic virus cultivating them under
conditions that select for immortalized cells, subjecting them to
carcinogenic or mutating compounds, fusing them with an
immortalized cell, e.g., a myeloma cell, and inactivating a tumor
suppressor gene. See, e.g., Harlow and Lane, supra. If fusion with
myeloma cells is used, the myeloma cells preferably do not secrete
immunoglobulin polypeptides (a non-secretory cell line).
Immortalized cells are screened using CD40, a portion thereof, or a
cell expressing CD40. In a preferred embodiment, the initial
screening is performed using an enzyme-linked immunoassay (ELISA)
or a radioimmunoassay. An example of ELISA screening is provided in
WO 00/37504, herein incorporated by reference.
[0148] Anti-CD40 antibody-producing cells, e.g., hybridomas, are
selected, cloned and further screened for desirable
characteristics, including robust growth, high antibody production
and desirable antibody characteristics, as discussed further below.
Hybridomas can be expanded in vivo in syngeneic animals, in animals
that lack an immune system, e.g., nude mice, or in cell culture in
vitro. Methods of selecting, cloning and expanding hybridomas are
well known to those of ordinary skill in the art.
[0149] In a preferred embodiment, the immunized animal is a
non-human animal that expresses human immunoglobulin genes and the
splenic B cells are fused to a myeloma cell line from the same
species as the non-human animal. In a more preferred embodiment,
the immunized animal is a XENOMOUSE.TM. animal and the myeloma cell
line is a non-secretory mouse myeloma. In an even more preferred
embodiment, the myeloma cell line is P3-X63-AG8.653. See, e.g.,
Example I.
[0150] In another aspect, the invention provides hybridomas that
produce an human anti-CD40 antibody. In a preferred embodiment, the
hybridomas are mouse hybridomas, as described above. In other
embodiments, the hybridomas are produced in a non-human, non-mouse
species such as rats, sheep, pigs, goats, cattle or horses. In
another embodiment, the hybridomas are human hybridomas.
Nucleic Acids, Vectors, Host Cells and Recombinant Methods of
Making Antibodies
Nucleic Acids
[0151] The present invention also encompasses nucleic acid
molecules encoding anti-CD40 antibodies. In some embodiments,
different nucleic acid molecules encode a heavy chain and a light
chain of an anti-CD40 immunoglobulin. In other embodiments, the
same nucleic acid molecule encodes a heavy chain and a light chain
of an anti-CD40 immunoglobulin.
[0152] In some embodiments, the nucleic acid molecule encoding the
variable domain of the light chain comprises a human A3/A19
(DPK-15), L5 (DP5) or A27 (DPK-22) V.kappa. gene sequence or a
sequence derived therefrom. In some embodiments, the nucleic acid
molecule comprises a nucleotide sequence of a A3/A19 V.kappa. gene
and a J.kappa.1, J.kappa.2 or J.kappa.3 gene or sequences derived
therefrom. In some embodiments, the nucleic acid molecule comprises
a nucleotide sequence of an L5 V.kappa. gene and a J.kappa.4 gene.
In some embodiments, the nucleic acid molecule comprises a
nucleotide sequence of a A27 V.kappa. gene and a J.kappa.3
gene.
[0153] In some embodiments, the nucleic acid molecule encoding the
light chain, encodes an amino acid sequence comprising 1, 2, 3, 4,
5, 6, 7, 8, 9 or 10 mutations from the germline amino acid
sequence. In some embodiments, the nucleic acid molecule comprises
a nucleotide sequence that encodes a V.sub.L amino acid sequence
comprising 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 non-conservative amino
acid substitutions and/or 1, 2 or 3 non-conservative substitutions
compared to the germline sequence. Substitutions may be in the CDR
regions, the framework regions or in the constant domain.
[0154] In some embodiments, the nucleic acid molecule encoding the
variable domain of the light chain (V.sub.L) encodes a V.sub.L
amino acid sequence comprising one or more mutations compared to
the germline sequence that are identical to the mutations found in
the V.sub.L of one of the antibodies 3.1.1, 3.1.1L-L4M-L83V, 7.1.2,
10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1,
23.28.1L-C92A, 23.29.1 and 24.2.1. In some embodiments, the nucleic
acid molecule encodes at least three amino acid mutations compared
to the germline sequence found in the V.sub.L of one of the
antibodies 3.1.1, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1,
21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A, 23.29.1
and 24.2.1.
[0155] In some embodiments, the nucleic acid molecule comprises a
nucleotide sequence that encodes the V.sub.L amino acid sequence of
monoclonal antibody 3.1.1 (SEQ ID NO: 4), 3.1.1L-L4M-L83V (SEQ ID
NO: 94), 7.1.2 (SEQ ID NO: 12), 10.8.3 (SEQ ID NO: 20), 15.1.1 (SEQ
ID NO: 28), 21.2.1 (SEQ ID NO: 36), 2.1.4.1 (SEQ ID NO: 44), 22.1.1
(SEQ ID NO: 52), 23.5.1 (SEQ ID NO: 60), 23.28.1 (SEQ ID NO: 68),
23.28.1L-C92A (SEQ ID NO: 100), 23.29.1 (SEQ ID NO: 76) or 24.2.1
(SEQ ID NO: 84), or a portion thereof. In some embodiments, said
portion comprises at least the CDR3 region. In some embodiments,
the nucleic acid encodes the amino acid sequence of the light chain
CDRs of said antibody. In some embodiments, said portion is a
contiguous portion comprising CDR1-CDR3.
[0156] In some embodiments, the nucleic acid molecule comprises a
nucleotide sequence that encodes the amino acid sequence of one of
SEQ ID NOS: 4, 12, 20, 28, 36, 44, 52, 60, 68, 76, 84, 94 or 100,
or said sequence lacking the signal sequence. In some preferred
embodiments, the nucleic acid molecule comprises the nucleotide
sequence of SEQ ID NOS: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83,
93 or 99, or a portion thereof, said sequences optionally lacking
the signal sequence.
[0157] In some embodiments, said portion encodes a V.sub.L region.
In some embodiments, said portion encodes at least the CDR2 region.
In some embodiments, the nucleic acid encodes the amino acid
sequence of the light chain CDRs of said antibody. In some
embodiments, said portion encodes a contiguous region from
CDR1-CDR3.
[0158] In some embodiments, the nucleic acid molecule encodes a
V.sub.L amino acid sequence that is at least 70%, 75%, 80%, 85%,
90%, 95%, 97%, 98% or 99% identical to a V.sub.L amino acid
sequence of any one of antibodies 3.1.1, 3.1.1L-L4M-L83V, 7.1.2,
10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1,
23.28.1L-C92A, 23.29.1 or 24.2.1, or a V.sub.L amino acid sequence
of any one of SEQ ID NOS: 4, 12, 20, 28, 36, 44, 52, 60, 68, 76,
84, 94 or 100. Nucleic acid molecules of the invention include
nucleic acids that hybridize under highly stringent conditions,
such as those described above, to a nucleic acid sequence encoding
the amino acid sequence of SEQ ID NOS: 4, 12, 20, 28, 36, 44, 52,
60, 68, 76, 84, 94 or 100, or that has the nucleic acid sequence of
SEQ ID NOS: 3, 11, 19, 27, 35, 43, 51, 59, 67, 75, 83, 93 or
99.
[0159] In another embodiment, the nucleic acid encodes a
full-length light chain of an antibody selected from 3.1.1,
3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1,
23.5.1, 23.25.1, 23.28.1, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K or
24.2.1, or a light chain comprising the amino acid sequence of SEQ
ID NOS: 8, 16, 24, 32, 40, 48, 56, 64, 72, 80, 88, 94, 100 or 102,
or a light chain comprising a mutation, such as one disclosed
herein. Further, the nucleic acid may comprise the nucleotide
sequence of SEQ ID NOS: 7, 15, 23, 31, 39, 47, 55, 63, 71, 79 or
87, or a nucleic acid molecule encoding a light chain comprise a
mutation, such as one disclosed herein.
[0160] In another preferred embodiment, the nucleic acid molecule
encodes the variable domain of the heavy chain (V.sub.H) that
comprises a human 3-30+, 4-59, 1-02, 4.35 or 3-30.3 V.sub.H gene
sequence or a sequence derived therefrom. In various embodiments,
the nucleic acid molecule comprises a human 3-30+ V.sub.H gene, a
D4 (DIR3) gene and a human J.sub.H6 gene; a human 3-30+ V.sub.H
gene, a human D1-26 (DIR5) gene and a human J.sub.H6 gene; a human
4.35 V.sub.H gene, a human DIR3 gene and a human J.sub.H6 gene; a
human 4-59 V.sub.H gene, a human D4-23 gene and a human J.sub.H4
gene; a human 1-02 V.sub.H gene, a human DLR1 gene and a human
J.sub.H4 gene; a human 3-30+ V.sub.H gene, a human D6-19 (DIR3)
gene and a human J.sub.H4 gene; a human 3-30+ V.sub.H gene, a human
D1-1 gene and a human J.sub.H6 gene; a human 3-30+ V.sub.H gene, a
human D4-17 gene and a human J.sub.H6 gene; a human 3-30.3 V.sub.H
gene, a human D4-17 gene and a human J.sub.H6 gene; a human 4-59
V.sub.H gene, a human D4-17 (DIR1) gene and a human J.sub.H5 gene,
or sequence derived from the human genes.
[0161] In some embodiments, the nucleic acid molecule encodes an
amino acid sequence comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17 or 18 mutations compared to the germline
amino acid sequence of the human V, D or J genes. In some
embodiments, said mutations are in the V.sub.H region. In some
embodiments, said mutations are in the CDR regions.
[0162] In some embodiments, the nucleic acid molecule encodes one
or more amino acid mutations compared to the germline sequence that
are identical to amino acid mutations found in the V.sub.H of
monoclonal antibody 3.1.1, 3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A,
7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A,
23.5.1, 23.25.1, 23.28.1, 23.28.1H-D16E, 23.29.1 or 24.2.1. In some
embodiments, the nucleic acid encodes at least three amino acid
mutations compared to the germline sequences that are identical to
at least three amino acid mutations found in one of the
above-listed monoclonal antibodies.
[0163] In some embodiments, the nucleic acid molecule comprises a
nucleotide sequence that encodes at least a portion of the V.sub.H
amino acid sequence of antibody 3.1.1 (SEQ ID NO: 2), 3.1.1H-A78T
(SEQ ID NO: 90), 3.1.1H-A78T-V88A-V97A (SEQ ID NO: 92), 7.1.2 (SEQ
ID NO: 10), 10.8.3 (SEQ ID NO: 18), 15.1.1 (SEQ ID NO: 26), 21.2.1
(SEQ ID NO: 34), 21.4.1 (SEQ ID NO: 42), 22.1.1 (SEQ ID NO: 50),
22.1.1H-C109A (SEQ ID NO: 96), 23.5.1 (SEQ ID NO: 58), 23.28.1 (SEQ
ID NO: 66), 23.28.1H-D16E (SEQ ID NO: 98), 23.29.1 (SEQ ID NO: 74)
or 24.2.1 (SEQ ID NO: 82), or said sequence having conservative
amino acid mutations and/or a total of three or fewer
non-conservative amino acid substitutions. In various embodiments
the sequence encodes one or more CDR regions, preferably a CDR3
region, all three CDR regions, a contiguous portion including
CDR1-CDR3, or the entire V.sub.H region, with or without a signal
sequence.
[0164] In some embodiments, the nucleic acid molecule comprises a
nucleotide sequence that encodes the amino acid sequence of one of
SEQ ID NOS: 2, 10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 92, 96
or 98, or said sequence lacking the signal sequence. In some
preferred embodiments, the nucleic acid molecule comprises at least
a portion of the nucleotide sequence of SEQ ID NO: 1, 9, 17, 25,
33, 41, 49, 57, 65, 73, 81, 89, 91, 95 or 97, or said sequence
lacking the signal sequence. In some embodiments, said portion
encodes the V.sub.H region (with or without a signal sequence), a
CDR3 region, all three CDR regions, or a contiguous region
including CDR1-CDR3.
[0165] In some embodiments, the nucleic acid molecule encodes a
V.sub.H amino acid sequence that is at least 70%, 75%, 80%, 85%,
90%, 95%, 97%, 98% or 99% identical to the V.sub.H amino acid
sequences shown in FIG. 1A-1C or 2A-2C or to a V.sub.H amino acid
sequence of any one of SEQ ID NOS: 2, 10, 18, 26, 34, 42, 50, 58,
66, 74, 82, 90, 92, 96 or 98. Nucleic acid molecules of the
invention include nucleic acids that hybridize under highly
stringent conditions, such as those described above, to a nucleic
acid sequence encoding the amino acid sequence of SEQ ID NOS: 2,
10, 18, 26, 34, 42, 50, 58, 66, 74, 82, 90, 92, 96 or 98, or that
has the nucleic acid sequence of SEQ ID NOS: 1, 9, 17, 25, 33, 41,
49, 57, 65, 73, 81, 89, 91, 95 or 97. Nucleic acid molecule of the
invention include nucleic acid molecule that hybridize under highly
stringent conditions, such as those described above, to a nucleic
acid sequence encoding a V.sub.H described immediately above.
[0166] In another embodiment, the nucleic acid encodes a
full-length heavy chain of an antibody selected from 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 7.1.2, 10.8.3, 15.1.1, 21.4.1,
21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.29.1 and 24.2.1, or a heavy chain having the
amino acid sequence of SEQ ID NOS: 6, 14, 22, 30, 38, 46, 54, 62,
70, 78 or 86, or a heavy chain comprising a mutation, such as one
of the mutations discussed herein Further, the nucleic acid may
comprise the nucleotide sequence of SEQ ID NOS: 5, 13, 21, 29, 37,
45, 53, 61, 69, 77, 85 or 89, or a nucleic acid molecule encoding a
heavy chain comprising a mutation, such as one of the mutations
discussed herein.
[0167] A nucleic acid molecule encoding the heavy or entire light
chain of an anti-CD40 antibody or portions thereof can be isolated
from any source that produces such antibody. In various
embodiments, the nucleic acid molecules are isolated from a B cell
isolated from an animal immunized with CD40 or from an immortalized
cell derived from such a B cell that expresses an anti-CD40
antibody. Methods of isolating mRNA encoding an antibody are
well-known in the art. See, e.g., Sambrook et al. The mRNA may be
used to produce cDNA for use in the polymerase chain reaction (PCR)
or cDNA cloning of antibody genes. In a preferred embodiment, the
nucleic acid molecule is isolated from a hybridoma that has as one
of its fusion partners a human immunoglobulin-producing cell from a
non-human transgenic animal. In an even more preferred embodiment,
the human immunoglobulin producing cell is isolated from a
XenoMouse.TM. animal. In another embodiment, the human
immunoglobulin-producing cell is from a non-human, non-mouse
transgenic animal, as described above. In another embodiment, the
nucleic acid is isolated from a non-human, non-transgenic animal.
The nucleic acid molecules isolated from a non-human,
non-transgenic animal may be used, e.g., for humanized
antibodies.
[0168] In some embodiments, a nucleic acid encoding a heavy chain
of an anti-CD40 antibody of the invention can comprise a nucleotide
sequence encoding a V.sub.H domain of the invention joined in-frame
to a nucleotide sequence encoding a heavy chain constant domain
from any source. Similarly, a nucleic acid molecule encoding a
light chain of an anti-CD40 antibody of the invention can comprise
a nucleotide sequence encoding a V.sub.L domain of the invention
joined in-frame to a nucleotide sequence encoding a light chain
constant domain from any source.
[0169] In a further aspect of the invention, nucleic acid molecules
encoding the variable domain of the heavy (V.sub.H) and light
(V.sub.L) chains are "converted" to full-length antibody genes. In
one embodiment, nucleic acid molecules encoding the V.sub.H or
V.sub.L domains are converted to full-length antibody genes by
insertion into an expression vector already encoding heavy chain
constant or light chain constant domains, respectively, such that
the V.sub.H segment is operatively linked to the C.sub.H segment(s)
within the vector, and the V.sub.L segment is operatively linked to
the C.sub.L segment within the vector. In another embodiment,
nucleic acid molecules encoding the V.sub.H and/or V.sub.L domains
are converted into full-length antibody genes by linking, e.g.,
ligating, a nucleic acid molecule encoding a V.sub.H and/or V.sub.L
domains to a nucleic acid molecule encoding a C.sub.H and/or
C.sub.L domain using standard molecular biological techniques.
Nucleic acid sequences of human heavy and light chain
immunoglobulin constant domain genes are known in the art. See,
e.g., Kabat et al., Sequences of Proteins of Immunological
Interest, 5th Ed., NIH Publ. No. 91-3242, 1991. Nucleic acid
molecules encoding the full-length heavy and/or light chains may
then be expressed from a cell into which they have been introduced
and the anti-CD40 antibody isolated.
[0170] The nucleic acid molecules may be used to recombinantly
express large quantities of anti-CD40 antibodies. The nucleic acid
molecules also may be used to produce chimeric antibodies,
bispecific antibodies, single chain antibodies, immunoadhesins,
diabodies, mutated antibodies and antibody derivatives, as
described further below. If the nucleic acid molecules are derived
from a non-human, non-transgenic animal, the nucleic acid molecules
may be used for antibody humanization, also as described below.
[0171] In another embodiment, a nucleic acid molecule of the
invention is used as a probe or PCR primer for a specific antibody
sequence. For instance, the nucleic acid can be used as a probe in
diagnostic methods or as a PCR primer to amplify regions of DNA
that could be used, inter alia, to isolate additional nucleic acid
molecules encoding variable domains of anti-CD40 antibodies. In
some embodiments, the nucleic acid molecules are oligonucleotides.
In some embodiments, the oligonucleotides are from highly variable
regions of the heavy and light chains of the antibody of interest.
In some embodiments, the oligonucleotides encode all or a part of
one or more of the CDRs of antibody 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.28.1L-C92A, 23.29.1 or 24.2.1.
Vectors
[0172] The invention provides vectors comprising nucleic acid
molecules that encode the heavy chain of an anti-CD40 antibody of
the invention or an antigen-binding portion thereof. The invention
also provides vectors comprising nucleic acid molecules that encode
the light chain of such antibodies or antigen-binding portion
thereof. The invention further provides vectors comprising nucleic
acid molecules encoding fusion proteins, modified antibodies,
antibody fragments, and probes thereof.
[0173] In some embodiments, the anti-CD40 antibodies, or
antigen-binding portions of the invention are expressed by
inserting DNAs encoding partial or full-length light and heavy
chains, obtained as described above, into expression vectors such
that the genes are operatively linked to necessary expression
control sequences such as transcriptional and translational control
sequences. Expression vectors include plasmids, retroviruses,
adenoviruses, adeno-associated viruses (AAV), plant viruses such as
cauliflower mosaic virus, tobacco mosaic virus, cosmids, YACs, EBV
derived episomes, and the like. The antibody gene is ligated into a
vector such that transcriptional and translational control
sequences within the vector serve their intended function of
regulating the transcription and translation of the antibody gene.
The expression vector and expression control sequences are chosen
to be compatible with the expression host cell used. The antibody
light chain gene and the antibody heavy chain gene can be inserted
into separate vectors. In a preferred embodiment, both genes are
inserted into the same expression vector. The antibody genes are
inserted into the expression vector by standard methods (e.g.,
ligation of complementary restriction sites on the antibody gene
fragment and vector, or blunt end ligation if no restriction sites
are present).
[0174] A convenient vector is one that encodes a functionally
complete human C.sub.H or C.sub.L immunoglobulin sequence, with
appropriate restriction sites engineered so that any V.sub.H or
V.sub.L sequence can easily be inserted and expressed, as described
above. In such vectors, splicing usually occurs between the splice
donor site in the inserted J region and the splice acceptor site
preceding the human C domain, and also at the splice regions that
occur within the human C.sub.H exons. Polyadenylation and
transcription termination occur at native chromosomal sites
downstream of the coding regions. The recombinant expression vector
also can encode a signal peptide that facilitates secretion of the
antibody chain from a host cell. The antibody chain gene may be
cloned into the vector such that the signal peptide is linked
in-frame to the amino terminus of the immunoglobulin chain. The
signal peptide can be an immunoglobulin signal peptide or a
heterologous signal peptide (i.e., a signal peptide from a
non-immunoglobulin protein).
[0175] In addition to the antibody chain genes, the recombinant
expression vectors of the invention carry regulatory sequences that
control the expression of the antibody chain genes in a host cell.
It will be appreciated by those skilled in the art that the design
of the expression vector, including the selection of regulatory
sequences may depend on such factors as the choice of the host cell
to be transformed, the level of expression of protein desired, etc.
Preferred regulatory sequences for mammalian host cell expression
include viral elements that direct high levels of protein
expression in mammalian cells, such as promoters and/or enhancers
derived from retroviral LTRs, cytomegalovirus (CMV) (such as the
CMV promoter/enhancer), Simian Virus 40 (SV40) (such as the SV40
promoter/enhancer), adenovirus, (e.g., the adenovirus major late
promoter (AdMLP)), polyoma and strong mammalian promoters such as
native immunoglobulin and actin promoters. For further description
of viral regulatory elements, and sequences thereof, see e.g., U.S.
Pat. No. 5,168,062, U.S. Pat. No. 4,510,245 and U.S. Pat. No.
4,968,615. Methods for expressing antibodies in plants, including a
description of promoters and vectors, as well as transformation of
plants is known in the art. See, e.g., U.S. Pat. No. 6,517,529,
herein incorporated by reference. Methods of expressing
polypeptides in bacterial cells or fungal cells, e.g., yeast cells,
are also well known in the art.
[0176] In addition to the antibody chain genes and regulatory
sequences, the recombinant expression vectors of the invention may
carry additional sequences, such as sequences that regulate
replication of the vector in host cells (e.g., origins of
replication) and selectable marker genes. The selectable marker
gene facilitates selection of host cells into which the vector has
been introduced (see e.g., U.S. Pat. Nos. 4,399,216, 4,634,665 and
5,179,017). For example, typically the selectable marker gene
confers resistance to drugs, such as G418, hygromycin or
methotrexate, on a host cell into which the vector has been
introduced. Preferred selectable marker genes include the
dihydrofolate reductase (DHFR) gene (for use in dhfr-host cells
with methotrexate selection/amplification), the neo gene (for G418
selection), and the glutamate synthetase gene.
Non-Hybridoma Host Cells and Methods of Recombinantly Producing
Protein
[0177] Nucleic acid molecules encoding anti-CD40 antibodies and
vectors comprising these nucleic acid molecules can be used for
transfection of a suitable mammalian, plant, bacterial or yeast
host cell. Transformation can be by any known method for
introducing polynucleotides into a host cell. Methods for
introduction of heterologous polynucleotides into mammalian cells
are well known in the art and include dextran-mediated
transfection, calcium phosphate precipitation, polybrene-mediated
transfection, protoplast fusion, electroporation, encapsulation of
the polynucleotide(s) in liposomes, and direct microinjection of
the DNA into nuclei. In addition, nucleic acid molecules may be
introduced into mammalian cells by viral vectors. Methods of
transforming cells are well known in the art. See, e.g., U.S. Pat.
Nos. 4,399,216, 4,912,040, 4,740,461, and 4,959,455 (which patents
are hereby incorporated herein by reference). Methods of
transforming plant cells are well known in the art, including,
e.g., Agrobacterium-mediated transformation, biolistic
transformation, direct injection, electroporation and viral
transformation. Methods of transforming bacterial and yeast cells
are also well known in the art.
[0178] Mammalian cell lines available as hosts for expression are
well known in the art and include many immortalized cell lines
available from the American Type Culture Collection (ATCC). These
include, inter alia, Chinese hamster ovary (CHO) cells, NSO, SP2
cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney
cells (COS), human hepatocellular carcinoma cells (e.g., Hep G2),
A549 cells, and a number of other cell lines. Cell lines of
particular preference are selected through determining which cell
lines have high expression levels. Other cell lines that may be
used are insect cell lines, such as Sf9 cells. When recombinant
expression vectors encoding antibody genes are introduced into
mammalian host cells, the antibodies are produced by culturing the
host cells for a period of time sufficient to allow for expression
of the antibody in the host cells or, more preferably, secretion of
the antibody into the culture medium in which the host cells are
grown. Antibodies can be recovered from the culture medium using
standard protein purification methods. Plant host cells include,
e.g., Nicotiana, Arabidopsis, duckweed, corn, wheat, potato, etc.
Bacterial host cells include E. coli and Streptomyces species.
Yeast host cells include Schizosaccharomyces pombe, Saccharomyces
cerevisiae and Pichia pastoris.
[0179] Further, expression of antibodies of the invention (or other
moieties therefrom) from production cell lines can be enhanced
using a number of known techniques. For example, the glutamine
synthetase gene expression system (the GS system) is a common
approach for enhancing expression under certain conditions. The GS
system is discussed in whole or part in connection with European
Patent Nos. 0 216 846, 0 256 055, and 0 323 997 and European Patent
Application No. 89303964.4.
[0180] It is likely that antibodies expressed by different cell
lines or in transgenic animals will have different glycosylation
from each other. However, all antibodies encoded by the nucleic
acid molecules provided herein, or comprising the amino acid
sequences provided herein are part of the instant invention,
regardless of the glycosylation of the antibodies.
Transgenic Animals and Plants
[0181] Anti-CD40 antibodies of the invention also can be produced
transgenically through the generation of a mammal or plant that is
transgenic for the immunoglobulin heavy and light chain sequences
of interest and production of the antibody in a recoverable form
therefrom. In connection with the transgenic production in mammals,
anti-CD40 antibodies can be produced in, and recovered from, the
milk of goats, cows, or other mammals. See, e.g., U.S. Pat. Nos.
5,827,690, 5,756,687, 5,750,172, and 5,741,957. In some
embodiments, non-human transgenic animals that comprise human
immunoglobulin loci are immunized with CD40 or an immunogenic
portion thereof, as described above. Methods for making antibodies
in plants are described, e.g., in U.S. Pat. No. 6,046,037 and U.S.
Pat. No. 5,959,177.
[0182] In some embodiments, non-human transgenic animals or plants
are produced by introducing one or more nucleic acid molecules
encoding an anti-CD40 antibody of the invention into the animal or
plant by standard transgenic techniques. See Hogan and U.S. Pat.
No. 6,417,429, supra. The transgenic cells used for making the
transgenic animal can be embryonic stem cells or somatic cells. The
transgenic non-human organisms can be chimeric, nonchimeric
heterozygotes, and nonchimeric homozygotes. See, e.g., Hogan et
al., Manipulating the Mouse Embryo: A Laboratory Manual 2ed., Cold
Spring Harbor Press (1999); Jackson et al., Mouse Genetics and
Transgenics: A Practical Approach, Oxford University Press (2000);
and Pinkert, Transgenic Animal Technology: A Laboratory Handbook,
Academic Press (1999). In some embodiments, the transgenic
non-human animals have a targeted disruption and replacement by a
targeting construct that encodes a heavy chain and/or a light chain
of interest. In a preferred embodiment, the transgenic animals
comprise and express nucleic acid molecules encoding heavy and
light chains that specifically bind to CD40, preferably human CD40.
In some embodiments, the transgenic animals comprise nucleic acid
molecules encoding a modified antibody such as a single-chain
antibody, a chimeric antibody or a humanized antibody. The
anti-CD40 antibodies may be made in any transgenic animal. In a
preferred embodiment, the non-human animals are mice, rats, sheep,
pigs, goats, cattle or horses. The non-human transgenic animal
expresses said encoded polypeptides in blood, milk, urine, saliva,
tears, mucus and other bodily fluids.
Phage Display Libraries
[0183] The invention provides a method for producing an anti-CD40
antibody or antigen-binding portion thereof comprising the steps of
synthesizing a library of human antibodies on phage, screening the
library with CD40 or a portion thereof, isolating phage that bind
CD40, and obtaining the antibody from the phage. By way of example,
one method for preparing the library of antibodies for use in phage
display techniques comprises the steps of immunizing a non-human
animal comprising human immunoglobulin loci with CD40 or an
antigenic portion thereof to create an immune response, extracting
antibody producing cells from the immunized animal; isolating RNA
from the extracted cells, reverse transcribing the RNA to produce
cDNA, amplifying the cDNA using a primer, and inserting the cDNA
into a phage display vector such that antibodies are expressed on
the phage. Recombinant anti-CD40 antibodies of the invention may be
obtained in this way.
[0184] Recombinant anti-CD40 human antibodies of the invention can
be isolated by screening a recombinant combinatorial antibody
library. Preferably the library is a scFv phage display library,
generated using human V.sub.L and V.sub.H cDNAs prepared from mRNA
isolated from B cells. Methodologies for preparing and screening
such libraries are known in the art. There are commercially
available kits for generating phage display libraries (e.g., the
Pharmacia Recombinant Phage Antibody System, catalog no.
27-9400-01; and the Stratagene SurfZAP.TM. phage display kit,
catalog no. 240612). There also are other methods and reagents that
can be used in generating and screening antibody display libraries
(see, e.g., U.S. Pat. No. 5,223,409; PCT Publication Nos. WO
92/18619, WO 91/17271, WO 92/20791, WO 92/15679, WO 93/01288, WO
92/01047, WO 92/09690; Fuchs et al., Bio/Technology 9:1370-1372
(1991); Hay et al., Hum. Antibod. Hybridomas 3:81-85 (1992); Huse
et al., Science 246:1275-1281 (1989); McCafferty et al., Nature
348:552-554 (1990); Griffiths et al., EMBO J. 12:725-734 (1993);
Hawkins et al., J. Mol. Biol. 226:889-896 (1992); Clackson et al.,
Nature 352:624-628 (1991); Gram et al., Proc. Natl. Acad. Sci. USA
89:3576-3580 (1992); Garrad et al., Bio/Technology 9:1373-1377
(1991); Hoogenboom et al., Nuc. Acid Res. 19:4133-4137 (1991); and
Barbas et al., Proc. Natl. Acad. Sci. USA 88:7978-7982 (1991).
[0185] In one embodiment, to isolate a human anti-CD40 antibodies
with the desired characteristics, a human anti-CD40 antibody as
described herein is first used to select human heavy and light
chain sequences having similar binding activity toward CD40, using
the epitope imprinting methods described in PCT Publication No. WO
93/06213. The antibody libraries used in this method are preferably
scFv libraries prepared and screened as described in PCT
Publication No. WO 92/01047, McCafferty et al., Nature 348:552-554
(1990); and Griffiths et al., EMBO J. 12:725-734 (1993). The scFv
antibody libraries preferably are screened using human CD40 as the
antigen.
[0186] Once initial human V.sub.L and V.sub.H domains are selected,
"mix and match" experiments are performed, in which different pairs
of the initially selected V.sub.L and V.sub.H segments are screened
for CD40 binding to select preferred V.sub.L/V.sub.H pair
combinations. Additionally, to further improve the quality of the
antibody, the V.sub.L and V.sub.H segments of the preferred
V.sub.L/V.sub.H pair(s) can be randomly mutated, preferably within
the CDR3 region of V.sub.H and/or V.sub.L, in a process analogous
to the in vivo somatic mutation process responsible for affinity
maturation of antibodies during a natural immune response. This in
vitro affinity maturation can be accomplished by amplifying V.sub.H
and V.sub.L domains using PCR primers complimentary to the V.sub.H
CDR3 or V.sub.L CDR3, respectively, which primers have been
"spiked" with a random mixture of the four nucleotide bases at
certain positions such that the resultant PCR products encode
V.sub.H and V.sub.L segments into which random mutations have been
introduced into the V.sub.H and/or V.sub.L CDR3 regions. These
randomly mutated V.sub.H and V.sub.L segments can be rescreened for
binding to CD40.
[0187] Following screening and isolation of an anti-CD40 antibody
of the invention from a recombinant immunoglobulin display library,
nucleic acids encoding the selected antibody can be recovered from
the display package (e.g., from the phage genome) and subcloned
into other expression vectors by standard recombinant DNA
techniques. If desired, the nucleic acid can further be manipulated
to create other antibody forms of the invention, as described
below. To express a recombinant human antibody isolated by
screening of a combinatorial library, the DNA encoding the antibody
is cloned into a recombinant expression vector and introduced into
a mammalian host cells, as described above.
Class Switching
[0188] Another aspect of the invention provides a method for
converting the class or subclass of an anti-CD40 antibody to
another class or subclass. In some embodiments, a nucleic acid
molecule encoding a V.sub.L or V.sub.H that does not include any
nucleic acid sequences encoding C.sub.L or C.sub.H is isolated
using methods well-known in the art. The nucleic acid molecule then
is operatively linked to a nucleic acid sequence encoding a C.sub.L
or C.sub.H from a desired immunoglobulin class or subclass. This
can be achieved using a vector or nucleic acid molecule that
comprises a C.sub.L or C.sub.H chain, as described above. For
example, an anti-CD40 antibody that was originally IgM can be class
switched to an IgG. Further, the class switching may be used to
convert one IgG subclass to another, e.g., from IgG1 to IgG2.
Another method for producing an antibody of the invention
comprising a desired isotype comprises the steps of isolating a
nucleic acid encoding a heavy chain of an anti-CD40 antibody and a
nucleic acid encoding a light chain of an anti-CD40 antibody,
isolating the sequence encoding the V.sub.H region, ligating the
V.sub.H sequence to a sequence encoding a heavy chain constant
domain of the desired isotype, expressing the light chain gene and
the heavy chain construct in a cell, and collecting the anti-CD40
antibody with the desired isotype.
Deimmunized Antibodies
[0189] Another way of producing antibodies with reduced
immunogenicity is the deimmunization of antibodies. In another
aspect of the invention, the antibody may be deimmunized using the
techniques described in, e.g., PCT Publication Nos. WO98/52976 and
WO00/34317 (which incorporated herein by reference in their
entirety).
Mutated Antibodies
[0190] In another embodiment, the nucleic acid molecules, vectors
and host cells may be used to make mutated anti-CD40 antibodies.
The antibodies may be mutated in the variable domains of the heavy
and/or light chains, e.g., to alter a binding property of the
antibody. For example, a mutation may be made in one or more of the
CDR regions to increase or decrease the K.sub.D of the antibody for
CD40, to increase or decrease K.sub.off, or to alter the binding
specificity of the antibody. Techniques in site-directed
mutagenesis are well-known in the art. See, e.g., Sambrook et al.
and Ausubel et al., supra. In a preferred embodiment, mutations are
made at an amino acid residue that is known to be changed compared
to germline in a variable domain of an anti-CD40 antibody. In
another embodiment, one or more mutations are made at an amino acid
residue that is known to be changed compared to the germline in a
CDR region or framework region of a variable domain, or in a
constant domain of a monoclonal antibody 3.1.1, 3.1.1H-A78T,
3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3, 15.1.1,
21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1, 23.28.1,
23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K and 24.2.1.
In another embodiment, one or more mutations are made at an amino
acid residue that is known to be changed compared to the germline
in a CDR region or framework region of a variable domain of an
amino acid sequence selected from SEQ ID NOS: 4, 12, 20, 28, 36,
44, 52, 60, 68, 76, 84, 94, 100, 102, 2, 10, 18, 26, 34, 42, 50,
58, 66, 74, 82, 90, 92, 96, 98, 100 or 102, or whose nucleic acid
sequence is presented in SEQ ID NOS: 3, 11, 19, 27, 35, 43, 51, 59,
67, 75, 83, 93, 99, 101, 1, 9, 17, 25, 33, 41, 49, 57, 65, 73, 81,
89, 91, 95, 97, 99 or 101.
[0191] In one embodiment, the framework region is mutated so that
the resulting framework region(s) have the amino acid sequence of
the corresponding germline gene. A mutation may be made in a
framework region or constant domain to increase the half-life of
the anti-CD40 antibody. See, e.g., PCT Publication No. WO 00/09560,
herein incorporated by reference. A mutation in a framework region
or constant domain also can be made to alter the immunogenicity of
the antibody, to provide a site for covalent or non-covalent
binding to another molecule, or to alter such properties as
complement fixation, FcR binding and ADCC. According to the
invention, a single antibody may have mutations in any one or more
of the framework regions, the constant domain and in the variable
regions.
[0192] In some embodiments, there are from 1 to 18, including any
number in between, amino acid mutations in either the V.sub.H or
V.sub.L domains of the mutated anti-CD40 antibody compared to the
anti-CD40 antibody prior to mutation. In any of the above, the
mutations may occur in one or more CDR regions. Further, any of the
mutations can be conservative amino acid substitutions. In some
embodiments, there are no more than 5, 4, 3, 2, or 1 amino acid
changes in the constant domains.
Modified Antibodies
[0193] In another embodiment, a fusion antibody or immunoadhesin
may be made that comprises all or a portion of an anti-CD40
antibody of the invention linked to another polypeptide. In a
preferred embodiment, only the variable domains of the anti-CD40
antibody are linked to the polypeptide. In another preferred
embodiment, the V.sub.H domain of an anti-CD40 antibody is linked
to a first polypeptide, while the V.sub.L domain of an anti-CD40
antibody is linked to a second polypeptide that associates with the
first polypeptide in a manner such that the V.sub.H and V.sub.L
domains can interact with one another to form an antibody binding
site. In another preferred embodiment, the V.sub.H domain is
separated from the V.sub.L domain by a linker such that the V.sub.H
and V.sub.L domains can interact with one another (see below under
Single Chain Antibodies). The V.sub.H-linker-V.sub.L antibody is
then linked to the polypeptide of interest. The fusion antibody is
useful for directing a polypeptide to a CD40-expressing cell or
tissue. The polypeptide may be a therapeutic agent, such as a
toxin, growth factor or other regulatory protein, or may be a
diagnostic agent, such as an enzyme that may be easily visualized,
such as horseradish peroxidase. In addition, fusion antibodies can
be created in which two (or more) single-chain antibodies are
linked to one another. This is useful if one wants to create a
divalent or polyvalent antibody on a single polypeptide chain, or
if one wants to create a bispecific antibody.
[0194] To create a single chain antibody, (scFv) the V.sub.H- and
V.sub.L-encoding DNA fragments are operatively linked to another
fragment encoding a flexible linker, e.g., encoding the amino acid
sequence (Gly.sub.4-Ser).sub.3 (SEQ ID NO: 143), such that the
V.sub.H and V.sub.L sequences can be expressed as a contiguous
single-chain protein, with the V.sub.L and V.sub.H domains joined
by the flexible linker. See, e.g., Bird et al., Science 242:423-426
(1988); Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883
(1988); McCafferty et al., Nature 348:552-554 (1990). The single
chain antibody may be monovalent, if only a single V.sub.H and
V.sub.L are used, bivalent, if two V.sub.H and V.sub.L are used, or
polyvalent, if more than two V.sub.H and V.sub.L are used.
Bispecific or polyvalent antibodies may be generated that bind
specifically to CD40 and to another molecule.
[0195] In other embodiments, other modified antibodies may be
prepared using anti-CD40 antibody-encoding nucleic acid molecules.
For instance, "Kappa bodies" (Ill et al., Protein Eng. 10: 949-57
(1997)), "Minibodies" (Martin et al., EMBO J. 13: 5303-9 (1994)),
"Diabodies" (Holliger et al., Proc. Natl. Acad. Sci. USA 90:
6444-6448 (1993)), or "Janusins" (Traunecker et al., EMBO J.
10:3655-3659 (1991) and Traunecker et al., Int. J. Cancer (Suppl.)
7:51-52 (1992)) may be prepared using standard molecular biological
techniques following the teachings of the specification.
[0196] Bispecific antibodies or antigen-binding fragments can be
produced by a variety of methods including fusion of hybridomas or
linking of Fab' fragments. See, e.g., Songsivilai & Lachmann,
Clin. Exp. Immunol. 79: 315-321 (1990), Kostelny et al., J.
Immunol. 148:1547-1553 (1992). In addition, bispecific antibodies
may be formed as "diabodies" or "Janusins." In some embodiments,
the bispecific antibody binds to two different epitopes of CD40. In
some embodiments, the bispecific antibody has a first heavy chain
and a first light chain from monoclonal antibody 3.1.1,
3.1.1H-A78T, 3.1.1H-A78T-V88A-V97A, 3.1.1L-L4M-L83V, 7.1.2, 10.8.3,
15.1.1, 21.4.1, 21.2.1, 22.1.1, 22.1.1H-C109A, 23.5.1, 23.25.1,
23.28.1, 23.28.1H-D16E, 23.28.1L-C92A, 23.29.1, 23.29.1L-R174K and
24.2.1, and an additional antibody heavy chain and light chain. In
some embodiments, the additional light chain and heavy chain also
are from one of the above-identified monoclonal antibodies, but are
different from the first heavy and light chains.
[0197] In some embodiments, the modified antibodies described above
are prepared using one or more of the variable domains or CDR
regions from a human anti-CD40 monoclonal antibody provided herein,
from an amino acid sequence of said monoclonal antibody, or from a
heavy chain or light chain encoded by a nucleic acid sequence
encoding said monoclonal antibody.
Derivatized and Labeled Antibodies
[0198] An anti-CD40 antibody or antigen-binding portion of the
invention can be derivatized or linked to another molecule (e.g.,
another peptide or protein). In general, the antibodies or portion
thereof is derivatized such that the CD40 binding is not affected
adversely by the derivatization or labeling. Accordingly, the
antibodies and antibody portions of the invention are intended to
include both intact and modified forms of the human anti-CD40
antibodies described herein. For example, an antibody or antibody
portion of the invention can be functionally linked (by chemical
coupling, genetic fusion, noncovalent association or otherwise) to
one or more other molecular entities, such as another antibody
(e.g., a bispecific antibody or a diabody), a detection agent, a
cytotoxic agent, a pharmaceutical agent, and/or a protein or
peptide that can mediate associate of the antibody or antibody
portion with another molecule (such as a streptavidin core region
or a polyhistidine tag).
[0199] One type of derivatized antibody is produced by crosslinking
two or more antibodies (of the same type or of different types,
e.g., to create bispecific antibodies). Suitable crosslinkers
include those that are heterobifunctional, having two distinctly
reactive groups separated by an appropriate spacer (e.g.,
m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional
(e.g., disuccinimidyl suberate). Such linkers are available from
Pierce Chemical Company, Rockford, Ill.
[0200] Another type of derivatized antibody is a labeled antibody.
