U.S. patent application number 14/992994 was filed with the patent office on 2016-05-19 for compositions and methods for the treatment of vprbp-related cancers.
The applicant listed for this patent is Woojin An, Kyunghwan Kim, Wange Lu, Nouri Neamati. Invention is credited to Woojin An, Kyunghwan Kim, Wange Lu, Nouri Neamati.
Application Number | 20160138026 14/992994 |
Document ID | / |
Family ID | 52810174 |
Filed Date | 2016-05-19 |
United States Patent
Application |
20160138026 |
Kind Code |
A1 |
An; Woojin ; et al. |
May 19, 2016 |
COMPOSITIONS AND METHODS FOR THE TREATMENT OF VprBP-RELATED
CANCERS
Abstract
This disclosure provides methods and compositions to inhibit or
suppress tumor growth or to treat cancer by inhibiting VprBP kinase
activity. Also provided are methods of determining the
effectiveness of the methods and compositions to inhibit or
suppress tumor growth or to treat cancer by inhibiting VprBP kinase
activity, methods for detecting a cancer, and methods for screening
potential agents that inhibit VprBP kinase activity.
Inventors: |
An; Woojin; (Los Angeles,
CA) ; Neamati; Nouri; (Ann Arbor, MI) ; Kim;
Kyunghwan; (Los Angeles, CA) ; Lu; Wange; (Los
Angeles, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
An; Woojin
Neamati; Nouri
Kim; Kyunghwan
Lu; Wange |
Los Angeles
Ann Arbor
Los Angeles
Los Angeles |
CA
MI
CA
CA |
US
US
US
US |
|
|
Family ID: |
52810174 |
Appl. No.: |
14/992994 |
Filed: |
January 11, 2016 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
14514223 |
Oct 14, 2014 |
9234018 |
|
|
14992994 |
|
|
|
|
61891220 |
Oct 15, 2013 |
|
|
|
Current U.S.
Class: |
514/44A ;
435/375 |
Current CPC
Class: |
C12N 9/1205 20130101;
G01N 33/5011 20130101; C07K 14/47 20130101; G01N 33/57484 20130101;
C07K 7/06 20130101; C12N 15/1137 20130101; C12N 2320/30 20130101;
C07K 2319/10 20130101; C07D 495/04 20130101; C12Q 1/485 20130101;
C12N 2310/531 20130101; G01N 2500/04 20130101; C07K 7/08 20130101;
A61K 38/00 20130101; C12N 2310/14 20130101; G01N 2800/52
20130101 |
International
Class: |
C12N 15/113 20060101
C12N015/113 |
Goverment Interests
STATEMENT OF GOVERNMENT SUPPORT
[0002] This invention was made with government support under NIH
Grant GM84209 awarded by the National Institutes of Health.
Accordingly, the government has certain rights in the invention.
Claims
1. A method for on or more of: a. inhibiting the growth of a cancer
cell; b. activating tumor suppressor function in a cell comprising
functional tumor suppressor genes; and c. inhibiting H2AT120P in a
cell comprising functional H2AT120P, comprising contacting the cell
with an effective amount of an agent that inhibits VprBP kinase
activity in the cell, wherein the agent is the composition of claim
3 or 4.
2. A method for inhibiting the growth of a cancer cell in a patient
or treating cancer in a patient, comprising administering to the
patient in need thereof an effective amount of the composition of
claim 3 or 4.
3. A composition comprising a carrier and a VprBR kinase-specific
RNAi.
4. The composition of claim 3, wherein VprBR kinase-specific RNAi
is selected from the group of reference polynucleotides of
consisting of VprBP shRNA1 (SEQ ID NO: 1:
5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2 (SEQ ID NO: 2:
5'-AATCACAGAGTATCTTAGA-3') and Bub1 shRNA (SEQ ID NO:
3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent thereof, wherein
an equivalent of each thereof, wherein an equivalent thereof
comprises a polynucleotide that has at least 80% sequence identity
to the reference polynucleotide and inhibits VprBP kinase activity
or a polynucleotide that hybridizes under conditions of high
stringency to the reference polynucleotide or its complement,
wherein conditions of high stringency comprise hybridization
reaction at about 60.degree. C. in about 1.times.SSC and inhibits
VprBP kinase activity.
5. The composition of claim 3, wherein the carrier is a
pharmaceutically acceptable carrier or an in situ device.