Useful detection agents with which an antibody or antigen-binding
portion of the invention may be derivatized include fluorescent
compounds, including fluorescein, fluorescein isothiocyanate,
rhodamine, 5-dimethylamine-1-napthalenesulfonyl chloride,
phycoerythrin, lanthanide phosphors and the like. An antibody can
also be labeled with enzymes that are useful for detection, such as
horseradish peroxidase, .beta.-galactosidase, luciferase, alkaline
phosphatase, glucose oxidase and the like. When an antibody is
labeled with a detectable enzyme, it is detected by adding
additional reagents that the enzyme uses to produce a reaction
product that can be discerned. For example, when the agent
horseradish peroxidase is present, the addition of hydrogen
peroxide and diaminobenzidine leads to a colored reaction product,
which is detectable. An antibody can also be labeled with biotin,
and detected through indirect measurement of avidin or streptavidin
binding. An antibody can also be labeled with a predetermined
polypeptide epitope recognized by a secondary reporter (e.g.,
leucine zipper pair sequences, binding sites for secondary
antibodies, metal binding domains, epitope tags). In some
embodiments, labels are attached by spacer arms of various lengths
to reduce potential steric hindrance.
[0201] An anti-CD40 antibody can also be labeled with a
radiolabeled amino acid. The radiolabel can be used for both
diagnostic and therapeutic purposes. For instance, the radiolabel
can be used to detect CD40-expressing tumors by x-ray or other
diagnostic techniques. Further, the radiolabel can be used
therapeutically as a toxin for cancerous cells or tumors. Examples
of labels for polypeptides include, but are not limited to, the
following radioisotopes or radionuclides--.sup.3H, .sup.14C,
.sup.15N, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I,
.sup.131I.
[0202] An anti-CD40 antibody can also be derivatized with a
chemical group such as polyethylene glycol (PEG), a methyl or ethyl
group, or a carbohydrate group. These groups are useful to improve
the biological characteristics of the antibody, e.g., to increase
serum half-life or to increase tissue binding.
Pharmaceutical Compositions and Kits
[0203] The invention also relates to compositions comprising a
human anti-CD40 agonist antibody for the treatment of subjects in
need of immunostimulation. Such compositions are useful to treat,
prevent, reduce the frequency of or severity of infection,
including viral and bacterial infection, for treating a
hyperproliferative disorder, including cancerous and pre-cancerous
conditions, for treating genetic immunodeficiency conditions, such
as hyper-IgM syndrome and for treating primary or combined
immunodeficiency conditions, including conditions characterized by
neutropenia, in a mammal, including humans. Subjects for treatment
with agonist anti-CD40 antibody therapy include any subject in need
of immune enhancement, including but not limited to the elderly and
individuals who are immunosuppressed, for example due to
chemotherapy.
[0204] Hyperproliferative disorders that may be treated by an
agonist anti-CD40 antibody of the invention can involve any tissue
or organ and include but are not limited to brain, lung, squamous
cell, bladder, gastric, pancreatic, breast, head, neck, liver,
renal, ovarian, prostate, colorectal, esophageal, gynecological,
nasopharynx, or thyroid cancers, melanomas, lymphomas, leukemias or
multiple myelomas. In particular, human agonist anti-CD40
antibodies of the invention are useful to treat carcinomas of the
breast, prostate, colon and lung.
[0205] Treatment may involve administration of one or more agonist
anti-CD40 monoclonal antibodies of the invention, or
antigen-binding fragments thereof, alone or with a pharmaceutically
acceptable carrier. As used herein, "pharmaceutically acceptable
carrier" means any and all solvents, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like that are physiologically compatible.
Some examples of pharmaceutically acceptable carriers are water,
saline, phosphate buffered saline, dextrose, glycerol, ethanol and
the like, as well as combinations thereof. In many cases, it will
be preferable to include isotonic agents, for example, sugars,
polyalcohols such as mannitol, sorbitol, or sodium chloride in the
composition. Additional examples of pharmaceutically acceptable
substances are wetting agents or minor amounts of auxiliary
substances such as wetting or emulsifying agents, preservatives or
buffers, which enhance the shelf life or effectiveness of the
antibody.
[0206] Agonist anti-CD40 antibodies of the invention and
compositions comprising them, can be administered in combination
with one or more other therapeutic, diagnostic or prophylactic
agents. Additional therapeutic agents include other
anti-neoplastic, anti-tumor, anti-angiogenic or chemotherapeutic
agents. Such additional agents may be included in the same
composition or administered separately. In some embodiments, one or
more agonist anti-CD40 antibodies of the invention can be used as a
vaccine or as adjuvants to a vaccine.
[0207] The compositions of this invention may be in a variety of
forms, for example, liquid, semi-solid and solid dosage forms, such
as liquid solutions (e.g., injectable and infusible solutions),
dispersions or suspensions, tablets, pills, powders, liposomes and
suppositories. The preferred form depends on the intended mode of
administration and therapeutic application. Typical preferred
compositions are in the form of injectable or infusible solutions,
such as compositions similar to those used for passive immunization
of humans. The preferred mode of administration is parenteral
(e.g., intravenous, subcutaneous, intraperitoneal, intramuscular).
In a preferred embodiment, the antibody is administered by
intravenous infusion or injection. In another preferred embodiment,
the antibody is administered by intramuscular or subcutaneous
injection.
[0208] Therapeutic compositions typically must be sterile and
stable under the conditions of manufacture and storage. The
composition can be formulated as a solution, microemulsion,
dispersion, liposome, or other ordered structure suitable to high
drug concentration. Sterile injectable solutions can be prepared by
incorporating the anti-CD40 antibody in the required amount in an
appropriate solvent with one or a combination of ingredients
enumerated above, as required, followed by filtered sterilization.
Generally, dispersions are prepared by incorporating the active
compound into a sterile vehicle that contains a basic dispersion
medium and the required other ingredients from those enumerated
above. In the case of sterile powders for the preparation of
sterile injectable solutions, the preferred methods of preparation
are vacuum drying and freeze-drying that yields a powder of the
active ingredient plus any additional desired ingredient from a
previously sterile-filtered solution thereof. The proper fluidity
of a solution can be maintained, for example, by the use of a
coating such as lecithin, by the maintenance of the required
particle size in the case of dispersion and by the use of
surfactants. Prolonged absorption of injectable compositions can be
brought about by including in the composition an agent that delays
absorption, for example, monostearate salts and gelatin.
[0209] The antibodies of the present invention can be administered
by a variety of methods known in the art, although for many
therapeutic applications, the preferred route/mode of
administration is subcutaneous, intramuscular, or intravenous
infusion. As will be appreciated by the skilled artisan, the route
and/or mode of administration will vary depending upon the desired
results.
[0210] In certain embodiments, the antibody compositions active
compound may be prepared with a carrier that will protect the
antibody against rapid release, such as a controlled release
formulation, including implants, transdermal patches, and
microencapsulated delivery systems. Biodegradable, biocompatible
polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Many methods for the preparation of such
formulations are patented or generally known to those skilled in
the art. See, e.g., Sustained and Controlled Release Drug Delivery
Systems (J. R. Robinson, ed., Marcel Dekker, Inc., New York,
1978).
[0211] In certain embodiments, an anti-CD40 antibody of the
invention can be orally administered, for example, with an inert
diluent or an assimilable edible carrier. The compound (and other
ingredients, if desired) can also be enclosed in a hard or soft
shell gelatin capsule, compressed into tablets, or incorporated
directly into the subject's diet. For oral therapeutic
administration, the anti-CD40 antibodies can be incorporated with
excipients and used in the form of ingestible tablets, buccal
tablets, troches, capsules, elixirs, suspensions, syrups, wafers,
and the like. To administer a compound of the invention by other
than parenteral administration, it may be necessary to coat the
compound with, or co-administer the compound with, a material to
prevent its inactivation.
[0212] Additional active compounds also can be incorporated into
the compositions. In certain embodiments, an anti-CD40 antibody of
the invention is co-formulated with and/or co-administered with one
or more additional therapeutic agents. These agents include,
without limitation, antibodies that bind other targets (e.g.,
antibodies that bind one or more growth factors or cytokines or
their cell surface receptors, such as anti-CTL4-antibody),
antineoplastic agents, antitumor agents, chemotherapeutic agents,
peptide analogues that activate CD40, soluble CD40L, one or more
chemical agents that activates CD40, and/or other agents known in
the art that can enhance an immune response against tumor cells,
e.g., IFN-.beta.1, IL-2, IL-8, IL-12, IL-15, IL-18, IL-23,
IFN-.gamma., and GM-CSF. Such combination therapies may require
lower dosages of the anti-CD40 antibody as well as the
co-administered agents, thus avoiding possible toxicities or
complications associated with the various monotherapies.
[0213] Agonist anti-CD40 antibodies of the invention and
compositions comprising them also may be administered in
combination with other therapeutic regimens, in particular in
combination with radiation treatment.
[0214] The compositions of the invention may include a
"therapeutically effective amount" or a "prophylactically effective
amount" of an antibody or antigen-binding portion of the invention.
A "therapeutically effective amount" refers to an amount effective,
at dosages and for periods of time necessary, to achieve the
desired therapeutic result. A therapeutically effective amount of
the antibody or antibody portion may vary according to factors such
as the disease state, age, sex, and weight of the individual, and
the ability of the antibody or antibody portion to elicit a desired
response in the individual. A therapeutically effective amount is
also one in which any toxic or detrimental effects of the antibody
or antibody portion are outweighed by the therapeutically
beneficial effects. A "prophylactically effective amount" refers to
an amount effective, at dosages and for periods of time necessary,
to achieve the desired prophylactic result. Typically, since a
prophylactic dose is used in subjects prior to or at an earlier
stage of disease, the prophylactically effective amount will be
less than the therapeutically effective amount.
[0215] Dosage regimens can be adjusted to provide the optimum
desired response (e.g., a therapeutic or prophylactic response).
For example, a single bolus can be administered, several divided
doses can be administered over time or the dose can be
proportionally reduced or increased as indicated by the exigencies
of the therapeutic situation. It is especially advantageous to
formulate parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. Dosage unit form as used
herein refers to physically discrete units suited as unitary
dosages for the mammalian subjects to be treated; each unit
containing a predetermined quantity of active compound calculated
to produce the desired therapeutic effect in association with the
required pharmaceutical carrier. The specification for the dosage
unit forms of the invention are dictated by and directly dependent
on (a) the unique characteristics of the anti-CD40 antibody or
portion and the particular therapeutic or prophylactic effect to be
achieved, and (b) the limitations inherent in the art of
compounding such an antibody for the treatment of sensitivity in
individuals.
[0216] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of an antibody or antibody
portion of the invention is 0.025 to 50 mg/kg, more preferably 0.1
to 50 mg/kg, more preferably 0.1-25, 0.1 to 10 or 0.1 to 3 mg/kg.
It is to be noted that dosage values may vary with the type and
severity of the condition to be alleviated. It is to be further
understood that for any particular subject, specific dosage
regimens should be adjusted over time according to the individual
need and the professional judgment of the person administering or
supervising the administration of the compositions, and that dosage
ranges set forth herein are exemplary only and are not intended to
limit the scope or practice of the claimed composition.
[0217] Another aspect of the present invention provides kits
comprising an anti-CD40 antibody or antibody portion of the
invention or a composition comprising such an antibody. A kit may
include, in addition to the antibody or composition, diagnostic or
therapeutic agents. A kit can also include instructions for use in
a diagnostic or therapeutic method. In a preferred embodiment, the
kit includes the antibody or a composition comprising it and a
diagnostic agent that can be used in a method described below. In
another preferred embodiment, the kit includes the antibody or a
composition comprising it and one or more therapeutic agents that
can be used in a method described below.
[0218] This invention also relates to compositions for inhibiting
abnormal cell growth in a mammal comprising an amount of an
antibody of the invention in combination with an amount of a
chemotherapeutic, wherein the amounts of the compound, salt,
solvate, or prodrug, and of the chemotherapeutic are together
effective in inhibiting abnormal cell growth. Many
chemotherapeutics are presently known in the art. In some
embodiments, the chemotherapeutic is selected from the group
consisting of mitotic inhibitors, alkylating agents,
anti-metabolites, intercalating antibiotics, growth factor
inhibitors, cell cycle inhibitors, enzymes, topoisomerase
inhibitors, biological response modifiers, anti-hormones, e.g.
anti-androgens, and anti-angiogenesis agents.
[0219] Anti-angiogenic agents, such as MMP-2
(matrix-metalloproteinase 2) inhibitors, MMP-9
(matrix-metalloproteinase 9) inhibitors, and COX-II (cyclooxygenase
II) inhibitors, can be used in conjunction with an anti-CD40
antibody of the invention. Examples of useful COX-II inhibitors
include CELEBREX.TM. (alecoxib), valdecoxib, and rofecoxib.
Examples of useful matrix metalloproteinase inhibitors are
described in WO 96/33172 (published Oct. 24, 1996), WO 96/27583
(published Mar. 7, 1996), European Patent Application No.
97304971.1 (filed Jul. 8, 1997), European Patent Application No.
99308617.2 (filed Oct. 29, 1999), WO 98/07697 (published Feb. 26,
1998), WO 98/03516 (published Jan. 29, 1998), WO 98/34918
(published Aug. 13, 1998), WO 98/34915 (published Aug. 13, 1998),
WO 98/33768 (published Aug. 6, 1998), WO 98/30566 (published Jul.
16, 1998), European Patent Publication 606,046 (published Jul. 13,
1994), European Patent Publication 931,788 (published Jul. 28,
1999), WO 90/05719 (published May 31, 1990), WO 99/52910 (published
Oct. 21, 1999), WO 99/52889 (published Oct. 21, 1999), WO 99/29667
(published Jun. 17, 1999), PCT International Application No.
PCT/IB98/01113 (filed Jul. 21, 1998), European Patent Application
No. 99302232.1 (filed Mar. 25, 1999), Great Britain patent
application number 9912961.1 (filed Jun. 3, 1999), U.S. Provisional
Application No. 60/148,464 (filed Aug. 12, 1999), U.S. Pat. No.
5,863,949 (issued Jan. 26, 1999), U.S. Pat. No. 5,861,510 (issued
Jan. 19, 1999), and European Patent Publication 780,386 (published
Jun. 25, 1997), all of which are incorporated herein in their
entireties by reference. Preferred MMP inhibitors are those that do
not demonstrate arthralgia. More preferred, are those that
selectively inhibit MMP-2 and/or MMP-9 relative to the other
matrix-metalloproteinases (i.e. MMP-1, MMP-3, MMP-4, MMP-5, MMP-6,
MMP-7, MMP-8, MMP-10, MMP-11, MMP-12, and MMP-13). Some specific
examples of MMP inhibitors useful in the present invention are
AG-3340, RO 32-3555, RS 13-0830, and the compounds recited in the
following list:
3-[[4-(4-fluoro-phenoxy)-benzenesulfonyl]-(1-hydroxycarbamoyl-cyclopentyl-
)-amino]-propionic acid;
3-exo-3-[4-(4-fluoro-phenoxy)-benzenesulfonylamino]-8-oxa-bicyclo[3.2.1]o-
ctane-3-carboxylic acid hydroxyamide; (2R,3R)
1-[4-(2-chloro-4-fluoro-benzyloxy)-benzenesulfonyl]-3-hydroxy-3-methyl-pi-
peridine-2-carboxylic acid hydroxyamide;
4-[4-(4-fluoro-phenoxy)-benzenesulfonylamino]-tetrahydro-pyran-4-carboxyl-
ic acid hydroxyamide;
3-[[4-(4-fluoro-phenoxy)-benzenesulfonyl]-(1-hydroxycarbamoyl-cyclobutyl)-
-amino]-propionic acid;
4-[4-(4-chloro-phenoxy)-benzenesulfonylamino]-tetrahydro-pyran-4-carboxyl-
ic acid hydroxyamide; (R)
3-[4-(4-chloro-phenoxy)-benzenesulfonylamino]-tetrahydro-pyran-3-carboxyl-
ic acid hydroxyamide; (2R,3R)
1-[4-(4-fluoro-2-methyl-benzyloxy)-benzenesulfonyl]-3-hydroxy-3-methyl-pi-
peridine-2-carboxylic acid hydroxyamide;
3-[[4-(4-fluoro-phenoxy)-benzenesulfonyl]-(1-hydroxycarbamoyl-1-methyl-et-
hyl)-amino]-propionic acid;
3-[[4-(4-fluoro-phenoxy)-benzenesulfonyl]-(4-hydroxycarbamoyl-tetrahydro--
pyran-4-yl)-amino]-propionic acid;
3-exo-3-[4-(4-chloro-phenoxy)-benzenesulfonylamino]-8-oxa-bicyclo[3.2.1]o-
ctane-3-carboxylic acid hydroxyamide;
3-endo-3-[4-(4-fluoro-phenoxy)-benzenesulfonylamino]-8-oxa-bicyclo[3.2.1]-
octane-3-carboxylic acid hydroxyamide; and (R)
3-[4-(4-fluoro-phenoxy)-benzenesulfonylamino]-tetrahydro-furan-3-carboxyl-
ic acid hydroxyamide; and pharmaceutically acceptable salts and
solvates of said compounds.
[0220] A compound of the invention can also be used with signal
transduction inhibitors, such as agents that can inhibit EGF-R
(epidermal growth factor receptor) responses, such as EGF-R
antibodies, EGF antibodies, and molecules that are EGF-R
inhibitors; VEGF (vascular endothelial growth factor) inhibitors,
such as VEGF receptors and molecules that can inhibit VEGF; and
erbB2 receptor inhibitors, such as organic molecules or antibodies
that bind to the erbB2 receptor, for example, HERCEPTIN.RTM.
(Genentech, Inc.). EGF-R inhibitors are described in, for example
in WO 95/19970 (published Jul. 27, 1995), WO 98/14451 (published
Apr. 9, 1998), WO 98/02434 (published Jan. 22, 1998), and U.S. Pat.
No. 5,747,498 (issued May 5, 1998), and such substances can be used
in the present invention as described herein. EGFR-inhibiting
agents include, but are not limited to, the monoclonal antibodies
C225 and anti-EGFR 22Mab (ImClone Systems Incorporated), ABX-EGF
(Abgenix/Cell Genesys), EMD-7200 (Merck KgaA), EMD-5590 (Merck
KgaA), MDX-447/H-477 (Medarex Inc. and Merck KgaA), and the
compounds ZD-1834, ZD-1838 and ZD-1839 (AstraZeneca), PKI-166
(Novartis), PKI-166/CGP-75166 (Novartis), PTK 787 (Novartis), CP
701 (Cephalon), leflunomide (Pharmacia/Sugen), CI-1033 (Warner
Lambert Parke Davis), CI-1033/PD 183,805 (Warner Lambert Parke
Davis), CL-387,785 (Wyeth-Ayerst), BBR-1611 (Boehringer Mannheim
GmbH/Roche), Naamidine A (Bristol Myers Squibb), RC-3940-II
(Pharmacia), BIBX-1382 (Boehringer Ingelheim), OLX-103 (Merck &
Co.), VRCTC-310 (Ventech Research), EGF fusion toxin (Seragen
Inc.), DAB-389 (Seragen/Lilgand), ZM-252808 (Imperial Cancer
Research Fund), RG-50864 (INSERM), LFM-A12 (Parker Hughes Cancer
Center), WHI-P97 (Parker Hughes Cancer Center), GW-282974 (Glaxo),
KT-8391 (Kyowa Hakko) and EGF-R Vaccine (York Medical/Centro de
Immunologia Molecular (CIM)). These and other EGF-R-inhibiting
agents can be used in the present invention.
[0221] VEGF inhibitors, for example SU-5416 and SU-6668 (Sugen
Inc.), SH-268 (Schering), and NX-1838 (NeXstar) can also be
combined with the compound of the present invention. VEGF
inhibitors are described in, for example in WO 99/24440 (published
May 20, 1999), PCT International Application PCT/IB99/00797 (filed
May 3, 1999), in WO 95/21613 (published Aug. 17, 1995), WO 99/61422
(published Dec. 2, 1999), U.S. Pat. No. 5,834,504 (issued Nov. 10,
1998), WO 98/50356 (published Nov. 12, 1998), U.S. Pat. No.
5,883,113 (issued Mar. 16, 1999), U.S. Pat. No. 5,886,020 (issued
Mar. 23, 1999), U.S. Pat. No. 5,792,783 (issued Aug. 11, 1998), WO
99/10349 (published Mar. 4, 1999), WO 97/32856 (published Sep. 12,
1997), WO 97/22596 (published Jun. 26, 1997), WO 98/54093
(published Dec. 3, 1998), WO 98/02438 (published Jan. 22, 1998), WO
99/16755 (published Apr. 8, 1999), and WO 98/02437 (published Jan.
22, 1998), all of which are incorporated herein in their entireties
by reference. Other examples of some specific VEGF inhibitors
useful in the present invention are IM862 (Cytran Inc.); anti-VEGF
monoclonal antibody of Genentech, Inc.; and angiozyme, a synthetic
ribozyme from Ribozyme and Chiron. These and other VEGF inhibitors
can be used in the present invention as described herein. ErbB2
receptor inhibitors, such as GW-282974 (Glaxo Wellcome plc), and
the monoclonal antibodies AR-209 (Aronex Pharmaceuticals Inc.) and
2B-1 (Chiron), can furthermore be combined with the compound of the
invention, for example those indicated in WO 98/02434 (published
Jan. 22, 1998), WO 99/35146 (published Jul. 15, 1999), WO 99/35132
(published Jul. 15, 1999), WO 98/02437 (published Jan. 22, 1998),
WO 97/13760 (published Apr. 17, 1997), WO 95/19970 (published Jul.
27, 1995), U.S. Pat. No. 5,587,458 (issued Dec. 24, 1996), and U.S.
Pat. No. 5,877,305 (issued Mar. 2, 1999), which are all hereby
incorporated herein in their entireties by reference. ErbB2
receptor inhibitors useful in the present invention are also
described in U.S. Provisional Application No. 60/117,341, filed
Jan. 27, 1999, and in U.S. Provisional Application No. 60/117,346,
filed Jan. 27, 1999, both of which are incorporated in their
entireties herein by reference. The erbB2 receptor inhibitor
compounds and substance described in the aforementioned PCT
applications, U.S. patents, and U.S. provisional applications, as
well as other compounds and substances that inhibit the erbB2
receptor, can be used with the compound of the present invention in
accordance with the present invention.
[0222] Anti-survival agents include anti-IGF-IR antibodies and
anti-integrin agents, such as anti-integrin antibodies.
Diagnostic Methods of Use
[0223] In another aspect, the invention provides diagnostic
methods. The anti-CD40 antibodies can be used to detect CD40 in a
biological sample in vitro or in vivo. In one embodiment, the
invention provides a method for diagnosing the presence or location
of an CD40-expressing tumor in a subject in need thereof,
comprising the steps of injecting the antibody into the subject,
determining the expression of CD40 in the subject by localizing
where the antibody has bound, comparing the expression in the
subject with that of a normal reference subject or standard, and
diagnosing the presence or location of the tumor.
[0224] The anti-CD40 antibodies can be used in a conventional
immunoassay, including, without limitation, an ELISA, an RIA, FACS,
tissue immunohistochemistry, Western blot or immunoprecipitation.
The anti-CD40 antibodies of the invention can be used to detect
CD40 from humans. In another embodiment, the anti-CD40 antibodies
can be used to detect CD40 from Old World primates such as
cynomolgus and rhesus monkeys, chimpanzees and apes. The invention
provides a method for detecting CD40 in a biological sample
comprising contacting a biological sample with an anti-CD40
antibody of the invention and detecting the bound antibody. In one
embodiment, the anti-CD40 antibody is directly labeled with a
detectable label. In another embodiment, the anti-CD40 antibody
(the first antibody) is unlabeled and a second antibody or other
molecule that can bind the anti-CD40 antibody is labeled. As is
well known to one of skill in the art, a second antibody is chosen
that is able to specifically bind the particular species and class
of the first antibody. For example, if the anti-CD40 antibody is a
human IgG, then the secondary antibody could be an anti-human-IgG.
Other molecules that can bind to antibodies include, without
limitation, Protein A and Protein G, both of which are available
commercially, e.g., from Pierce Chemical Co.
[0225] Suitable labels for the antibody or secondary antibody have
been disclosed supra, and include various enzymes, prosthetic
groups, fluorescent materials, luminescent materials and
radioactive materials. Examples of suitable enzymes include
horseradish peroxidase, alkaline phosphatase, .beta.-galactosidase,
or acetylcholinesterase; examples of suitable prosthetic group
complexes include streptavidin/biotin and avidin/biotin; examples
of suitable fluorescent materials include umbelliferone,
fluorescein, fluorescein isothiocyanate, rhodamine,
dichlorotriazinylamine fluorescein, dansyl chloride or
phycoerythrin; an example of a luminescent material includes
luminol; and examples of suitable radioactive material include
.sup.125I, .sup.131I, .sup.35S or .sup.3H.
[0226] In other embodiments, CD40 can be assayed in a biological
sample by a competition immunoassay utilizing CD40 standards
labeled with a detectable substance and an unlabeled anti-CD40
antibody. In this assay, the biological sample, the labeled CD40
standards and the anti-CD40 antibody are combined and the amount of
labeled CD40 standard bound to the unlabeled antibody is
determined. The amount of CD40 in the biological sample is
inversely proportional to the amount of labeled CD40 standard bound
to the anti-CD40 antibody.
[0227] One can use the immunoassays disclosed above for a number of
purposes. For example, the anti-CD40 antibodies can be used to
detect CD40 in cells in cell culture. In a preferred embodiment,
the anti-CD40 antibodies are used to determine the amount of CD40
on the surface of cells that have been treated with various
compounds. This method can be used to identify compounds that are
useful to activate or inhibit CD40. According to this method, one
sample of cells is treated with a test compound for a period of
time while another sample is left untreated. If the total level of
CD40 is to be measured, the cells are lysed and the total CD40
level is measured using one of the immunoassays described above.
The total level of CD40 in the treated versus the untreated cells
is compared to determine the effect of the test compound.
[0228] A preferred immunoassay for measuring total CD40 levels is
an ELISA or Western blot. If the cell surface level of CD40 is to
be measured, the cells are not lysed, and the cell surface levels
of CD40 are measured using one of the immunoassays described above.
A preferred immunoassay for determining cell surface levels of CD40
includes the steps of labeling the cell surface proteins with a
detectable label, such as biotin or .sup.125I, immunoprecipitating
the CD40 with an anti-CD40 antibody and then detecting the labeled
CD40. Another preferred immunoassay for determining the
localization of CD40, e.g., cell surface levels, is by using
immunohistochemistry. Methods such as ELISA, RIA, Western blot,
immunohistochemistry, cell surface labeling of integral membrane
proteins and immunoprecipitation are well known in the art. See,
e.g., Harlow and Lane, supra. In addition, the immunoassays can be
scaled up for high throughput screening in order to test a large
number of compounds for either activation or inhibition of
CD40.
[0229] The anti-CD40 antibodies of the invention can also be used
to determine the levels of CD40 in a tissue or in cells derived
from the tissue. In some embodiments, the tissue is a diseased
tissue. In some embodiments, the tissue is a tumor or a biopsy
thereof. In some embodiments of the method, a tissue or a biopsy
thereof is excised from a patient. The tissue or biopsy is then
used in an immunoassay to determine, e.g., total CD40 levels, cell
surface levels of CD40 or localization of CD40 by the methods
discussed above.
[0230] The above-described diagnostic method can be used to
determine whether a tumor expresses high levels of CD40, which
could be indicative that the tumor is a target for treatment with
anti-CD40 antibody. Further, the same method can also be used to
monitor the effect of the treatment with anti-CD40 antibody by
detecting cell death in the tumor. The diagnostic method can also
be used to determine whether a tissue or cell expresses
insufficient levels of CD40 or activated CD40, and thus is a
candidate for treatment with activating anti-CD40 antibodies, CD40L
and/or other therapeutic agents for increasing CD40 levels or
activity.
[0231] The antibodies of the present invention can also be used in
vivo to identify tissues and organs that express CD40. In some
embodiments, the anti-CD40 antibodies are used to identify
CD40-expressing tumors. One advantage of using the human anti-CD40
antibodies of the present invention is that they may safely be used
in vivo without eliciting an immune response to the antibody upon
administration, unlike antibodies of non-human origin or with
humanized antibodies.
[0232] The method comprises the steps of administering a detectably
labeled an anti-CD40 antibody or a composition comprising them to a
patient in need of such a diagnostic test and subjecting the
patient to imaging analysis to determine the location of the
CD40-expressing tissues. Imaging analysis is well known in the
medical art, and includes, without limitation, x-ray analysis,
magnetic resonance imaging (MRI) or computed tomography (CE). The
antibody can be labeled with any agent suitable for in vivo
imaging, for example a contrast agent, such as barium, which can be
used for x-ray analysis, or a magnetic contrast agent, such as a
gadolinium chelate, which can be used for MRI or CE. Other labeling
agents include, without limitation, radioisotopes, such as
.sup.99Tc. In another embodiment, the anti-CD40 antibody will be
unlabeled and will be imaged by administering a second antibody or
other molecule that is detectable and that can bind the anti-CD40
antibody. In embodiment, a biopsy is obtained from the patient to
determine whether the tissue of interest expresses CD40.
Therapeutic Methods of Use
[0233] In another aspect, invention provides therapeutic methods of
using an anti-CD40 antibody of the invention.
[0234] A human agonist anti-CD40 antibody of the invention can be
administered to a human or to a non-human mammal that expresses a
cross-reacting CD40. The antibody can be administered to such a
non-human mammal (i.e., a primate, cynomolgus or rhesus monkey) for
veterinary purposes or as an animal model of human disease. Such
animal models are useful for evaluating the therapeutic efficacy of
antibodies of this invention.
[0235] In some embodiments, the anti-CD40 antibody is administered
to a subject who suffers from primary and/or combined
immunodeficiencies, including CD40-dependent immunodeficiency with
Hyper-IgM syndrome, Common Variable Immunodeficiency, Bruton's
Agammaglobulinemia, IgG subclass deficiencies, and X-linked SCID
(common gamma chain mutations). In some embodiments, the anti-CD40
antibody is administered to treat a subject who is
immunosuppressed, for example due to chemotherapy, or has an
immune-debilitating disease, including any acquired immune
deficiency disease, such as HIV. In some embodiments, the anti-CD40
antibody is administered to enhance the immunity of an elderly
subject. In some embodiments, the anti-CD40 antibody is
administered to treat a subject who has a bacterial, viral, fungal
or parasitic infection. In some embodiments, a human agonist
anti-CD40 antibody of the invention may be administered
prophylactically to a subject who, because of age, illness or
general poor health is susceptible to infection to prevent or to
reduce the number or severity of infections.
[0236] In some embodiments, the anti-CD40 antibody is administered
to a subject who has a hyperproliferative disorder.
[0237] In some embodiments, the anti-CD40 antibody is administered
to treat a subject who has a tumor. In some embodiments, the tumor
is CD40 positive. In some embodiments, the tumor is a CD40
negative. The tumor can be a solid tumor or a non-solid tumor such
as lymphoma. In some embodiments, an anti-CD40 antibody is
administered to a patient who has a tumor that is cancerous. In
some embodiments, the antibody inhibits cancer cell proliferation,
inhibits or prevents an increase in tumor weight or volume, and/or
causes a decrease in tumor weight or volume.
[0238] Patients that can be treated with anti-CD40 antibodies or
antibody portions of the invention include, but are not limited to,
patients that have been diagnosed as having brain cancer, lung
cancer, bone cancer, pancreatic cancer, skin cancer, cancer of the
head and neck, cutaneous or intraocular melanoma, uterine cancer,
ovarian cancer, rectal cancer, cancer of the anal region, stomach
cancer, gastric cancer, colorectal cancer, colon cancer, breast
cancer, gynecologic tumors (e.g., uterine sarcomas, carcinoma of
the fallopian tubes, carcinoma of the endometrium, carcinoma of the
cervix, carcinoma of the vagina or carcinoma of the vulva), cancer
of the esophagus, cancer of the small intestine, cancer of the
endocrine system (e.g., cancer of the thyroid, parathyroid or
adrenal glands), sarcomas of soft tissues, leukemia, myeloma,
multiple myeloma, cancer of the urethra, cancer of the penis,
prostate cancer, chronic or acute leukemia, solid tumors of
childhood, Hodgkin's disease, lymphocytic lymphomas, non-Hodgkin
lymphoma, cancer of the bladder, liver cancer, renal cancer, cancer
of the kidney or ureter (e.g., renal cell carcinoma, carcinoma of
the renal pelvis), or neoplasms of the central nervous system
(e.g., primary CNS lymphoma, spinal axis tumors, brain stem gliomas
or pituitary adenomas), glioma or fibrosarcoma.
[0239] The antibody may be administered from three times daily to
once every six months, and preferably may be administered via an
oral, mucosal, buccal, intranasal, inhalable, intravenous,
subcutaneous, intramuscular, parenteral, intratumor, transdermal or
topical route. The antibody can also be administered continuously
via a minipump. The antibody generally will be administered for as
long as the tumor is present provided that the antibody causes the
tumor or cancer to stop growing or to decrease in weight or volume.
The dosage of antibody generally will be in the range of 0.025 to
50 mg/kg, more preferably 0.1 to 50 mg/kg, more preferably 0.1-20
mg/kg, 0.1-10 mg/kg, 0.1-5 mg/kg or even more preferable 0.1-2
mg/kg. The antibody can also be administered prophylactically.
[0240] In some embodiments, the anti-CD40 antibody is administered
as part of a therapeutic regimen that includes one or more
additional antineoplastic drugs or molecules to a patient who has a
hyperproliferative disorder, such as cancer or a tumor. Exemplary
antitumor agents include, but are not limited to, mitotic
inhibitors, alkylating agents, anti-metabolites, intercalating
agents, growth factor inhibitors, cell cycle inhibitors, enzymes,
topoisomerase inhibitors, biological response modifiers,
anti-hormones, kinase inhibitors, matrix metalloprotease
inhibitors, genetic therapeutics and anti-androgens. In more
preferred embodiments, the anti-CD40 antibody is administered with
an antineoplastic agent, such as adriamycin or taxol. In some
preferred embodiments, the anti-CD40 therapy is performed along
with radiotherapy, chemotherapy, photodynamic therapy, surgery or
other immunotherapy. In some embodiments, the anti-CD40 antibody is
administered with one or more additional antibodies. For example,
the anti-CD40 antibody can be administered with antibodies that are
known to inhibit tumor or cancer cell proliferation. Such
antibodies include, but are not limited to, an antibody that
inhibits CTLA4, erbB2 receptor, EGF-R, IGF-1R, CD20 or VEGF.
[0241] In some embodiments, the anti-CD40 antibody is labeled with
a radiolabel, an immunotoxin or a toxin, or is a fusion protein
comprising a toxic peptide. The anti-CD40 antibody or anti-CD40
antibody fusion protein directs the radiolabel, immunotoxin, toxin
or toxic peptide to the tumor or cancer cell. In a preferred
embodiment, the radiolabel, immunotoxin, toxin or toxic peptide is
internalized by the tumor or cancer cell after the anti-CD40
antibody binds to the CD40 on the surface of the cell.
[0242] In another aspect, the anti-CD40 antibody can be used
therapeutically to induce apoptosis of specific cells in a patient.
In many cases, the cells targeted for apoptosis are cancerous or
tumor cells. Thus, the invention provides a method of inducing
apoptosis by administering an anti-CD40 antibody to a patient in
need thereof.
[0243] In another aspect, the invention provides a method of
administering an activating anti-CD40 antibody to a patient to
increase CD40 activity. An anti-CD40 antibody is administered with
one or more other factors that increase CD40 activity. Such factors
include CD40L, and/or analogues of CD40L that activate CD40.
[0244] In some embodiments, the anti-CD40 antibody is administered
with one or more additional immune enhancing agents, including,
without limitation IFN-.beta.1, IL-2, IL-8, IL-12, IL-15, IL-18,
IL-23, IFN-.gamma., and GM-CSF.
[0245] In some embodiments, a human agonist anti-CD40 antibody of
the invention is used as an adjuvant to enhance the efficacy of a
vaccine. When used in this way, the anti-CD-40 antibody activates
CD40 on antigen presenting cells, including B cells, dendritic
cells and monocytes as well as enhancing the production of
immunomodulatory molecules, such as cytokines and chemokines. The
immunostimulatory effect of the antibody enhances the immune
response of the vaccinated subject to the vaccine antigen.
[0246] In another aspect, the invention provides a method for
generating a dendritic cell vaccine for cancer or for dendritic
cell immunotherapy. According to the method dendritic cells from a
cancer patient are cultured for 1-5 days with tumor lysate or
homogenate, tumor cells killed by irradiation or other means, or
tumor specific antigens (e.g., peptides, idiotypes) and 1-10
.mu.g/ml of an anti-CD40 antibody. The tumor antigen-pulsed
dendritic cells are re-injected into the patient to stimulate
anti-tumor immune responses, particularly anti-tumor CTL responses.
Monocyte-derived dendritic cells for use in the method can be
obtained from a peripheral blood sample by culture in IL-4 and
GM-CSF. Dendritic cells also can be derived from the bone marrow of
a patient by magnetic purification or sorting of CD34 positive
cells, followed by culture in IL-4 and GM-CSF.
Gene Therapy
[0247] The nucleic acid molecules of the instant invention can be
administered to a patient in need thereof via gene therapy. The
therapy may be either in vivo or ex vivo. In a preferred
embodiment, nucleic acid molecules encoding both a heavy chain and
a light chain are administered to a patient. In a more preferred
embodiment, the nucleic acid molecules are administered such that
they are stably integrated into chromosomes of B cells because
these cells are specialized for producing antibodies. In a
preferred embodiment, precursor B cells are transfected or infected
ex vivo and re-transplanted into a patient in need thereof. In
another embodiment, precursor B cells or other cells are infected
in vivo using a virus known to infect the cell type of interest.
Typical vectors used for gene therapy include liposomes, plasmids
and viral vectors. Exemplary viral vectors are retroviruses,
adenoviruses and adeno-associated viruses. After infection either
in vivo or ex vivo, levels of antibody expression can be monitored
by taking a sample from the treated patient and using any
immunoassay known in the art or discussed herein.
[0248] In a preferred embodiment, the gene therapy method comprises
the steps of administering an isolated nucleic acid molecule
encoding the heavy chain or an antigen-binding portion thereof of
an anti-CD40 antibody and expressing the nucleic acid molecule. In
another embodiment, the gene therapy method comprises the steps of
administering an isolated nucleic acid molecule encoding the light
chain or an antigen-binding portion thereof of an anti-CD40
antibody and expressing the nucleic acid molecule. In a more
preferred method, the gene therapy method comprises the steps of
administering of an isolated nucleic acid molecule encoding the
heavy chain or an antigen-binding portion thereof and an isolated
nucleic acid molecule encoding the light chain or the
antigen-binding portion thereof of an anti-CD40 antibody of the
invention and expressing the nucleic acid molecules. The gene
therapy method may also comprise the step of administering another
anti-cancer agent, such as taxol or adriamycin.
[0249] In order that this invention may be better understood, the
following examples are set forth. These examples are for purposes
of illustration only and are not to be construed as limiting the
scope of the invention in any manner.
Example I
Generation of Hybridomas Producing Anti-CD40 Antibody
[0250] Antibodies of the invention were prepared, selected, and
assayed as follows:
Immunization and Hybridoma Generation
[0251] We immunized eight to ten week old XenoMice.TM.
intraperitoneally or in their hind footpads with either a CD40-IgG
fusion protein (10 .mu.g/dose/mouse) or with 300.19-CD40 cells
which is a transfected cell line that express human CD40 on its
plasma membrane (10.times.10.sup.6 cells/dose/mouse). We repeated
this dose five to seven times over a three to eight week period.
Four days before fusion, we gave the mice a final injection of the
extracellular domain of human CD40 in PBS. We fused the spleen and
lymph node lymphocytes from immunized mice with the non-secretory
myeloma P3-X63-Ag8.653 cell line, and subjected the fused cells to
HAT selection as previously described (Galfre and Milstein, Methods
Enzymol. 73:3-46, 1981). We recovered a panel of hybridomas all
secreting CD40 specific human IgG2.kappa. antibodies. We selected
eleven hybridomas for further study and designated them 3.1.1,
7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.25.1,
23.29.1 and 24.2.1.
[0252] We deposited hybridomas 3.1.1, 7.1.2, 10.8.3, 15.1.1 and
21.4.1 in the American Type Culture Collection (ATCC) in accordance
with the Budapest Treaty, 10801 University Boulevard, Manassas, Va.
20110-2209, on Aug. 6, 2001. We deposited hybridomas 21.2.1,
22.1.1, 23.5.1, 23.25.1, 23.28.1, 23.29.1 and 24.2.1 in the ATCC on
Jul. 16, 2002. The hybridomas have been assigned the following
deposit numbers:
TABLE-US-00002 Hybridoma Deposit No. 3.1.1 (LN 15848) PTA-3600
7.1.2 (LN 15849) PTA-3601 10.8.3 (LN 15850) PTA-3602 15.1.1 (LN
15851) PTA-3603 21.4.1 (LN 15853) PTA-3605 21.2.1 (LN 15874)
PTA-4549 22.1.1 (LN 15875) PTA-4550 23.5.1 (LN 15855) PTA-4548
23.25.1 (LN 15876) PTA-4551 23.28.1 (LN 15877) PTA-4552 23.29.1 (LN
15878) PTA-4553 24.2.1 (LN 15879) PTA-4554
Example II
Sequences of Anti-CD40-Antibodies Prepared in Accordance with the
Invention
[0253] To analyze the structure of antibodies produced in
accordance with the invention, we cloned nucleic acids encoding
heavy and light chain fragments from hybridomas producing anti-CD40
monoclonal antibodies. Cloning and sequencing was accomplished as
follows.
[0254] We isolated Poly(A).sup.+ mRNA from approximately
2.times.10.sup.5 hybridoma cells derived from XenoMouse.TM. mice
immunized with human CD40 as described in Example I using a
Fast-Track kit (Invitrogen). We followed by PCR the generation of
random primed cDNA. We used human V.sub.H or human V.kappa. family
specific variable region primers (Marks et al., "Oligonucleotide
primers for polymerase chain reaction amplification of human
immunoglobulin variable genes and design of family-specific
oligonucleotide probes." Eur. J. Immunol. 21:985-991 (1991)) or a
universal human V.sub.H primer, MG-30, CAGGTGCAGCTGGAGCAGTCIGG (SEQ
ID NO: 118), in conjunction with primers specific for the human Cj2
constant region, MG-40d, 5'-GCTGAGGGAGTAGAGTCCTGAGGA-3' (SEQ ID NO:
119) or C.kappa..quadrature. constant region (h.kappa.P2; as
previously described in Green et al., 1994). We obtained nucleic
acid molecules encoding human heavy and kappa light chain
transcripts from the anti-CD40 producing hybridomas by direct
sequencing of PCR products generated from poly(A.sup.+) RNA using
the primers described above. We also cloned PCR products into pCRII
using a TA cloning kit (Invitrogen) and sequenced both strands
using Prism dye-terminator sequencing kits and an ABI 377
sequencing machine. We analyzed all sequences by alignments to the
"V BASE sequence directory" (Tomlinson et al., MRC Centre for
Protein Engineering, Cambridge, UK) using MacVector and Geneworks
software programs.
[0255] Further, we subjected monoclonal antibodies 3.1.1, 7.1.2,
10.8.3, 15.1.1, 21.4.1, 21.2.1, 22.1.1, 23.5.1, 23.28.1, 23.29.1
and 24.2.1 to full length DNA cloning and sequencing. For such
sequencing, we isolated RNA from approximately 4.times.10.sup.6
hybridoma cells using QIAGEN RNeasy.RTM. RNA isolation kit
(QIAGEN). We reverse transcribed the mRNA using oligo-dT(18) (SEQ
ID NO: 144) and the Advantage.RTM. RT/PCR kit (Clontech). We used V
Base to design forward amplification primers that included
restriction sites, optimal Kozak sequence, the ATG start site and
part of the signal sequence of the heavy chain. Table 1 lists the
forward amplification primers used to sequence the antibody
clones.
TABLE-US-00003 TABLE 1 Clone Forward Primer Heavy Chain 3.1.1
5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGAGTTT GGGCTGAGCTG-3'(SEQ ID NO:
120) 7.1.2 5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGAGTTT
GGGCTGAGCTG-3'(SEQ ID NO: 121) 10.8.3
5'-TATCTAAGCTTCTAGACTCGAGCGCCACCATGAAACAC CTGTGGTTCTTCC-3'(SEQ ID
NO: 122) 15.1.1 5'-TATCTAAGCTTCTAGACTCGAGCGCCACCATGAAACAT
CTGTGGTTCTTCC 3'(SEQ ID NO: 123) 21.4.1
5'-TATCTAAGCTTCTAGACTCGAGCGCCACCATGGACTGG ACCTGGAGGATCC-3'(SEQ ID
NO: 124) 21.2.1 5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGA
GTTTGGGCTGAGCTG-3' (SEQ ID NO: 128) 22.1.1
5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGAG TTTGGGCTGAGCTG-3' (SEQ ID
NO: 129) 23.5.1 5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGAG
TTTGGGCTGAGCTG-3'(SEQ ID NO: 130) 23.28.1
5'-TATCTAAGCTTCTAGACTCGAGCGCCACCATGAAA CATCTGTGGTTCTTCC-3'(SEQ ID
NO: 131) 23.29.1 5'-TATCTAAGCTTCTAGACTCGACCGCCACCATGGAG
TTTGGGCTGAGCTG-3'(SEQ ID NO: 132) 24.2.1
5'-TATCTAAGCTTCTAGACTCGAGCGCCACCATGAA ACATCTGTGGTTCTTCC-3'(SEQ ID
NO: 133)
We used the same method to design a primer to include the 3' coding
sequences, the stop codon of the IgG2 constant region,
(5'-TTCTCTGATCAGAATTCC TATCATTTACCCGGAGACAGGGAGAG-3') (SEQ ID
NO:125) and restriction sites.
[0256] We also used the same method to design a primer around the
ATG start site of the kappa chain:
(5'-CTTCAAGCTTACCCGGGCCACCATGAGGCTCC CTGCTCAGC-3') (SEQ ID NO:126).
An optimal Kozak sequence (CCGCCACC) was added 5' to the ATG start
site. This primer was used to PCR clone the light chains of
following antibody clones: 3.1.1, 7.1.2, 10.8.3, 15.1.1, 21.4.1,
21.2.1, 22.1.1, 23.5.1 and 23.29.1. We used a second forward primer
5'-TCTTC AAGCTTGCCCGGGCCCGCCACCATGGAAACCCCAGCGCAG-3' (SEQ ID NO.
134) to clone the light chains of clones 23.28.1 and 24.2.1. We
also used the same method to design a primer around the stop codon
of the kappa constant region
(5'-TTCTTTGATCAGAATTCTCACTAACACTCTCCCCTGTTGAAGC-3')(SEQ ID NO:127).
We used the primer pairs to amplify the cDNAs using Advantage.RTM.
High Fidelity PCR Kit (Clontech). We obtained the sequence of the
PCR product by direct sequencing using standard techniques (e.g.,
primer walking) using dye-terminator sequencing kits and an ABI
sequencing machine. We cloned the PCR product into a mammalian
expression vector and we sequenced clones to confirm somatic
mutations. For each clone, we verified the sequence on both strands
in at least three reactions.
Gene Utilization Analysis
[0257] Table 2 sets forth the gene utilization evidenced by
selected hybridoma clones of antibodies in accordance with the
invention:
TABLE-US-00004 TABLE 2 Heavy and Light Chain Gene Utilization Kappa
Heavy Chain Light Chain Clone VH D JH VK JK 3.1.1 (3-30+) D4+ JH6
A3/A19 JK1 DP-49 DIR3 (DPK-15) 7.1.2 (3-30+) DIR5+ JH6 A3/A19 JK1
DP-49 D1-26 (DPK-15) 10.8.3 (4.35) DIR3 JH6 L5 JK4 VIV-4 (DP5)
15.1.1 (4-59) D4-23 JH4 A3/A19 JK2 DP-71 (DPK-15) 21.4.1 (1-02)
DLR1 JH4 L5 JK4 DP-75 (DP5) 21.2.1 (3-30+) DIR3+ JH4 A3/A19 JK3
DP-49 D6-19 (DPK-15) 22.1.1 (3-30+) D1-1 JH6 A3/A19 JK1 DP-49
(DPK-15) 23.5.1 (3-30+) D4-17 JH6 A3/A19 JK1 DP-49 (DPK-15) 23.28.1
(4-59) DIR1+ JH5 A27 JK3 DP-71 D4-17 (DPK-22) 23.29.1 (3-30.3)
D4-17 JH6 A3/A19 JK1 DP-46 (DPK-15) 24.2.1 (4-59) DIR1+ JH5 A27 JK3
DP-71 D4-17 (DPK-22)
Sequence and Mutation Analysis
[0258] As will be appreciated, gene utilization analysis provides
only a limited overview of antibody structure. As the B-cells in
XenoMouse.TM. animals stochastically generate V-D-J heavy or V-J
kappa light chain transcripts, there are a number of secondary
processes that occur, including, without limitation, somatic
hypermutation, deletions, N-additions, and CDR3 extensions. See,
for example, Mendez et al., Nature Genetics 15:146-156 (1997) and
International Patent Publication WO 98/24893. Accordingly, to
further examine antibody structure, we generated predicted amino
acid sequences of the antibodies from the cDNAs obtained from the
clones. Table A provides the sequence identifiers for each of the
nucleotide and predicted amino acid sequences of the sequenced
antibodies.
[0259] Tables 3-7 provide the nucleotide and predicted amino acid
sequences of the heavy and kappa light chains of antibodies 3.1.1
(Table 3), 7.1.2 (Table 4), 10.8.3 (Table 5), 15.1.1 (Table 6) and
21.4.1 (Table 7).
[0260] Tables 8-13 provide the nucleotide and predicted amino acid
sequences of the variable domain of the heavy chain and kappa light
chain of antibodies 21.2.1 (Table 8), 22.1.1 (Table 9), 23.5.1
(Table 10), 23.28.1 (Table 11), 23.29.1 (Table 12) and 24.2.1
(Table 13).
[0261] The DNA sequence from the full-length sequencing of
monoclonal antibody 23.28.1 differs from DNA sequences obtained
from sequencing the V.sub.H region of the initial PCR product by
one base pair (C to G), resulting in a change of residue 16 of the
natural heavy chain from D to E.
[0262] Tables 14-19 provide the nucleotide and predicted amino acid
sequences of the heavy and kappa light chains of antibodies 21.2.1
(Table 14), 22.1.1 (Table 15), 23.5.1 (Table 16), 23.28.1 (Table
17), 23.29.1 (Table 18) and 24.2.1 (Table 19). In the Tables, the
signal peptide sequence (or the bases encoding the same) are
underlined.
[0263] We generated two mutated antibodies, 22.1.1 and 23.28.1. The
heavy chain of antibody 22.1.1 was mutated to change a cysteine
residue at position 109 to an alanine residue. We designated the
mutated clone 22.1.1H-0019A. The light chain of antibody 23.28.1 at
position 92 was mutated also to change a cysteine residue to an
alanine residue. We designated the mutated clone 23.28.1L-C92A.
[0264] Mutagenesis of specific residues was carried out by
designing primers and using the Quikchange.RTM. Site-Directed
Mutagenesis Kit from Stratagene, according to the manufacturer's
instructions. Mutations were confirmed by automated sequencing, and
mutagenized inserts were subcloned into expression vectors.
[0265] Table 20 provides the nucleotide and amino acid sequences of
the mutated heavy chain of antibody 22.1.1H-C109A. Table 21
provides the nucleotide and amino acid sequences of the mutated
light chain of antibody 23.28.1. The mutated DNA codons are shown
in italics. The mutated amino acid residue is in bold.
TABLE-US-00005 TABLE 3 DNA and protein sequences of antibody 3.1.1
DESCRIPTION: SEQUENCE (signal sequence underlined): Heavy Chain
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA Sequence
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAGCTG (SEQ ID NO: 5)
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG
AGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGAT
TCACCTTCAGTAGTTATGGCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGC
AGTTATATCAAAGGATGGAGGTAATAAATACCAT
GCAGACTCCGTGAAGGGCCGATTCACCATCTCCA
GAGACAATTCCAAGAATGCGCTGTATCTGCAAAT
GAATAGCCTGAGAGTTGAAGACACGGCTGTGTAT
TACTGTGTGAGAAGAGGGCATCAGCTGGTTCTGG
GATACTACTACTACAACGGTCTGGACGTCTGGGG
CCAAGGGACCACGGTCACCGTCTCCTCAGCCTCC
ACCAAGGGCCCATCGGTCTTCCCCCTGGCGCCCT
GCTCCAGGAGCACCTCCGAGAGCACAGCGGCCCT
GGGCTGCCTGGTCAAGGACTACTTCCCCGAACCG
GTGACGGTGTCGTGGAACTCAGGCGCTCTGACCA
GCGGCGTGCACACCTTCCCAGCTGTCCTACAGTC
CTCAGGACTCTACTCCCTCAGCAGCGTGGTGACC
GTGCCCTCCAGCAACTTCGGCACCCAGACCTACA
CCTGCAACGTAGATCACAAGCCCAGCAACACCAA
GGTGGACAAGACAGTTGAGCGCAAATGTTGTGTC
GAGTGCCCACCGTGCCCAGCACCACCTGTGGCAG
GACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAA
GGACACCCTCATGATCTCCCGGACCCCTGAGGTC
ACGTGCGTGGTGGTGGACGTGAGCCACGAAGAC
CCCGAGGTCCAGTTCAACTGGTACGTGGACGGCG
TGGAGGTGCATAATGCCAAGACAAAGCCACGGG
AGGAGCAGTTCAACAGCACGTTCCGTGTGGTCAG
CGTCCTCACCGTTGTGCACCAGGACTGGCTGAAC
GGCAAGGAGTACAAGTGCAAGGTCTCCAACAAA
GGCCTCCCAGCCCCCATCGAGAAAACCATCTCCA
AAACCAAAGGGCAGCCCCGAGAACCACAGGTGT
ACACCCTGCCCCCATCCCGGGAGGAGATGACCAA
GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGC
TTCTACCCCAGCGACATCGCCGTGGAGTGGGAGA
GCAATGGGCAGCCGGAGAACAACTACAAGACCA
CACCTCCCATGCTGGACTCCGACGGCTCCTTCTTC
CTCTACAGCAAGCTCACCGTGGACAAGAGCAGGT
GGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT
GCATGAGGCTCTGCACAACCACTACACGCAGAAG AGCCTCTCCCTGTCTCCGGGTAAATGA
Heavy Chain MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein Sequence
RSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVA (SEQ ID NO: 6)
VISKDGGNKYHADSVKGRFTISRDNSKNALYLQMN
SLRVEDTAVYYCVRRGHQLVLGYYYYNGLDVWG
QGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTV
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRT
PEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK Light Chain
DNA ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA Sequence
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO: 7)
GCTGACTCAGTCTCCACTCTCCCTGCCCGTCACCC
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCTTGTATAGTAATGGATACAACTTTT
TGGATTGGTACCTGCAGAAGCCAGGGCAGTCTCC
ACAGCTCCTGATCTATTTGGGTTCTAATCGGGCCT
CCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATC
AGGCACAGATTTTACACTGAAAATCAGCAGATTG
GAGGCTGAGGATGTTGGGGTTTATTACTGCATGC
AAGCTCTACAAACTCCTCGGACGTTCGGCCAAGG
GACCAAGGTGGAAATCAAACGAACTGTGGCTGC
ACCATCTGTCTTCATCTTCCCGCCATCTGATGAGC
AGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTA
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCCTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVLTQSPLSLPVTPG Protein Sequence
EPASISCRSSQSLLYSNGYNFLDWYLQKPGQSPQLLI (SEQ ID NO: 8)
YLGSNRASGVPDRFSGSGSGTDFTLKISRLEAEDVG
VYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHK VYACEVTHQGLSSPVTKSFNRGEC
Mature Variable CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG Domain of Heavy
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG Chain DNA
CAGCCTCTGGATTCACCTTCAGTAGTTATGGCAT Sequence
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG (SEQ ID NO: 1)
GAGTGGGTGGCAGTTATATCAAAGGATGGAGGT
AATAAATACCATGCAGACTCCGTGAAGGGCCGAT
TCACCATCTCCAGAGACAATTCCAAGAATGCGCT
GTATCTGCAAATGAATAGCCTGAGAGTTGAAGAC
ACGGCTGTGTATTACTGTGTGAGAAGAGGGCATC
AGCTGGTTCTGGGATACTACTACTACAACGGTCT
GGACGTCTGGGGCCAAGGGACCACGGTCACCGTC TCCTCA Mature Variable
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMH Domain of Heavy
WVRQAPGKGLEWVAVISKDGGNKYHADSVKGRFT Chain Protein
ISRDNSKNALYLQMNSLRVEDTAVYYCVRRGHQL Sequence VLGYYYYNGLDVWGQGTTVTVSS
(SEQ ID NO: 2) Mature Variable GATATTGTGCTGACTCAGTCTCCACTCTCCCTGCC
Domain of Light CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC Chain DNA
AGGTCTAGTCAGAGCCTCTTGTATAGTAATGGAT Sequence
ACAACTTTTTGGATTGGTACCTGCAGAAGCCAGG (SEQ ID NO: 3)
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGATTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAA
Mature Variable DIVLTQSPLSLPVTPGEPASISCRSSQSLLYSNGYNFL Domain of
Light DWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGT Chain Protein
DFTLKISRLEAEDVGVYYCMQALQTPRTFGQGTKV Sequence EIK (SEQ ID NO: 4)
Heavy chain CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA (variable
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG domain)
CAGCCTCTGGATTCACCTTCAGTAGTTATGGCAT (3.1.1H-A78T)
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG SEQ ID NO: 89
GAGTGGGTGGCAGTTATATCAAAGGATGGAGGT
AATAAATACCATGCAGACTCCGTGAAGGGCCGAT
TCACCATCTCCAGAGACAATTCCAAGAATaCGCT
GTATCTGCAAATGAATAGCCTGAGAGTTGAAGAC
ACGGCTGTGTATTACTGTGTGAGAAGAGGGCATC
AGCTGGTTCTGGGATACTACTACTACAACGGTCT
GGACGTCTGGGGCCAAGGGACCACGGTCACCGTC TCCTCA Heavy chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMH protein (variable
WVRQAPGKGLEWVAVISKDGGNKYHADSVKGRFT domain)
ISRDNSKNTLYLQMNSLRVEDTAVYYCVRRGHQLV (3.1.1H-A78T)
LGYYYYNGLDVWGQGTTVTVSS SEQ ID NO: 90 Heavy chain
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA (variable
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG domain)
CAGCCTCTGGATTCACCTTCAGTAGTTATGGCAT (3.1.1H-A78T-
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG V88A-V97A)
GAGTGGGTGGCAGTTATATCAAAGGATGGAGGT SEQ ID NO: 91
AATAAATACCATGCAGACTCCGTGAAGGGCCGAT
TCACCATCTCCAGAGACAATTCCAAGAATaCGCT
GTATCTGCAAATGAATAGCCTGAGAGcTGAAGAC
ACGGCTGTGTATTACTGTGcGAGAAGAGGGCATC
AGCTGGTTCTGGGATACTACTACTACAACGGTCT
GGACGTCTGGGGCCAAGGGACCACGGTCACCGTC TCCTCA Heavy chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMH protein (variable
WVRQAPGKGLEWVAVISKDGGNKYHADSVKGRFT domain)
ISRDNSKNTLYLQMNSLRAEDTAVYYCARRGHQLV (3.1.1H-A78T-
LGYYYYNGLDVWGQGTTVTVSS V88A-V97A) SEQ ID NO: 92 Light chain DNA
GATATTGTGaTGACTCAGTCTCCACTCTCCCTGCC (variable domain)
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC (3.1.1L-L4M-
AGGTCTAGTCAGAGCCTCTTGTATAGTAATGGAT L83V)
ACAACTTTTTGGATTGGTACCTGCAGAAGCCAGG SEQ ID NO: 93
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGAgTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAA
Light chain DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSNGYNF protein (variable
LDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG domain)
TDFTLKISRVEAEDVGVYYCMQALQTPRTFGQGTK (3.1.1 L-L4M- VEIK L83V) SEQ ID
NO: 94
TABLE-US-00006 TABLE 4 DNA and protein sequences of antibody 7.1.2
DESCRIPTION: SEQUENCE (signal sequence underlined): Heavy Chain
ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA Sequence
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAGCTG (SEQ ID NO: 13)
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG
AGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGAT
TCACCTTCAGTAGCTATGGCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGC
AGTTATATCAAATGATGGAGATAATAAATACCAT
GCAGACTCCGTGTGGGGCCGATTCACCATCTCCA
GAGACAATTCCAGGAGCACGCTTTATCTGCAAAT
GAACAGCCTGAGAGCTGAGGACACGGCTGTATAT
TACTGTGCGAGAAGAGGCATGGGGTCTAGTGGG
AGCCGTGGGGATTACTACTACTACTACGGTTTGG
ACGTCTGGGGCCAAGGGACCACGGTCACCGTCTC
CTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCC
CTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGCA
CAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTT
CCCCGAACCGGTGACGGTGTCGTGGAACTCAGGC
GCTCTGACCAGCGGCGTGCACACCTTCCCAGCTG
TCCTACAGTCCTCAGGACTCTACTCCCTCAGCAG
CGTGGTGACCGTGCCCTCCAGCAACTTCGGCACC
CAGACCTACACCTGCAACGTAGATCACAAGCCCA
GCAACACCAAGGTGGACAAGACAGTTGAGCGCA
AATGTTGTGTCGAGTGCCCACCGTGCCCAGCACC
ACCTGTGGCAGGACCGTCAGTCTTCCTCTTCCCCC
CAAAACCCAAGGACACCCTCATGATCTCCCGGAC
CCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGC
CACGAAGACCCCGAGGTCCAGTTCAACTGGTACG
TGGACGGCGTGGAGGTGCATAATGCCAAGACAA AGCCACGGGAGGAGCAGTTCAACAGCACGTTCC
GTGTGGTCAGCGTCCTCACCGTTGTGCACCAGGA
CTGGCTGAACGGCAAGGAGTACAAGTGCAAGGT
CTCCAACAAAGGCCTCCCAGCCCCCATCGAGAAA
ACCATCTCCAAAACCAAAGGGCAGCCCCGAGAA
CCACAGGTGTACACCCTGCCCCCATCCCGGGAGG
AGATGACCAAGAACCAGGTCAGCCTGACCTGCCT
GGTCAAAGGCTTCTACCCCAGCGACATCGCCGTG
GAGTGGGAGAGCAATGGGCAGCCGGAGAACAAC
TACAAGACCACACCTCCCATGCTGGACTCCGACG
GCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGAC
AAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCAT
GCTCCGTGATGCATGAGGCTCTGCACAACCACTA
CACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA TGA Heavy Chain
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein Sequence
RSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVA (SEQ ID NO: 14)
VISNDGDNKYHADSVWGRFTISRDNSRSTLYLQMN
SLRAEDTAVYYCARRGMGSSGSRGDYYYYYGLDV
WGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAAL
GCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVD
KTVERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLM
ISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNSTFRVVSVLTVVHQDWLNGKEYKC
KVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEM
TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKT
TPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSLSLSPGK Light Chain
DNA ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA Sequence
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO: 15)
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCTTGTATAGTAATGGATACAACTTTT
TGGATTGGTACCTGCAGAAGCCAGGGCAGTCTCC
ACAGCTCCTGATCTATTTGGGTTCTAATCGGGCCT
CCGGGGTCCCTGACAGGTTCAGTGGCAGTGGATC
AGGCACAGATTTTACACTGAAAATCAGCAGAGTG
GAGGCTGAGGATGTTGGGGTTTATTACTGCATGC
AAGCTCTACAAACTCCTCGGACGTTCGGCCAAGG
GACCAAGGTGGAAATCAAACGAACTGTGGCTGC
ACCATCTGTCTTCATCTTCCCGCCATCTGATGAGC
AGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTA
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCCTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein Sequence
GEPASISCRSSQSLLYSNGYNFLDWYLQKPGQSPQL (SEQ ID NO: 16)
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV
GVYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
Mature Variable CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG Domain of Heavy
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG Chain DNA
CAGCCTCTGGATTCACCTTCAGTAGCTATGGCAT Sequence
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG (SEQ ID NO: 9)
GAGTGGGTGGCAGTTATATCAAATGATGGAGATA
ATAAATACCATGCAGACTCCGTGTGGGGCCGATT
CACCATCTCCAGAGACAATTCCAGGAGCACGCTT
TATCTGCAAATGAACAGCCTGAGAGCTGAGGACA
CGGCTGTATATTACTGTGCGAGAAGAGGCATGGG
GTCTAGTGGGAGCCGTGGGGATTACTACTACTAC
TACGGTTTGGACGTCTGGGGCCAAGGGACCACGG TCACCGTCTCCTCA Mature Variable
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMH Domain of Heavy
WVRQAPGKGLEWVAVISNDGDNKYHADSVWGRF Chain Protein Sequence
TISRDNSRSTLYLQMNSLRAEDTAVYYCARRGMGS (SEQ ID NO: 10)
SGSRGDYYYYYGLDVWGQGTTVTVSS Mature Variable
GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC Domain of Light
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC Chain DNA Sequence
AGGTCTAGTCAGAGCCTCTTGTATAGTAATGGAT (SEQ ID NO: 11)
ACAACTTTTTGGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAA
Mature Variable DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSNGYNF Domain of
Light LDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG Chain Protein Sequence
TDFTLKISRVEAEDVGVYYCMQALQTPRTFGQGTKVEIK (SEQ ID NO: 12)
TABLE-US-00007 TABLE 5 DNA and protein sequences of antibody 10.8.3
DESCRIPTION: SEQUENCE (signal sequence underlined): Heavy Chain
ATGAAACACCTGTGGTTCTTCCTCCTGCTGGTGGC DNA Sequence
AGCTCCCAGATGGGTCCTGTCCCAGGTGCAGCTG (SEQ ID NO: 21)
CAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGG
AGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGC
TCCATCAGTAGTTACTACTGGATCTGGATCCGGC
AGCCCGCCGGGAAGGGACTGGAATGGATTGGGC
GTGTCTATACCAGTGGGAGCACCAACTACAACCC
CTCCCTCAAGAGTCGAGTCACCATGTCAGTAGAC
ACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGCT
CTGTGACCGCCGCGGACACGGCCGTGTATTACTG
TGCGAGAGATGGTCTTTACAGGGGGTACGGTATG
GACGTCTGGGGCCAAGGGACCACGGTCACCGTCT
CCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCC
CCTGGCGCCCTGCTCCAGGAGCACCTCCGAGAGC
ACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACT
TCCCCGAACCGGTGACGGTGTCGTGGAACTCAGG
CGCTCTGACCAGCGGCGTGCACACCTTCCCAGCT
GTCCTACAGTCCTCAGGACTCTACTCCCTCAGCA
GCGTGGTGACCGTGCCCTCCAGCAACTTCGGCAC
CCAGACCTACACCTGCAACGTAGATCACAAGCCC
AGCAACACCAAGGTGGACAAGACAGTTGAGCGC
AAATGTTGTGTCGAGTGCCCACCGTGCCCAGCAC
CACCTGTGGCAGGACCGTCAGTCTTCCTCTTCCCC
CCAAAACCCAAGGACACCCTCATGATCTCCCGGA
CCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAG
CCACGAAGACCCCGAGGTCCAGTTCAACTGGTAC
GTGGACGGCGTGGAGGTGCATAATGCCAAGACA AAGCCACGGGAGGAGCAGTTCAACAGCACGTTC
CGTGTGGTCAGCGTCCTCACCGTTGTGCACCAGG
ACTGGCTGAACGGCAAGGAGTACAAGTGCAAGG
TCTCCAACAAAGGCCTCCCAGCCCCCATCGAGAA
AACCATCTCCAAAACCAAAGGGCAGCCCCGAGA
ACCACAGGTGTACACCCTGCCCCCATCCCGGGAG
GAGATGACCAAGAACCAGGTCAGCCTGACCTGCC
TGGTCAAAGGCTTCTACCCCAGCGACATCGCCGT
GGAGTGGGAGAGCAATGGGCAGCCGGAGAACAA
CTACAAGACCACACCTCCCATGCTGGACTCCGAC
GGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGG
ACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCT
CATGCTCCGTGATGCATGAGGCTCTGCACAACCA
CTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGT AAATGA Heavy Chain
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSE Protein Sequence
TLSLTCTVSGGSISSYYWIWIRQPAGKGLEWIGRVY (SEQ ID NO: 22)
TSGSTNYNPSLKSRVTMSVDTSKNQFSLKLSSVTAA
DTAVYYCARDGLYRGYGMDVWGQGTTVTVSSAS
TKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVT
VSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS
NFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPC
PAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDV
SHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR
VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTI
SKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKG
FYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFLY
SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK Light Chain DNA
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTCCTGC Sequence
TGCTCTGGTTCCCAGGTTCCAGATGCGACATCCA (SEQ ID NO: 23)
GATGACCCAGTCTCCATCTTCCGTGTCTGCATCTG
TAGGAGACAGAGTCACCATCACTTGTCGGGCGAG
TCAGCCTATTAGCAGCTGGTTAGCCTGGTATCAG
CAGAAACCAGGGAAAGCCCCTAAACTCCTGATTT
ATTCTGCCTCCGGTTTGCAAAGTGGGGTCCCATC
AAGGTTCAGCGGCAGTGGATCTGGGACAGATTTC
ACTCTCACCATCAGCAGCCTGCAGCCTGAAGATT
TTGCAACTTACTATTGTCAACAGACTGACAGTTTC
CCGCTCACTTTCGGCGGCGGGACCAAGGTGGAGA
TCAAACGAACTGTGGCTGCACCATCTGTCTTCAT
CTTCCCGCCATCTGATGAGCAGTTGAAATCTGGA
ACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTA
TCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA
TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGT
GTCACAGAGCAGGACAGCAAGGACAGCACCTAC AGCCTCAGCAGCACCCTGACGCTGAGCAAAGCA
GACTACGAGAAACACAAAGTCTACGCCTGCGAA
GTCACCCATCAGGGCCTGAGCTCGCCCGTCACAA AGAGCTTCAACAGGGGAGAGTGTTAG Light
Chain MRLPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVG Protein Sequence
DRVTITCRASQPISSWLAWYQQKPGKAPKLLIYSAS (SEQ ID NO: 24)
GLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQ
QTDSFPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC Mature
Variable CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTG Domain of Heavy
GTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCA Chain DNA
CTGTCTCTGGTGGCTCCATCAGTAGTTACTACTGG Sequence
ATCTGGATCCGGCAGCCCGCCGGGAAGGGACTG (SEQ ID NO: 17)
GAATGGATTGGGCGTGTCTATACCAGTGGGAGCA
CCAACTACAACCCCTCCCTCAAGAGTCGAGTCAC
CATGTCAGTAGACACGTCCAAGAACCAGTTCTCC
CTGAAGCTGAGCTCTGTGACCGCCGCGGACACGG
CCGTGTATTACTGTGCGAGAGATGGTCTTTACAG
GGGGTACGGTATGGACGTCTGGGGCCAAGGGAC CACGGTCACCGTCTCCTCA Mature
Variable QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWIWI Domain of Heavy
RQPAGKGLEWIGRVYTSGSTNYNPSLKSRVTMSVD Chain Protein Sequence
TSKNQFSLKLSSVTAADTAVYYCARDGLYRGYGM (SEQ ID NO: 18) DVWGQGTTVTVSS
Mature Variable GACATCCAGATGACCCAGTCTCCATCTTCCGTGT Domain of Light
CTGCATCTGTAGGAGACAGAGTCACCATCACTTG Chain DNA Sequence
TCGGGCGAGTCAGCCTATTAGCAGCTGGTTAGCC (SEQ ID NO: 19)
TGGTATCAGCAGAAACCAGGGAAAGCCCCTAAA
CTCCTGATTTATTCTGCCTCCGGTTTGCAAAGTGG
GGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGG
ACAGATTTCACTCTCACCATCAGCAGCCTGCAGC
CTGAAGATTTTGCAACTTACTATTGTCAACAGAC
TGACAGTTTCCCGCTCACTTTCGGCGGCGGGACC AAGGTGGAGATCAAA Mature Variable
DIQMTQSPSSVSASVGDRVTITCRASQPISSWLAWY Domain of Light
QQKPGKAPKLLIYSASGLQSGVPSRFSGSGSGTDFT Chain Protein Sequence
LTISSLQPEDFATYYCQQTDSFPLTFGGGTKVEIK (SEQ ID NO: 20)
TABLE-US-00008 TABLE 6 DNA and protein sequences of antibody 15.1.1
DESCRIPTION: SEQUENCE (signal sequence underlined): Heavy Chain
ATGAAACATCTGTGGTTCTTCCTTCTCCTGGTGGC DNA Sequence
AGCTCCCAGATGGGTCCTGTCCCAGGTGCAGCTG (SEQ ID NO: 29)
CAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGG
AGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGC
TCCATCAGAAGTTACTACTGGACCTGGATCCGGC
AGCCCCCAGGGAAGGGACTGGAGTGGATTGGAT
ATATCTATTACAGTGGGAGCACCAACTACAATCC
CTCCCTCAAGAGTCGAGTCACCATATCAGTAGAC
ATGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTT
CTGTGACCGCTGCGGACACGGCCGTTTATTACTG
TGCGAGAAAGGGTGACTACGGTGGTAATTTTAAC
TACTTTCACCAGTGGGGCCAGGGAACCCTGGTCA
CCGTCTCCTCAGCCTCCACCAAGGGCCCATCGGT
CTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCC
GAGAGCACAGCGGCCCTGGGCTGCCTGGTCAAG
GACTACTTCCCCGAACCGGTGACGGTGTCGTGGA
ACTCAGGCGCTCTGACCAGCGGCGTGCACACCTT
CCCAGCTGTCCTACAGTCCTCAGGACTCTACTCCC
TCAGCAGCGTGGTGACCGTGCCCTCCAGCAACTT
CGGCACCCAGACCTACACCTGCAACGTAGATCAC
AAGCCCAGCAACACCAAGGTGGACAAGACAGTT
GAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCC
CAGCACCACCTGTGGCAGGACCGTCAGTCTTCCT
CTTCCCCCCAAAACCCAAGGACACCCTCATGATC
TCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGG
ACGTGAGTCACGAAGACCCCGAGGTCCAGTTCAA
CTGGTACGTGGACGGCGTGGAGGTGCATAATGCC
AAGACAAAGCCACGGGAGGAGCAGTTCAACAGC
ACGTTCCGTGTGGTCAGCGTCCTCACCGTTGTGC
ACCAGGACTGGCTGAACGGCAAGGAGTACAAGT
GCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCAT
CGAGAAAACCATCTCCAAAACCAAAGGGCAGCC
CCGAGAACCACAGGTGTACACCCTGCCCCCATCC
CGGGAGGAGATGACCAAGAACCAGGTCAGCCTG
ACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACA
TCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG
AGAACAACTACAAGACCACACCTCCCATGCTGGA
CTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCA
CCGTGGACAAGAGCAGGTGGCAGCAGGGGAACG
TCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC
AACCACTACACGCAGAAGAGCCTCTCCCTGTCTC CGGGTAAATGA Heavy Chain
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSE Protein Sequence
TLSLTCTVSGGSIRSYYWTWIRQPPGKGLEWIGYIY (SEQ ID NO: 30)
YSGSTNYNPSLKSRVTISVDMSKNQFSLKLSSVTAA
DTAVYYCARKGDYGGNFNYFHQWGQGTLVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPP
CPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEK
TISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Light Chain DNA
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA Sequence
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO: 31)
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCCTACATACTAATGGATACAACTAT
TTCGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACAACTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGAT
CAGGCACAGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGGTTTATTACTGCATG
CAAGCTCTACAAACTCCGTACAGTTTTGGCCAGG
GGACCAAGCTGGAGATCAAACGAACTGTGGCTG
CACCATCTGTCTTCATCTTCCCGCCATCTGATGAG
CAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTA
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCCTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein Sequence
GEPASISCRSSQSLLHTNGYNYFDWYLQKPGQSPQL (SEQ ID NO: 32)
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV
GVYYCMQALQTPYSFGQGTKLEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
Mature Variable CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTG Domain of Heavy
GTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCA Chain DNA Sequence
CTGTCTCTGGTGGCTCCATCAGAAGTTACTACTG (SEQ ID NO: 25)
GACCTGGATCCGGCAGCCCCCAGGGAAGGGACT
GGAGTGGATTGGATATATCTATTACAGTGGGAGC
ACCAACTACAATCCCTCCCTCAAGAGTCGAGTCA
CCATATCAGTAGACATGTCCAAGAACCAGTTCTC
CCTGAAGCTGAGTTCTGTGACCGCTGCGGACACG
GCCGTTTATTACTGTGCGAGAAAGGGTGACTACG
GTGGTAATTTTAACTACTTTCACCAGTGGGGCCA GGGAACCCTGGTCACCGTCTCCTCA Mature
Variable QVQLQESGPGLVKPSETLSLTCTVSGGSIRSYYWTW Domain of Heavy Chain
IRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVD Protein Sequence
MSKNQFSLKLSSVTAADTAVYYCARKGDYGGNFN (SEQ ID NO: 26) YFHQWGQGTLVTVSS
Mature Variable GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC Domain of Light
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC Chain DNA Sequence
AGGTCTAGTCAGAGCCTCCTACATACTAATGGAT (SEQ ID NO: 27)
ACAACTATTTCGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACAACTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCGTACAGTTT TGGCCAGGGGACCAAGCTGGAGATCAAA
Mature Variable DIVMTQSPLSLPVTPGEPASISCRSSQSLLHTNGYNY Domain of
Light FDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG Chain Protein Sequence
TDFTLKISRVEAEDVGVYYCMQALQTPYSFGQGTK (SEQ ID NO: 28) LEIK
TABLE-US-00009 TABLE 7 DNA and protein sequences of antibody 21.4.1
DESCRIPTION: SEQUENCE (signal sequence underlined): Heavy Chain
ATGGACTGGACCTGGAGGATCCTCTTCTTGGTGG DNA Sequence
CAGCAGCCACAGGAGCCCACTCCCAGGTGCAGCT (SEQ ID NO: 45)
GGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGG
GGCCTCAGTGAAGGTCTCCTGCAAGGCTTCTGGA
TACACCTTCACCGGCTACTATATGCACTGGGTGC
GACAGGCCCCTGGACAAGGGCTTGAGTGGATGG
GATGGATCAACCCTGACAGTGGTGGCACAAACTA
TGCACAGAAGTTTCAGGGCAGGGTCACCATGACC
AGGGACACGTCCATCAGCACAGCCTACATGGAGC
TGAACAGGCTGAGATCTGACGACACGGCCGTGTA
TTACTGTGCGAGAGATCAGCCCCTAGGATATTGT
ACTAATGGTGTATGCTCCTACTTTGACTACTGGG
GCCAGGGAACCCTGGTCACCGTCTCCTCAGCCTC
CACCAAGGGCCCATCGGTCTTCCCCCTGGCGCCC
TGCTCCAGGAGCACCTCCGAGAGCACAGCGGCCC
TGGGCTGCCTGGTCAAGGACTACTTCCCCGAACC
GGTGACGGTGTCGTGGAACTCAGGCGCTCTGACC
AGCGGCGTGCACACCTTCCCAGCTGTCCTACAGT
CCTCAGGACTCTACTCCCTCAGCAGCGTGGTGAC
CGTGCCCTCCAGCAACTTCGGCACCCAGACCTAC
ACCTGCAACGTAGATCACAAGCCCAGCAACACCA
AGGTGGACAAGACAGTTGAGCGCAAATGTTGTGT
CGAGTGCCCACCGTGCCCAGCACCACCTGTGGCA
GGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCA
AGGACACCCTCATGATCTCCCGGACCCCTGAGGT
CACGTGCGTGGTGGTGGACGTGAGCCACGAAGA
CCCCGAGGTCCAGTTCAACTGGTACGTGGACGGC
GTGGAGGTGCATAATGCCAAGACAAAGCCACGG
GAGGAGCAGTTCAACAGCACGTTCCGTGTGGTCA
GCGTCCTCACCGTTGTGCACCAGGACTGGCTGAA
CGGCAAGGAGTACAAGTGCAAGGTCTCCAACAA
AGGCCTCCCAGCCCCCATCGAGAAAACCATCTCC
AAAACCAAAGGGCAGCCCCGAGAACCACAGGTG
TACACCCTGCCCCCATCCCGGGAGGAGATGACCA
AGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGG
CTTCTACCCCAGCGACATCGCCGTGGAGTGGGAG
AGCAATGGGCAGCCGGAGAACAACTACAAGACC
ACACCTCCCATGCTGGACTCCGACGGCTCCTTCTT
CCTCTACAGCAAGCTCACCGTGGACAAGAGCAGG
TGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGA
TGCATGAGGCTCTGCACAACCACTACACGCAGAA GAGCCTCTCCCTGTCTCCGGGTAAATGA
Heavy Chain MDWTWRILFLVAAATGAHSQVQLVQSGAEVKKPG Protein Sequence
ASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWM (SEQ ID NO: 46)
GWINPDSGGTNYAQKFQGRVTMTRDTSISTAYMEL
NRLRSDDTAVYYCARDQPLGYCTNGVCSYFDYWG
QGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTV
ERKCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRT
PEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTK
PREEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVS
NKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP
PMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK Light Chain
DNA ATGAGGCTCCCTGCTCAGCTCCTGGGGCTCCTGC Sequence
TGCTCTGGTTCCCAGGTTCCAGATGCGACATCCA (SEQ ID NO: 47)
GATGACCCAGTCTCCATCTTCCGTGTCTGCATCTG
TAGGAGACAGAGTCACCATCACTTGTCGGGCGAG
TCAGGGTATTTACAGCTGGTTAGCCTGGTATCAG
CAGAAACCAGGGAAAGCCCCTAACCTCCTGATCT
ATACTGCATCCACTTTACAAAGTGGGGTCCCATC
AAGGTTCAGCGGCAGTGGATCTGGGACAGATTTC
ACTCTCACCATCAGCAGCCTGCAACCTGAAGATT
TTGCAACTTACTATTGTCAACAGGCTAACATTTTC
CCGCTCACTTTCGGCGGAGGGACCAAGGTGGAGA
TCAAACGAACTGTGGCTGCACCATCTGTCTTCAT
CTTCCCGCCATCTGATGAGCAGTTGAAATCTGGA
ACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTA
TCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGA
TAACGCCCTCCAATCGGGTAACTCCCAGGAGAGT
GTCACAGAGCAGGACAGCAAGGACAGCACCTAC AGCCTCAGCAGCACCCTGACGCTGAGCAAAGCA
GACTACGAGAAACACAAAGTCTACGCCTGCGAA
GTCACCCATCAGGGCCTGAGCTCGCCCGTCACAA AGAGCTTCAACAGGGGAGAGTGTTAG Light
Chain MRLPAQLLGLLLLWFPGSRCDIQMTQSPSSVSASVG Protein Sequence
DRVTITCRASQGIYSWLAWYQQKPGKAPNLLIYTA (SEQ ID NO: 48)
STLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYC
QQANIFPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQL
KSGTASVVCLLNNFYPREAKVQWKVDNALQSGNS
QESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC EVTHQGLSSPVTKSFNRGEC Mature
Variable CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGA Domain of Heavy
AGAAGCCTGGGGCCTCAGTGAAGGTCTCCTGCAA Chain DNA
GGCTTCTGGATACACCTTCACCGGCTACTATATG Sequence
CACTGGGTGCGACAGGCCCCTGGACAAGGGCTTG (SEQ ID NO: 41)
AGTGGATGGGATGGATCAACCCTGACAGTGGTGG
CACAAACTATGCACAGAAGTTTCAGGGCAGGGTC
ACCATGACCAGGGACACGTCCATCAGCACAGCCT
ACATGGAGCTGAACAGGCTGAGATCTGACGACA
CGGCCGTGTATTACTGTGCGAGAGATCAGCCCCT
AGGATATTGTACTAATGGTGTATGCTCCTACTTTG
ACTACTGGGGCCAGGGAACCCTGGTCACCGTCTC CTCA Mature Variable
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYM Domain of Heavy
HWVRQAPGQGLEWMGWINPDSGGTNYAQKFQGR Chain Protein
VTMTRDTSISTAYMELNRLRSDDTAVYYCARDQPL Sequence
GYCTNGVCSYFDYWGQGTLVTVSS (SEQ ID NO: 42) Mature Variable
GACATCCAGATGACCCAGTCTCCATCTTCCGTGT Domain of Light
CTGCATCTGTAGGAGACAGAGTCACCATCACTTG Chain DNA Sequence
TCGGGCGAGTCAGGGTATTTACAGCTGGTTAGCC (SEQ ID NO: 43)
TGGTATCAGCAGAAACCAGGGAAAGCCCCTAAC
CTCCTGATCTATACTGCATCCACTTTACAAAGTGG
GGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGG
ACAGATTTCACTCTCACCATCAGCAGCCTGCAAC
CTGAAGATTTTGCAACTTACTATTGTCAACAGGC
TAACATTTTCCCGCTCACTTTCGGCGGAGGGACC AAGGTGGAGATCAAA Mature Variable
DIQMTQSPSSVSASVGDRVTITCRASQGIYSWLAWY Domain of Light Chain
QQKPGKAPNLLIYTASTLQSGVPSRFSGSGSGTDFT Protein Sequence
LTISSLQPEDFATYYCQQANIFPLTFGGGTKVEIK (SEQ ID NO: 44)
TABLE-US-00010 TABLE 8 DNA and protein sequences of mature variable
domains of 21.2.1 antibody DESCRIPTION: SEQUENCE: Heavy Chain
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG (SEQ ID NO:
CAGCCTCTGGATTCACCTTCAGTAGCTATGTCATG 33)
CACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTGG
AGTGGGTGGCAGTTATGTCATATGATGGAAGTAG
TAAATACTATGCAAACTCCGTGAAGGGCCGATTC
ACCATCTCCAGAGACAATTCCAAGAACACGCTGT
ATCTGCAAATAAACAGCCTGAGAGCTGAGGACA
CGGCTGTGTATTACTGTGCGAGAGATGGGGGTAA
AGCAGTGCCTGGTCCTGACTACTGGGGCCAGGGA ATCCTGGTCACCGTCTCCTCAG Heavy
Chain QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYVMH Protein
WVRQAPGKGLEWVAVMSYDGSSKYYANSVKGRF (SEQ ID NO:
TISRDNSKNTLYLQINSLRAEDTAVYYCARDGGKA 34) VPGPDYWGQGILVTVSS Light
Chain GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC DNA
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC (SEQ ID NO:
AGGTCTAGTCAGAGTGTTCTGTATAGTAATGGAT 35)
ACAACTATTTGGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGTTTTACAAACTCCATTCACTTTC GGCCCTGGGACCAAAGTGGATATCAAAC
Light Chain DIVMTQSPLSLPVTPGEPASISCRSSQSVLYSNGYNY Protein
LDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG (SEQ ID NO:
TDFTLKISRVEAEDVGVYYCMQVLQTPFTFGPGTK 36) VDIK
TABLE-US-00011 TABLE 9 DNA and protein sequences of mature variable
domains of 22.1.1 antibody DESCRIPTION: SEQUENCE: Heavy Chain
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG (SEQ ID NO:
CAGCCTCTGGATTCACCTTCAGTCGCTATGGCAT 49)
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG
GAGTGGGTGGCAGTTATATCATCTGATGGAGGTA
ATAAATACTATGCAGACTCCGTGAAGGGCCGATT
CACCATCTCCAGAGACAATTCCAAGAACACGCTG
TATCTGCAAATGAACAGCCTGAGAGCTGAGGACA
CGGCTGTGTATTACTGTACGAGAAGAGGGACTGG
AAAGACTTACTACCACTACTGTGGTATGGACGTC
TGGGGCCAAGGGACCACGGTCACCGTCTCCTCAG Heavy Chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGMH Protein
WVRQAPGKGLEWVAVISSDGGNKYYADSVKGRFT (SEQ ID NO:
ISRDNSKNTLYLQMNSLRAEDTAVYYCTRRGTGKT 50) YYHYCGMDVWGQGTTVTVSS Light
Chain GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC DNA
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC (SEQ ID NO:
AGGTCTAGTCAGAGCCTCCTGTATAGTAATGGAT 51)
ATAACTATTTGGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACACCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGTTCAGGCACTGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAAC
Light Chain DIVMTQSPLSLPVTPGEPASISCRSSQSLLYSNGYNY Protein
LDWYLQKPGQSPHLLIYLGSNRASGVPDRFSGSGSG (SEQ ID NO:
TDFTLKISRVEAEDVGVYYCMQALQTPRTFGQGTK 52) VEIK
TABLE-US-00012 TABLE 10 DNA and protein sequences of mature
variable domains of 23.5.1 antibody DESCRIPTION: SEQUENCE: Heavy
Chain CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG (SEQ ID NO:
TAGCCTCTGGATTCACCTTCAGTAACTATGGCAT 57)
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG
GAGTGGGTGGCAATTATATCATATGATGGAAGTA
ATAAATACTATGCAGACTCCGTGAAGGGCCGATT
CACCATCTCCAGAGACAATTCCAAGAACACGCTG
TATGTGCAAATGAACAGCCTGAGAGCTGAGGAC
ACGGCTGTGTATTACTGTGCGAGACGCGGTCACT
ACGGGAGGGATTACTACTCCTACTACGGTTTGGA
CGTCTGGGGCCAAGGGACCACGGTCACCGTCTCC TCAG Heavy Chain
QVQLVESGGGVVQPGRSLRLSCVASGFTFSNYGMH Protein
WVRQAPGKGLEWVAIISYDGSNKYYADSVKGRFTI (SEQ ID NO:
SRDNSKNTLYVQMNSLRAEDTAVYYCARRGHYGR 58) DYYSYYGLDVWGQGTTVTVSS Light
Chain GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC DNA
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC (SEQ ID NO:
AGGTCTAGTCAGAGCCTCCTGCCTGGTAATGGAT 59)
ACAACTATTTGGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGATCAGGCACAGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAAC
Light Chain DIVMTQSPLSLPVTPGEPASISCRSSQSLLPGNGYNY Protein
LDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG (SEQ ID NO:
TDFTLKISRVEAEDVGVYYCMQALQTPRTFGQGTK 60) VEIK
TABLE-US-00013 TABLE 11 DNA and protein sequences of mature
variable domains of 23.28.1 antibody DESCRIPTION: SEQUENCE: Heavy
Chain CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTG DNA
GTGAAGCCTTCGGACACCCTGTCCCTCACCTGCA (SEQ ID NO:
CTGTCTCTGGTGGCTCCATCAGAGGTTACTACTG 65)
GAGCTGGATCCGGCAGCCCCCTGGGAAGGGACT
GGAGTGGATTGGGTATATCTATTACAGTGGGAGC
ACCAACTACAACCCCTCCCTCAAGAGTCGAGTCA
CCATATCAGTAGACACGTCCAAGAACCAGTTCTC
CCTGAAGCTGAACTCTGTGACCGCTGCGGACACG
GCCGTGTATTATTGTGCGAGAAAGGGGGGCCTCT
ACGGTGACTACGGCTGGTTCGCCCCCTGGGGCCA GGGAACCCTGGTCACCGTCTCCTCAG Heavy
Chain QVQLQESGPGLVKPSDTLSLTCTVSGGSIRGYYWS Protein
WIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISV (SEQ ID NO:
DTSKNQFSLKLNSVTAADTAVYYCARKGGLYGDY 66) GWFAPWGQGTLVTVSS Light Chain
GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGT DNA
CTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTG (SEQ ID NO:
CAGGGCCAGTCAGAGTGTTAGCAGCAGCGACTTA 67)
GCCTGGCACCAGCAGAAACCTGGCCAGGCTCCCA
GACTCCTCATCTATGGTGCATCCAGCAGGGCCAC
TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCT
GGGACAGACTTCACTCTCACCATCAGCAGACTGG
AGCCTGAAGATTTTGCAGTGTATTACTGTCAGCA
CTGTCGTAGCTTATTCACTTTCGGCCCTGGGACCA AAGTGGATATCAAAC Light Chain
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSDLAWH Protein
QQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTL (SEQ ID NO:
TISRLEPEDFAVYYCQHCRSLFTFGPGTKVDIK 68) Heavy Chain
CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTG DNA
GTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCA (variable
CTGTCTCTGGTGGCTCCATCAGAGGTTACTACTG domain)
GAGCTGGATCCGGCAGCCCCCTGGGAAGGGACT (23.28.1H-
GGAGTGGATTGGGTATATCTATTACAGTGGGAGC D16E)
ACCAACTACAACCCCTCCCTCAAGAGTCGAGTCA (SEQ ID NO:
CCATATCAGTAGACACGTCCAAGAACCAGTTCTC 97)
CCTGAAGCTGAACTCTGTGACCGCTGCGGACACG
GCCGTGTATTATTGTGCGAGAAAGGGGGGCCTCT
ACGGTGACTACGGCTGGTTCGCCCCCTGGGGCCA GGGAACCCTGGTCACCGTCTCCTCAG Heavy
Chain QVQLQESGPGLVKPSETLSLTCTVSGGSIRGYYWS Protein
WIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISV (variable
DTSKNQFSLKLNSVTAADTAVYYCARKGGLYGDY domain) GWFAPWGQGTLVTVSS
(23.28.1H-) D16E) (SEQ ID NO: 98)
TABLE-US-00014 TABLE 12 DNA and protein sequences of mature
variable domains of 23.29.1 antibody DESCRIPTION: SEQUENCE: Heavy
Chain CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTG DNA
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG (SEQ ID NO:
CAGCCTCTGGATTCACCTTCAGTAGCTATGCCAT 73)
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG
GAGTGGGTGGCAGTTATATCATATGATGGAAGTA
ATAAATACTATGCAGACTCCGTGAAGGGCCGATT
CACCATCTACAGAGACAATTCCAAGAACACGCTG
TATCTGCAAATGAACAGCCTGAGAGCTGAGGACA
CGGCTGTGTATTACTGTGCGAGACGCGGTCACTA
CGGGAATAATTACTACTCCTATTACGGTTTGGAC
GTCTGGGGCCAAGGGACCACGGTCACCGTCTCCT CAG Heavy Chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYAMH Protein
WVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFT (SEQ ID NO:
IYRDNSKNTLYLQMNSLRAEDTAVYYCARRGHYG 74) NNYYSYYGLDVWGQGTTVTVSS Light
Chain GATATTGTGATGACTCAGTCTCCACTCTCCCTGCC DNA
CGTCACCCCTGGAGAGCCGGCCTCCATCTCCTGC (SEQ ID NO:
AGGTCTAGTCAGAGCCTCCTGCCTGGTAATGGAT 75)
ACAACTATTTGGATTGGTACCTGCAGAAGCCAGG
GCAGTCTCCACAGCTCCTGATCTATTTGGGTTCTA
ATCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGG
CAGTGGCTCAGGCACAGATTTTACACTGAAAATC
AGCAGAGTGGAGGCTGAGGATGTTGGGATTTATT
ACTGCATGCAAGCTCTACAAACTCCTCGGACGTT CGGCCAAGGGACCAAGGTGGAAATCAAAC
Light Chain DIVMTQSPLSLPVTPGEPASISCRSSQSLLPGNGYNY Protein
LDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSG (SEQ ID NO:
TDFTLKISRVEAEDVGIYYCMQALQTPRTFGQGTK 76) VEIK
TABLE-US-00015 TABLE 13 DNA and protein sequences of mature
variable domains of 24.2.1 antibody DESCRIPTION: SEQUENCE Heavy
Chain CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTG DNA
GTGAAGCCTTCGGAGACCCTGTCCCTCACCTGCA (SEQ ID NO:
CTGTCTCTGGTGGCTCCATCAGAGGTTACTACTG 81)
GAGCTGGATCCGGCAGCCCCCAGGGAAGGGACT
GGAGTGGATTGGGTATATCTATTACAGTGGGAGC
ACCAACTACAACCCCTCCCTCAAGAGTCGAGTCA
CCATATCAGTAGACACGTCCAAGAACCAGTTCTC
CCTGAAGCTGAGTTCTGTGACCGCTGCGGACACG
GCCGTGTATTACTGTGCGAGAAGGGGGGGCCTCT
ACGGTGACTACGGCTGGTTCGCCCCCTGGGGCCA GGGAACCCTGGTCACCGTCTCCTCAG Heavy
Chain QVQLQESGPGLVKPSETLSLTCTVSGGSIRGYYWS Protein
WIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISV (SEQ ID NO:
DTSKNQFSLKLSSVTAADTAVYYCARRGGLYGDY 82) GWFAPWGQGTLVTVSS Light Chain
GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGT DNA
CTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTG (SEQ ID NO:
CAGGGCCAGTCAGAGTGTTAGCAGCACCTACTTA 83)
GCCTGGTACCAGCAGAAACCTGGCCAGGCTCCCA
GGCTCCTCATCTATGGTGCATCCAGCAGGGCCAC
TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCT
GGGACAGACTTCACTCTCACCATCAGCAGACTGG
AGCCTGAAGATTTTGCAGTGTATTACTGTCAGCA
GTATAGTAGCTTATTCACTTTCGGCCCTGGGACC AAAGTGGATATCAAAC Light Chain
EIVLTQSPGTLSLSPGERATLSCRASQSVSSTYLAWY Protein
QQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTL (SEQ ID NO:
TISRLEPEDFAVYYCQQYSSLFTFGPGTKVDIK 84)
TABLE-US-00016 TABLE 14 DNA and protein sequences of antibody
21.2.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAGCTG (SEQ ID NO:
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG 37)
AGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGAT
TCACCTTCAGTAGCTATGTCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGC
AGTTATGTCATATGATGGAAGTAGTAAATACTAT
GCAAACTCCGTGAAGGGCCGATTCACCATCTCCA
GAGACAATTCCAAGAACACGCTGTATCTGCAAAT
AAACAGCCTGAGAGCTGAGGACACGGCTGTGTAT
TACTGTGCGAGAGATGGGGGTAAAGCAGTGCCTG
GTCCTGACTACTGGGGCCAGGGAATCCTGGTCAC
CGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTC
TTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCCG
AGAGCACAGCGGCCCTGGGCTGCCTGGTCAAGG
ACTACTTCCCCGAACCGGTGACGGTGTCGTGGAA
CTCAGGCGCTCTGACCAGCGGCGTGCACACCTTC
CCAGCTGTCCTACAGTCCTCAGGACTCTACTCCCT
CAGCAGCGTGGTGACCGTGCCCTCCAGCAACTTC
GGCACCCAGACCTACACCTGCAACGTAGATCACA
AGCCCAGCAACACCAAGGTGGACAAGACAGTTG
AGCGCAAATGTTGTGTCGAGTGCCCACCGTGCCC
AGCACCACCTGTGGCAGGACCGTCAGTCTTCCTC
TTCCCCCCAAAACCCAAGGACACCCTCATGATCT
CCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGA
CGTGAGCCACGAAGACCCCGAGGTCCAGTTCAAC
TGGTACGTGGACGGCGTGGAGGTGCATAATGCCA
AGACAAAGCCACGGGAGGAGCAGTTCAACAGCA
CGTTCCGTGTGGTCAGCGTCCTCACCGTTGTGCAC
CAGGACTGGCTGAACGGCAAGGAGTACAAGTGC
AAGGTCTCCAACAAAGGCCTCCCAGCCCCCATCG
AGAAAACCATCTCCAAAACCAAAGGGCAGCCCC
GAGAACCACAGGTGTACACCCTGCCCCCATCCCG
GGAGGAGATGACCAAGAACCAGGTCAGCCTGAC
CTGCCTGGTCAAAGGCTTCTACCCCAGCGACATC
GCCGTGGAGTGGGAGAGCAATGGGCAGCCGGAG
AACAACTACAAGACCACACCTCCCATGCTGGACT
CCGACGGCTCCTTCTTCCTCTACAGCAAGCTCACC
GTGGACAAGAGCAGGTGGCAGCAGGGGAACGTC
TTCTCATGCTCCGTGATGCATGAGGCTCTGCACA
ACCACTACACGCAGAAGAGCCTCTCCCTGTCTCC GGGTAAATGA Heavy Chain
MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein
RSLRLSCAASGFTFSSYVMHWVRQAPGKGLEWVA (SEQ ID NO:
VMSYDGSSKYYANSVKGRFTISRDNSKNTLYLQINS 38)
LRAEDTAVYYCARDGGKAVPGPDYWGQGILVTVS
SASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVP
SSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECP
PCPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEK
TISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Light Chain
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA DNA
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO:
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC 39)
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGTGTTCTGTATAGTAATGGATACAACTAT
TTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACAGCTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGAT
CAGGCACAGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGGTTTATTACTGCATG
CAAGTTTTACAAACTCCATTCACTTTCGGCCCTGG
GACCAAAGTGGATATCAAACGAACTGTGGCTGCA
CCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA
GTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGC
TGAATAACTTCTATCCCAGAGAGGCCAAAGTACA
GTGGAAGGTGGATAACGCCCTCCAATCGGGTAAC
TCCCAGGAGAGTGTCACAGAGCAGGACAGCAAG
GACAGCACCTACAGCCTCAGCAGCACCCTGACGC
TGAGCAAAGCAGACTACGAGAAACACAAAGTCT
ACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTC
GCCCGTCACAAAGAGCTTCAACAGGGGAGAGTG TTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein
GEPASISCRSSQSVLYSNGYNYLDWYLQKPGQSPQL (SEQ ID NO:
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV 40)
GVYYCMQVLQTPFTFGPGTKVDIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
TABLE-US-00017 TABLE 15 DNA and protein sequences of antibody
22.1.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAACTG (SEQ ID NO:
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG 53)
AGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGAT
TCACCTTCAGTCGCTATGGCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGC
AGTTATATCATCTGATGGAGGTAATAAATACTAT
GCAGACTCCGTGAAGGGCCGATTCACCATCTCCA
GAGACAATTCCAAGAACACGCTGTATCTGCAAAT
GAACAGCCTGAGAGCTGAGGACACGGCTGTGTAT
TACTGTACGAGAAGAGGGACTGGAAAGACTTACT
ACCACTACTGTGGTATGGACGTCTGGGGCCAAGG
GACCACGGTCACCGTCTCCTCAGCCTCCACCAAG
GGCCCATCGGTCTTCCCCCTGGCGCCCTGCTCCA
GGAGCACCTCCGAGAGCACAGCGGCCCTGGGCT
GCCTGGTCAAGGACTACTTCCCCGAACCGGTGAC
GGTGTCGTGGAACTCAGGCGCTCTGACCAGCGGC
GTGCACACCTTCCCAGCTGTCCTACAGTCCTCAG
GACTCTACTCCCTCAGCAGCGTGGTGACCGTGCC
CTCCAGCAACTTCGGCACCCAGACCTACACCTGC
AACGTAGATCACAAGCCCAGCAACACCAAGGTG
GACAAGACAGTTGAGCGCAAATGTTGTGTCGAGT
GCCCACCGTGCCCAGCACCACCTGTGGCAGGACC
GTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGAC
ACCCTCATGATCTCCCGGACCCCTGAGGTCACGT
GCGTGGTGGTGGACGTGAGCCACGAAGACCCCG
AGGTCCAGTTCAACTGGTACGTGGACGGCGTGGA
GGTGCATAATGCCAAGACAAAGCCACGGGAGGA
GCAGTTCAACAGCACGTTCCGTGTGGTCAGCGTC
CTCACCGTTGTGCACCAGGACTGGCTGAACGGCA
AGGAGTACAAGTGCAAGGTCTCCAACAAAGGCC
TCCCAGCCCCCATCGAGAAAACCATCTCCAAAAC
CAAAGGGCAGCCCCGAGAACCACAGGTGTACAC
CCTGCCCCCATCCCGGGAGGAGATGACCAAGAAC
CAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCT
ACCCCAGCGACATCGCCGTGGAGTGGGAGAGCA ATGGGCAGCCGGAGAACAACTACAAGACCACAC
CTCCCATGCTGGACTCCGACGGCTCCTTCTTCCTC
TACAGCAAGCTCACCGTGGACAAGAGCAGGTGG
CAGCAGGGGAACGTCTTCTCATGCTCCGTGATGC
ATGAGGCTCTGCACAACCACTACACGCAGAAGA GCCTCTCCCTGTCTCCGGGTAAATGA Heavy
Chain MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein
RSLRLSCAASGFTFSRYGMHWVRQAPGKGLEWVA (SEQ ID NO:
VISSDGGNKYYADSVKGRFTISRDNSKNTLYLQMN 54)
SLRAEDTAVYYCTRRGTGKTYYHYCGMDVWGQG
TTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERK
CCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPRE
EQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG
LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK Light Chain
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA DNA
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO:
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC 55)
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCCTGTATAGTAATGGATATAACTAT
TTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACACCTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGTT
CAGGCACTGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGGTTTATTACTGCATG
CAAGCTCTACAAACTCCTCGGACGTTCGGCCAAG
GGACCAAGGTGGAAATCAAACGAACTGTGGCTG
CACCATCTGTCTTCATCTTCCCGCCATCTGATGAG
CAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTA
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCYTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein
GEPASISCRSSQSLLYSNGYNYLDWYLQKPGQSPHL (SEQ ID NO:
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV 56)
GVYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
TABLE-US-00018 TABLE 16 DNA and protein sequences of antibody
23.5.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAGCTG (SEQ ID NO:
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG 61)
AGGTCCCTGAGACTCTCCTGTGTAGCCTCTGGATT
CACCTTCAGTAACTATGGCATGCACTGGGTCCGC
CAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCA
ATTATATCATATGATGGAAGTAATAAATACTATG
CAGACTCCGTGAAGGGCCGATTCACCATCTCCAG
AGACAATTCCAAGAACACGCTGTATGTGCAAATG
AACAGCCTGAGAGCTGAGGACACGGCTGTGTATT
ACTGTGCGAGACGCGGTCACTACGGGAGGGATTA
CTACTCCTACTACGGTTTGGACGTCTGGGGCCAA
GGGACCACGGTCACCGTCTCCTCAGCCTCCACCA
AGGGCCCATCGGTCTTCCCCCTGGCGCCCTGCTC
CAGGAGCACCTCCGAGAGCACAGCGGCCCTGGG
CTGCCTGGTCAAGGACTACTTCCCCGAACCGGTG
ACGGTGTCGTGGAACTCAGGCGCTCTGACCAGCG
GCGTGCACACCTTCCCAGCTGTCCTACAGTCCTC
AGGACTCTACTCCCTCAGCAGCGTGGTGACCGTG
CCCTCCAGCAACTTCGGCACCCAGACCTACACCT
GCAACGTAGATCACAAGCCCAGCAACACCAAGG
TGGACAAGACAGTTGAGCGCAAATGTTGTGTCGA
GTGCCCACCGTGCCCAGCACCACCTGTGGCAGGA
CCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGG
ACACCCTCATGATCTCCCGGACCCCTGAGGTCAC
GTGCGTGGTGGTGGACGTGAGCCACGAAGACCCC
GAGGTCCAGTTCAACTGGTACGTGGACGGCGTGG
AGGTGCATAATGCCAAGACAAAGCCACGGGAGG
AGCAGTTCAACAGCACGTTCCGTGTGGTCAGCGT
CCTCACCGTTGTGCACCAGGACTGGCTGAACGGC
AAGGAGTACAAGTGCAAGGTCTCCAACAAAGGC
CTCCCAGCCCCCATCGAGAAAACCATCTCCAAAA
CCAAAGGGCAGCCCCGAGAACCACAGGTGTACA
CCCTGCCCCCATCCCGGGAGGAGATGACCAAGAA
CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTC
TACCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACA
CCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCT
CTACAGCAAGCTCACCGTGGACAAGAGCAGGTG
GCAGCAGGGGAACGTCTTCTCATGCTCCGTGATG
CATGAGGCTCTGCACAACCACTACACGCAGAAGA GCCTCTCCCTGTCTCCGGGTAAATGA Heavy
Chain MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein
RSLRLSCVASGFTFSNYGMHWVRQAPGKGLEWVA (SEQ ID NO:
IISYDGSNKYYADSVKGRFTISRDNSKNTLYVQMNS 62)
LRAEDTAVYYCARRGHYGRDYYSYYGLDVWGQG
TTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERK
CCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPRE
EQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNKG
LPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVS
LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPMLD
SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK Light Chain
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA DNA
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO:
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC 63)
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCCTGCCTGGTAATGGATACAACTAT
TTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACAGCTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGAT
CAGGCACAGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGGTTTATTACTGCATG
CAAGCTCTACAAACTCCTCGGACGTTCGGCCAAG
GGACCAAGGTGGAAATCAAACGAACTGTGGCTG
CACCATCTGTCTTCATCTTCCCGCCATCTGATGAG
CAGTTGAAATCTGGAACTGCCTSTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTA
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCYTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAA Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein
GEPASISCRSSQSLLPGNGYNYLDWYLQKPGQSPQL (SEQ ID NO:
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV 64)
GVYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTAXVVCLLNNFYPREAKVQWKVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
TABLE-US-00019 TABLE 17 DNA and protein sequences of antibody
23.28.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGAAACATCTGTGGTTCTTCCTTCTCCTGGTGGC DNA
AGCTCCCAGATGGGTCCTGTCCCAGGTGCAGCTG (SEQ ID NO:
CAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGG 69)
AGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGC
TCCATCAGAGGTTACTACTGGAGCTGGATCCGGC
AGCCCCCTGGGAAGGGACTGGAGTGGATTGGGT
ATATCTATTACAGTGGGAGCACCAACTACAACCC
CTCCCTCAAGAGTCGAGTCACCATATCAGTAGAC
ACGTCCAAGAACCAGTTCTCCCTGAAGCTGAACT
CTGTGACCGCTGCGGACACGGCCGTGTATTATTG
TGCGAGAAAGGGGGGCCTCTACGGTGACTACGG
CTGGTTCGCCCCCTGGGGCCAGGGAACCCTGGTC
ACCGTCTCCTCAGCCTCCACCAAGGGCCCATCGG
TCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCC
GAGAGCACAGCGGCCCTGGGCTGCCTGGTCAAG
GACTACTTCCCCGAACCGGTGACGGTGTCGTGGA
ACTCAGGCGCTCTGACCAGCGGCGTGCACACCTT
CCCAGCTGTCCTACAGTCCTCAGGACTCTACTCCC
TCAGCAGCGTGGTGACCGTGCCCTCCAGCAACTT
CGGCACCCAGACCTACACCTGCAACGTAGATCAC
AAGCCCAGCAACACCAAGGTGGACAAGACAGTT
GAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCC
CAGCACCACCTGTGGCAGGACCGTCAGTCTTCCT
CTTCCCCCCAAAACCCAAGGACACCCTCATGATC
TCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGG
ACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAA
CTGGTACGTGGACGGCGTGGAGGTGCATAATGCC
AAGACAAAGCCACGGGAGGAGCAGTTCAACAGC
ACGTTCCGTGTGGTCAGCGTCCTCACCGTTGTGC
ACCAGGACTGGCTGAACGGCAAGGAGTACAAGT
GCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCAT
CGAGAAAACCATCTCCAAAACCAAAGGGCAGCC
CCGAGAACCACAGGTGTACACCCTGCCCCCATCC
CGGGAGGAGATGACCAAGAACCAGGTCAGCCTG
ACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACA
TCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG
AGAACAACTACAAGACCACACCTCCCATGCTGGA
CTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCA
CCGTGGACAAGAGCAGGTGGCAGCAGGGGAACG
TCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC
AACCACTACACGCAGAAGAGCCTCTCCCTGTCTC CGGGTAAATGA Heavy Chain
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSE Protein
TLSLTCTVSGGSIRGYYWSWIRQPPGKGLEWIGYIY (SEQ ID NO:
YSGSTNYNPSLKSRVTISVDTSKNQFSLKLNSVTAA 70)
DTAVYYCARKGGLYGDYGWFAPWGQGTLVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPP
CPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEK
TISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Light Chain
ATGGAAACCCCAGCGCAGCTTCTCTTCCTCCTGCT DNA
ACTCTGGCTCCCAGAATCCACCGGAGAAATTGTG (SEQ ID NO:
TTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCC 71)
AGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGT
CAGAGTGTTAGCAGCAGCGACTTAGCCTGGCACC
AGCAGAAACCTGGCCAGGCTCCCAGACTCCTCAT
CTATGGTGCATCCAGCAGGGCCACTGGCATCCCA
GACAGGTTCAGTGGCAGTGGGTCTGGGACAGACT
TCACTCTCACCATCAGCAGACTGGAGCCTGAAGA
TTTTGCAGTGTATTACTGTCAGCACTGTCGTAGCT
TATTCACTTTCGGCCCTGGGACCAAAGTGGATAT
CAAACGAACTGTGGCTGCACCATCTGTCTTCATC
TTCCCGCCATCTGATGAGCAGTTGAAATCTGGAA
CTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTAT
CCCAGAGAGGCCAAAGTACAGTGGAAGGTGGAT
AACGCCCTCCAATCGGGTAACTCCCAGGAGAGTG
TCACAGAGCAGGACAGCAAGGACAGCACCTACA GCCTCAGCAGCACCCTGACGCTGAGCAAAGCAG
ACTACGAGAAACACAAAGTCTACGCCTGCGAAGT
CACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG AGCTTCAACAGGGGAGAGTGTTAG Light
Chain METPAQLLFLLLLWLPESTGEIVLTQSPGTLSLSPGE Protein
RATLSCRASQSVSSSDLAWHQQKPGQAPRLLIYGA (SEQ ID NO:
SSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC 72)
QHCRSLFTFGPGTKVDIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC
TABLE-US-00020 TABLE 18 DNA and protein sequences of antibody
23.29.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGGAGTTTGGGCTGAGCTGGGTTTTCCTCGTTGC DNA
TCTTTTAAGAGGTGTCCAGTGTCAGGTGCAACTG (SEQ ID NO:
GTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGG 77)
AGGTCCCTGAGACTCTCCTGTGCAGCCTCTGGAT
TCACCTTCAGTAGCTATGCCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGC
AGTTATATCATATGATGGAAGTAATAAATACTAT
GCAGACTCCGTGAAGGGCCGATTCACCATCTACA
GAGACAATTCCAAGAACACGCTGTATCTGCAAAT
GAACAGCCTGAGAGCTGAGGACACGGCTGTGTAT
TACTGTGCGAGACGCGGTCACTACGGGAATAATT
ACTACTCCTATTACGGTTTGGACGTCTGGGGCCA
AGGGACCACGGTCACCGTCTCCTCAGCCTCCACC
AAGGGCCCATCGGTCTTCCCCCTGGCGCCCTGCT
CCAGGAGCACCTCCGAGAGCACAGCGGCCCTGG
GCTGCCTGGTCAAGGACTACTTCCCCGAACCGGT
GACGGTGTCGTGGAACTCAGGCGCTCTGACCAGC
GGCGTGCACACCTTCCCAGCTGTCCTACAGTCCT
CAGGACTCTACTCCCTCAGCAGCGTGGTGACCGT
GCCCTCCAGCAACTTCGGCACCCAGACCTACACC
TGCAACGTAGATCACAAGCCCAGCAACACCAAG
GTGGACAAGACAGTTGAGCGCAAATGTTGTGTCG
AGTGCCCACCGTGCCCAGCACCACCTGTGGCAGG
ACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAG
GACACCCTCATGATCTCCCGGACCCCTGAGGTCA
CGTGCGTGGTGGTGGACGTGAGCCACGAAGACCC
CGAGGTCCAGTTCAACTGGTACGTGGACGGCGTG
GAGGTGCATAATGCCAAGACAAAGCCACGGGAG
GAGCAGTTCAACAGCACGTTCCGTGTGGTCAGCG
TCCTCACCGTTGTGCACCAGGACTGGCTGAACGG
CAAGGAGTACAAGTGCAAGGTCTCCAACAAAGG
CCTCCCAGCCCCCATCGAGAAAACCATCTCCAAA
ACCAAAGGGCAGCCCCGAGAACCACAGGTGTAC
ACCCTGCCCCCATCCCGGGAGGAGATGACCAAGA
ACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTT
CTACCCCAGCGACATCGCCGTGGAGTGGGAGAGC
AATGGGCAGCCGGAGAACAACTACAAGACCACA
CCTCCCATGCTGGACTCCGACGGCTCCTTCTTCCT
CTACAGCAAGCTCACCGTGGACAAGAGCAGGTG
GCAGCAGGGGAACGTCTTCTCATGCTCCGTGATG
CATGAGGCTCTGCACAACCACTACACGCAGAAGA GCCTCTCCCTGTCTCCGGGTAAATGA Heavy
Chain MEFGLSWVFLVALLRGVQCQVQLVESGGGVVQPG Protein
RSLRLSCAASGFTFSSYAMHWVRQAPGKGLEWVA (SEQ ID NO:
VISYDGSNKYYADSVKGRFTIYRDNSKNTLYLQMN 78)
SLRAEDTAVYYCARRGHYGNNYYSYYGLDVWGQ
GTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLV
KDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVER
KCCVECPPCPAPPVAGPSVFLFPPKPKDTLMISRTPE
VTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPR
EEQFNSTFRVVSVLTVVHQDWLNGKEYKCKVSNK
GLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPM
LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL HNHYTQKSLSLSPGK Light Chain
ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA DNA
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (SEQ ID NO:
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC 79)
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG
TCAGAGCCTCCTGCCTGGTAATGGATACAACTAT
TTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACAGCTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGCT
CAGGCACAGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGATTTATTACTGCATG
CAAGCTCTACAAACTCCTCGGACGTTCGGCCAAG
GGACCAAGGTGGAAATCAAACGAACTGTGGCTG
CACCATCTGTCTTCATCTTCCCGCCATCTGATGAG
CAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTT
CAGTGGAGGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCCTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein
GEPASISCRSSQSLLPGNGYNYLDWYLQKPGQSPQL (SEQ ID NO:
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV 80)
GIYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWRVDNA
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
Light Chain ATGAGGCTCCCTGCTCAGCTCCTGGGGCTGCTAA DNA
TGCTCTGGGTCTCTGGATCCAGTGGGGATATTGT (23.29.
GATGACTCAGTCTCCACTCTCCCTGCCCGTCACCC 1LR174K)
CTGGAGAGCCGGCCTCCATCTCCTGCAGGTCTAG (SEQ ID NO:
TCAGAGCCTCCTGCCTGGTAATGGATACAACTAT 101)
TTGGATTGGTACCTGCAGAAGCCAGGGCAGTCTC
CACAGCTCCTGATCTATTTGGGTTCTAATCGGGCC
TCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGCT
CAGGCACAGATTTTACACTGAAAATCAGCAGAGT
GGAGGCTGAGGATGTTGGGATTTATTACTGCATG
CAAGCTCTACAAACTCCTCGGACGTTCGGCCAAG
GGACCAAGGTGGAAATCAAACGAACTGTGGCTG
CACCATCTGTCTTCATCTTCCCGCCATCTGATGAG
CAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCT
GCTGAATAACTTCTATCCCAGAGAGGCCAAAGTT
CAGTGGAAGGTGGATAACGCCCTCCAATCGGGTA
ACTCCCAGGAGAGTGTCACAGAGCAGGACAGCA
AGGACAGCACCTACAGCCTCAGCAGCACCCTGAC
GCTGAGCAAAGCAGACTACGAGAAACACAAAGT
CTACGCCTGCGAAGTCACCCATCAGGGCCTGAGC
TCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGT GTTAG Light Chain
MRLPAQLLGLLMLWVSGSSGDIVMTQSPLSLPVTP Protein
GEPASISCRSSQSLLPGNGYNYLDWYLQKPGQSPQL (23.29.
LIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDV 1LR174K)
GIYYCMQALQTPRTFGQGTKVEIKRTVAAPSVFIFP (SEQ ID NO:
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNA 102)
LQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKH KVYACEVTHQGLSSPVTKSFNRGEC
TABLE-US-00021 TABLE 19 DNA and protein sequences of antibody
24.2.1 SEQUENCE (signal DESCRIPTION: sequence underlined): Heavy
Chain ATGAAACATCTGTGGTTCTTCCTTCTCCTGGTGGC DNA
AGCTCCCAGATGGGTCCTGTCCCAGGTGCAGCTG (SEQ ID NO:
CAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGG 85)
AGACCCTGTCCCTCACCTGCACTGTCTCTGGTGGC
TCCATCAGAGGTTACTACTGGAGCTGGATCCGGC
AGCCCCCAGGGAAGGGACTGGAGTGGATTGGGT
ATATCTATTACAGTGGGAGCACCAACTACAACCC
CTCCCTCAAGAGTCGAGTCACCATATCAGTAGAC
ACGTCCAAGAACCAGTTCTCCCTGAAGCTGAGTT
CTGTGACCGCTGCGGACACGGCCGTGTATTACTG
TGCGAGAAGGGGGGGCCTCTACGGTGACTACGG
CTGGTTCGCCCCCTGGGGCCAGGGAACCCTGGTC
ACCGTCTCCTCAGCCTCCACCAAGGGCCCATCGG
TCTTCCCCCTGGCGCCCTGCTCCAGGAGCACCTCC
GAGAGCACAGCGGCCCTGGGCTGCCTGGTCAAG
GACTACTTCCCCGAACCGGTGACGGTGTCGTGGA
ACTCAGGCGCTCTGACCAGCGGCGTGCACACCTT
CCCAGCTGTCCTACAGTCCTCAGGACTCTACTCCC
TCAGCAGCGTGGTGACCGTGCCCTCCAGCAACTT
CGGCACCCAGACCTACACCTGCAACGTAGATCAC
AAGCCCAGCAACACCAAGGTGGACAAGACAGTT
GAGCGCAAATGTTGTGTCGAGTGCCCACCGTGCC
CAGCACCACCTGTGGCAGGACCGTCAGTCTTCCT
CTTCCCCCCAAAACCCAAGGACACCCTCATGATC
TCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGG
ACGTGAGCCACGAAGACCCCGAGGTCCAGTTCAA
CTGGTACGTGGACGGCGTGGAGGTGCATAATGCC
AAGACAAAGCCACGGGAGGAGCAGTTCAACAGC
ACGTTCCGTGTGGTCAGCGTCCTCACCGTTGTGC
ACCAGGACTGGCTGAACGGCAAGGAGTACAAGT
GCAAGGTCTCCAACAAAGGCCTCCCAGCCCCCAT
CGAGAAAACCATCTCCAAAACCAAAGGGCAGCC
CCGAGAACCACAGGTGTACACCCTGCCCCCATCC
CGGGAGGAGATGACCAAGAACCAGGTCAGCCTG
ACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACA
TCGCCGTGGAGTGGGAGAGCAATGGGCAGCCGG
AGAACAACTACAAGACCACACCTCCCATGCTGGA
CTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTCA
CCGTGGACAAGAGCAGGTGGCAGCAGGGGAACG
TCTTCTCATGCTCCGTGATGCATGAGGCTCTGCAC
AACCACTACACGCAGAAGAGCCTCTCCCTGTCTC CGGGTAAATGA Heavy Chain
MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSE Protein
TLSLTCTVSGGSIRGYYWSWIRQPPGKGLEWIGYIY (SEQ ID NO:
YSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAA 86)
DTAVYYCARRGGLYGDYGWFAPWGQGTLVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV
TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPS
SNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPP
CPAPPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVD
VSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTF
RVVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEK
TISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVK
GFYPSDIAVEWESNGQPENNYKTTPPMLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK Light Chain
ATGGAAACCCCAGCGCAGCTTCTCTTCCTCCTGCT DNA
ACTCTGGCTCCCAGATACCACCGGAGAAATTGTG (SEQ ID NO:
TTGACGCAGTCTCCAGGCACCCTGTCTTTGTCTCC 87)
AGGGGAAAGAGCCACCCTCTCCTGCAGGGCCAGT
CAGAGTGTTAGCAGCACCTACTTAGCCTGGTACC
AGCAGAAACCTGGCCAGGCTCCCAGGCTCCTCAT
CTATGGTGCATCCAGCAGGGCCACTGGCATCCCA
GACAGGTTCAGTGGCAGTGGGTCTGGGACAGACT
TCACTCTCACCATCAGCAGACTGGAGCCTGAAGA
TTTTGCAGTGTATTACTGTCAGCAGTATAGTAGCT
TATTCACTTTCGGCCCTGGGACCAAAGTGGATAT
CAAACGAACTGTGGCTGCACCATCTGTCTTCATC
TTCCCGCCATCTGATGAGCAGTTGAAATCTGGAA
CTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTAT
CCCAGAGAGGCCAAAGTACAGTGGAAGGTGGAT
AACGCCCTCCAATCGGGTAACTCCCAGGAGAGTG
TCACAGAGCAGGACAGCAAGGACAGCACCTACA GCCTCAGCAGCACCCTGACGCTGAGCAAAGCAG
ACTACGAGAAACACAAAGTCTACGCCTGCGAAGT
CACCCATCAGGGCCTGAGCTCGCCCGTCACAAAG AGCTTCAACAGGGGAGAGTGTTAG Light
Chain METPAQLLFLLLLWLPDTTGEIVLTQSPGTLSLSPGE Protein
RATLSCRASQSVSSTYLAWYQQKPGQAPRLLIYGA (SEQ ID NO:
SSRATGIPDRFSGSGSGTDFTLTISRLEPEDFAVYYC 88)
QQYSSLFTFGPGTKVDIKRTVAAPSVFIFPPSDEQLK
SGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQ
ESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE VTHQGLSSPVTKSFNRGEC
TABLE-US-00022 TABLE 20 DNA and protein sequences of the mature
variable domains of antibody 22.1.1H-C109A SEQUENCE (signal
DESCRIPTION: sequence underlined): Heavy Chain
CAGGTGCAACTGGTGGAGTCTGGGGGAGGCGTG DNA
GTCCAGCCTGGGAGGTCCCTGAGACTCTCCTGTG (SEQ ID NO:
CAGCCTCTGGATTCACCTTCAGTCGCTATGGCAT 95)
GCACTGGGTCCGCCAGGCTCCAGGCAAGGGGCTG
GAGTGGGTGGCAGTTATATCATCTGATGGAGGTA
ATAAATACTATGCAGACTCCGTGAAGGGCCGATT
CACCATCTCCAGAGACAATTCCAAGAACACGCTG
TATCTGCAAATGAACAGCCTGAGAGCTGAGGACA
CGGCTGTGTATTACTGTACGAGAAGAGGGACTGG
AAAGACTTACTACCACTACGCCGGTATGGACGTC
TGGGGCCAAGGGACCACGGTCACCGTCTCCTCAG Heavy Chain
QVQLVESGGGVVQPGRSLRLSCAASGFTFSRYGMH Protein
WVRQAPGKGLEWVAVISSDGGNKYYADSVKGRFT (SEQ ID NO:
ISRDNSKNTLYLQMNSLRAEDTAVYYCTRRGTGKT 96) YYHYAGMDVWGQGTTVTVSS
TABLE-US-00023 TABLE 21 DNA and protein sequences of the mature
variable domains of antibody 23.28.1L-C92A SEQUENCE (signal
DESCRIPTION: sequence underlined): Light Chain
GAAATTGTGTTGACGCAGTCTCCAGGCACCCTGT DNA
CTTTGTCTCCAGGGGAAAGAGCCACCCTCTCCTG (SEQ ID NO:
CAGGGCCAGTCAGAGTGTTAGCAGCAGCGACTTA 99)
GCCTGGCACCAGCAGAAACCTGGCCAGGCTCCCA
GACTCCTCATCTATGGTGCATCCAGCAGGGCCAC
TGGCATCCCAGACAGGTTCAGTGGCAGTGGGTCT
GGGACAGACTTCACTCTCACCATCAGCAGACTGG
AGCCTGAAGATTTTGCAGTGTATTACTGTCAGCA
CGCCCGTAGCTTATTCACTTTCGGCCCTGGGACC AAAGTGGATATCAAAC Light Chain
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSDLAWH Protein
QQKPGQAPRLLIYGASSRATGIPDRFSGSGSGTDFTL (SEQ ID NO:
TISRLEPEDFAVYYCQHARSLFTFGPGTKVDIK 100)
Example III
Analysis of Heavy and Light Chain Amino Acid Substitutions
[0266] FIGS. 1D-1H and 2D-2H provide sequence alignments between
the predicted heavy chain variable domain amino acid sequences of
monoclonal antibodies 3.1.1, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1,
22.1.1, 22.1.1H-C109A, 23.5.1, 23.28.1, 23.28.1H-D16E, 23.29.1 and
24.2.1 antibodies and the germline amino acid sequences of their
respective genes. Most of the heavy chain CDR3 regions contain
amino acid insertions.