6. The composition of claim 5, wherein the device is a catheter.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a divisional of U.S. patent application
Ser. No. 14/514,223, filed Oct. 14, 2014, now U.S. Pat. No.
9,234,018, which claims the benefit under 35 U.S.C. .sctn.119(e) to
U.S. Provisional Application No. 61/891,220, filed Oct. 15, 2013,
the content of each of which is hereby incorporated by reference in
its entirety.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted electronically in ASCII format and is hereby
incorporated by reference in its entirety. Said ASCII copy, created
on Dec. 3, 2014, is named 064189-7083_SL.txt and is 17,329 bytes in
size.
TECHNICAL FIELD
[0004] This invention generally relates to the methods and
compositions for treating cancer and inhibiting the growth of a
cancer cell or a tumor.
BACKGROUND
[0005] Genomic DNA in human cells is hierarchically packaged by
histones to form a highly repressive structure of chromatin. The
basic unit of chromatin is the nucleosome, which consists of 147-bp
of negatively supercoiled DNA wrapped a core histone octamer
containing pairs of each of the four core histones, H2A, H2B, H3
and H4. The dynamic posttranslational modifications of histone
N-terminal and C-terminal domains (called histone "tails"), which
extend away from the nucleosome, govern the structural diversity of
chromatin and the accessibility of DNA, thus representing an
important molecular mechanism underlying regulation of gene
expression. VprBP is a nuclear protein that can interact with HIV
viral protein R and the Cullin 4-DDB 1 ubiquitin ligase complex.
Its cellular function has been studied mainly with respect to its
role in regulating Cullin 4 E3 ubiquitin ligase activity and cell
cycle progression. However, subsequent studies, predominantly from
Inventor's laboratory, have revealed that VprBP stably binds to
promoter nucleosomes and that this association represses
p53-mediated chromatin transcription (Mol Cell Biol 32, 783-796).
The C-terminal region of VprBP has an ability to interact with H3
N-terminal tails protruding from nucleosomes and is critical for
the observed functions of VprBP. Overexpression and mutations of
VprBP have been detected in bladder/breast/prostate cancer cells
supporting the idea that it possesses oncogenic properties.
SUMMARY
[0006] In one aspect, this technology provides methods and
compositions for treating cancer by inhibiting VprBP kinase
activity.
[0007] In another aspect, this technology provides methods and
compositions for activating tumor suppression by inhibiting VprBP
kinase activity.
[0008] In still another aspect, this technology provides methods
and compositions for inhibiting H2AT120p by inhibiting VprBP kinase
activity.
[0009] In some embodiments, the VprBP kinase activity is inhibited
by an inhibitor of VprBP. In one aspect, the inhibitor comprises,
or alternatively consists essentially of, or yet further consists
of, QTARKSTGGKAPRKQLATKAARK (SEQ ID NO: 12) or comprises, or
alternatively consists essentially of, or yet further consists of,
a synthetic peptide comprising a HIV1 TAT sequence and the H3
N-terminal tail domain which corresponds to amino acids 5-27
(QTARKSTGGKAPRKQLATKAARK (human histone H3 N-terminal tail
corresponding to amino acids 5-27)-RKKRRQRRR (HIV1 TAT sequence))
(SEQ ID NO: 11), and sequences having at least 80% amino acid
sequence identity to each thereof and having the same or similar
biological activity. Since the regulation of H2AT120
phosphorylation is important in the control of cell growth and the
establishment and maintenance of gene silencing, the present
invention should make it possible to detect and regulate VprBP
dysfunction related to cancer development. In addition, the
invention provides a method of reducing H2AT120 phosphorylation by
using histone H3 tail peptides which block VprBP kinase activity
and therefore reduce VprBP carcinogenic potential in cancer
cells.
[0010] In some embodiments, the VprBP kinase activity is inhibited
by RNA interference. In some embodiments, the RNAi comprises, or
alternatively consists essentially of, or yet further consists of,
one or more polynucleotide of the group VprBP shRNA1 (SEQ ID NO: 1:
5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2 (SEQ ID NO: 2:
5'-AATCACAGAGTATCTTAGA-3') or Bub1 shRNA (SEQ ID NO:
3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent of each
thereof.