[0267] The DLR1 gene used in the V.sub.H domain of antibody 21.4.1
codes for two cysteine (Cys) residues. Mass spectrometry analysis
and homology modeling demonstrated that the two Cys residues are
disulfide-linked, and that this disulfide link does not disrupt the
structure of the antibody.
[0268] FIGS. 1A-1C and 2A-2C provide sequence alignments between
the predicted light chain variable amino acid sequences of
monoclonal antibodies 3.1.1, 7.1.2, 10.8.3, 15.1.1, 21.4.1, 21.2.1,
22.1.1, 23.5.1, 23.28.1, 23.28.1L-C92A, 23.29.1 and 24.2.1 clones
and the germline amino acid sequences of their respective genes.
The light chains of these antibodies are derived from three
different V.kappa. genes. Seven of the eleven antibodies use the
A3/A19 V.kappa. gene, six of which have two mutations in the CDR1
region. Further, five of the seven antibodies that use the A3/A19
V.kappa. gene, also use the J.kappa.1 gene; in all of these
antibodies the first amino acid derived from the J.kappa.1 gene is
consistently changed from a W to an R.
[0269] It will be appreciated that many of the above-identified
amino acid substitutions or insertions exist in close proximity to
or within a CDR. Such substitutions would appear to bear some
effect upon the binding of the antibody to the CD40 molecule.
Further, such substitutions could have significant effect upon the
affinity of the antibodies.
Example IV
Species Crossreactivity of the Antibodies of the Invention
[0270] We performed FACS analyses to determine the binding and
affinity of the antibodies of the invention for CD40 from various
species, particularly certain old world monkeys. We incubated
aliquots of human and monkey whole blood for 1 hour on ice with
increasing concentrations of anti-CD40 antibodies of the invention
exemplified herein or with an anti-keyhole limpet hemocyanin (KLH)
antibody as a negative control. We then incubated the samples for
30 minutes on ice with anti-human IgG2-conjugated RPE
(phycoerythrin). We measured binding by flow cytometry of CD19/CD20
positive B cells and analyzed the histograms of fluorescence
intensity (F12-H) versus cell number (Counts) using CellQuest
software. We estimated binding (K.sub.D) for each antibody from
graphs of mean fluorescence intensity versus antibody
concentration. We controlled for depletion of the antibody by
measuring binding over a range of cell concentrations.
[0271] We tested antibodies 3.1.1, 7.1.2, 10.8.3, 15.1.1 and 21.4.1
for binding to human, rhesus and cynomolgus B cells. We also tested
antibodies 21.2.1, 22.1.1, 23.5.1, 23.25.1, 23.28.1, 23.29.1 and
24.2.1 for binding to human and cynomolgus B cells.
[0272] We observed that the maximum signal and the concentration
for half maximum binding to monkey cells, was within a factor of
two to the corresponding parameters for human B cells. No binding
was observed in similar experiments with mouse, rat, rabbit and dog
blood.
Example V
Selectivity of Antibodies for CD40
[0273] We conducted another in vitro assay to determine the
selectivity of antibodies of the invention with respect to
CD40.
CD40 Selectivity ELISA: Materials and Methods
[0274] We coated a 96-well FluroNUNC plate (Nunc Cat No. 475515)
with four antigens: CD40/Ig, CD44/Ig, RANK/Ig, 4-1BB/Ig, TNFR-1/Ig
and TNFR-2/Ig (antigens generated in-house), overnight at
+4.degree. C. at 1 .mu.g/ml of 100 .mu.l/well in 0.1M sodium
bicarbonate buffer, pH 9.6. We then washed the plate with PBST
(PBS+0.1% Tween-20) three times and blocked the plate with
PBST+0.5% BSA at 150 .mu.l/well. We incubated the plate at room
temperature for 1 hour and then washed with PBST three times. Next,
we diluted the anti-CD40 antibodies generated in Example I in block
at 1 .mu.g/ml and added the diluted antibodies to the plate. We
incubated the plate at room temperature for 1 hour then washed with
PBST three times. We then treated the wells that contained the
antibodies generated in Example I with 100 ml/well anti-human
IgG2-HRP (Southern Biotech Cat No. 9070-05) at a 1:4000 dilution in
block. Also, we treated one row with anti-human IgG (Jackson Cat
No. 209-035-088) diluted to 1:5000 in block and added at 100
.mu.l/well to normalize for plate coating. We also treated one row
with anti-human CD40-HRP (Pharmingen Cat No. 345815/Custom HRP
conjugated) at 0.05 .mu.g/ml diluted in block as a positive
control. We incubated the plate at room temperature for 1 hour and
then washed with PBST three times. We added TMB substrate (K &
P Labs) at 100 .mu.l/well and incubated the plate for 5 to 10
minutes. We then read the plate using a Spectra-Max.TM. plate
reader. The results showed that the antibodies have a selectivity
for CD40 that is at least 100 times greater than their selectivity
for RANK, 4-1BB, TNFR-1 and TNFR-2 in that the CD4-specific signal
(CD40 signal minus background) is at least 100.times. greater than
the corresponding signal for the other molecules.
Example VI
Epitope Classification Studies
[0275] Having demonstrated that the antibodies of the invention are
selective for CD40, we performed competition binding analysis using
BIAcore and FACS.
BIAcore Competition Studies
[0276] We conducted BIAcore competition studies to determine
whether the human anti-CD40 antibodies of the invention bind to the
same or distinct sites on the CD40 molecule.
[0277] In these experiments we used a BIAcore 2000 instrument,
following the manufacturer's protocols. Protein-A was immobilized
on the sensor chip surfaces of the BIAcore. A saturating
concentration of CD40-Ig which comprises the extracellular domain
of CD40 was bound to the sensorchip. We then bound a first human
agonist anti-CD40 antibody of the invention, a commercial anti-CD40
antibody or CD40L to the sensorchip-bound CD40 under saturating
conditions. We then measured the ability of a second human agonist
anti-CD40 antibody of the invention to compete with the first
antibody, commercial antibody or CD40L for binding to CD40. This
technique enabled us to assign the antibodies to different binding
groups. Binding to CD40 indicated recognition of an independent
epitope. Lack of binding may indicate recognition of the same
epitope or overlapping epitopes.
FACS Studies
[0278] We conducted FACS studies to determine whether the human
anti-CD40 antibodies of the invention bind to the same or distinct
sites on the CD40 molecule, and to determine whether they bind to
the same or distinct site on the CD40 molecule as commercially
available anti-CD40 antibodies EA5 (Alexis Cat. No. ANC-300-050),
LOB7/6 (Serotec MCA/590PE) and 5C3 (Pharmingen #555458 (unlabeled)
and 555460 (PE labeled for FACS).
[0279] We counter-stained dendritic cells treated with anti-CD40
antibodies of the invention with PE labeled EA5 or PE labeled
LOB7/6 antibody on ice for 30 minutes. After a wash, cell staining
was analyzed on a B-D caliber cytometer. Reduced binding of the
commercial antibodies was interpreted as an indication that the
test antibody bound to the same or overlapping epitope.
[0280] Competition binding analysis by BIAcore and FACS showed that
the epitopes recognized by mAb 21.4.1 antibodies overlaps with the
epitope recognized by the EA5 antibody, did not overlap with the
epitope recognized by the commercially available LOB7/6 antibody
and does not overlap with the binding site for CD40L. The epitopes
recognized by the remaining antibodies do overlap with the binding
site for CD40L.
[0281] Table 22 summarizes the results of these epitope
classification studies.
TABLE-US-00024 TABLE 22 BIAcore Competition Epitope Classification
of Certain Anti-CD40 Antibodies Of The Invention 3.1.1, 21.2.1,
22.1.1, 23.25.1, 23.5.1, 23.28.1, EA5 5C3 LOB7/6 23.29.1 21.4.1
24.2.1 CD40L EA5 X X X X 5C3 X X X X X LOB7/6 X X X X 3.1.1, X X X
21.2.1, 22.1.1, 23.5.1, 23.29.1 21.4.1 X X X 23.25.1, X X X X
23.28.1, 24.2.1 CD40L X X X X X X
Example VII
Upregulation of Surface Molecules by Anti-CD40 Antibodies
[0282] We conducted a whole blood assay to determine whether the
human anti-CD40 antibodies of the invention upregulate the
expression of surface molecules on B cells.
[0283] Human or primate whole blood was diluted 1:1 with RPMI
medium and incubated 24 hours with various concentrations of CD40
agonist antibodies or controls. Cells were stained for 30 minutes
(on ice, in the dark) for HLA-DR, ICAM, B7-1, B7-2, CD19/CD20,
CD40, CD23 and CD71, using commercially available, fluorochrome
labeled antibody reagents. The cells were then analyzed on a
FACSCalibur.TM. (Becton-Dickinson). B-cells were identified by
gating on CD19 or CD20 positive cells, and activation markers
determined for this gate.
[0284] The maximum fold increase of median fluorescence (at
.ltoreq.1 .mu.g/ml antibody), and mean EC.sub.50 obtained using one
of the anti-CD40 antibodies of the claimed invention (21.4.1) are
shown in Table 23.
TABLE-US-00025 TABLE 23 Upregulation of B-Cell Surface Molecules by
an Anti-CD40 Antibody of the Invention Maximum Fold Increase
EC.sub.50 (ng/ml) Mean +/- St. Dev. Mean +/- St. Dev. MHC II 4.50
+/- 0.52 3.85 +/- 0.35 CD71 2.30 +/- 0.77 0.73 +/- 0.28 ICAM 4.52
+/- 2.42 15.3 +/- 7.3 CD23 69.9 +/- 25.8 19.0 +/- 4.4 B7-2 2.74 +/-
0.14 16.0 +/- 21.9
[0285] We also conducted experiments to determine whether the human
anti-CD40 antibodies of the invention upregulate the expression of
surface molecules of monocyte-derived dendritic cell.
Preparation of the Monocyte Derived Dendritic Cells
[0286] Peripheral blood was collected from normal human volunteers.
Mononuclear cells were isolated using Sigma ACCUSPIN.TM. tubes (St.
Louis, Mo.), washed with RPMI media (Gibco BRL, Rockville, Md.) and
placed into tissue culture flasks at 5.times.10.sup.6/ml in
complete RPMI medium (containing 100 U/ml penicillin/streptomycin,
10 mM HEPES buffer, 2 mM glutamine, 0.1 mM non-essential amino
acids; all from Gibco BRL); and 10% fetal calf serum (HyClone,
Logan, Utah). After a 3 hours of incubation at 37.degree. C. (5%
CO.sub.2), non-adherent cells were removed and the T cells were
isolated using selection columns (R&D Systems, Minneapolis,
Minn.). The adherent cells were washed with RPMI medium and
incubated for 7 days in complete RPMI medium supplemented with 10
ng/ml IL-4 (R&D Systems) and 100 ng/ml GM-CSF (R&D
systems). The non-adherent cells were then isolated, washed, and
utilized as monocyte derived dendritic cells (mDCs) for all
experiments. The remaining adherent cells were removed using
trypsin/EDTA and utilized in experiments employing adherent
monocytes.
[0287] To determine whether the anti-CD40 antibodies of the
invention upregulate the expression of cell surface markers, the
monocyte derived dendritic cells were cultured with various
concentrations of agonist antibodies for 48-72 hours, followed by
staining (30 minutes, on ice, in the dark) for HLA-DR, ICAM, B7-1,
B7-2, CD40 and CD83, using commercially available fluorochrome
labeled antibody reagents. The cells were then analyzed on a
FACS-Caliber (Becton-Dickinson).
[0288] The maximum fold increase of median fluorescence (at
.ltoreq.1 .mu.g/ml antibody), and mean EC.sub.50 obtained using one
of the anti-CD40 antibodies of the claimed invention (21.4.1) are
shown in Table 24.
TABLE-US-00026 TABLE 24 Upregulation of Dendritic Cell Surface
Molecules by an Anti-CD40 Antibody of the Invention Maximum Fold
Increase EC.sub.50 (ng/ml) Mean +/- St. Dev. Mean +/- St. Dev. MHC
II 7.7 +/- 5.6 252 +/- 353 CD83 36.3 +/- 42.2 233 +/- 262 ICAM 10.4
+/- 4.8 241 +/- 140 B7-2 21.9 +/- 9.4 71.4 +/- 44.4
[0289] We conducted similar experiments with B cells and mDCs using
various anti-CD40 antibodies of the invention and additional
markers. We measured the expression of B cell surface molecules
(MHC-II, ICAM, B7-1, B7-2 and CD23) as described above but using 1
.mu.g/ml of the anti-CD40 antibody. The results of this experiment
are presented in Table 25. We measured the expression of dendritic
cell surface molecules (MHC-II, ICAM, B7-1, B7-2 and CD83) after 72
hours as indicated above but using 1 .mu.g/ml of the anti-CD40
antibody. The results of this experiment are presented in Table 26.
Tables 25-26 show the fold increase in median intensity+/-standard
deviation.
TABLE-US-00027 TABLE 25 Upregulation of B-Cell Surface Molecules by
Anti-CD40 Antibodies Of The Invention MHC Class II ICAM (CD54) B7-1
(CD 80) B7-2 (CD86) CD23 B cell B cell B cell B cell B cell 3.1.1
3.2 +/- 2.6 1.3 +/- 0.2 1.7 +/- 0.2 1.2 +/- 0.4 5.6 +/- 4.8 21.2.1
1.2 +/- 0.2 1.3 +/- 0.9 0.9 +/- 0.5 1.0 +/- 0.04 1.0 +/- 0.1 21.4.1
3.6 +/- 3.0 5.0 +/- 3.0 1.9 +/- 0.8 1.8 +/- 0.7 21.5 +/- 34.8
22.1.1 1.4 +/- 0.5 1.1 +/- 0.2 1.2 +/- 0.3 1.0 +/- 0.1 1.3 +/- 0.2
23.5.1 1.4 +/- 0.5 1.1 +/- 0.2 1.4 +/- 0.6 1.0 +/- 0.1 1.1 +/- 0.2
23.25.1 2.5 +/- 1.1 2.5 +/- 0.9 1.6 +/- 0.4 1.3 +/- 0.2 4.3 +/- 2.3
23.28.1 1.1 +/- 0.2 1.1 +/- 0.2 1.8 +/- 0.6 1.0 +/- 0.1 1.1 +/- 0.4
23.29.1 1.2 +/- 0.2 1.0 +/- 0.2 1.3 +/- 0.6 0.9 +/- 0.2 1.1 +/- 0.1
24.2.1 1.8 +/- 1.0 1.6 +/- 0.8 1.1 +/- 0.4 1.1 +/- 0.2 0.9 +/-
0.6
TABLE-US-00028 TABLE 26 Upregulation of Dendritic Cell Surface
Molecules by Anti-CD40 Antibodies Of The Invention MHC Class II
ICAM (CD54) B7-1 (CD 80) B7-2 (CD86) CD83 DC DC DC DC DC 3.1.1 4.4
+/- 2.4 1.5 +/- 0.7 1.8 +/- 0.9 23.7 +/- 33.5 15.2 +/- 18.2 21.2.1
1.8 +/- 1.3 1.5 +/- 0.9 0.9 +/- 0.4 7.4 +/- 10.5 10.8 +/- 16.5
21.4.1 5.0 +/- 3.8 3.7 +/- 1.4 1.5 +/- 1.1 12.9 +/- 13.3 48.6 +/-
49.5 22.1.1 2.3 +/- 1.2 1.6 +/- 0.7 1.4 +/- 1.0 16.3 +/- 25.5 12.0
+/- 17.0 23.5.1 2.3 +/- 1.8 1.2 +/- 0.5 1.1 +/- 0.6 10.7 +/- 17.5
9.2 +/- 11.1 23.25.1 2.1 +/- 1.8 2.4 +/- 1.0 1.1 +/- 0.5 3.3 +/-
4.2 13.6 +/- 28.9 23.28.1 2.4 +/- 1.7 2.7 +/- 2.1 1.3 +/- 0.6 10.6
+/- 17.5 18.3 +/- 22.6 23.29.1 2.0 +/- 1.5 1.2 +/- 0.4 0.9 +/- 0.5
8.4 +/- 10.6 10.6 +/- 13.1 24.2.1 4.7 +/- 3.0 2.1 +/- 1.2 3.8 +/-
3.8 56.6 +/- 95.8 31.2 +/- 28.4
[0290] Table 27 compares the upregulation of cell surface molecules
in dendritic cells over B cells in terms of the ratio of the
mean-fold increase on dendritic cells over the mean-fold increase
on B cells.
TABLE-US-00029 TABLE 27 Upregulation of Cell Surface Molecules On
Dendritic Cells Over B Cells B7-1 B7-2 (CD80) (CD86) MHC Class II
ICAM (CD54) 3.1.1 1.08 19.40 1.38 1.15 21.2.1 1.01 7.37 1.49 1.12
21.4.1 0.77 7.04 1.37 0.74 22.1.1 1.18 16.36 1.61 1.44 23.5.1 0.83
10.54 1.59 1.06 23.25.1 0.66 2.57 0.85 0.98 23.28.1 0.71 10.81 2.16
2.57 23.29.1 0.73 9.07 1.66 1.23 24.2.1 3.48 52.30 2.64 1.35
Example VIII
Enhancement of Cytokine Secretion
[0291] We conducted a monocyte derived dendritic cell assay to
determine whether the human anti-CD40 antibodies of the invention
enhance the secretion of IL-12p40, IL-12p70 and IL-8.
[0292] The monocyte derived dendritic cells and the adherent
monocytes were prepared as described above. Cells were cultured in
the presence of an anti-CD40 antibody of the invention (21.4.1) or
with a anti-keyhole limpet hemocyanin (KLH) antibody as a negative
control. The cytokines were measured in the supernatants at 24
hours by ELISA (R&D Systems). In some studies (see Table 28),
the monocyte derived dendritic cells treated with the antibody also
were co-stimulated with either 100 ng/ml LPS (Sigma), 1000 U/ml
IFN.gamma. (R&D Systems) or 25 ng/ml IL-1.beta. R&D
systems.
[0293] The anti-CD40 antibody enhanced IL-12p40, IL-12p70 and IL-8
production in both monocyte derived dendritic cells and adherent
monocytes. The presence of LPS further enhanced the production of
IL-12p40 and IL-12p70. Only minimal levels of cytokines were
detected in the supernatants of dendritic cells incubated with the
isotype control antibody, anti-KLH. Representative results are
presented in Table 28 and in FIGS. 3 and 4. Table 28 summarizes the
principle cytokines produced by dendritic cells or adherent
monocytes by 1 .mu.g/ml of an anti-CD40 antibody of the invention
(21.4.1)+/-100 ng/ml LPS. As shown in FIG. 3, the anti-CD40
antibody enhanced IL-12p40 production by human dendritic cells.
FIG. 4 illustrates enhanced IL-12p70 production by human dendritic
cells in the presence of antibody and 100 ng/ml LPS.
TABLE-US-00030 TABLE 28 Enhancement of IL-12p40, IL-12p70 and IL-8
Secretion by an Anti-CD40 Antibody of the Invention Treatment
Induced cytokine Antibody LPS IL-12p40 IL-12p70 IL-8 Cell Type 1
.mu.g/ml 100 ng/ml pg/ml pg/ml pg/ml Dendritic 21.4.1 + 32252 1000
ND cell 21.4.1 - 1200 76 1200 anti-KLH + 14280 352 ND anti-KLH -
200 4 150 Adherent 21.4.1 - ND ND 7000 monocyte 21.4.1 + ND 425 ND
anti-KLH - ND ND 400 anti-KLH + ND 30 ND ND = not determined
[0294] Similar experiments were performed using multiple anti-CD40
antibodies of the invention. The monocyte derived dendritic cells
were prepared as described above and cultured in the presence of
various concentrations of the anti-CD40 antibodies and were
co-stimulated with 100 ng/ml LPS (Sigma). The IL-12p70 in the
supernatant was measured at 24 hours by ELISA (R&D Systems) and
the for each antibody EC.sub.50 was determined. The results of the
experiments are presented in Table 29.
TABLE-US-00031 TABLE 29 Enhancement of IL-12p70 Secretion In
Dendritic Cells DC IL-12p70 Antibody EC.sub.50: Max Clone g/ml
pg/ml 21.4.1 0.3 1796-7004 22.1.1 0.1 720-1040 23.25.1 0.2 540-960
23.5.1 0.1 676-1112 24.2.1 0.2 754-3680 3.1.1 0.2 668-960 23.28.1
0.2 1332-1404 23.29.1 0.1 852-900 21.2.1 0.03 656-872
[0295] We also tested the ability of the anti-CD40 antibodies of
the invention to enhance the secretion of IFN-gamma from T cells in
an allogenic T cell/dendritic cell assay. To perform this assay, T
cells and monocytes were isolated from the peripheral blood of
healthy volunteers. Monocytes were differentiated into dendritic
cells using the above-described methods. 1.times.10.sup.5 T cells
obtained from an individual were cultured with 1.times.10.sup.5
dendritic cells obtained from a different individual in the
presence of an anti-CD40 antibody of the invention or a control
antibody. After 4 days of culture, the supernatants were assayed
for IFN-gamma secretion by ELISA. The results of this assay are
shown in Table 30.
TABLE-US-00032 TABLE 30 Enhancement of IFN-gamma Secretion by
Anti-CD40 Antibodies Of The Invention Allo DC/T IFN( Antibody
EC.sub.50: Max Clone g/ml pg/ml 21.4.1 0.3 212 22.1.1 0.3 110-180
23.25.1 0.3 180-232 23.5.1 0.2 150-240 24.2.1 0.2 111-194 3.1.1 0.1
100-195 23.28.1 0.2 120-190 23.29.1 0.3 134-150 21.2.1 0.03
230-256
Example IX
Induction of Inflammatory Cytokines by the Anti-CD40 Antibodies of
the Invention
[0296] Antibodies 10.8.3, 15.1.1, 21.4.1 and 3.1.1 were tested in a
whole-blood cytokine release assay described by Wing et al.,
Therapeutic. Immunol. 2:183-90 (1995) to determine if inflammatory
cytokines are induced by the antibodies at 1, 10 and 100 .mu.g/ml
concentration. No significant release of TNF-.alpha., IL-1 (3,
IFN-.gamma., or IL-6 was observed with these antibodies at the
indicated concentrations in blood from 10 normal donors.
Example X
Enhancement of Immunogenicity of Cell Line Jy by Anti-CD40
Antibodies
[0297] CD40 positive JIYOYE cells (ATCC CCL 87) ("Jy cells") were
cultured and maintained in RPMI medium. JIYOYE cells were incubated
for 24 hours with an anti-CD40 antibody of the invention (21.4.1),
or with an isotype matched antibody (anti-KLH), in complete RPMI
medium. Cells were then washed and treated with 25 mg mitomycin C
(Sigma)/7 ml media for 60 min. These cells were then incubated with
isolated human T cells at a 1:100 ratio for 6 days at 37.degree. C.
(5% CO.sub.2). T cells were then collected, washed, and the level
of CTL activity determined against fresh chromium 51 (New England
Nuclear, Boston, Mass.) labeled JIYOYE cells. Specific CTL activity
was calculated as % specific cytolysis=(cytolysis Jy
(cpm)-spontaneous cytolysis (cpm))/(total cytolysis
(cpm)-spontaneous cytolysis (cpm)).
[0298] As FIG. 5 illustrates, an anti-CD40 antibody of the
invention (21.4.1) significantly enhanced the immunogenicity
against Jy cells treated with the antibody.
Example XI
Animal Tumor Model
[0299] To further investigate the anti-tumor activity of the
anti-CD40 antibodies made in accordance with the invention, we
designed a SCID-beige mouse model to test the in vivo effect of the
antibody on tumor growth.
[0300] We obtained SCID-beige mice from Charles River and we
allowed the mice to acclimate one week prior to use. We injected
tumor cells (Daudi cells (ATCC CCL 213), CD40 (-) K562 cells (ATCC
CCL 243) and CD40 (+) Raji cells (ATCC CCL 86), BT474 breast cancer
cells (ATCC HTB 20) or PC-3 prostate cells (ATCC CRL 1435))
subcutaneously at a concentration of 1.times.10.sup.7 cells/animal.
In some cases, we injected T cells (5.times.10.sup.5) and dendritic
cells (1.times.10.sup.5) from the same human donor along with the
tumor cells. We also injected an anti-CD40 antibody of the
invention, or an isotype matched control (anti-KLH),
intraperitoneally, immediately prior to tumor injection (one
injection only). We then measured tumor growth. Specific
experiments are described below.
[0301] In one experiment, we injected an anti-CD40 antibody of the
invention (21.4.1), or an isotype matched control (anti-KLH),
intraperitoneally, at a dose of 10 mg/kg immediately prior to tumor
injection (one injection only). The tumor cells (Daudi cells) were
injected subcutaneously at a concentration of 1.times.10.sup.7
cells/animal. We measured tumor growth with calipers at days 17,
19, 20, 21, 25, 26, 27 and 28 after implantation in the presence of
human T cells and dendritic cells. As shown in FIG. 6, the
anti-CD40 antibody inhibited tumor growth by about [60]%.
[0302] In another experiment, we injected an anti-CD40 antibody of
the invention (21.4.1), or an isotype matched control (anti-KLH),
intraperitoneally, at a dose of 0.1 mg/kg, 1 mg/kg or 10 mg/kg
immediately prior to tumor injection (one injection only). The
tumor cells (K562 cells) were injected subcutaneously at a
concentration of 1.times.10.sup.7 cells/animal. In this experiment
we injected T cells (5.times.10.sup.5) and dendritic cells
(1.times.10.sup.5) from the same human donor along with the tumor
cells. We measured tumor growth with calipers at days 17, 19, 20,
21, 25, 26, 27 and 28 after implantation. As shown in FIG. 7, the
anti-CD40 antibody inhibited tumor growth by 60-85%.
[0303] In another experiment, we injected an anti-CD40 antibody of
the invention (21.4.1, 23.29.1 or 3.1.1), or an isotype matched
control (anti-KLH), intraperitoneally, immediately prior to tumor
injection (one injection only). The isotype matched control
antibody and antibody 21.4.1 were injected at a dose of 1 mg/ml.
Antibodies 23.29.1 and 3.1.1 were injected at a dose of 1, 0.1,
0.01, 0.001 or 0.0001 mg/kg. The tumor cells (K562 cells) were
injected subcutaneously at a concentration of 1.times.10.sup.7
cells/animal. In this experiment we injected T cells
(5.times.10.sup.5) and dendritic cells (1.times.10.sup.5) from the
same human donor along with the tumor cells. We then measured tumor
growth with calipers at day 28 after implantation. The results of
this experiment are shown in FIGS. 8 and 9. Each point in the
figures represents a measurement from an individual animal.
[0304] In another experiment, we injected an anti-CD40 antibody of
the invention (21.4.1), or an isotype matched control (anti-KLH),
intraperitoneally, immediately prior to tumor injection (one
injection only). The antibodies were injected at a dose of 1, 0.1,
0.01, 0.001 or 0.0001 mg/kg. The tumor cells (Raji cells) were
injected subcutaneously at a concentration of 1.times.10.sup.7
cells/animal. In some animals, we injected T cells
(5.times.10.sup.5) and dendritic cells (1.times.10.sup.5) from the
same human donor along with the tumor cells. We then measured tumor
growth with calipers at day 28 after implantation. The results of
this experiment are shown in FIG. 10. Each point in the figure
represents a measurement from an individual animal.
[0305] In yet another experiment, we injected an anti-CD40 antibody
of the invention (21.4.1, 23.28.1, 3.1.1 or 23.5.1), or an isotype
matched control (anti-KLH), intraperitoneally, immediately prior to
tumor injection (one injection only). The antibodies were injected
at a dose of 1 or 0.1 mg/kg. The tumor cells (Raji cells) were
injected subcutaneously at a concentration of 1.times.10.sup.7
cells/animal. We then measured tumor growth with calipers at day 28
after implantation. The results of this experiment are shown in
FIG. 11. Each point in the figure represents a measurement from an
individual animal.
[0306] In yet another experiment, we injected an anti-CD40 antibody
of the invention (21.4.1, 23.29.1, or 3.1.1), or an isotype matched
control (anti-KLH), intraperitoneally, immediately prior to tumor
injection (one injection only). The antibodies were injected at a
dose of 1 mg/kg. The tumor cells (BT474 breast cancer cells) were
injected subcutaneously at a concentration of 1.times.10.sup.7
cells/animal. We injected T cells (5.times.10.sup.5) and dendritic
cells (1.times.10.sup.5) from the same human donor along with the
tumor cells. We then measured tumor growth with calipers at day 39
after implantation. As shown in FIG. 12, all of the antibodies
inhibited breast cancer tumor growth. Each point in the figure
represents a measurement from an individual animal.
[0307] In yet another experiment, we injected an anti-CD40 antibody
of the invention (3.1.1), or an isotype matched control (anti-KLH),
intraperitoneally, immediately prior to tumor injection (one
injection only). The antibodies were injected at a dose of 1 mg/kg.
The tumor cells (PC-3 prostate tumor cells) were injected
subcutaneously at a concentration of 1.times.10.sup.7 cells/animal.
We then measured tumor growth with calipers at day 41 after
implantation. As shown in FIG. 13, the anti-CD40 antibody inhibited
prostate tumor growth by about 60%. Each point in the figure
represents a measurement from an individual animal.
Example XII
Survival of SCID-Beige Mice Injected with Daudi Tumor Cells and
Treated with the Anti-CD40 Antibodies of the Invention
[0308] In another experiment, we injected an anti-CD40 antibody of
the invention, or an isotype matched (one injection) control,
intraperitoneally, immediately prior to tumor injection. The
antibodies were injected at a dose of 1 or 0.1 mg/kg. The tumor
cells (Daudi cells) were injected intravenously at a dose of
5.times.10.sup.6 cells/animal. We then monitor animal survival. As
shown in FIG. 14, all of the anti-CD40 antibodies tested prolonged
the survival of mice injected tumors by at least six days.
[0309] Table 31 lists the ED.sub.50 of the anti-CD40 antibodies in
the different solid tumor models described in Example XI. Table 31
summarizes the in vivo anti-tumor activity of some of the anti-CD40
antibodies of the invention in SCID mice. In addition, the table
lists the ED.sub.50 of the anti-CD40 antibodies in the Daudi
systemic tumor model described above in Example XII.
TABLE-US-00033 TABLE 31 ED.sub.50 Of Anti-CD40 Antibodies Of The
Invention Using Different In Vivo Tumor Models in SCID mice CD40(-)
K562 CD40(+) Raji & T/DC & T/DC CD40(+) Raji CD40(+) sub-
sub- sub- Daudi cutaneous cutaneous cutaneous intra-venous Antibody
(mg/kg) (mg/kg) (mg/kg) (mg/kg) 21.4.1 0.005 0.0008 0.016 0.1
22.1.1 0.01 ND >1.0 0.1 23.25.1 -1.0 ND >1.0 ND 23.5.1
>1.0 ND -1.0 ND 24.2.1 >1.0 ND >1.0 ND 3.1.1 0.02 ND -0.1
. . . 0.1 23.28.1 >1.0 ND -1.0 0.1 23.29.1 0.009 ND >1.0 . .
. 0.1 21.2.1 . . . 1.0 ND ND ND ND = Not Done
Example XIII
Determination of Affinity Constants (K.sub.D) of Fully Human
Anti-CD40 Antibodies by BIAcore
[0310] We performed affinity measures of purified antibodies by
surface plasmon resonance using the BIAcore 3000 instrument,
following the manufacturer's protocols.
[0311] The Biosensor biospecific interaction analysis instrument
(BIAcore) uses surface plasmon resonance to measure molecular
interactions on a CMS sensor chip. Changes in the refractive
indices between two media, glass and carboxymethylated dextran,
caused by the interaction of molecules to the dextran side of the
sensor chip, is measured and reported as changes in arbitrary
reflectance units (RU) as detailed in the manufacturer's
application notes.
[0312] The carboxymethylated dextran surface of a flow cell on a
sensor chip was activated by derivatization with 0.05 M
N-hydroxysuccinimide mediated by 0.2 M
N-ethyl-N'-(dimethylaminopropyl) carbodiimide for 7 min. CD40-Ig
fusion protein (described in Example I) at a concentration of 5
.mu.g/ml, in 10 mM Na acetate, pH 3.5, was manually injected into
the flow cell at a rate of 5 .mu.l/min and covalently immobilized
to the flow cell surface with the desired amount of RU's.
Deactivation of unreacted N-hydroxysuccinimide esters was performed
using 1 M ethanolamine hydrochloride, pH 8.5. Following
immobilization, the flow cells are cleaned of any unreacted or
poorly bound material with 5 regeneration injections of 5 .mu.l of
50 mM NaOH until a stable baseline is achieved. Flow cell 2, a high
density surface, measured approximately 300 RU's following surface
preparation and flow cell 3, a low density surface, measured
approximately 150 RU's. For flow cell 1, the activated blank
surface, 35 .mu.l of 10 mM Na acetate buffer was injected during
immobilization in place of antigen. Flow cell 4 contained
approximately 450 RU's of immobilized CTLA4-Ig, an irrelevant
antigen control.
[0313] A dilution series of each antibody was prepared in the
concentration range of 100 .mu.g/ml to 0.1 .mu.g/ml by half logs.
The flow rate was set at 5 .mu.l/min and 25 .mu.l of each
concentration point sample was injected over the sensor chip with a
regeneration injection of 5 .mu.l of 50 mM NaOH between each
concentration of antibody injected. The data was analyzed using
BIAevaluation 3.0 software.
[0314] In reverse orientation kinetic experiments, the antibody
21.4.1 was immobilized to the sensor chip surface using the
protocol described above. Anti-KLH was used as a control antibody
surface. The antigen, CD40-Ig fusion protein, was injected in the
concentration range of 100 .mu.g/ml to 0.1 .mu.g/ml.
[0315] Table 32 lists affinity measurements for representative
anti-CD40 antibodies of the present invention:
TABLE-US-00034 TABLE 32 Affinity Measurements For Anti-CD40
Antibodies Of The Invention Antibody K.sub.on (1/Ms) K.sub.off
(1/s) K.sub.D (M) 3.1.1 1.12 .times. 10.sup.6 3.31 .times.
10.sup.-5 3.95 .times. 10.sup.-11 10.8.3 2.22 .times. 10.sup.5 4.48
.times. 10.sup.-7 2.23 .times. 10.sup.-12 15.1.1 8.30 .times.
10.sup.4 2.83 .times. 10.sup.-7 4.05 .times. 10.sup.-12 21.4.1 8.26
.times. 10.sup.4 2.23 .times. 10.sup.-5 3.48 .times. 10.sup.-10
22.1.1 9.55 .times. 10.sup.5 1.55 .times. 10.sup.-4 2.79 .times.
10.sup.-10 23.25.1 3.83 .times. 10.sup.5 1.65 .times. 10.sup.-7
7.78 .times. 10.sup.-12 23.28.1 7.30 .times. 10.sup.5 8.11 .times.
10.sup.-5 1.61 .times. 10.sup.-10 23.29.1 3.54 .times. 10.sup.5
3.90 .times. 10.sup.-5 7.04 .times. 10.sup.-11
Example XIV
Epitope Mapping of Anti-CD40 Antibodies
[0316] The binding assays were done using Protein A purified
CD40-human IgG1 Fc fusion antigen. The human CD40-IgG1 Fc fusion
protein was cloned at Pfizer. The human CD40 IgG1 fusion protein
was expressed in a mammalian cell line and purified over Protein A
column. The purity of the fusion antigen was assessed by
SDS/PAGE.
[0317] CD40 has a structure of a typical type I transmembrane
protein. The mature molecule is composed of 277 amino acids. The
extracellular domain of CD40 consists of four TNFR-like cysteine
rich domains. See, e.g., Neismith and Sprang, TIES 23:74-79 (1998);
van Kooten and Banchereau, J. Leukocyte Biol. 67:2-17 (2000);
Stamenkovic et al., EMBO J. 8:1403-1410 (1989).
Binding of Anti-CD40 Antibodies to Reduced and Non-Reduced Human
CD40:
[0318] Because the extracellular domain of CD40 consists of four
cysteine rich domains, disruption of the intramolecular bonds, by
reducing agent, can change antibody reactivity. To determine
whether disruption of the intramolecular bonds, by reducing agent,
changed the reactivity of selected anti-CD40 antibodies of the
invention, purified CD40-hIgG was loaded on SDS/PAGE (4-20% gel)
under non-reducing (NR), or reducing (R), conditions. SDS/PAGE was
performed by the method of Laemmli, using a mini-gel system.
Separated proteins were transferred on to nitrocellulose membrane.
Membranes were blocked using PBS containing 5% (w/v) non fat dried
milk for at least 1 hour before developing, and probed for 1 hr
with each antibody. Anti-CD40 antibodies were detected using
HRP-conjugated goat anti-human immunoglobulins (1:8,000 dilution;
Catalog No. A-8667 from Sigma). Membranes were developed by using
enhanced Chemiluminescence (ECL.RTM.; Amersham Bioscience)
according to the manufacturer's instructions.
[0319] The Western Blot was then probed with four anti-CD40
antibodies of the invention: 21.4.1, 23.25.1, 23.29.1 and 24.2.1 (1
.mu.g/ml) followed by HRP conjugated goat anti-human IgG (1:8000
dilution). The results of this experiment are show in FIG. 15. The
results indicate that antibodies 21.4.1, 23.25.1, 23.29.1 and
24.2.1 bind non-reduced but do not bind reduced CD40, the
antibodies, thus, recognize a conformational epitope.
Binding of Anti-CD40 Antibodies to Human CD40 Domain Deleted
Proteins:
[0320] The extracellular region of CD40 includes four TNFR-like
repeat domains (referred to as D1-D4). See, e.g., Neismith and
Sprang, TIBS 23:74-79 (1998); van Kooten and Banchereau, J.
Leukocyte Biol. 67:2-17 (2000); Stamenkovic et al., EMBO J.
8:1403-1410 (1989). FIG. 16 shows the amino acid sequences of the
mouse and human CD40 domains D1-D4. To investigate the contribution
of different regions of the CD40 molecule in the presentation of
the epitope, a number of domain deleted mutants were
constructed.
[0321] To make the human CD40 deletion constructs, the entire
extracellular domain of human CD40 (amino acids 1-193) was
amplified from human B cells (CD19+) cDNA (Multiple tissue cDNA
panels, Catalog No. K1428-1, from Clontech) by PCR using sequence
specific primers, and a 6.times.His-tag was added at the
C-terminal. A human CD40 5' primer 5'-GCAAGCTTCACCAATGGT
TCGTCTGCCTCTGCAGTG-3' (SEQ ID NO: 135) was used with different
combination of 3' primers for cloning of full length and truncated
CD40 molecules. The 3' primer for cloning the full-length
extracellular domain of human CD40 was:
5'-TCAGTGATGGTGATGGTGATGTCTCAGCCGAT CCTGGGGACCA-3' (SEQ ID NO:
136). The 3' primer used to clone the D1-D3 domains of human CD40
was: 5'-TCAGTGATGGTGATGGTGATGTGGGCA GGGCTCGCGATGGTAT-3' (SEQ ID NO:
137) The 3' primer used to clone the D1-D2 domains of CD40 was:
5'-TCAGTGATGGTGATGGTGATGA CAGGTGCAGATGGTGTCTGTT-3' (SEQ ID NO:
138). After these constructs of truncated CD40 cDNA were generated,
they were expressed in the 293F cell line using the pCR3.1 vector
(Invitrogen). The CD40-6.times.His fusion proteins (SEQ ID NOS
139-141) were purified by elution from a nickel column.
[0322] The amino acid sequences of these four deletion mutants are
shown in Table 33.
TABLE-US-00035 TABLE 33 CD40 His-Tag Fusion Proteins Deletion Amino
Acid Sequence Mutant: (leader sequence underlined) Human CD40-
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINS 6XHis (full
QCCSLCQPGQKLVSDCTEFTETECLPC length
GESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGT extra-
SETDTICTCEEGWHCTSEACESCVLHRS cellular
CSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEK domain)-
CHPWTSCETKDLVVQQAGTNKTDVVC GPQDRHHHHHH (SEQ ID NO: 139) Human CD40
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINS (D1-D3)-
QCCSLCQPGQKLVSDCTEFTETECLPC 6xHis
GESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGT SETDTICTCEEGWHCTSEACESCVLHRS
CSPGFGVKQIATGVSDTICEPCPHHHHHH (SEQ ID NO: 140) Human CD40
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINS (D1-D2)-
QCCSLCQPGQKLVSDCTEFTETECLPC 6Xhis
GESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGT SETDTICTCHHHHHH (SEQ ID NO:
141)
[0323] To express these human CD40 deletion constructs, the
constructs were cloned into the pCR3.1 vector (Invitrogen) and
expression was assessed in various stable and transiently
transfected 293F cell lines. The supernatants from transiently
transfected 293F cells were analyzed for binding to antibodies
21.4.1, 23.25.1, 23.29.1 and 24.2.1 by ELISA and Western Blot.
[0324] ELISA assays were preformed using supernatant from 293F
cells transfected with different CD40 constructs. ELISA plates were
coated goat anti-human CD40 polyclonal antibodies (R&D catalog
No. AF 632) or goat anti-mouse CD40 polyclonal antibodies (R&D
catalog No. AF 440) diluted to 1 .mu.g/ml in ELISA plate coating
buffer. Expression of CD40 constructs in 293F cells was confirmed
by detection with biotinylated goat anti-human CD40 (R&D
catalog No. BAF 632), goat anti-mouse CD40 (R&D catalog No. BAF
440), or HRP-conjugated anti-His (C terminal) antibody (Invitrogen,
Catalog No. 46-0707). Binding of anti-CD40 human antibodies were
detected with HRP conjugated goat anti-human IgG (FC specific
Caltag H10507), diluted 1:2,000. The results, as shown in Table 34,
indicate that most if not all of the epitope recognized by mAbs
21.4.1, 23.28.1 and 23.29.1 is located in the D1-D2 region of CD40
while the epitope for mAb 24.2.1 is located at least partly in
domain D3-D4. A human CD40-rabbit Fc fusion protein was used a
control to confirm the specificity of the antibody binding.
TABLE-US-00036 TABLE 34 ELISA: Antibody Binding To CD40 Deletion
Mutants Human CD40 Human CD40 Human CD40- (D1-D2)-6Xhis
(D1-D3)-6XHis 6XHis (SEQ ID NO: 141) (SEQ ID NO: 140) (SEQ ID NO:
139) 21.4.1 + + + 23.25.1 + + + 23.29.1 + + + 24.2.1 - + + anti-His
+ + + anti- ND ND ND RbIg
[0325] The CD40 deletion constructs also were analyzed by Western
Blot analysis. The results are shown in Table 35. The ELISA results
show that the binding site of antibodies 21.4.1, 23.25.1, 23.29.1
and 24.2.1 involves domains D1-D3. The results also show that the
binding site for antibodies 21.4.1, 23.25.1 and 23.29.1 involve
domains D1-D2, and that the binding site of antibody 24.2.1
involves domain D3.
TABLE-US-00037 TABLE 35 Western Blot: Antibody Binding To CD40
Deletion Mutant Human CD40(D1-D3)- 6XHis Human CD40-6Xhis (SEQ ID
NO: 140) (SEQ ID NO: 139) 21.4.1 + + 23.25.1 + + 23.29.1 + + 24.2.1
+ + anti-His + + Anti-RbIg ND ND
Binding of Anti-CD40 Antibodies to Mouse CD40:
[0326] We set out to determine the ability of antibodies 21.4.1,
23.25.1, 23.29.1 and 24.2.1 to bind mouse CD40.
[0327] For this experiment, mouse CD40 was amplified from mouse B
cells cDNA. Mouse CD40 (D1-D3)-6.times.His fusion protein was
cloned into pCR3.1, which utilizes the CMV promoter, to drive
transcription. The 5' primer used to clone the extracellular domain
of the mouse CD40 was: 5'-TGCAAGCTTCACCATGGTGTCTTTGCCTCGGCTGTG-3'
(SEQ ID NO: 146). The 3' primer used to clone the D1-D3 domains of
mouse CD40 was:
5'-GTCCTCGAGTCAGTGATGGTGATGGTGATGTGGGCAGGGATGACAGAC-3' (SEQ ID NO:
147). Mouse and human cDNA constructs were transfected into 293F
cells transiently. The expression of recombinant CD40 was detected
by ELISA using polyclonal antibodies against mouse and human CD40,
anti-His antibodies, and anti-CD40 antibodies 21.4.1, 23.25.1,
23.29.1 and 24.2.1. The results of these experiments are shown in
Table 36. This experiment shows that all antibodies are specific to
human CD40 and do not cross react with mouse CD40.
TABLE-US-00038 TABLE 36 Cross-Reactivity of Mouse and Human CD40
Mouse CD40(D1-D3)- Human CD40(D1-D3)- 6XHis 6XHis (SEQ ID NO: 140)
(SEQ ID NO: 140) 21.4.1 No Yes 23.25.1 No Yes 23.29.1 No Yes 24.2.1
No Yes goat anti-human CD40 No Yes goat anti-mouse CD40 Yes No
Anti-His Yes Yes
Binding of Anti-CD40 Antibodies to of Human/Mouse Chimeric
CD40:
[0328] Because antibodies 21.4.1, 23.25.1, 23.29.1 and 24.2.1 do
not bind mouse CD40, we constructed human/mouse chimeric CD40
proteins to more definitively map the epitopes of those
antibodies.
[0329] For the construction of in-frame fusions of the human and
murine CD40 chimeric proteins, we used unique restriction sites at
the borders of CD40 domains at identical positions in the cDNA of
both human and mouse CD40. Various cDNA constructs of CD40 were
generated using the EcoRI restriction site at the end of domain 1
(nucleotide 244, amino acid 64) and the BanI restriction site at
the end of domain 2 (nucleotide 330, amino acid 94) (FIG. 17).
[0330] Various CD40 domains were amplified by PCR and ligated. This
approach allowed the replacement of various domains of the mouse
CD40 by the homologous domains from the human CD40. The constructs
obtained are shown in FIG. 18.
[0331] We then determined whether antibodies 21.4.1, 23.25.1,
23.29.1 and 24.2.1 were able to bind the mouse/human chimeric CD40
proteins by ELISA. The results of this experiment are shown in
Table 37. As shown in Table 37, mAbs 21.4.1 and 23.25.1 recognize
and epitope that is located partly in D1 and partly in D2; mAb
23.29.1 recognizes an epitope located mostly if not completely in
D2; and mAb 24.2.1 recognizes an epitope located in D2 and D3.
TABLE-US-00039 TABLE 37 Antibody Binding to Chimeric CD40 Proteins
HuD1, HuD2, HuD1, Antibody HuD1 HuD2 HuD3 D2 D3 D3 21.4.1 No No No
Yes No No 23.25.1 No No No Yes No No 23.29.1 No Yes No Yes Yes No
24.2.1 No No No No Yes No
[0332] All publications and patent applications cited in this
specification are herein incorporated by reference as if each
individual publication or patent application were specifically and
individually indicated to be incorporated by reference. Although
the foregoing invention has been described in some detail by way of
illustration and example for purposes of clarity of understanding,
it will be readily apparent to those of ordinary skill in the art
in light of the teachings of this invention that certain changes
and modifications may be made thereto without departing from the
spirit or scope of the invention.
Sequence CWU 1
1
1471378DNAHomo sapiens 1caggtgcagc tggtggagtc tgggggaggc gtggtccagc
ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt agttatggca
tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg ggtggcagtt
atatcaaagg atggaggtaa taaataccat 180gcagactccg tgaagggccg
attcaccatc tccagagaca attccaagaa tgcgctgtat 240ctgcaaatga
atagcctgag agttgaagac acggctgtgt attactgtgt gagaagaggg
300catcagctgg ttctgggata ctactactac aacggtctgg acgtctgggg
ccaagggacc 360acggtcaccg tctcctca 3782126PRTHomo sapiens 2Gln Val
Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20
25 30 Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ala Val Ile Ser Lys Asp Gly Gly Asn Lys Tyr His Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser
Lys Asn Ala Leu Tyr 65 70 75 80Leu Gln Met Asn Ser Leu Arg Val Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Val Arg Arg Gly His Gln Leu
Val Leu Gly Tyr Tyr Tyr Tyr Asn Gly 100 105 110 Leu Asp Val Trp Gly
Gln Gly Thr Thr Val Thr Val Ser Ser 115 120 125 3336DNAHomo sapiens
3gatattgtgc tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
60atctcctgca ggtctagtca gagcctcttg tatagtaatg gatacaactt tttggattgg
120tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca
cagattttac actgaaaatc 240agcagattgg aggctgagga tgttggggtt
tattactgca tgcaagctct acaaactcct 300cggacgttcg gccaagggac
caaggtggaa atcaaa 3364112PRTHomo sapiens 4Asp Ile Val Leu Thr Gln
Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser
Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Tyr Ser 20 25 30 Asn Gly
Tyr Asn Phe Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45
Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50
55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys
Ile 65 70 75 80Ser Arg Leu Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys
Met Gln Ala 85 90 95 Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 105 110 51416DNAHomo sapiens 5atggagtttg
ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag 60gtgcagctgg
tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcct ctggattcac cttcagtagt tatggcatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt ggcagttata tcaaaggatg
gaggtaataa ataccatgca 240gactccgtga agggccgatt caccatctcc
agagacaatt ccaagaatgc gctgtatctg 300caaatgaata gcctgagagt
tgaagacacg gctgtgtatt actgtgtgag aagagggcat 360cagctggttc
tgggatacta ctactacaac ggtctggacg tctggggcca agggaccacg
420gtcaccgtct cctcagcctc caccaagggc ccatcggtct tccccctggc
gccctgctcc 480aggagcacct ccgagagcac agcggccctg ggctgcctgg
tcaaggacta cttccccgaa 540ccggtgacgg tgtcgtggaa ctcaggcgct
ctgaccagcg gcgtgcacac cttcccagct 600gtcctacagt cctcaggact
ctactccctc agcagcgtgg tgaccgtgcc ctccagcaac 660ttcggcaccc
agacctacac ctgcaacgta gatcacaagc ccagcaacac caaggtggac
720aagacagttg agcgcaaatg ttgtgtcgag tgcccaccgt gcccagcacc
acctgtggca 780ggaccgtcag tcttcctctt ccccccaaaa cccaaggaca
ccctcatgat ctcccggacc 840cctgaggtca cgtgcgtggt ggtggacgtg
agccacgaag accccgaggt ccagttcaac 900tggtacgtgg acggcgtgga
ggtgcataat gccaagacaa agccacggga ggagcagttc 960aacagcacgt
tccgtgtggt cagcgtcctc accgttgtgc accaggactg gctgaacggc
1020aaggagtaca agtgcaaggt ctccaacaaa ggcctcccag cccccatcga
gaaaaccatc 1080tccaaaacca aagggcagcc ccgagaacca caggtgtaca
ccctgccccc atcccgggag 1140gagatgacca agaaccaggt cagcctgacc
tgcctggtca aaggcttcta ccccagcgac 1200atcgccgtgg agtgggagag
caatgggcag ccggagaaca actacaagac cacacctccc 1260atgctggact
ccgacggctc cttcttcctc tacagcaagc tcaccgtgga caagagcagg
1320tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca
caaccactac 1380acgcagaaga gcctctccct gtctccgggt aaatga
14166471PRTHomo sapiens 6Met Glu Phe Gly Leu Ser Trp Val Phe Leu
Val Ala Leu Leu Arg Gly 1 5 10 15 Val Gln Cys Gln Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln 20 25 30 Pro Gly Arg Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe 35 40 45 Ser Ser Tyr Gly
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60 Glu Trp
Val Ala Val Ile Ser Lys Asp Gly Gly Asn Lys Tyr His Ala 65 70 75
80Asp Ser Val Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
85 90 95 Ala Leu Tyr Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr
Ala Val 100 105 110 Tyr Tyr Cys Val Arg Arg Gly His Gln Leu Val Leu
Gly Tyr Tyr Tyr 115 120 125 Tyr Asn Gly Leu Asp Val Trp Gly Gln Gly
Thr Thr Val Thr Val Ser 130 135 140 Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe Pro Leu Ala Pro Cys Ser 145 150 155 160Arg Ser Thr Ser Glu
Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp 165 170 175 Tyr Phe Pro
Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr 180 185 190 Ser
Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr 195 200
205 Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln
210 215 220 Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys
Val Asp 225 230 235 240Lys Thr Val Glu Arg Lys Cys Cys Val Glu Cys
Pro Pro Cys Pro Ala 245 250 255 Pro Pro Val Ala Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys 260 265 270 Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 275 280 285 Asp Val Ser His Glu
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp 290 295 300 Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 305 310 315
320Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp
325 330 335 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Gly Leu 340 345 350 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys
Gly Gln Pro Arg 355 360 365 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Glu Glu Met Thr Lys 370 375 380 Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp 385 390 395 400Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 405 410 415 Thr Thr Pro
Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 420 425 430 Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 435 440
445 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
450 455 460 Leu Ser Leu Ser Pro Gly Lys 465 470 7720DNAHomo sapiens
7atgaggctcc ctgctcagct cctggggctg ctaatgctct gggtctctgg atccagtggg
60gatattgtgc tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
120atctcctgca ggtctagtca gagcctcttg tatagtaatg gatacaactt
tttggattgg 180tacctgcaga agccagggca gtctccacag ctcctgatct
atttgggttc taatcgggcc 240tccggggtcc ctgacaggtt cagtggcagt
ggatcaggca cagattttac actgaaaatc 300agcagattgg aggctgagga
tgttggggtt tattactgca tgcaagctct acaaactcct 360cggacgttcg
gccaagggac caaggtggaa atcaaacgaa ctgtggctgc accatctgtc
420ttcatcttcc cgccatctga tgagcagttg aaatctggaa ctgcctctgt
tgtgtgcctg 480ctgaataact tctatcccag agaggccaaa gtacagtgga
aggtggataa cgccctccaa 540tcgggtaact cccaggagag tgtcacagag
caggacagca aggacagcac ctacagcctc 600agcagcaccc tgacgctgag
caaagcagac tacgagaaac acaaagtcta cgcctgcgaa 660gtcacccatc
agggcctgag ctcgcccgtc acaaagagct tcaacagggg agagtgttag
7208239PRTHomo sapiens 8Met Arg Leu Pro Ala Gln Leu Leu Gly Leu Leu
Met Leu Trp Val Ser 1 5 10 15 Gly Ser Ser Gly Asp Ile Val Leu Thr
Gln Ser Pro Leu Ser Leu Pro 20 25 30 Val Thr Pro Gly Glu Pro Ala
Ser Ile Ser Cys Arg Ser Ser Gln Ser 35 40 45 Leu Leu Tyr Ser Asn
Gly Tyr Asn Phe Leu Asp Trp Tyr Leu Gln Lys 50 55 60 Pro Gly Gln
Ser Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala 65 70 75 80Ser
Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe 85 90
95 Thr Leu Lys Ile Ser Arg Leu Glu Ala Glu Asp Val Gly Val Tyr Tyr
100 105 110 Cys Met Gln Ala Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly
Thr Lys 115 120 125 Val Glu Ile Lys Arg Thr Val Ala Ala Pro Ser Val
Phe Ile Phe Pro 130 135 140 Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr
Ala Ser Val Val Cys Leu 145 150 155 160Leu Asn Asn Phe Tyr Pro Arg
Glu Ala Lys Val Gln Trp Lys Val Asp 165 170 175 Asn Ala Leu Gln Ser
Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp 180 185 190 Ser Lys Asp
Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys 195 200 205 Ala
Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln 210 215
220 Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225
230 235 9387DNAHomo sapiens 9caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt
agctatggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatcaaatg atggagataa taaataccat 180gcagactccg
tgtggggccg attcaccatc tccagagaca attccaggag cacgctttat
240ctgcaaatga acagcctgag agctgaggac acggctgtat attactgtgc
gagaagaggc 300atggggtcta gtgggagccg tggggattac tactactact
acggtttgga cgtctggggc 360caagggacca cggtcaccgt ctcctca
38710129PRTHomo sapiens 10Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Ser
Asn Asp Gly Asp Asn Lys Tyr His Ala Asp Ser Val 50 55 60 Trp Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Arg Ser Thr Leu Tyr 65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Arg Gly Met Gly Ser Ser Gly Ser Arg Gly Asp Tyr
Tyr Tyr 100 105 110 Tyr Tyr Gly Leu Asp Val Trp Gly Gln Gly Thr Thr
Val Thr Val Ser 115 120 125 Ser 11336DNAHomo sapiens 11gatattgtga
tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc 60atctcctgca
ggtctagtca gagcctcttg tatagtaatg gatacaactt tttggattgg
120tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca
cagattttac actgaaaatc 240agcagagtgg aggctgagga tgttggggtt
tattactgca tgcaagctct acaaactcct 300cggacgttcg gccaagggac
caaggtggaa atcaaa 33612112PRTHomo sapiens 12Asp Ile Val Met Thr Gln
Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser
Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Tyr Ser 20 25 30 Asn Gly
Tyr Asn Phe Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45
Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50
55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys
Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys
Met Gln Ala 85 90 95 Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile Lys 100 105 110 131425DNAHomo sapiens 13atggagtttg
ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag 60gtgcagctgg
tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcct ctggattcac cttcagtagc tatggcatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt ggcagttata tcaaatgatg
gagataataa ataccatgca 240gactccgtgt ggggccgatt caccatctcc
agagacaatt ccaggagcac gctttatctg 300caaatgaaca gcctgagagc
tgaggacacg gctgtatatt actgtgcgag aagaggcatg 360gggtctagtg
ggagccgtgg ggattactac tactactacg gtttggacgt ctggggccaa
420gggaccacgg tcaccgtctc ctcagcctcc accaagggcc catcggtctt
ccccctggcg 480ccctgctcca ggagcacctc cgagagcaca gcggccctgg
gctgcctggt caaggactac 540ttccccgaac cggtgacggt gtcgtggaac
tcaggcgctc tgaccagcgg cgtgcacacc 600ttcccagctg tcctacagtc
ctcaggactc tactccctca gcagcgtggt gaccgtgccc 660tccagcaact
tcggcaccca gacctacacc tgcaacgtag atcacaagcc cagcaacacc
720aaggtggaca agacagttga gcgcaaatgt tgtgtcgagt gcccaccgtg
cccagcacca 780cctgtggcag gaccgtcagt cttcctcttc cccccaaaac
ccaaggacac cctcatgatc 840tcccggaccc ctgaggtcac gtgcgtggtg
gtggacgtga gccacgaaga ccccgaggtc 900cagttcaact ggtacgtgga
cggcgtggag gtgcataatg ccaagacaaa gccacgggag 960gagcagttca
acagcacgtt ccgtgtggtc agcgtcctca ccgttgtgca ccaggactgg
1020ctgaacggca aggagtacaa gtgcaaggtc tccaacaaag gcctcccagc
ccccatcgag 1080aaaaccatct ccaaaaccaa agggcagccc cgagaaccac
aggtgtacac cctgccccca 1140tcccgggagg agatgaccaa gaaccaggtc
agcctgacct gcctggtcaa aggcttctac 1200cccagcgaca tcgccgtgga
gtgggagagc aatgggcagc cggagaacaa ctacaagacc 1260acacctccca
tgctggactc cgacggctcc ttcttcctct acagcaagct caccgtggac
1320aagagcaggt ggcagcaggg gaacgtcttc tcatgctccg tgatgcatga
ggctctgcac 1380aaccactaca cgcagaagag cctctccctg tctccgggta aatga
142514474PRTHomo sapiens 14Met Glu Phe Gly Leu Ser Trp Val Phe Leu
Val Ala Leu Leu Arg Gly 1 5 10 15 Val Gln Cys Gln Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln 20 25 30 Pro Gly Arg Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe 35 40 45 Ser Ser Tyr Gly
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60 Glu Trp
Val Ala Val Ile Ser Asn Asp Gly Asp Asn Lys Tyr His Ala 65 70 75
80Asp Ser Val Trp Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Arg Ser
85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Arg Gly Met Gly Ser Ser Gly
Ser Arg Gly Asp 115 120 125 Tyr Tyr Tyr Tyr Tyr Gly Leu Asp Val Trp
Gly Gln Gly Thr Thr Val 130 135 140 Thr Val Ser Ser Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala 145 150 155 160Pro Cys Ser Arg Ser
Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu 165 170 175 Val Lys Asp
Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly 180 185 190 Ala
Leu Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser 195 200
205 Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe
210 215 220 Gly Thr Gln Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser
Asn Thr 225 230 235 240Lys Val Asp Lys Thr Val Glu Arg Lys Cys Cys
Val Glu Cys Pro Pro 245 250 255 Cys Pro Ala Pro Pro Val Ala Gly Pro
Ser Val Phe Leu Phe Pro Pro 260 265 270 Lys Pro
Lys Asp Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys 275 280 285
Val Val Val Asp Val Ser His Glu Asp Pro Glu Val Gln Phe Asn Trp 290
295 300 Tyr Val Asp Gly Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu 305 310 315 320Glu Gln Phe Asn Ser Thr Phe Arg Val Val Ser Val
Leu Thr Val Val 325 330 335 His Gln Asp Trp Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn 340 345 350 Lys Gly Leu Pro Ala Pro Ile Glu
Lys Thr Ile Ser Lys Thr Lys Gly 355 360 365 Gln Pro Arg Glu Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu 370 375 380 Met Thr Lys Asn
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr 385 390 395 400Pro
Ser Asp Ile Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn 405 410
415 Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe
420 425 430 Leu Tyr Ser Lys Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn 435 440 445 Val Phe Ser Cys Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr 450 455 460 Gln Lys Ser Leu Ser Leu Ser Pro Gly Lys
465 470 15720DNAHomo sapiens 15atgaggctcc ctgctcagct cctggggctg
ctaatgctct gggtctctgg atccagtggg 60gatattgtga tgactcagtc tccactctcc
ctgcccgtca cccctggaga gccggcctcc 120atctcctgca ggtctagtca
gagcctcttg tatagtaatg gatacaactt tttggattgg 180tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
240tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac
actgaaaatc 300agcagagtgg aggctgagga tgttggggtt tattactgca
tgcaagctct acaaactcct 360cggacgttcg gccaagggac caaggtggaa
atcaaacgaa ctgtggctgc accatctgtc 420ttcatcttcc cgccatctga
tgagcagttg aaatctggaa ctgcctctgt tgtgtgcctg 480ctgaataact
tctatcccag agaggccaaa gtacagtgga aggtggataa cgccctccaa
540tcgggtaact cccaggagag tgtcacagag caggacagca aggacagcac
ctacagcctc 600agcagcaccc tgacgctgag caaagcagac tacgagaaac
acaaagtcta cgcctgcgaa 660gtcacccatc agggcctgag ctcgcccgtc
acaaagagct tcaacagggg agagtgttag 72016239PRTHomo sapiens 16Met Arg
Leu Pro Ala Gln Leu Leu Gly Leu Leu Met Leu Trp Val Ser 1 5 10 15
Gly Ser Ser Gly Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro 20
25 30 Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln
Ser 35 40 45 Leu Leu Tyr Ser Asn Gly Tyr Asn Phe Leu Asp Trp Tyr
Leu Gln Lys 50 55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu
Gly Ser Asn Arg Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly
Ser Gly Ser Gly Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg Val
Glu Ala Glu Asp Val Gly Val Tyr Tyr 100 105 110 Cys Met Gln Ala Leu
Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr Lys 115 120 125 Val Glu Ile
Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140 Pro
Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu 145 150
155 160Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val
Asp 165 170 175 Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr
Glu Gln Asp 180 185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr
Leu Thr Leu Ser Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val Tyr
Ala Cys Glu Val Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val Thr
Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235 17357DNAHomo sapiens
17caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcggagac cctgtccctc
60acctgcactg tctctggtgg ctccatcagt agttactact ggatctggat ccggcagccc
120gccgggaagg gactggaatg gattgggcgt gtctatacca gtgggagcac
caactacaac 180ccctccctca agagtcgagt caccatgtca gtagacacgt
ccaagaacca gttctccctg 240aagctgagct ctgtgaccgc cgcggacacg
gccgtgtatt actgtgcgag agatggtctt 300tacagggggt acggtatgga
cgtctggggc caagggacca cggtcaccgt ctcctca 35718119PRTHomo sapiens
18Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1
5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Ser
Tyr 20 25 30 Tyr Trp Ile Trp Ile Arg Gln Pro Ala Gly Lys Gly Leu
Glu Trp Ile 35 40 45 Gly Arg Val Tyr Thr Ser Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Met Ser Val Asp Thr
Ser Lys Asn Gln Phe Ser Leu 65 70 75 80Lys Leu Ser Ser Val Thr Ala
Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Asp Gly Leu Tyr
Arg Gly Tyr Gly Met Asp Val Trp Gly Gln Gly 100 105 110 Thr Thr Val
Thr Val Ser Ser 115 19321DNAHomo sapiens 19gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gcctattagc agctggttag cctggtatca gcagaaacca 120gggaaagccc
ctaaactcct gatttattct gcctccggtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcagcct 240gaagattttg caacttacta ttgtcaacag actgacagtt
tcccgctcac tttcggcggc 300gggaccaagg tggagatcaa a 32120107PRTHomo
sapiens 20Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Pro
Ile Ser Ser Trp 20 25 30 Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys
Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ser Ala Ser Gly Leu Gln Ser
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Thr Asp Ser Phe Pro Leu 85 90 95 Thr Phe
Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 211395DNAHomo sapiens
21atgaaacacc tgtggttctt cctcctgctg gtggcagctc ccagatgggt cctgtcccag
60gtgcagctgc aggagtcggg cccaggactg gtgaagcctt cggagaccct gtccctcacc
120tgcactgtct ctggtggctc catcagtagt tactactgga tctggatccg
gcagcccgcc 180gggaagggac tggaatggat tgggcgtgtc tataccagtg
ggagcaccaa ctacaacccc 240tccctcaaga gtcgagtcac catgtcagta
gacacgtcca agaaccagtt ctccctgaag 300ctgagctctg tgaccgccgc
ggacacggcc gtgtattact gtgcgagaga tggtctttac 360agggggtacg
gtatggacgt ctggggccaa gggaccacgg tcaccgtctc ctcagcctcc
420accaagggcc catcggtctt ccccctggcg ccctgctcca ggagcacctc
cgagagcaca 480gcggccctgg gctgcctggt caaggactac ttccccgaac
cggtgacggt gtcgtggaac 540tcaggcgctc tgaccagcgg cgtgcacacc
ttcccagctg tcctacagtc ctcaggactc 600tactccctca gcagcgtggt
gaccgtgccc tccagcaact tcggcaccca gacctacacc 660tgcaacgtag
atcacaagcc cagcaacacc aaggtggaca agacagttga gcgcaaatgt
720tgtgtcgagt gcccaccgtg cccagcacca cctgtggcag gaccgtcagt
cttcctcttc 780cccccaaaac ccaaggacac cctcatgatc tcccggaccc
ctgaggtcac gtgcgtggtg 840gtggacgtga gccacgaaga ccccgaggtc
cagttcaact ggtacgtgga cggcgtggag 900gtgcataatg ccaagacaaa
gccacgggag gagcagttca acagcacgtt ccgtgtggtc 960agcgtcctca
ccgttgtgca ccaggactgg ctgaacggca aggagtacaa gtgcaaggtc
1020tccaacaaag gcctcccagc ccccatcgag aaaaccatct ccaaaaccaa
agggcagccc 1080cgagaaccac aggtgtacac cctgccccca tcccgggagg
agatgaccaa gaaccaggtc 1140agcctgacct gcctggtcaa aggcttctac
cccagcgaca tcgccgtgga gtgggagagc 1200aatgggcagc cggagaacaa
ctacaagacc acacctccca tgctggactc cgacggctcc 1260ttcttcctct
acagcaagct caccgtggac aagagcaggt ggcagcaggg gaacgtcttc
1320tcatgctccg tgatgcatga ggctctgcac aaccactaca cgcagaagag
cctctccctg 1380tctccgggta aatga 139522464PRTHomo sapiens 22Met Lys
His Leu Trp Phe Phe Leu Leu Leu Val Ala Ala Pro Arg Trp 1 5 10 15
Val Leu Ser Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys 20
25 30 Pro Ser Glu Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser
Ile 35 40 45 Ser Ser Tyr Tyr Trp Ile Trp Ile Arg Gln Pro Ala Gly
Lys Gly Leu 50 55 60 Glu Trp Ile Gly Arg Val Tyr Thr Ser Gly Ser
Thr Asn Tyr Asn Pro 65 70 75 80Ser Leu Lys Ser Arg Val Thr Met Ser
Val Asp Thr Ser Lys Asn Gln 85 90 95 Phe Ser Leu Lys Leu Ser Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr 100 105 110 Tyr Cys Ala Arg Asp
Gly Leu Tyr Arg Gly Tyr Gly Met Asp Val Trp 115 120 125 Gly Gln Gly
Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 130 135 140 Ser
Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr 145 150
155 160Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr 165 170 175 Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His
Thr Phe Pro 180 185 190 Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu
Ser Ser Val Val Thr 195 200 205 Val Pro Ser Ser Asn Phe Gly Thr Gln
Thr Tyr Thr Cys Asn Val Asp 210 215 220 His Lys Pro Ser Asn Thr Lys
Val Asp Lys Thr Val Glu Arg Lys Cys 225 230 235 240Cys Val Glu Cys
Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser 245 250 255 Val Phe
Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 260 265 270
Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro 275
280 285 Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His Asn
Ala 290 295 300 Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe
Arg Val Val 305 310 315 320Ser Val Leu Thr Val Val His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr 325 330 335 Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro Ala Pro Ile Glu Lys Thr 340 345 350 Ile Ser Lys Thr Lys Gly
Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 355 360 365 Pro Pro Ser Arg
Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys 370 375 380 Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 385 390 395
400Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu Asp
405 410 415 Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp
Lys Ser 420 425 430 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val
Met His Glu Ala 435 440 445 Leu His Asn His Tyr Thr Gln Lys Ser Leu
Ser Leu Ser Pro Gly Lys 450 455 460 23705DNAHomo sapiens
23atgaggctcc ctgctcagct cctggggctc ctgctgctct ggttcccagg ttccagatgc
60gacatccaga tgacccagtc tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc
120atcacttgtc gggcgagtca gcctattagc agctggttag cctggtatca
gcagaaacca 180gggaaagccc ctaaactcct gatttattct gcctccggtt
tgcaaagtgg ggtcccatca 240aggttcagcg gcagtggatc tgggacagat
ttcactctca ccatcagcag cctgcagcct 300gaagattttg caacttacta
ttgtcaacag actgacagtt tcccgctcac tttcggcggc 360gggaccaagg
tggagatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca
420tctgatgagc agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa
taacttctat 480cccagagagg ccaaagtaca gtggaaggtg gataacgccc
tccaatcggg taactcccag 540gagagtgtca cagagcagga cagcaaggac
agcacctaca gcctcagcag caccctgacg 600ctgagcaaag cagactacga
gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 660ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gttag 70524234PRTHomo sapiens
24Met Arg Leu Pro Ala Gln Leu Leu Gly Leu Leu Leu Leu Trp Phe Pro 1
5 10 15 Gly Ser Arg Cys Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val
Ser 20 25 30 Ala Ser Val Gly Asp Arg Val Thr Ile Thr Cys Arg Ala
Ser Gln Pro 35 40 45 Ile Ser Ser Trp Leu Ala Trp Tyr Gln Gln Lys
Pro Gly Lys Ala Pro 50 55 60 Lys Leu Leu Ile Tyr Ser Ala Ser Gly
Leu Gln Ser Gly Val Pro Ser 65 70 75 80Arg Phe Ser Gly Ser Gly Ser
Gly Thr Asp Phe Thr Leu Thr Ile Ser 85 90 95 Ser Leu Gln Pro Glu
Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Thr Asp 100 105 110 Ser Phe Pro
Leu Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys Arg 115 120 125 Thr
Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln 130 135
140 Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
145 150 155 160Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala
Leu Gln Ser 165 170 175 Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr 180 185 190 Tyr Ser Leu Ser Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys 195 200 205 His Lys Val Tyr Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro 210 215 220 Val Thr Lys Ser Phe
Asn Arg Gly Glu Cys 225 230 25363DNAHomo sapiens 25caggtgcagc
tgcaggagtc gggcccagga ctggtgaagc cttcggagac cctgtccctc 60acctgcactg
tctctggtgg ctccatcaga agttactact ggacctggat ccggcagccc
120ccagggaagg gactggagtg gattggatat atctattaca gtgggagcac
caactacaat 180ccctccctca agagtcgagt caccatatca gtagacatgt
ccaagaacca gttctccctg 240aagctgagtt ctgtgaccgc tgcggacacg
gccgtttatt actgtgcgag aaagggtgac 300tacggtggta attttaacta
ctttcaccag tggggccagg gaaccctggt caccgtctcc 360tca 363 26121PRTHomo
sapiens 26Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro
Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser
Ile Arg Ser Tyr 20 25 30 Tyr Trp Thr Trp Ile Arg Gln Pro Pro Gly
Lys Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser
Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser
Val Asp Met Ser Lys Asn Gln Phe Ser Leu 65 70 75 80Lys Leu Ser Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Lys
Gly Asp Tyr Gly Gly Asn Phe Asn Tyr Phe His Gln Trp Gly 100 105 110
Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 27336DNAHomo sapiens
27gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
60atctcctgca ggtctagtca gagcctccta catactaatg gatacaacta tttcgattgg
120tacctgcaga agccagggca gtctccacaa ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca
cagattttac actgaaaatc 240agcagagtgg aggctgagga tgttggggtt
tattactgca tgcaagctct acaaactccg 300tacagttttg gccaggggac
caagctggag atcaaa 33628112PRTHomo sapiens 28Asp Ile Val Met Thr Gln
Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser
Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu His Thr 20 25 30 Asn Gly
Tyr Asn Tyr Phe Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45
Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50
55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys
Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr
Cys Met Gln Ala 85 90 95 Leu Gln Thr Pro Tyr Ser Phe Gly Gln Gly
Thr Lys Leu Glu Ile Lys 100 105 110 291401DNAHomo sapiens
29atgaaacatc tgtggttctt ccttctcctg gtggcagctc ccagatgggt cctgtcccag
60gtgcagctgc aggagtcggg cccaggactg gtgaagcctt cggagaccct gtccctcacc
120tgcactgtct ctggtggctc catcagaagt tactactgga cctggatccg
gcagccccca 180gggaagggac tggagtggat tggatatatc tattacagtg
ggagcaccaa ctacaatccc 240tccctcaaga gtcgagtcac catatcagta
gacatgtcca agaaccagtt ctccctgaag 300ctgagttctg tgaccgctgc
ggacacggcc gtttattact gtgcgagaaa gggtgactac 360ggtggtaatt
ttaactactt tcaccagtgg ggccagggaa ccctggtcac cgtctcctca
420gcctccacca agggcccatc ggtcttcccc ctggcgccct gctccaggag
cacctccgag 480agcacagcgg ccctgggctg cctggtcaag gactacttcc
ccgaaccggt gacggtgtcg 540tggaactcag gcgctctgac cagcggcgtg
cacaccttcc cagctgtcct acagtcctca 600ggactctact ccctcagcag
cgtggtgacc gtgccctcca gcaacttcgg cacccagacc 660tacacctgca
acgtagatca caagcccagc aacaccaagg tggacaagac agttgagcgc
720aaatgttgtg tcgagtgccc accgtgccca gcaccacctg tggcaggacc
gtcagtcttc 780ctcttccccc caaaacccaa ggacaccctc atgatctccc
ggacccctga ggtcacgtgc 840gtggtggtgg acgtgagtca cgaagacccc
gaggtccagt tcaactggta cgtggacggc 900gtggaggtgc ataatgccaa
gacaaagcca cgggaggagc agttcaacag cacgttccgt 960gtggtcagcg
tcctcaccgt tgtgcaccag gactggctga acggcaagga gtacaagtgc
1020aaggtctcca acaaaggcct cccagccccc atcgagaaaa ccatctccaa
aaccaaaggg 1080cagccccgag aaccacaggt gtacaccctg cccccatccc
gggaggagat gaccaagaac 1140caggtcagcc tgacctgcct ggtcaaaggc
ttctacccca gcgacatcgc cgtggagtgg 1200gagagcaatg ggcagccgga
gaacaactac aagaccacac ctcccatgct ggactccgac 1260ggctccttct
tcctctacag caagctcacc gtggacaaga gcaggtggca gcaggggaac
1320gtcttctcat gctccgtgat gcatgaggct ctgcacaacc actacacgca
gaagagcctc 1380tccctgtctc cgggtaaatg a 140130466PRTHomo sapiens
30Met Lys His Leu Trp Phe Phe Leu Leu Leu Val Ala Ala Pro Arg Trp 1
5 10 15 Val Leu Ser Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val
Lys 20 25 30 Pro Ser Glu Thr Leu Ser Leu Thr Cys Thr Val Ser Gly
Gly Ser Ile 35 40 45 Arg Ser Tyr Tyr Trp Thr Trp Ile Arg Gln Pro
Pro Gly Lys Gly Leu 50 55 60 Glu Trp Ile Gly Tyr Ile Tyr Tyr Ser
Gly Ser Thr Asn Tyr Asn Pro 65 70 75 80Ser Leu Lys Ser Arg Val Thr
Ile Ser Val Asp Met Ser Lys Asn Gln 85 90 95 Phe Ser Leu Lys Leu
Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr 100 105 110 Tyr Cys Ala
Arg Lys Gly Asp Tyr Gly Gly Asn Phe Asn Tyr Phe His 115 120 125 Gln
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys 130 135
140 Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu
145 150 155 160Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro 165 170 175 Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr
Ser Gly Val His Thr 180 185 190 Phe Pro Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val 195 200 205 Val Thr Val Pro Ser Ser Asn
Phe Gly Thr Gln Thr Tyr Thr Cys Asn 210 215 220 Val Asp His Lys Pro
Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg 225 230 235 240Lys Cys
Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly 245 250 255
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 260
265 270 Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu 275 280 285 Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His 290 295 300 Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe
Asn Ser Thr Phe Arg 305 310 315 320Val Val Ser Val Leu Thr Val Val
His Gln Asp Trp Leu Asn Gly Lys 325 330 335 Glu Tyr Lys Cys Lys Val
Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu 340 345 350 Lys Thr Ile Ser
Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 355 360 365 Thr Leu
Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 370 375 380
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 385
390 395 400Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Met 405 410 415 Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp 420 425 430 Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His 435 440 445 Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro 450 455 460 Gly Lys 465
31720DNAHomo sapiens 31atgaggctcc ctgctcagct cctggggctg ctaatgctct
gggtctctgg atccagtggg 60gatattgtga tgactcagtc tccactctcc ctgcccgtca
cccctggaga gccggcctcc 120atctcctgca ggtctagtca gagcctccta
catactaatg gatacaacta tttcgattgg 180tacctgcaga agccagggca
gtctccacaa ctcctgatct atttgggttc taatcgggcc 240tccggggtcc
ctgacaggtt cagtggcagt ggatcaggca cagattttac actgaaaatc
300agcagagtgg aggctgagga tgttggggtt tattactgca tgcaagctct
acaaactccg 360tacagttttg gccaggggac caagctggag atcaaacgaa
ctgtggctgc accatctgtc 420ttcatcttcc cgccatctga tgagcagttg
aaatctggaa ctgcctctgt tgtgtgcctg 480ctgaataact tctatcccag
agaggccaaa gtacagtgga aggtggataa cgccctccaa 540tcgggtaact
cccaggagag tgtcacagag caggacagca aggacagcac ctacagcctc
600agcagcaccc tgacgctgag caaagcagac tacgagaaac acaaagtcta
cgcctgcgaa 660gtcacccatc agggcctgag ctcgcccgtc acaaagagct
tcaacagggg agagtgttag 72032239PRTHomo sapiens 32Met Arg Leu Pro Ala
Gln Leu Leu Gly Leu Leu Met Leu Trp Val Ser 1 5 10 15 Gly Ser Ser
Gly Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro 20 25 30 Val
Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser 35 40
45 Leu Leu His Thr Asn Gly Tyr Asn Tyr Phe Asp Trp Tyr Leu Gln Lys
50 55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn
Arg Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser
Gly Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu
Asp Val Gly Val Tyr Tyr 100 105 110 Cys Met Gln Ala Leu Gln Thr Pro
Tyr Ser Phe Gly Gln Gly Thr Lys 115 120 125 Leu Glu Ile Lys Arg Thr
Val Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140 Pro Ser Asp Glu
Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu 145 150 155 160Leu
Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp 165 170
175 Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp
180 185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu
Ser Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu
Val Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val Thr Lys Ser Phe
Asn Arg Gly Glu Cys 225 230 235 33361DNAHomo sapiens 33caggtgcagc
tggtggagtc tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag
cctctggatt caccttcagt agctatgtca tgcactgggt ccgccaggct
120ccaggcaagg ggctggagtg ggtggcagtt atgtcatatg atggaagtag
taaatactat 180gcaaactccg tgaagggccg attcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaataa acagcctgag agctgaggac
acggctgtgt attactgtgc gagagatggg 300ggtaaagcag tgcctggtcc
tgactactgg ggccagggaa tcctggtcac cgtctcctca 360g 361 34120PRTHomo
sapiens 34Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro
Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr
Phe Ser Ser Tyr 20 25 30 Val Met His Trp Val Arg Gln Ala Pro Gly
Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Met Ser Tyr Asp Gly Ser
Ser Lys Tyr Tyr Ala Asn Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile
Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75 80Leu Gln Ile Asn
Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg
Asp Gly Gly Lys Ala Val Pro Gly Pro Asp Tyr Trp Gly Gln 100 105 110
Gly Ile Leu Val Thr Val Ser Ser 115 12035337DNAHomo sapiens
35gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
60atctcctgca ggtctagtca gagtgttctg tatagtaatg gatacaacta tttggattgg
120tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca
cagattttac actgaaaatc 240agcagagtgg aggctgagga tgttggggtt
tattactgca tgcaagtttt acaaactcca 300ttcactttcg gccctgggac
caaagtggat atcaaac 33736112PRTHomo sapiens 36Asp Ile Val Met Thr
Gln Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala
Ser Ile Ser Cys Arg Ser Ser Gln Ser Val Leu Tyr Ser 20 25 30 Asn
Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40
45 Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro
50 55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
Lys Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr
Cys Met Gln Val 85 90 95 Leu Gln Thr Pro Phe Thr Phe Gly Pro Gly
Thr Lys Val Asp Ile Lys 100 105 110 371398DNAHomo sapiens
37atggagtttg ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag
60gtgcagctgg tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcct ctggattcac cttcagtagc tatgtcatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt ggcagttatg tcatatgatg
gaagtagtaa atactatgca 240aactccgtga agggccgatt caccatctcc
agagacaatt ccaagaacac gctgtatctg 300caaataaaca gcctgagagc
tgaggacacg gctgtgtatt actgtgcgag agatgggggt 360aaagcagtgc
ctggtcctga ctactggggc cagggaatcc tggtcaccgt ctcctcagcc
420tccaccaagg gcccatcggt cttccccctg gcgccctgct ccaggagcac
ctccgagagc 480acagcggccc tgggctgcct ggtcaaggac tacttccccg
aaccggtgac ggtgtcgtgg 540aactcaggcg ctctgaccag cggcgtgcac
accttcccag ctgtcctaca gtcctcagga 600ctctactccc tcagcagcgt
ggtgaccgtg ccctccagca acttcggcac ccagacctac 660acctgcaacg
tagatcacaa gcccagcaac accaaggtgg acaagacagt tgagcgcaaa
720tgttgtgtcg agtgcccacc gtgcccagca ccacctgtgg caggaccgtc
agtcttcctc 780ttccccccaa aacccaagga caccctcatg atctcccgga
cccctgaggt cacgtgcgtg 840gtggtggacg tgagccacga agaccccgag
gtccagttca actggtacgt ggacggcgtg 900gaggtgcata atgccaagac
aaagccacgg gaggagcagt tcaacagcac gttccgtgtg 960gtcagcgtcc
tcaccgttgt gcaccaggac tggctgaacg gcaaggagta caagtgcaag
1020gtctccaaca aaggcctccc agcccccatc gagaaaacca tctccaaaac
caaagggcag 1080ccccgagaac cacaggtgta caccctgccc ccatcccggg
aggagatgac caagaaccag 1140gtcagcctga cctgcctggt caaaggcttc
taccccagcg acatcgccgt ggagtgggag 1200agcaatgggc agccggagaa
caactacaag accacacctc ccatgctgga ctccgacggc 1260tccttcttcc
tctacagcaa gctcaccgtg gacaagagca ggtggcagca ggggaacgtc
1320ttctcatgct ccgtgatgca tgaggctctg cacaaccact acacgcagaa
gagcctctcc 1380ctgtctccgg gtaaatga 139838465PRTHomo sapiens 38Met
Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu Arg Gly 1 5 10
15 Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln
20 25 30 Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe
Thr Phe 35 40 45 Ser Ser Tyr Val Met His Trp Val Arg Gln Ala Pro
Gly Lys Gly Leu 50 55 60 Glu Trp Val Ala Val Met Ser Tyr Asp Gly
Ser Ser Lys Tyr Tyr Ala 65 70 75 80Asn Ser Val Lys Gly Arg Phe Thr
Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95 Thr Leu Tyr Leu Gln Ile
Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys Ala
Arg Asp Gly Gly Lys Ala Val Pro Gly Pro Asp Tyr 115 120 125 Trp Gly
Gln Gly Ile Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly 130 135 140
Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser 145
150 155 160Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu
Pro Val 165 170 175 Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe 180 185 190 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr
Ser Leu Ser Ser Val Val 195 200 205 Thr Val Pro Ser Ser Asn Phe Gly
Thr Gln Thr Tyr Thr Cys Asn Val 210 215 220 Asp His Lys Pro Ser Asn
Thr Lys Val Asp Lys Thr Val Glu Arg Lys 225 230 235 240Cys Cys Val
Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro 245 250 255 Ser
Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser 260 265
270 Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp
275 280 285 Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val
His Asn 290 295 300 Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser
Thr Phe Arg Val 305 310 315 320Val Ser Val Leu Thr Val Val His Gln
Asp Trp Leu Asn Gly Lys Glu 325 330 335 Tyr Lys Cys Lys Val Ser Asn
Lys Gly Leu Pro Ala Pro Ile Glu Lys 340 345 350 Thr Ile Ser Lys Thr
Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr 355 360 365 Leu Pro Pro
Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr 370 375 380 Cys
Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu 385 390
395 400Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met
Leu 405 410 415 Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys 420 425 430 Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu 435 440 445 Ala Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly 450 455 460 Lys 46539720DNAHomo sapiens
39atgaggctcc ctgctcagct cctggggctg ctaatgctct gggtctctgg atccagtggg
60gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
120atctcctgca ggtctagtca gagtgttctg tatagtaatg gatacaacta
tttggattgg 180tacctgcaga agccagggca gtctccacag ctcctgatct
atttgggttc taatcgggcc 240tccggggtcc ctgacaggtt cagtggcagt
ggatcaggca cagattttac actgaaaatc 300agcagagtgg aggctgagga
tgttggggtt tattactgca tgcaagtttt acaaactcca 360ttcactttcg
gccctgggac caaagtggat atcaaacgaa ctgtggctgc accatctgtc
420ttcatcttcc cgccatctga tgagcagttg aaatctggaa ctgcctctgt
tgtgtgcctg 480ctgaataact tctatcccag agaggccaaa gtacagtgga
aggtggataa cgccctccaa 540tcgggtaact cccaggagag tgtcacagag
caggacagca aggacagcac ctacagcctc 600agcagcaccc tgacgctgag
caaagcagac tacgagaaac acaaagtcta cgcctgcgaa 660gtcacccatc
agggcctgag ctcgcccgtc acaaagagct tcaacagggg agagtgttag
72040239PRTHomo sapiens 40Met Arg Leu Pro Ala Gln Leu Leu Gly Leu
Leu Met Leu Trp Val Ser 1 5 10 15 Gly Ser Ser Gly Asp Ile Val Met
Thr Gln Ser Pro Leu Ser Leu Pro 20 25 30 Val Thr Pro Gly Glu Pro
Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser 35
40 45 Val Leu Tyr Ser Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln
Lys 50 55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Gly Ser
Asn Arg Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg Val Glu Ala
Glu Asp Val Gly Val Tyr Tyr 100 105 110 Cys Met Gln Val Leu Gln Thr
Pro Phe Thr Phe Gly Pro Gly Thr Lys 115 120 125 Val Asp Ile Lys Arg
Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140 Pro Ser Asp
Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu 145 150 155
160Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp
165 170 175 Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu
Gln Asp 180 185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu
Thr Leu Ser Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val Tyr Ala
Cys Glu Val Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val Thr Lys
Ser Phe Asn Arg Gly Glu Cys 225 230 235 41378DNAHomo sapiens
41caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc
60tcctgcaagg cttctggata caccttcacc ggctactata tgcactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatgg atcaaccctg acagtggtgg
cacaaactat 180gcacagaagt ttcagggcag ggtcaccatg accagggaca
cgtccatcag cacagcctac 240atggagctga acaggctgag atctgacgac
acggccgtgt attactgtgc gagagatcag 300cccctaggat attgtactaa
tggtgtatgc tcctactttg actactgggg ccagggaacc 360ctggtcaccg tctcctca
37842126PRTHomo sapiens 42Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Gly Tyr 20 25 30 Tyr Met His Trp Val Arg
Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Trp Ile Asn
Pro Asp Ser Gly Gly Thr Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly
Arg Val Thr Met Thr Arg Asp Thr Ser Ile Ser Thr Ala Tyr 65 70 75
80Met Glu Leu Asn Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Asp Gln Pro Leu Gly Tyr Cys Thr Asn Gly Val Cys
Ser Tyr 100 105 110 Phe Asp Tyr Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 125 43321DNAHomo sapiens 43gacatccaga tgacccagtc
tccatcttcc gtgtctgcat ctgtaggaga cagagtcacc 60atcacttgtc gggcgagtca
gggtatttac agctggttag cctggtatca gcagaaacca 120gggaaagccc
ctaacctcct gatctatact gcatccactt tacaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagat ttcactctca ccatcagcag
cctgcaacct 240gaagattttg caacttacta ttgtcaacag gctaacattt
tcccgctcac tttcggcgga 300gggaccaagg tggagatcaa a 32144107PRTHomo
sapiens 44Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Val Ser Ala Ser
Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly
Ile Tyr Ser Trp 20 25 30 Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys
Ala Pro Asn Leu Leu Ile 35 40 45 Tyr Thr Ala Ser Thr Leu Gln Ser
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Asp
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70 75 80Glu Asp Phe Ala
Thr Tyr Tyr Cys Gln Gln Ala Asn Ile Phe Pro Leu 85 90 95 Thr Phe
Gly Gly Gly Thr Lys Val Glu Ile Lys 100 105 451416DNAHomo sapiens
45atggactgga cctggaggat cctcttcttg gtggcagcag ccacaggagc ccactcccag
60gtgcagctgg tgcagtctgg ggctgaggtg aagaagcctg gggcctcagt gaaggtctcc
120tgcaaggctt ctggatacac cttcaccggc tactatatgc actgggtgcg
acaggcccct 180ggacaagggc ttgagtggat gggatggatc aaccctgaca
gtggtggcac aaactatgca 240cagaagtttc agggcagggt caccatgacc
agggacacgt ccatcagcac agcctacatg 300gagctgaaca ggctgagatc
tgacgacacg gccgtgtatt actgtgcgag agatcagccc 360ctaggatatt
gtactaatgg tgtatgctcc tactttgact actggggcca gggaaccctg
420gtcaccgtct cctcagcctc caccaagggc ccatcggtct tccccctggc
gccctgctcc 480aggagcacct ccgagagcac agcggccctg ggctgcctgg
tcaaggacta cttccccgaa 540ccggtgacgg tgtcgtggaa ctcaggcgct
ctgaccagcg gcgtgcacac cttcccagct 600gtcctacagt cctcaggact
ctactccctc agcagcgtgg tgaccgtgcc ctccagcaac 660ttcggcaccc
agacctacac ctgcaacgta gatcacaagc ccagcaacac caaggtggac
720aagacagttg agcgcaaatg ttgtgtcgag tgcccaccgt gcccagcacc
acctgtggca 780ggaccgtcag tcttcctctt ccccccaaaa cccaaggaca
ccctcatgat ctcccggacc 840cctgaggtca cgtgcgtggt ggtggacgtg
agccacgaag accccgaggt ccagttcaac 900tggtacgtgg acggcgtgga
ggtgcataat gccaagacaa agccacggga ggagcagttc 960aacagcacgt
tccgtgtggt cagcgtcctc accgttgtgc accaggactg gctgaacggc
1020aaggagtaca agtgcaaggt ctccaacaaa ggcctcccag cccccatcga
gaaaaccatc 1080tccaaaacca aagggcagcc ccgagaacca caggtgtaca
ccctgccccc atcccgggag 1140gagatgacca agaaccaggt cagcctgacc
tgcctggtca aaggcttcta ccccagcgac 1200atcgccgtgg agtgggagag
caatgggcag ccggagaaca actacaagac cacacctccc 1260atgctggact
ccgacggctc cttcttcctc tacagcaagc tcaccgtgga caagagcagg
1320tggcagcagg ggaacgtctt ctcatgctcc gtgatgcatg aggctctgca
caaccactac 1380acgcagaaga gcctctccct gtctccgggt aaatga
141646471PRTHomo sapiens 46Met Asp Trp Thr Trp Arg Ile Leu Phe Leu
Val Ala Ala Ala Thr Gly 1 5 10 15 Ala His Ser Gln Val Gln Leu Val
Gln Ser Gly Ala Glu Val Lys Lys 20 25 30 Pro Gly Ala Ser Val Lys
Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe 35 40 45 Thr Gly Tyr Tyr
Met His Trp Val Arg Gln Ala Pro Gly Gln Gly Leu 50 55 60 Glu Trp
Met Gly Trp Ile Asn Pro Asp Ser Gly Gly Thr Asn Tyr Ala 65 70 75
80Gln Lys Phe Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Ile Ser
85 90 95 Thr Ala Tyr Met Glu Leu Asn Arg Leu Arg Ser Asp Asp Thr
Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Asp Gln Pro Leu Gly Tyr Cys
Thr Asn Gly Val 115 120 125 Cys Ser Tyr Phe Asp Tyr Trp Gly Gln Gly
Thr Leu Val Thr Val Ser 130 135 140 Ser Ala Ser Thr Lys Gly Pro Ser
Val Phe Pro Leu Ala Pro Cys Ser 145 150 155 160Arg Ser Thr Ser Glu
Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp 165 170 175 Tyr Phe Pro
Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr 180 185 190 Ser
Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr 195 200
205 Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln
210 215 220 Thr Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys
Val Asp 225 230 235 240Lys Thr Val Glu Arg Lys Cys Cys Val Glu Cys
Pro Pro Cys Pro Ala 245 250 255 Pro Pro Val Ala Gly Pro Ser Val Phe
Leu Phe Pro Pro Lys Pro Lys 260 265 270 Asp Thr Leu Met Ile Ser Arg
Thr Pro Glu Val Thr Cys Val Val Val 275 280 285 Asp Val Ser His Glu
Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp 290 295 300 Gly Val Glu
Val His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe 305 310 315
320Asn Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp
325 330 335 Trp Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys
Gly Leu 340 345 350 Pro Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys
Gly Gln Pro Arg 355 360 365 Glu Pro Gln Val Tyr Thr Leu Pro Pro Ser
Arg Glu Glu Met Thr Lys 370 375 380 Asn Gln Val Ser Leu Thr Cys Leu
Val Lys Gly Phe Tyr Pro Ser Asp 385 390 395 400Ile Ala Val Glu Trp
Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys 405 410 415 Thr Thr Pro
Pro Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser 420 425 430 Lys
Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser 435 440
445 Cys Ser Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser
450 455 460 Leu Ser Leu Ser Pro Gly Lys 465 470 47705DNAHomo
sapiens 47atgaggctcc ctgctcagct cctggggctc ctgctgctct ggttcccagg
ttccagatgc 60gacatccaga tgacccagtc tccatcttcc gtgtctgcat ctgtaggaga
cagagtcacc 120atcacttgtc gggcgagtca gggtatttac agctggttag
cctggtatca gcagaaacca 180gggaaagccc ctaacctcct gatctatact
gcatccactt tacaaagtgg ggtcccatca 240aggttcagcg gcagtggatc
tgggacagat ttcactctca ccatcagcag cctgcaacct 300gaagattttg
caacttacta ttgtcaacag gctaacattt tcccgctcac tttcggcgga
360gggaccaagg tggagatcaa acgaactgtg gctgcaccat ctgtcttcat
cttcccgcca 420tctgatgagc agttgaaatc tggaactgcc tctgttgtgt
gcctgctgaa taacttctat 480cccagagagg ccaaagtaca gtggaaggtg
gataacgccc tccaatcggg taactcccag 540gagagtgtca cagagcagga
cagcaaggac agcacctaca gcctcagcag caccctgacg 600ctgagcaaag
cagactacga gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc
660ctgagctcgc ccgtcacaaa gagcttcaac aggggagagt gttag
70548234PRTHomo sapiens 48Met Arg Leu Pro Ala Gln Leu Leu Gly Leu
Leu Leu Leu Trp Phe Pro 1 5 10 15 Gly Ser Arg Cys Asp Ile Gln Met
Thr Gln Ser Pro Ser Ser Val Ser 20 25 30 Ala Ser Val Gly Asp Arg
Val Thr Ile Thr Cys Arg Ala Ser Gln Gly 35 40 45 Ile Tyr Ser Trp
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro 50 55 60 Asn Leu
Leu Ile Tyr Thr Ala Ser Thr Leu Gln Ser Gly Val Pro Ser 65 70 75
80Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser
85 90 95 Ser Leu Gln Pro Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln
Ala Asn 100 105 110 Ile Phe Pro Leu Thr Phe Gly Gly Gly Thr Lys Val
Glu Ile Lys Arg 115 120 125 Thr Val Ala Ala Pro Ser Val Phe Ile Phe
Pro Pro Ser Asp Glu Gln 130 135 140 Leu Lys Ser Gly Thr Ala Ser Val
Val Cys Leu Leu Asn Asn Phe Tyr 145 150 155 160Pro Arg Glu Ala Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser 165 170 175 Gly Asn Ser
Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 180 185 190 Tyr
Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 195 200
205 His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
210 215 220 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230
49373DNAHomo sapiens 49caggtgcagc tggtggagtc tgggggaggc gtggtccagc
ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt cgctatggca
tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg ggtggcagtt
atatcatctg atggaggtaa taaatactat 180gcagactccg tgaagggccg
attcaccatc tccagagaca attccaagaa cacgctgtat 240ctgcaaatga
acagcctgag agctgaggac acggctgtgt attactgtac gagaagaggg
300actggaaaga cttactacca ctactgtggt atggacgtct ggggccaagg
gaccacggtc 360accgtctcct cag 37350124PRTHomo sapiens 50Gln Val Gln
Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser
Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25
30 Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val
35 40 45 Ala Val Ile Ser Ser Asp Gly Gly Asn Lys Tyr Tyr Ala Asp
Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys
Asn Thr Leu Tyr 65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp
Thr Ala Val Tyr Tyr Cys 85 90 95 Thr Arg Arg Gly Thr Gly Lys Thr
Tyr Tyr His Tyr Cys Gly Met Asp 100 105 110 Val Trp Gly Gln Gly Thr
Thr Val Thr Val Ser Ser 115 120 51337DNAHomo sapiens 51gatattgtga
tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc 60atctcctgca
ggtctagtca gagcctcctg tatagtaatg gatataacta tttggattgg
120tacctgcaga agccagggca gtctccacac ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggttcaggca
ctgattttac actgaaaatc 240agcagagtgg aggctgagga tgttggggtt
tattactgca tgcaagctct acaaactcct 300cggacgttcg gccaagggac
caaggtggaa atcaaac 33752112PRTHomo sapiens 52Asp Ile Val Met Thr
Gln Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala
Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Tyr Ser 20 25 30 Asn
Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40
45 Pro His Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro
50 55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
Lys Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr
Cys Met Gln Ala 85 90 95 Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly
Thr Lys Val Glu Ile Lys 100 105 110 531410DNAHomo sapiens
53atggagtttg ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag
60gtgcaactgg tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcct ctggattcac cttcagtcgc tatggcatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt ggcagttata tcatctgatg
gaggtaataa atactatgca 240gactccgtga agggccgatt caccatctcc
agagacaatt ccaagaacac gctgtatctg 300caaatgaaca gcctgagagc
tgaggacacg gctgtgtatt actgtacgag aagagggact 360ggaaagactt
actaccacta ctgtggtatg gacgtctggg gccaagggac cacggtcacc
420gtctcctcag cctccaccaa gggcccatcg gtcttccccc tggcgccctg
ctccaggagc 480acctccgaga gcacagcggc cctgggctgc ctggtcaagg
actacttccc cgaaccggtg 540acggtgtcgt ggaactcagg cgctctgacc
agcggcgtgc acaccttccc agctgtccta 600cagtcctcag gactctactc
cctcagcagc gtggtgaccg tgccctccag caacttcggc 660acccagacct
acacctgcaa cgtagatcac aagcccagca acaccaaggt ggacaagaca
720gttgagcgca aatgttgtgt cgagtgccca ccgtgcccag caccacctgt
ggcaggaccg 780tcagtcttcc tcttcccccc aaaacccaag gacaccctca
tgatctcccg gacccctgag 840gtcacgtgcg tggtggtgga cgtgagccac
gaagaccccg aggtccagtt caactggtac 900gtggacggcg tggaggtgca
taatgccaag acaaagccac gggaggagca gttcaacagc 960acgttccgtg
tggtcagcgt cctcaccgtt gtgcaccagg actggctgaa cggcaaggag
1020tacaagtgca aggtctccaa caaaggcctc ccagccccca tcgagaaaac
catctccaaa 1080accaaagggc agccccgaga accacaggtg tacaccctgc
ccccatcccg ggaggagatg 1140accaagaacc aggtcagcct gacctgcctg
gtcaaaggct tctaccccag cgacatcgcc 1200gtggagtggg agagcaatgg
gcagccggag aacaactaca agaccacacc tcccatgctg 1260gactccgacg
gctccttctt cctctacagc aagctcaccg tggacaagag caggtggcag
1320caggggaacg tcttctcatg ctccgtgatg catgaggctc tgcacaacca
ctacacgcag 1380aagagcctct ccctgtctcc gggtaaatga 141054469PRTHomo
sapiens 54Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu
Arg Gly 1 5 10 15 Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly
Gly Val Val Gln 20 25 30 Pro Gly Arg Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe 35 40 45 Ser Arg Tyr Gly Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60 Glu Trp Val Ala Val Ile
Ser Ser Asp Gly Gly Asn Lys Tyr Tyr Ala 65 70 75 80Asp Ser Val Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn
85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val 100 105 110 Tyr Tyr Cys Thr Arg Arg Gly Thr Gly Lys Thr Tyr
Tyr His Tyr Cys 115 120 125 Gly Met Asp Val Trp Gly Gln Gly Thr Thr
Val Thr Val Ser Ser Ala 130 135 140 Ser Thr Lys Gly Pro Ser Val Phe
Pro Leu Ala Pro Cys Ser Arg Ser 145 150 155 160Thr Ser Glu Ser Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe 165 170 175 Pro Glu Pro
Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly 180 185 190 Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu 195 200
205 Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr
210 215 220 Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val Asp
Lys Thr 225 230 235 240Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro
Cys Pro Ala Pro Pro 245 250 255 Val Ala Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp Thr 260 265 270 Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp Val 275 280 285 Ser His Glu Asp Pro
Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val 290 295 300 Glu Val His
Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser 305 310 315
320Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp Leu
325 330 335 Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu
Pro Ala 340 345 350 Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln
Pro Arg Glu Pro 355 360 365 Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu
Glu Met Thr Lys Asn Gln 370 375 380 Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile Ala 385 390 395 400Val Glu Trp Glu Ser
Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr 405 410 415 Pro Pro Met
Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu 420 425 430 Thr
Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser 435 440
445 Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser
450 455 460 Leu Ser Pro Gly Lys 465 55720DNAHomo sapiens
55atgaggctcc ctgctcagct cctggggctg ctaatgctct gggtctctgg atccagtggg
60gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
120atctcctgca ggtctagtca gagcctcctg tatagtaatg gatataacta
tttggattgg 180tacctgcaga agccagggca gtctccacac ctcctgatct
atttgggttc taatcgggcc 240tccggggtcc ctgacaggtt cagtggcagt
ggttcaggca ctgattttac actgaaaatc 300agcagagtgg aggctgagga
tgttggggtt tattactgca tgcaagctct acaaactcct 360cggacgttcg
gccaagggac caaggtggaa atcaaacgaa ctgtggctgc accatctgtc
420ttcatcttcc cgccatctga tgagcagttg aaatctggaa ctgcctctgt
tgtgtgcctg 480ctgaataact tctatcccag agaggccaaa gtacagtgga
aggtggataa cgccctccaa 540tcgggtaact cccaggagag tgtcacagag
caggacagca aggacagcac ctacagcctc 600agcagcaccy tgacgctgag
caaagcagac tacgagaaac acaaagtcta cgcctgcgaa 660gtcacccatc
agggcctgag ctcgcccgtc acaaagagct tcaacagggg agagtgttag
72056239PRTHomo sapiens 56Met Arg Leu Pro Ala Gln Leu Leu Gly Leu
Leu Met Leu Trp Val Ser 1 5 10 15 Gly Ser Ser Gly Asp Ile Val Met
Thr Gln Ser Pro Leu Ser Leu Pro 20 25 30 Val Thr Pro Gly Glu Pro
Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser 35 40 45 Leu Leu Tyr Ser
Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln Lys 50 55 60 Pro Gly
Gln Ser Pro His Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala 65 70 75
80Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
85 90 95 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp Val Gly Val
Tyr Tyr 100 105 110 Cys Met Gln Ala Leu Gln Thr Pro Arg Thr Phe Gly
Gln Gly Thr Lys 115 120 125 Val Glu Ile Lys Arg Thr Val Ala Ala Pro
Ser Val Phe Ile Phe Pro 130 135 140 Pro Ser Asp Glu Gln Leu Lys Ser
Gly Thr Ala Ser Val Val Cys Leu 145 150 155 160Leu Asn Asn Phe Tyr
Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp 165 170 175 Asn Ala Leu
Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp 180 185 190 Ser
Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys 195 200
205 Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln
210 215 220 Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn Arg Gly Glu
Cys 225 230 235 57376DNAHomo sapiens 57caggtgcagc tggtggagtc
tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgtag cctctggatt
caccttcagt aactatggca tgcactgggt ccgccaggct 120ccaggcaagg
ggctggagtg ggtggcaatt atatcatatg atggaagtaa taaatactat
180gcagactccg tgaagggccg attcaccatc tccagagaca attccaagaa
cacgctgtat 240gtgcaaatga acagcctgag agctgaggac acggctgtgt
attactgtgc gagacgcggt 300cactacggga gggattacta ctcctactac
ggtttggacg tctggggcca agggaccacg 360gtcaccgtct cctcag
37658125PRTHomo sapiens 58Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Val Ala
Ser Gly Phe Thr Phe Ser Asn Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Ile Ile Ser
Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75
80Val Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Arg Gly His Tyr Gly Arg Asp Tyr Tyr Ser Tyr Tyr
Gly Leu 100 105 110 Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser
Ser 115 120 12559337DNAHomo sapiens 59gatattgtga tgactcagtc
tccactctcc ctgcccgtca cccctggaga gccggcctcc 60atctcctgca ggtctagtca
gagcctcctg cctggtaatg gatacaacta tttggattgg 120tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac
actgaaaatc 240agcagagtgg aggctgagga tgttggggtt tattactgca
tgcaagctct acaaactcct 300cggacgttcg gccaagggac caaggtggaa atcaaac
33760112PRTHomo sapiens 60Asp Ile Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Leu Pro Gly 20 25 30 Asn Gly Tyr Asn Tyr Leu
Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu
Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala
85 90 95 Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr Lys Val Glu
Ile Lys 100 105 110 611413DNAHomo sapiens 61atggagtttg ggctgagctg
ggttttcctc gttgctcttt taagaggtgt ccagtgtcag 60gtgcagctgg tggagtctgg
gggaggcgtg gtccagcctg ggaggtccct gagactctcc 120tgtgtagcct
ctggattcac cttcagtaac tatggcatgc actgggtccg ccaggctcca
180ggcaaggggc tggagtgggt ggcaattata tcatatgatg gaagtaataa
atactatgca 240gactccgtga agggccgatt caccatctcc agagacaatt
ccaagaacac gctgtatgtg 300caaatgaaca gcctgagagc tgaggacacg
gctgtgtatt actgtgcgag acgcggtcac 360tacgggaggg attactactc
ctactacggt ttggacgtct ggggccaagg gaccacggtc 420accgtctcct
cagcctccac caagggccca tcggtcttcc ccctggcgcc ctgctccagg
480agcacctccg agagcacagc ggccctgggc tgcctggtca aggactactt
ccccgaaccg 540gtgacggtgt cgtggaactc aggcgctctg accagcggcg
tgcacacctt cccagctgtc 600ctacagtcct caggactcta ctccctcagc
agcgtggtga ccgtgccctc cagcaacttc 660ggcacccaga cctacacctg
caacgtagat cacaagccca gcaacaccaa ggtggacaag 720acagttgagc
gcaaatgttg tgtcgagtgc ccaccgtgcc cagcaccacc tgtggcagga
780ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc tcatgatctc
ccggacccct 840gaggtcacgt gcgtggtggt ggacgtgagc cacgaagacc
ccgaggtcca gttcaactgg 900tacgtggacg gcgtggaggt gcataatgcc
aagacaaagc cacgggagga gcagttcaac 960agcacgttcc gtgtggtcag
cgtcctcacc gttgtgcacc aggactggct gaacggcaag 1020gagtacaagt
gcaaggtctc caacaaaggc ctcccagccc ccatcgagaa aaccatctcc
1080aaaaccaaag ggcagccccg agaaccacag gtgtacaccc tgcccccatc
ccgggaggag 1140atgaccaaga accaggtcag cctgacctgc ctggtcaaag
gcttctaccc cagcgacatc 1200gccgtggagt gggagagcaa tgggcagccg
gagaacaact acaagaccac acctcccatg 1260ctggactccg acggctcctt
cttcctctac agcaagctca ccgtggacaa gagcaggtgg 1320cagcagggga
acgtcttctc atgctccgtg atgcatgagg ctctgcacaa ccactacacg
1380cagaagagcc tctccctgtc tccgggtaaa tga 141362470PRTHomo sapiens
62Met Glu Phe Gly Leu Ser Trp Val Phe Leu Val Ala Leu Leu Arg Gly 1
5 10 15 Val Gln Cys Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val
Gln 20 25 30 Pro Gly Arg Ser Leu Arg Leu Ser Cys Val Ala Ser Gly
Phe Thr Phe 35 40 45 Ser Asn Tyr Gly Met His Trp Val Arg Gln Ala
Pro Gly Lys Gly Leu 50 55 60 Glu Trp Val Ala Ile Ile Ser Tyr Asp
Gly Ser Asn Lys Tyr Tyr Ala 65 70 75 80Asp Ser Val Lys Gly Arg Phe
Thr Ile Ser Arg Asp Asn Ser Lys Asn 85 90 95 Thr Leu Tyr Val Gln
Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val 100 105 110 Tyr Tyr Cys
Ala Arg Arg Gly His Tyr Gly Arg Asp Tyr Tyr Ser Tyr 115 120 125 Tyr
Gly Leu Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 130 135
140 Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg
145 150 155 160Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu Val
Lys Asp Tyr 165 170 175 Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser
Gly Ala Leu Thr Ser 180 185 190 Gly Val His Thr Phe Pro Ala Val Leu
Gln Ser Ser Gly Leu Tyr Ser 195 200 205 Leu Ser Ser Val Val Thr Val
Pro Ser Ser Asn Phe Gly Thr Gln Thr 210 215 220 Tyr Thr Cys Asn Val
Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 225 230 235 240Thr Val
Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro 245 250 255
Pro Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 260
265 270 Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp 275 280 285 Val Ser His Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr
Val Asp Gly 290 295 300 Val Glu Val His Asn Ala Lys Thr Lys Pro Arg
Glu Glu Gln Phe Asn 305 310 315 320Ser Thr Phe Arg Val Val Ser Val
Leu Thr Val Val His Gln Asp Trp 325 330 335 Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 340 345 350 Ala Pro Ile Glu
Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 355 360 365 Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn 370 375 380
Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile 385
390 395 400Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr 405 410 415 Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys 420 425 430 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys 435 440 445 Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu 450 455 460 Ser Leu Ser Pro Gly Lys
465 47063720DNAHomo sapiens 63atgaggctcc ctgctcagct cctggggctg
ctaatgctct gggtctctgg atccagtggg 60gatattgtga tgactcagtc tccactctcc
ctgcccgtca cccctggaga gccggcctcc 120atctcctgca ggtctagtca
gagcctcctg cctggtaatg gatacaacta tttggattgg 180tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
240tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac
actgaaaatc 300agcagagtgg aggctgagga tgttggggtt tattactgca
tgcaagctct acaaactcct 360cggacgttcg gccaagggac caaggtggaa
atcaaacgaa ctgtggctgc accatctgtc 420ttcatcttcc cgccatctga
tgagcagttg aaatctggaa ctgcctstgt tgtgtgcctg 480ctgaataact
tctatcccag agaggccaaa gtacagtgga aggtggataa cgccctccaa
540tcgggtaact cccaggagag tgtcacagag caggacagca aggacagcac
ctacagcctc 600agcagcaccy tgacgctgag caaagcagac tacgagaaac
acaaagtcta cgcctgcgaa 660gtcacccatc agggcctgag ctcgcccgtc
acaaagagct tcaacagggg agagtgttaa 72064239PRTHomo
sapiensMOD_RES(156)Variable amino acid 64Met Arg Leu Pro Ala Gln
Leu Leu Gly Leu Leu Met Leu Trp Val Ser 1 5 10 15 Gly Ser Ser Gly
Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro 20 25 30 Val Thr
Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser 35 40 45
Leu Leu Pro Gly Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln Lys 50
55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg
Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly
Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg Val Glu Ala Glu Asp
Val Gly Val Tyr Tyr 100 105 110 Cys Met Gln Ala Leu Gln Thr Pro Arg
Thr Phe Gly Gln Gly Thr Lys 115 120 125 Val Glu Ile Lys Arg Thr Val
Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140 Pro Ser Asp Glu Gln
Leu Lys Ser Gly Thr Ala Xaa Val Val Cys Leu 145 150 155 160Leu Asn
Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp 165 170 175
Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp 180
185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser
Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val Tyr Ala Cys Glu Val
Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val Thr Lys Ser Phe Asn
Arg Gly Glu Cys 225 230 235 65364DNAHomo sapiens 65caggtgcagc
tgcaggagtc gggcccagga ctggtgaagc cttcggacac cctgtccctc 60acctgcactg
tctctggtgg ctccatcaga ggttactact ggagctggat ccggcagccc
120cctgggaagg gactggagtg gattgggtat atctattaca gtgggagcac
caactacaac 180ccctccctca agagtcgagt caccatatca gtagacacgt
ccaagaacca gttctccctg 240aagctgaact ctgtgaccgc tgcggacacg
gccgtgtatt attgtgcgag aaaggggggc 300ctctacggtg actacggctg
gttcgccccc tggggccagg gaaccctggt caccgtctcc 360tcag 36466121PRTHomo
sapiens 66Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro
Ser Asp 1 5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser
Ile Arg Gly Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly
Lys Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser
Thr Asn Tyr Asn Pro Ser Leu Lys 50 55
60 Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser Leu
65 70 75 80Lys Leu Asn Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr
Cys Ala 85 90 95 Arg Lys Gly Gly Leu Tyr Gly Asp Tyr Gly Trp Phe
Ala Pro Trp Gly 100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser 115
120 67322DNAHomo sapiens 67gaaattgtgt tgacgcagtc tccaggcacc
ctgtctttgt ctccagggga aagagccacc 60ctctcctgca gggccagtca gagtgttagc
agcagcgact tagcctggca ccagcagaaa 120cctggccagg ctcccagact
cctcatctat ggtgcatcca gcagggccac tggcatccca 180gacaggttca
gtggcagtgg gtctgggaca gacttcactc tcaccatcag cagactggag
240cctgaagatt ttgcagtgta ttactgtcag cactgtcgta gcttattcac
tttcggccct 300gggaccaaag tggatatcaa ac 32268107PRTHomo sapiens
68Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly 1
5 10 15 Glu Arg Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser
Ser 20 25 30 Asp Leu Ala Trp His Gln Gln Lys Pro Gly Gln Ala Pro
Arg Leu Leu 35 40 45 Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile
Pro Asp Arg Phe Ser 50 55 60 Gly Ser Gly Ser Gly Thr Asp Phe Thr
Leu Thr Ile Ser Arg Leu Glu 65 70 75 80Pro Glu Asp Phe Ala Val Tyr
Tyr Cys Gln His Cys Arg Ser Leu Phe 85 90 95 Thr Phe Gly Pro Gly
Thr Lys Val Asp Ile Lys 100 105 691401DNAHomo sapiens 69atgaaacatc
tgtggttctt ccttctcctg gtggcagctc ccagatgggt cctgtcccag 60gtgcagctgc
aggagtcggg cccaggactg gtgaagcctt cggagaccct gtccctcacc
120tgcactgtct ctggtggctc catcagaggt tactactgga gctggatccg
gcagccccct 180gggaagggac tggagtggat tgggtatatc tattacagtg
ggagcaccaa ctacaacccc 240tccctcaaga gtcgagtcac catatcagta
gacacgtcca agaaccagtt ctccctgaag 300ctgaactctg tgaccgctgc
ggacacggcc gtgtattatt gtgcgagaaa ggggggcctc 360tacggtgact
acggctggtt cgccccctgg ggccagggaa ccctggtcac cgtctcctca
420gcctccacca agggcccatc ggtcttcccc ctggcgccct gctccaggag
cacctccgag 480agcacagcgg ccctgggctg cctggtcaag gactacttcc
ccgaaccggt gacggtgtcg 540tggaactcag gcgctctgac cagcggcgtg
cacaccttcc cagctgtcct acagtcctca 600ggactctact ccctcagcag
cgtggtgacc gtgccctcca gcaacttcgg cacccagacc 660tacacctgca
acgtagatca caagcccagc aacaccaagg tggacaagac agttgagcgc
720aaatgttgtg tcgagtgccc accgtgccca gcaccacctg tggcaggacc
gtcagtcttc 780ctcttccccc caaaacccaa ggacaccctc atgatctccc
ggacccctga ggtcacgtgc 840gtggtggtgg acgtgagcca cgaagacccc
gaggtccagt tcaactggta cgtggacggc 900gtggaggtgc ataatgccaa
gacaaagcca cgggaggagc agttcaacag cacgttccgt 960gtggtcagcg
tcctcaccgt tgtgcaccag gactggctga acggcaagga gtacaagtgc
1020aaggtctcca acaaaggcct cccagccccc atcgagaaaa ccatctccaa
aaccaaaggg 1080cagccccgag aaccacaggt gtacaccctg cccccatccc
gggaggagat gaccaagaac 1140caggtcagcc tgacctgcct ggtcaaaggc
ttctacccca gcgacatcgc cgtggagtgg 1200gagagcaatg ggcagccgga
gaacaactac aagaccacac ctcccatgct ggactccgac 1260ggctccttct
tcctctacag caagctcacc gtggacaaga gcaggtggca gcaggggaac
1320gtcttctcat gctccgtgat gcatgaggct ctgcacaacc actacacgca
gaagagcctc 1380tccctgtctc cgggtaaatg a 140170466PRTHomo sapiens
70Met Lys His Leu Trp Phe Phe Leu Leu Leu Val Ala Ala Pro Arg Trp 1
5 10 15 Val Leu Ser Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val
Lys 20 25 30 Pro Ser Glu Thr Leu Ser Leu Thr Cys Thr Val Ser Gly
Gly Ser Ile 35 40 45 Arg Gly Tyr Tyr Trp Ser Trp Ile Arg Gln Pro
Pro Gly Lys Gly Leu 50 55 60 Glu Trp Ile Gly Tyr Ile Tyr Tyr Ser
Gly Ser Thr Asn Tyr Asn Pro 65 70 75 80Ser Leu Lys Ser Arg Val Thr
Ile Ser Val Asp Thr Ser Lys Asn Gln 85 90 95 Phe Ser Leu Lys Leu
Asn Ser Val Thr Ala Ala Asp Thr Ala Val Tyr 100 105 110 Tyr Cys Ala
Arg Lys Gly Gly Leu Tyr Gly Asp Tyr Gly Trp Phe Ala 115 120 125 Pro
Trp Gly Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys 130 135
140 Gly Pro Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu
145 150 155 160Ser Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro 165 170 175 Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr
Ser Gly Val His Thr 180 185 190 Phe Pro Ala Val Leu Gln Ser Ser Gly
Leu Tyr Ser Leu Ser Ser Val 195 200 205 Val Thr Val Pro Ser Ser Asn
Phe Gly Thr Gln Thr Tyr Thr Cys Asn 210 215 220 Val Asp His Lys Pro
Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg 225 230 235 240Lys Cys
Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly 245 250 255
Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile 260
265 270 Ser Arg Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His
Glu 275 280 285 Asp Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val
Glu Val His 290 295 300 Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe
Asn Ser Thr Phe Arg 305 310 315 320Val Val Ser Val Leu Thr Val Val
His Gln Asp Trp Leu Asn Gly Lys 325 330 335 Glu Tyr Lys Cys Lys Val
Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu 340 345 350 Lys Thr Ile Ser
Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr 355 360 365 Thr Leu
Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu 370 375 380
Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp 385
390 395 400Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro
Pro Met 405 410 415 Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys
Leu Thr Val Asp 420 425 430 Lys Ser Arg Trp Gln Gln Gly Asn Val Phe
Ser Cys Ser Val Met His 435 440 445 Glu Ala Leu His Asn His Tyr Thr
Gln Lys Ser Leu Ser Leu Ser Pro 450 455 460 Gly Lys 465
71705DNAHomo sapiens 71atggaaaccc cagcgcagct tctcttcctc ctgctactct
ggctcccaga atccaccgga 60gaaattgtgt tgacgcagtc tccaggcacc ctgtctttgt
ctccagggga aagagccacc 120ctctcctgca gggccagtca gagtgttagc
agcagcgact tagcctggca ccagcagaaa 180cctggccagg ctcccagact
cctcatctat ggtgcatcca gcagggccac tggcatccca 240gacaggttca
gtggcagtgg gtctgggaca gacttcactc tcaccatcag cagactggag
300cctgaagatt ttgcagtgta ttactgtcag cactgtcgta gcttattcac
tttcggccct 360gggaccaaag tggatatcaa acgaactgtg gctgcaccat
ctgtcttcat cttcccgcca 420tctgatgagc agttgaaatc tggaactgcc
tctgttgtgt gcctgctgaa taacttctat 480cccagagagg ccaaagtaca
gtggaaggtg gataacgccc tccaatcggg taactcccag 540gagagtgtca
cagagcagga cagcaaggac agcacctaca gcctcagcag caccctgacg
600ctgagcaaag cagactacga gaaacacaaa gtctacgcct gcgaagtcac
ccatcagggc 660ctgagctcgc ccgtcacaaa gagcttcaac aggggagagt gttag
70572234PRTHomo sapiens 72Met Glu Thr Pro Ala Gln Leu Leu Phe Leu
Leu Leu Leu Trp Leu Pro 1 5 10 15 Glu Ser Thr Gly Glu Ile Val Leu
Thr Gln Ser Pro Gly Thr Leu Ser 20 25 30 Leu Ser Pro Gly Glu Arg
Ala Thr Leu Ser Cys Arg Ala Ser Gln Ser 35 40 45 Val Ser Ser Ser
Asp Leu Ala Trp His Gln Gln Lys Pro Gly Gln Ala 50 55 60 Pro Arg
Leu Leu Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro 65 70 75
80Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile
85 90 95 Ser Arg Leu Glu Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln
His Cys 100 105 110 Arg Ser Leu Phe Thr Phe Gly Pro Gly Thr Lys Val
Asp Ile Lys Arg 115 120 125 Thr Val Ala Ala Pro Ser Val Phe Ile Phe
Pro Pro Ser Asp Glu Gln 130 135 140 Leu Lys Ser Gly Thr Ala Ser Val
Val Cys Leu Leu Asn Asn Phe Tyr 145 150 155 160Pro Arg Glu Ala Lys
Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser 165 170 175 Gly Asn Ser
Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr 180 185 190 Tyr
Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys 195 200
205 His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro
210 215 220 Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230
73376DNAHomo sapiens 73caggtgcagc tggtggagtc tgggggaggc gtggtccagc
ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt caccttcagt agctatgcca
tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg ggtggcagtt
atatcatatg atggaagtaa taaatactat 180gcagactccg tgaagggccg
attcaccatc tacagagaca attccaagaa cacgctgtat 240ctgcaaatga
acagcctgag agctgaggac acggctgtgt attactgtgc gagacgcggt
300cactacggga ataattacta ctcctattac ggtttggacg tctggggcca
agggaccacg 360gtcaccgtct cctcag 37674125PRTHomo sapiens 74Gln Val
Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15
Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20
25 30 Ala Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp
Val 35 40 45 Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala
Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Tyr Arg Asp Asn Ser
Lys Asn Thr Leu Tyr 65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu
Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Arg Gly His Tyr Gly
Asn Asn Tyr Tyr Ser Tyr Tyr Gly Leu 100 105 110 Asp Val Trp Gly Gln
Gly Thr Thr Val Thr Val Ser Ser 115 120 12575337DNAHomo sapiens
75gatattgtga tgactcagtc tccactctcc ctgcccgtca cccctggaga gccggcctcc
60atctcctgca ggtctagtca gagcctcctg cctggtaatg gatacaacta tttggattgg
120tacctgcaga agccagggca gtctccacag ctcctgatct atttgggttc
taatcgggcc 180tccggggtcc ctgacaggtt cagtggcagt ggctcaggca
cagattttac actgaaaatc 240agcagagtgg aggctgagga tgttgggatt
tattactgca tgcaagctct acaaactcct 300cggacgttcg gccaagggac
caaggtggaa atcaaac 33776112PRTHomo sapiens 76Asp Ile Val Met Thr
Gln Ser Pro Leu Ser Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala
Ser Ile Ser Cys Arg Ser Ser Gln Ser Leu Leu Pro Gly 20 25 30 Asn
Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40
45 Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro
50 55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu
Lys Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly Ile Tyr Tyr
Cys Met Gln Ala 85 90 95 Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly
Thr Lys Val Glu Ile Lys 100 105 110 771413DNAHomo sapiens
77atggagtttg ggctgagctg ggttttcctc gttgctcttt taagaggtgt ccagtgtcag
60gtgcaactgg tggagtctgg gggaggcgtg gtccagcctg ggaggtccct gagactctcc
120tgtgcagcct ctggattcac cttcagtagc tatgccatgc actgggtccg
ccaggctcca 180ggcaaggggc tggagtgggt ggcagttata tcatatgatg
gaagtaataa atactatgca 240gactccgtga agggccgatt caccatctac
agagacaatt ccaagaacac gctgtatctg 300caaatgaaca gcctgagagc
tgaggacacg gctgtgtatt actgtgcgag acgcggtcac 360tacgggaata
attactactc ctattacggt ttggacgtct ggggccaagg gaccacggtc
420accgtctcct cagcctccac caagggccca tcggtcttcc ccctggcgcc
ctgctccagg 480agcacctccg agagcacagc ggccctgggc tgcctggtca
aggactactt ccccgaaccg 540gtgacggtgt cgtggaactc aggcgctctg
accagcggcg tgcacacctt cccagctgtc 600ctacagtcct caggactcta
ctccctcagc agcgtggtga ccgtgccctc cagcaacttc 660ggcacccaga
cctacacctg caacgtagat cacaagccca gcaacaccaa ggtggacaag
720acagttgagc gcaaatgttg tgtcgagtgc ccaccgtgcc cagcaccacc
tgtggcagga 780ccgtcagtct tcctcttccc cccaaaaccc aaggacaccc
tcatgatctc ccggacccct 840gaggtcacgt gcgtggtggt ggacgtgagc
cacgaagacc ccgaggtcca gttcaactgg 900tacgtggacg gcgtggaggt
gcataatgcc aagacaaagc cacgggagga gcagttcaac 960agcacgttcc
gtgtggtcag cgtcctcacc gttgtgcacc aggactggct gaacggcaag
1020gagtacaagt gcaaggtctc caacaaaggc ctcccagccc ccatcgagaa
aaccatctcc 1080aaaaccaaag ggcagccccg agaaccacag gtgtacaccc
tgcccccatc ccgggaggag 1140atgaccaaga accaggtcag cctgacctgc
ctggtcaaag gcttctaccc cagcgacatc 1200gccgtggagt gggagagcaa
tgggcagccg gagaacaact acaagaccac acctcccatg 1260ctggactccg
acggctcctt cttcctctac agcaagctca ccgtggacaa gagcaggtgg
1320cagcagggga acgtcttctc atgctccgtg atgcatgagg ctctgcacaa
ccactacacg 1380cagaagagcc tctccctgtc tccgggtaaa tga
141378470PRTHomo sapiens 78Met Glu Phe Gly Leu Ser Trp Val Phe Leu
Val Ala Leu Leu Arg Gly 1 5 10 15 Val Gln Cys Gln Val Gln Leu Val
Glu Ser Gly Gly Gly Val Val Gln 20 25 30 Pro Gly Arg Ser Leu Arg
Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe 35 40 45 Ser Ser Tyr Ala
Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu 50 55 60 Glu Trp
Val Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala 65 70 75
80Asp Ser Val Lys Gly Arg Phe Thr Ile Tyr Arg Asp Asn Ser Lys Asn
85 90 95 Thr Leu Tyr Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val 100 105 110 Tyr Tyr Cys Ala Arg Arg Gly His Tyr Gly Asn Asn
Tyr Tyr Ser Tyr 115 120 125 Tyr Gly Leu Asp Val Trp Gly Gln Gly Thr
Thr Val Thr Val Ser Ser 130 135 140 Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Cys Ser Arg 145 150 155 160Ser Thr Ser Glu Ser
Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 165 170 175 Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 180 185 190 Gly
Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 195 200
205 Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr
210 215 220 Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val
Asp Lys 225 230 235 240Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro
Pro Cys Pro Ala Pro 245 250 255 Pro Val Ala Gly Pro Ser Val Phe Leu
Phe Pro Pro Lys Pro Lys Asp 260 265 270 Thr Leu Met Ile Ser Arg Thr
Pro Glu Val Thr Cys Val Val Val Asp 275 280 285 Val Ser His Glu Asp
Pro Glu Val Gln Phe Asn Trp Tyr Val Asp Gly 290 295 300 Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 305 310 315
320Ser Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp
325 330 335 Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly
Leu Pro 340 345 350 Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly
Gln Pro Arg Glu 355 360 365 Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg
Glu Glu Met Thr Lys Asn 370 375 380 Gln Val Ser Leu Thr Cys Leu Val
Lys Gly Phe Tyr Pro Ser Asp Ile 385 390 395 400Ala Val Glu Trp Glu
Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr 405 410 415 Thr Pro Pro
Met Leu Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser
Lys 420 425 430 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln Gly Asn Val
Phe Ser Cys 435 440 445 Ser Val Met His Glu Ala Leu His Asn His Tyr
Thr Gln Lys Ser Leu 450 455 460 Ser Leu Ser Pro Gly Lys 465
47079720DNAHomo sapiens 79atgaggctcc ctgctcagct cctggggctg
ctaatgctct gggtctctgg atccagtggg 60gatattgtga tgactcagtc tccactctcc
ctgcccgtca cccctggaga gccggcctcc 120atctcctgca ggtctagtca
gagcctcctg cctggtaatg gatacaacta tttggattgg 180tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
240tccggggtcc ctgacaggtt cagtggcagt ggctcaggca cagattttac
actgaaaatc 300agcagagtgg aggctgagga tgttgggatt tattactgca
tgcaagctct acaaactcct 360cggacgttcg gccaagggac caaggtggaa
atcaaacgaa ctgtggctgc accatctgtc 420ttcatcttcc cgccatctga
tgagcagttg aaatctggaa ctgcctctgt tgtgtgcctg 480ctgaataact
tctatcccag agaggccaaa gttcagtgga gggtggataa cgccctccaa
540tcgggtaact cccaggagag tgtcacagag caggacagca aggacagcac
ctacagcctc 600agcagcaccc tgacgctgag caaagcagac tacgagaaac
acaaagtcta cgcctgcgaa 660gtcacccatc agggcctgag ctcgcccgtc
acaaagagct tcaacagggg agagtgttag 72080239PRTHomo sapiens 80Met Arg
Leu Pro Ala Gln Leu Leu Gly Leu Leu Met Leu Trp Val Ser 1 5 10 15
Gly Ser Ser Gly Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro 20
25 30 Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln
Ser 35 40 45 Leu Leu Pro Gly Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr
Leu Gln Lys 50 55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr Leu
Gly Ser Asn Arg Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser Gly
Ser Gly Ser Gly Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg Val
Glu Ala Glu Asp Val Gly Ile Tyr Tyr 100 105 110 Cys Met Gln Ala Leu
Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr Lys 115 120 125 Val Glu Ile
Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140 Pro
Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu 145 150
155 160Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Arg Val
Asp 165 170 175 Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val Thr
Glu Gln Asp 180 185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser Thr
Leu Thr Leu Ser Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val Tyr
Ala Cys Glu Val Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val Thr
Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235 81364DNAHomo sapiens
81caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcggagac cctgtccctc
60acctgcactg tctctggtgg ctccatcaga ggttactact ggagctggat ccggcagccc
120ccagggaagg gactggagtg gattgggtat atctattaca gtgggagcac
caactacaac 180ccctccctca agagtcgagt caccatatca gtagacacgt
ccaagaacca gttctccctg 240aagctgagtt ctgtgaccgc tgcggacacg
gccgtgtatt actgtgcgag aagggggggc 300ctctacggtg actacggctg
gttcgccccc tggggccagg gaaccctggt caccgtctcc 360tcag 36482121PRTHomo
sapiens 82Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro
Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser
Ile Arg Gly Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly
Lys Gly Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser
Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser
Val Asp Thr Ser Lys Asn Gln Phe Ser Leu 65 70 75 80Lys Leu Ser Ser
Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Arg
Gly Gly Leu Tyr Gly Asp Tyr Gly Trp Phe Ala Pro Trp Gly 100 105 110
Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 83322DNAHomo sapiens
83gaaattgtgt tgacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc
60ctctcctgca gggccagtca gagtgttagc agcacctact tagcctggta ccagcagaaa
120cctggccagg ctcccaggct cctcatctat ggtgcatcca gcagggccac
tggcatccca 180gacaggttca gtggcagtgg gtctgggaca gacttcactc
tcaccatcag cagactggag 240cctgaagatt ttgcagtgta ttactgtcag
cagtatagta gcttattcac tttcggccct 300gggaccaaag tggatatcaa ac
32284107PRTHomo sapiens 84Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
Leu Ser Leu Ser Pro Gly 1 5 10 15 Glu Arg Ala Thr Leu Ser Cys Arg
Ala Ser Gln Ser Val Ser Ser Thr 20 25 30 Tyr Leu Ala Trp Tyr Gln
Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu 35 40 45 Ile Tyr Gly Ala
Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser 50 55 60 Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu 65 70 75
80Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr Ser Ser Leu Phe
85 90 95 Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys 100 105
851401DNAHomo sapiens 85atgaaacatc tgtggttctt ccttctcctg gtggcagctc
ccagatgggt cctgtcccag 60gtgcagctgc aggagtcggg cccaggactg gtgaagcctt
cggagaccct gtccctcacc 120tgcactgtct ctggtggctc catcagaggt
tactactgga gctggatccg gcagccccca 180gggaagggac tggagtggat
tgggtatatc tattacagtg ggagcaccaa ctacaacccc 240tccctcaaga
gtcgagtcac catatcagta gacacgtcca agaaccagtt ctccctgaag
300ctgagttctg tgaccgctgc ggacacggcc gtgtattact gtgcgagaag
ggggggcctc 360tacggtgact acggctggtt cgccccctgg ggccagggaa
ccctggtcac cgtctcctca 420gcctccacca agggcccatc ggtcttcccc
ctggcgccct gctccaggag cacctccgag 480agcacagcgg ccctgggctg
cctggtcaag gactacttcc ccgaaccggt gacggtgtcg 540tggaactcag
gcgctctgac cagcggcgtg cacaccttcc cagctgtcct acagtcctca
600ggactctact ccctcagcag cgtggtgacc gtgccctcca gcaacttcgg
cacccagacc 660tacacctgca acgtagatca caagcccagc aacaccaagg
tggacaagac agttgagcgc 720aaatgttgtg tcgagtgccc accgtgccca
gcaccacctg tggcaggacc gtcagtcttc 780ctcttccccc caaaacccaa
ggacaccctc atgatctccc ggacccctga ggtcacgtgc 840gtggtggtgg
acgtgagcca cgaagacccc gaggtccagt tcaactggta cgtggacggc
900gtggaggtgc ataatgccaa gacaaagcca cgggaggagc agttcaacag
cacgttccgt 960gtggtcagcg tcctcaccgt tgtgcaccag gactggctga
acggcaagga gtacaagtgc 1020aaggtctcca acaaaggcct cccagccccc
atcgagaaaa ccatctccaa aaccaaaggg 1080cagccccgag aaccacaggt
gtacaccctg cccccatccc gggaggagat gaccaagaac 1140caggtcagcc
tgacctgcct ggtcaaaggc ttctacccca gcgacatcgc cgtggagtgg
1200gagagcaatg ggcagccgga gaacaactac aagaccacac ctcccatgct
ggactccgac 1260ggctccttct tcctctacag caagctcacc gtggacaaga
gcaggtggca gcaggggaac 1320gtcttctcat gctccgtgat gcatgaggct
ctgcacaacc actacacgca gaagagcctc 1380tccctgtctc cgggtaaatg a
140186466PRTHomo sapiens 86Met Lys His Leu Trp Phe Phe Leu Leu Leu
Val Ala Ala Pro Arg Trp 1 5 10 15 Val Leu Ser Gln Val Gln Leu Gln
Glu Ser Gly Pro Gly Leu Val Lys 20 25 30 Pro Ser Glu Thr Leu Ser
Leu Thr Cys Thr Val Ser Gly Gly Ser Ile 35 40 45 Arg Gly Tyr Tyr
Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu 50 55 60 Glu Trp
Ile Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr Asn Pro 65 70 75
80Ser Leu Lys Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln
85 90 95 Phe Ser Leu Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala
Val Tyr 100 105 110 Tyr Cys Ala Arg Arg Gly Gly Leu Tyr Gly Asp Tyr
Gly Trp Phe Ala 115 120 125 Pro Trp Gly Gln Gly Thr Leu Val Thr Val
Ser Ser Ala Ser Thr Lys 130 135 140 Gly Pro Ser Val Phe Pro Leu Ala
Pro Cys Ser Arg Ser Thr Ser Glu 145 150 155 160Ser Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro 165 170 175 Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr 180 185 190 Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val 195 200
205 Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn
210 215 220 Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys Thr Val
Glu Arg 225 230 235 240Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala
Pro Pro Val Ala Gly 245 250 255 Pro Ser Val Phe Leu Phe Pro Pro Lys
Pro Lys Asp Thr Leu Met Ile 260 265 270 Ser Arg Thr Pro Glu Val Thr
Cys Val Val Val Asp Val Ser His Glu 275 280 285 Asp Pro Glu Val Gln
Phe Asn Trp Tyr Val Asp Gly Val Glu Val His 290 295 300 Asn Ala Lys
Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg 305 310 315
320Val Val Ser Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys
325 330 335 Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro
Ile Glu 340 345 350 Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu
Pro Gln Val Tyr 355 360 365 Thr Leu Pro Pro Ser Arg Glu Glu Met Thr
Lys Asn Gln Val Ser Leu 370 375 380 Thr Cys Leu Val Lys Gly Phe Tyr
Pro Ser Asp Ile Ala Val Glu Trp 385 390 395 400Glu Ser Asn Gly Gln
Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met 405 410 415 Leu Asp Ser
Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 420 425 430 Lys
Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 435 440
445 Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro
450 455 460 Gly Lys 465 87705DNAHomo sapiens 87atggaaaccc
cagcgcagct tctcttcctc ctgctactct ggctcccaga taccaccgga 60gaaattgtgt
tgacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc
120ctctcctgca gggccagtca gagtgttagc agcacctact tagcctggta
ccagcagaaa 180cctggccagg ctcccaggct cctcatctat ggtgcatcca
gcagggccac tggcatccca 240gacaggttca gtggcagtgg gtctgggaca
gacttcactc tcaccatcag cagactggag 300cctgaagatt ttgcagtgta
ttactgtcag cagtatagta gcttattcac tttcggccct 360gggaccaaag
tggatatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca
420tctgatgagc agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa
taacttctat 480cccagagagg ccaaagtaca gtggaaggtg gataacgccc
tccaatcggg taactcccag 540gagagtgtca cagagcagga cagcaaggac
agcacctaca gcctcagcag caccctgacg 600ctgagcaaag cagactacga
gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 660ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gttag 70588234PRTHomo sapiens
88Met Glu Thr Pro Ala Gln Leu Leu Phe Leu Leu Leu Leu Trp Leu Pro 1
5 10 15 Asp Thr Thr Gly Glu Ile Val Leu Thr Gln Ser Pro Gly Thr Leu
Ser 20 25 30 Leu Ser Pro Gly Glu Arg Ala Thr Leu Ser Cys Arg Ala
Ser Gln Ser 35 40 45 Val Ser Ser Thr Tyr Leu Ala Trp Tyr Gln Gln
Lys Pro Gly Gln Ala 50 55 60 Pro Arg Leu Leu Ile Tyr Gly Ala Ser
Ser Arg Ala Thr Gly Ile Pro 65 70 75 80Asp Arg Phe Ser Gly Ser Gly
Ser Gly Thr Asp Phe Thr Leu Thr Ile 85 90 95 Ser Arg Leu Glu Pro
Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr 100 105 110 Ser Ser Leu
Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys Arg 115 120 125 Thr
Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu Gln 130 135
140 Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr
145 150 155 160Pro Arg Glu Ala Lys Val Gln Trp Lys Val Asp Asn Ala
Leu Gln Ser 165 170 175 Gly Asn Ser Gln Glu Ser Val Thr Glu Gln Asp
Ser Lys Asp Ser Thr 180 185 190 Tyr Ser Leu Ser Ser Thr Leu Thr Leu
Ser Lys Ala Asp Tyr Glu Lys 195 200 205 His Lys Val Tyr Ala Cys Glu
Val Thr His Gln Gly Leu Ser Ser Pro 210 215 220 Val Thr Lys Ser Phe
Asn Arg Gly Glu Cys 225 230 89378DNAHomo sapiens 89caggtgcagc
tggtggagtc tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag
cctctggatt caccttcagt agttatggca tgcactgggt ccgccaggct
120ccaggcaagg ggctggagtg ggtggcagtt atatcaaagg atggaggtaa
taaataccat 180gcagactccg tgaagggccg attcaccatc tccagagaca
attccaagaa tacgctgtat 240ctgcaaatga atagcctgag agttgaagac
acggctgtgt attactgtgt gagaagaggg 300catcagctgg ttctgggata
ctactactac aacggtctgg acgtctgggg ccaagggacc 360acggtcaccg tctcctca
37890126PRTHomo sapiens 90Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Ser
Lys Asp Gly Gly Asn Lys Tyr His Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75
80Leu Gln Met Asn Ser Leu Arg Val Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Val Arg Arg Gly His Gln Leu Val Leu Gly Tyr Tyr Tyr Tyr
Asn Gly 100 105 110 Leu Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val
Ser Ser 115 120 125 91378DNAHomo sapiens 91caggtgcagc tggtggagtc
tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cctctggatt
caccttcagt agttatggca tgcactgggt ccgccaggct 120ccaggcaagg
ggctggagtg ggtggcagtt atatcaaagg atggaggtaa taaataccat
180gcagactccg tgaagggccg attcaccatc tccagagaca attccaagaa
tacgctgtat 240ctgcaaatga atagcctgag agctgaagac acggctgtgt
attactgtgc gagaagaggg 300catcagctgg ttctgggata ctactactac
aacggtctgg acgtctgggg ccaagggacc 360acggtcaccg tctcctca
37892126PRTHomo sapiens 92Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Ser
Lys Asp Gly Gly Asn Lys Tyr His Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Arg Gly His Gln Leu Val Leu Gly Tyr Tyr Tyr Tyr
Asn Gly 100 105 110 Leu Asp Val Trp Gly Gln Gly Thr Thr Val Thr Val
Ser Ser 115 120 125 93336DNAHomo sapiens 93gatattgtga tgactcagtc
tccactctcc ctgcccgtca cccctggaga gccggcctcc 60atctcctgca ggtctagtca
gagcctcttg tatagtaatg gatacaactt tttggattgg 120tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
180tccggggtcc ctgacaggtt cagtggcagt ggatcaggca cagattttac
actgaaaatc 240agcagagtgg aggctgagga tgttggggtt tattactgca
tgcaagctct acaaactcct 300cggacgttcg gccaagggac caaggtggaa atcaaa
33694112PRTHomo sapiens 94Asp Ile Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Leu Tyr Ser 20
25 30 Asn Gly Tyr Asn Phe Leu Asp Trp Tyr Leu Gln Lys Pro Gly Gln
Ser 35 40 45 Pro Gln Leu Leu Ile Tyr Leu Gly Ser Asn Arg Ala Ser
Gly Val Pro 50 55 60 Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp
Phe Thr Leu Lys Ile 65 70 75 80Ser Arg Val Glu Ala Glu Asp Val Gly
Val Tyr Tyr Cys Met Gln Ala 85 90 95 Leu Gln Thr Pro Arg Thr Phe
Gly Gln Gly Thr Lys Val Glu Ile Lys 100 105 110 95373DNAHomo
sapiens 95caggtgcaac tggtggagtc tgggggaggc gtggtccagc ctgggaggtc
cctgagactc 60tcctgtgcag cctctggatt caccttcagt cgctatggca tgcactgggt
ccgccaggct 120ccaggcaagg ggctggagtg ggtggcagtt atatcatctg
atggaggtaa taaatactat 180gcagactccg tgaagggccg attcaccatc
tccagagaca attccaagaa cacgctgtat 240ctgcaaatga acagcctgag
agctgaggac acggctgtgt attactgtac gagaagaggg 300actggaaaga
cttactacca ctacgccggt atggacgtct ggggccaagg gaccacggtc
360accgtctcct cag 37396124PRTHomo sapiens 96Gln Val Gln Leu Val Glu
Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Arg Tyr 20 25 30 Gly Met
His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45
Ala Val Ile Ser Ser Asp Gly Gly Asn Lys Tyr Tyr Ala Asp Ser Val 50
55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr 65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Thr Arg Arg Gly Thr Gly Lys Thr Tyr Tyr His
Tyr Ala Gly Met Asp 100 105 110 Val Trp Gly Gln Gly Thr Thr Val Thr
Val Ser Ser 115 120 97364DNAHomo sapiens 97caggtgcagc tgcaggagtc
gggcccagga ctggtgaagc cttcggagac cctgtccctc 60acctgcactg tctctggtgg
ctccatcaga ggttactact ggagctggat ccggcagccc 120cctgggaagg
gactggagtg gattgggtat atctattaca gtgggagcac caactacaac
180ccctccctca agagtcgagt caccatatca gtagacacgt ccaagaacca
gttctccctg 240aagctgaact ctgtgaccgc tgcggacacg gccgtgtatt
attgtgcgag aaaggggggc 300ctctacggtg actacggctg gttcgccccc
tggggccagg gaaccctggt caccgtctcc 360tcag 36498121PRTHomo sapiens
98Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1
5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Arg Gly
Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu
Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser Val Asp Thr
Ser Lys Asn Gln Phe Ser Leu 65 70 75 80Lys Leu Asn Ser Val Thr Ala
Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Lys Gly Gly Leu
Tyr Gly Asp Tyr Gly Trp Phe Ala Pro Trp Gly 100 105 110 Gln Gly Thr
Leu Val Thr Val Ser Ser 115 120 99322DNAHomo sapiens 99gaaattgtgt
tgacgcagtc tccaggcacc ctgtctttgt ctccagggga aagagccacc 60ctctcctgca
gggccagtca gagtgttagc agcagcgact tagcctggca ccagcagaaa
120cctggccagg ctcccagact cctcatctat ggtgcatcca gcagggccac
tggcatccca 180gacaggttca gtggcagtgg gtctgggaca gacttcactc
tcaccatcag cagactggag 240cctgaagatt ttgcagtgta ttactgtcag
cacgcccgta gcttattcac tttcggccct 300gggaccaaag tggatatcaa ac
322100107PRTHomo sapiens 100Glu Ile Val Leu Thr Gln Ser Pro Gly Thr
Leu Ser Leu Ser Pro Gly 1 5 10 15 Glu Arg Ala Thr Leu Ser Cys Arg
Ala Ser Gln Ser Val Ser Ser Ser 20 25 30 Asp Leu Ala Trp His Gln
Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu 35 40 45 Ile Tyr Gly Ala
Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser 50 55 60 Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg Leu Glu 65 70 75
80Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln His Ala Arg Ser Leu Phe
85 90 95 Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys 100 105
101720DNAHomo sapiens 101atgaggctcc ctgctcagct cctggggctg
ctaatgctct gggtctctgg atccagtggg 60gatattgtga tgactcagtc tccactctcc
ctgcccgtca cccctggaga gccggcctcc 120atctcctgca ggtctagtca
gagcctcctg cctggtaatg gatacaacta tttggattgg 180tacctgcaga
agccagggca gtctccacag ctcctgatct atttgggttc taatcgggcc
240tccggggtcc ctgacaggtt cagtggcagt ggctcaggca cagattttac
actgaaaatc 300agcagagtgg aggctgagga tgttgggatt tattactgca
tgcaagctct acaaactcct 360cggacgttcg gccaagggac caaggtggaa
atcaaacgaa ctgtggctgc accatctgtc 420ttcatcttcc cgccatctga
tgagcagttg aaatctggaa ctgcctctgt tgtgtgcctg 480ctgaataact
tctatcccag agaggccaaa gttcagtgga aggtggataa cgccctccaa
540tcgggtaact cccaggagag tgtcacagag caggacagca aggacagcac
ctacagcctc 600agcagcaccc tgacgctgag caaagcagac tacgagaaac
acaaagtcta cgcctgcgaa 660gtcacccatc agggcctgag ctcgcccgtc
acaaagagct tcaacagggg agagtgttag 720102239PRTHomo sapiens 102Met
Arg Leu Pro Ala Gln Leu Leu Gly Leu Leu Met Leu Trp Val Ser 1 5 10
15 Gly Ser Ser Gly Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro
20 25 30 Val Thr Pro Gly Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser
Gln Ser 35 40 45 Leu Leu Pro Gly Asn Gly Tyr Asn Tyr Leu Asp Trp
Tyr Leu Gln Lys 50 55 60 Pro Gly Gln Ser Pro Gln Leu Leu Ile Tyr
Leu Gly Ser Asn Arg Ala 65 70 75 80Ser Gly Val Pro Asp Arg Phe Ser
Gly Ser Gly Ser Gly Thr Asp Phe 85 90 95 Thr Leu Lys Ile Ser Arg
Val Glu Ala Glu Asp Val Gly Ile Tyr Tyr 100 105 110 Cys Met Gln Ala
Leu Gln Thr Pro Arg Thr Phe Gly Gln Gly Thr Lys 115 120 125 Val Glu
Ile Lys Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro 130 135 140
Pro Ser Asp Glu Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu 145
150 155 160Leu Asn Asn Phe Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys
Val Asp 165 170 175 Asn Ala Leu Gln Ser Gly Asn Ser Gln Glu Ser Val
Thr Glu Gln Asp 180 185 190 Ser Lys Asp Ser Thr Tyr Ser Leu Ser Ser
Thr Leu Thr Leu Ser Lys 195 200 205 Ala Asp Tyr Glu Lys His Lys Val
Tyr Ala Cys Glu Val Thr His Gln 210 215 220 Gly Leu Ser Ser Pro Val
Thr Lys Ser Phe Asn Arg Gly Glu Cys 225 230 235 103112PRTHomo
sapiens 103Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro Val Thr
Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser
Leu Leu His Ser 20 25 30 Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu
Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu Ile Tyr Leu Gly
Ser Asn Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80Ser Arg Val Glu
Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala 85 90 95 Leu Gln
Thr Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 105 110
104112PRTHomo sapiens 104Asp Ile Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Leu His Ser 20 25 30 Asn Gly Tyr Asn Tyr Leu
Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu
Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala
85 90 95 Leu Gln Thr Pro Tyr Thr Phe Gly Gln Gly Thr Lys Leu Glu
Ile Lys 100 105 110 105107PRTHomo sapiens 105Asp Ile Gln Met Thr
Gln Ser Pro Ser Ser Val Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val
Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Ser Ser Trp 20 25 30 Leu
Ala Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40
45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly
50 55 60 Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu
Gln Pro 65 70 75 80Glu Asp Phe Ala Thr Tyr Tyr Cys Gln Gln Ala Asn
Ser Phe Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile
Lys 100 105 106124PRTHomo sapiens 106Gln Val Gln Leu Val Glu Ser
Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser
Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His
Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala
Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55
60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr
65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Arg Gly His Gln Leu Leu Gly Tyr Tyr Tyr Tyr
Tyr Gly Met Asp 100 105 110 Val Trp Gly Gln Gly Thr Thr Val Thr Val
Ser Ser 115 120 107125PRTHomo sapiens 107Gln Val Gln Leu Val Glu
Ser Gly Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu
Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met
His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45
Ala Val Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50
55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu
Tyr 65 70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val
Tyr Tyr Cys 85 90 95 Ala Arg Met Gly Ser Ser Gly Ser Asp Tyr Tyr
Tyr Tyr Tyr Gly Met 100 105 110 Asp Val Trp Gly Gln Gly Thr Thr Val
Thr Val Ser Ser 115 120 125108120PRTHomo sapiens 108Gln Val Gln Leu
Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu 1 5 10 15 Thr Leu
Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser Ser Tyr 20 25 30
Tyr Trp Ser Trp Ile Arg Gln Pro Ala Gly Lys Gly Leu Glu Trp Ile 35
40 45 Gly Arg Ile Tyr Thr Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu
Lys 50 55 60 Ser Arg Val Thr Met Ser Val Asp Thr Ser Lys Asn Gln
Phe Ser Leu 65 70 75 80Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala
Val Tyr Tyr Cys Ala 85 90 95 Arg Tyr Cys Gly Tyr Tyr Tyr Tyr Tyr
Gly Met Asp Val Trp Gly Gln 100 105 110 Gly Thr Thr Val Thr Val Ser
Ser 115 120109118PRTHomo sapiens 109Gln Val Gln Leu Gln Glu Ser Gly
Pro Gly Leu Val Lys Pro Ser Glu 1 5 10 15 Thr Leu Ser Leu Thr Cys
Thr Val Ser Gly Gly Ser Ile Ser Ser Tyr 20 25 30 Tyr Trp Ser Trp
Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45 Gly Tyr
Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60
Ser Arg Val Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser Leu 65
70 75 80Lys Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys
Ala 85 90 95 Arg Asp Tyr Gly Gly Asn Ser Tyr Phe Asp Tyr Trp Gly
Gln Gly Thr 100 105 110 Leu Val Thr Val Ser Ser 115 110122PRTHomo
sapiens 110Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ala 1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr
Phe Thr Gly Tyr 20 25 30 Tyr Met His Trp Val Arg Gln Ala Pro Gly
Gln Gly Leu Glu Trp Met 35 40 45 Gly Trp Ile Asn Pro Asn Ser Gly
Gly Thr Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met
Thr Arg Asp Thr Ser Ile Ser Thr Ala Tyr 65 70 75 80Met Glu Leu Ser
Arg Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg
Gly Tyr Cys Thr Asn Gly Val Cys Tyr Tyr Phe Asp Tyr Trp 100 105 110
Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 111112PRTHomo
sapiens 111Asp Ile Val Met Thr Gln Ser Pro Leu Ser Leu Pro Val Thr
Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg Ser Ser Gln Ser
Leu Leu His Ser 20 25 30 Asn Gly Tyr Asn Tyr Leu Asp Trp Tyr Leu
Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu Ile Tyr Leu Gly
Ser Asn Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg Phe Ser Gly Ser
Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75 80Ser Arg Val Glu
Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala 85 90 95 Leu Gln
Thr Pro Trp Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys 100 105 110
112112PRTHomo sapiens 112Asp Ile Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly 1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Leu His Ser 20 25 30 Asn Gly Tyr Asn Tyr Leu
Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu
Ile Tyr Leu Gly Ser Asn Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile 65 70 75
80Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala
85 90 95 Leu Gln Thr Pro Phe Thr Phe Gly Pro Gly Thr Lys Val Asp
Ile Lys 100 105 110 113108PRTHomo sapiens 113Glu Ile Val Leu Thr
Gln Ser Pro Gly Thr Leu Ser Leu Ser Pro Gly 1 5 10 15 Glu Arg Ala
Thr Leu Ser Cys Arg Ala Ser Gln Ser Val Ser Ser Ser 20 25 30 Tyr
Leu Ala Trp Tyr Gln Gln Lys Pro Gly Gln Ala Pro Arg Leu Leu 35 40
45 Ile Tyr Gly Ala Ser Ser Arg Ala Thr Gly Ile Pro Asp Arg Phe Ser
50 55 60 Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Arg
Leu Glu 65 70 75 80Pro Glu Asp Phe Ala Val Tyr Tyr Cys Gln Gln Tyr
Gly Ser Ser Pro
85 90 95 Phe Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys 100 105
114122PRTHomo sapiens 114Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Ser
Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Tyr Cys Gly Gly Asp Cys Tyr Gly Ile Ala Val Ala
Gly Trp 100 105 110 Gly Gln Gly Thr Leu Val Thr Val Ser Ser 115 120
115123PRTHomo sapiens 115Gln Val Gln Leu Val Glu Ser Gly Gly Gly
Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Ser
Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70 75
80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Ala Arg Gly Thr Thr Gly Thr Tyr Tyr Tyr Tyr Tyr Gly Met
Asp Val 100 105 110 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser 115
120 116123PRTHomo sapiens 116Gln Val Gln Leu Val Glu Ser Gly Gly
Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile
Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60 Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65 70
75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95 Ala Arg Asp Tyr Gly Asp Tyr Tyr Tyr Tyr Tyr Tyr Gly
Met Asp Val 100 105 110 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser
115 120 117123PRTHomo sapiens 117Gln Val Gln Leu Val Glu Ser Gly
Gly Gly Val Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Ala Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val
Ile Ser Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr 65
70 75 80Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr
Cys 85 90 95 Ala Arg Asp Tyr Gly Asp Tyr Tyr Tyr Tyr Tyr Tyr Gly
Met Asp Val 100 105 110 Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser
115 120 11823DNAArtificial SequenceDescription of Artificial
Sequence Primer 118caggtgcagc tggagcagtc ngg 2311924DNAArtificial
SequenceDescription of Artificial Sequence Primer 119gctgagggag
tagagtcctg agga 2412049DNAArtificial SequenceDescription of
Artificial Sequence Primer 120tatctaagct tctagactcg accgccacca
tggagtttgg gctgagctg 4912149DNAArtificial SequenceDescription of
Artificial Sequence Primer 121tatctaagct tctagactcg accgccacca
tggagtttgg gctgagctg 4912251DNAArtificial SequenceDescription of
Artificial Sequence Primer 122tatctaagct tctagactcg agcgccacca
tgaaacacct gtggttcttc c 5112351DNAArtificial SequenceDescription of
Artificial Sequence Primer 123tatctaagct tctagactcg agcgccacca
tgaaacatct gtggttcttc c 5112451DNAArtificial SequenceDescription of
Artificial Sequence Primer 124tatctaagct tctagactcg agcgccacca
tggactggac ctggaggatc c 5112544DNAArtificial SequenceDescription of
Artificial Sequence Primer 125ttctctgatc agaattccta tcatttaccc
ggagacaggg agag 4412641DNAArtificial SequenceDescription of
Artificial Sequence Primer 126cttcaagctt acccgggcca ccatgaggct
ccctgctcag c 4112743DNAArtificial SequenceDescription of Artificial
Sequence Primer 127ttctttgatc agaattctca ctaacactct cccctgttga agc
4312849DNAArtificial SequenceDescription of Artificial Sequence
Primer 128tatctaagct tctagactcg accgccacca tggagtttgg gctgagctg
4912949DNAArtificial SequenceDescription of Artificial Sequence
Primer 129tatctaagct tctagactcg accgccacca tggagtttgg gctgagctg
4913049DNAArtificial SequenceDescription of Artificial Sequence
Primer 130tatctaagct tctagactcg accgccacca tggagtttgg gctgagctg
4913151DNAArtificial SequenceDescription of Artificial Sequence
Primer 131tatctaagct tctagactcg agcgccacca tgaaacatct gtggttcttc c
5113249DNAArtificial SequenceDescription of Artificial Sequence
Primer 132tatctaagct tctagactcg accgccacca tggagtttgg gctgagctg
4913351DNAArtificial SequenceDescription of Artificial Sequence
Primer 133tatctaagct tctagactcg agcgccacca tgaaacatct gtggttcttc c
5113445DNAArtificial SequenceDescription of Artificial Sequence
Primer 134tcttcaagct tgcccgggcc cgccaccatg gaaaccccag cgcag
4513536DNAArtificial SequenceDescription of Artificial Sequence
Primer 135gcaagcttca ccaatggttc gtctgcctct gcagtg
3613643DNAArtificial SequenceDescription of Artificial Sequence
Primer 136tcagtgatgg tgatggtgat gtctcagccg atcctgggga cca
4313743DNAArtificial SequenceDescription of Artificial Sequence
Primer 137tcagtgatgg tgatggtgat gtgggcaggg ctcgcgatgg tat
4313843DNAArtificial SequenceDescription of Artificial Sequence
Primer 138tcagtgatgg tgatggtgat gacaggtgca gatggtgtct gtt
43139197PRTHomo sapiens 139Met Val Arg Leu Pro Leu Gln Cys Val Leu
Trp Gly Cys Leu Leu Thr 1 5 10 15 Ala Val His Pro Glu Pro Pro Thr
Ala Cys Arg Glu Lys Gln Tyr Leu 20 25 30 Ile Asn Ser Gln Cys Cys
Ser Leu Cys Gln Pro Gly Gln Lys Leu Val 35 40 45 Ser Asp Cys Thr
Glu Phe Thr Glu Thr Glu Cys Leu Pro Cys Gly Glu 50 55 60 Ser Glu
Phe Leu Asp Thr Trp Asn Arg Glu Thr His Cys His Gln His 65 70 75
80Lys Tyr Cys Asp Pro Asn Leu Gly Leu Arg Val Gln Gln Lys Gly Thr
85 90 95 Ser Glu Thr Asp Thr Ile Cys Thr Cys Glu Glu Gly Trp His
Cys Thr 100 105 110 Ser Glu Ala Cys Glu Ser Cys Val Leu His Arg Ser
Cys Ser Pro Gly 115 120 125 Phe Gly Val Lys Gln Ile Ala Thr Gly Val
Ser Asp Thr Ile Cys Glu 130 135 140 Pro Cys Pro Val Gly Phe Phe Ser
Asn Val Ser Ser Ala Phe Glu Lys 145 150 155 160Cys His Pro Trp Thr
Ser Cys Glu Thr Lys Asp Leu Val Val Gln Gln 165 170 175 Ala Gly Thr
Asn Lys Thr Asp Val Val Cys Gly Pro Gln Asp Arg His 180 185 190 His
His His His His 195 140153PRTHomo sapiens 140Met Val Arg Leu Pro
Leu Gln Cys Val Leu Trp Gly Cys Leu Leu Thr 1 5 10 15 Ala Val His
Pro Glu Pro Pro Thr Ala Cys Arg Glu Lys Gln Tyr Leu 20 25 30 Ile
Asn Ser Gln Cys Cys Ser Leu Cys Gln Pro Gly Gln Lys Leu Val 35 40
45 Ser Asp Cys Thr Glu Phe Thr Glu Thr Glu Cys Leu Pro Cys Gly Glu
50 55 60 Ser Glu Phe Leu Asp Thr Trp Asn Arg Glu Thr His Cys His
Gln His 65 70 75 80Lys Tyr Cys Asp Pro Asn Leu Gly Leu Arg Val Gln
Gln Lys Gly Thr 85 90 95 Ser Glu Thr Asp Thr Ile Cys Thr Cys Glu
Glu Gly Trp His Cys Thr 100 105 110 Ser Glu Ala Cys Glu Ser Cys Val
Leu His Arg Ser Cys Ser Pro Gly 115 120 125 Phe Gly Val Lys Gln Ile
Ala Thr Gly Val Ser Asp Thr Ile Cys Glu 130 135 140 Pro Cys Pro His
His His His His His 145 150 141111PRTHomo sapiens 141Met Val Arg
Leu Pro Leu Gln Cys Val Leu Trp Gly Cys Leu Leu Thr 1 5 10 15 Ala
Val His Pro Glu Pro Pro Thr Ala Cys Arg Glu Lys Gln Tyr Leu 20 25
30 Ile Asn Ser Gln Cys Cys Ser Leu Cys Gln Pro Gly Gln Lys Leu Val
35 40 45 Ser Asp Cys Thr Glu Phe Thr Glu Thr Glu Cys Leu Pro Cys
Gly Glu 50 55 60 Ser Glu Phe Leu Asp Thr Trp Asn Arg Glu Thr His
Cys His Gln His 65 70 75 80Lys Tyr Cys Asp Pro Asn Leu Gly Leu Arg
Val Gln Gln Lys Gly Thr 85 90 95 Ser Glu Thr Asp Thr Ile Cys Thr
Cys His His His His His His 100 105 110 142118PRTHomo sapiens
142Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu
1 5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Ser
Ser Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly
Leu Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn
Tyr Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser Val Asp
Thr Ser Lys Asn Gln Phe Ser Leu 65 70 75 80Lys Leu Ser Ser Val Thr
Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Asp Tyr Gly
Asp Tyr Asn Trp Phe Asp Pro Trp Gly Gln Gly Thr 100 105 110 Leu Val
Thr Val Ser Ser 115 14315PRTArtificial SequenceDescription of
Artificial Sequence Linker peptide 143Gly Gly Gly Gly Ser Gly Gly
Gly Gly Ser Gly Gly Gly Gly Ser 1 5 10 1514418DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 144tttttttttt tttttttt 181456PRTArtificial
SequenceDescription of Artificial Sequence 6-His tag 145His His His
His His His 1 5 14636DNAArtificial SequenceDescription of
Artificial Sequence Primer 146tgcaagcttc accatggtgt ctttgcctcg
gctgtg 3614748DNAArtificial SequenceDescription of Artificial
Sequence Primer 147gtcctcgagt cagtgatggt gatggtgatg tgggcaggga
tgacagac 48
* * * * *