[0011] In some embodiments, the VprBP inhibitor is a small molecule
inhibitor of VprBP, such as a compound of the formula:
##STR00001##
or a pharmaceutically acceptable salt thereof or a solvate of the
compound or the salt thereof.
[0012] In still another aspect, this technology provides a method
for treating or inhibiting cancer comprising administering to a
patient in need thereof an effective amount of a compound of the
formula:
##STR00002##
or a pharmaceutically acceptable salt thereof or a solvate of the
compound or the salt thereof, or an RNAi, wherein the RNAi
comprises, or alternatively consists essentially of, or yet further
consists of, one or more polynucleotide of the group VprBP shRNA1
(SEQ ID NO: 1: 5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2 (SEQ ID
NO: 2: 5'-AATCACAGAGTATCTTAGA-3') Bub1 shRNA (SEQ ID NO:
3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent of each
thereof.
[0013] The compound, a salt of the compound, or a solvate of the
compound or the salt thereof, RNAi or a composition containing one
or more thereof, can be administered locally or systemically by any
appropriate method, e.g., to the site of infection, topically,
rectally, vaginally, ocularly, subcutaneous, intramuscularly,
intraperitoneally, urethrally, intranasally, by inhalation or
orally.
[0014] In still another aspect, this technology provides a method
of detecting a VprBP-related cancer in a patient, comprising, or
alternatively consisting essentially thereof, or yet further
consisting of, determining the presence of VprBP in a sample of the
patient, wherein the presence of VprBP is indicative of a cancer in
the patient.
[0015] In some embodiments, an overexpression of VprBP is
indicative of a cancer in the patient. In some embodiments,
overexpression of VprBP means that the VprBP level in the sample is
higher than the average or range of VprBP level of healthy
individuals or individuals that do not have the cancer.
[0016] In some embodiments, the cancer or tumor is a solid tumor.
In some embodiments, the cancer is bladder, breast or prostate
cancer.
[0017] In still another aspect, this technology provides a method
for determining the effectiveness of treating or monitoring the
treatment a cancer, e.g., a VprBP-related cancer, by VprBP
inhibition, comprising determining the gene expression of a gene
selected from Tables 2 and 3 in a sample of the patient before
VprBP inhibition and in a sample of the patient after VprBP
inhibition, wherein activation of a gene selected from Table 2 or
repression of a gene selected from Table 3 is indicative of
effectiveness of VprBP inhibition in treating the cancer in the
patient.
[0018] Activation of a gene refers to an increase in the expression
of the gene in the presence of VprBP inhibition as compared with
the expression of the gene in the absence of VprBP inhibition. In
some embodiments, activation of a gene selected from Table 2 means
that at least 0.5 or more, or alternatively at least 1, or more
fold change in gene expression of a gene selected from Table 2 is
found. In some embodiments, activation of a gene selected from
Table 2 means that at least 1.5, or alternatively at least a 2 fold
change in gene expression of a gene selected from Table 2 is found.
In some embodiments, activation of a gene selected from Table 2
means that at least 3 fold change in gene expression of a gene
selected from Table 2 is found. In some embodiments, activation of
a gene selected from Table 2 means that at least 4 fold change in
gene expression of a gene selected from Table 2 is found. In some
embodiments, activation of a gene selected from Table 2 means that
at least 5 fold change in gene expression of a gene selected from
Table 2 is found. In some embodiments, the gene is one or more gene
selected from LOC100008589, IL11, LOC100132564, RMRP, SCARNA18,
LOC100008588, CD24 SCARNA11, LOC100133565, SLC22A18AS, Hs.543887,
KIAA1644, MIR1978, NOV, SCARNA14, SCARNA8, C6orf48 and SCARNA16, or
a combination thereof. In some embodiments, the gene is selected
from LOC100008589, IL11, LOC100132564, RMRP, SCARNA18,
LOC100008588, CD24 and SCARNA11, or a combination thereof.
[0019] Repression of a gene refers to a decrease in the expression
of the gene in the presence of VprBP inhibition as compared with
the expression of the gene in the absence of VprBP inhibition. In
some embodiments, repression of a gene selected from Table 3 means
that at least -0.5 fold, or at least -1.0, or alternatively at
least a -1.5 fold change in gene expression of a gene selected from
Table 3 is found. In some embodiments, repression of a gene
selected from Table 3 means that at least -2 fold change in gene
expression of a gene selected from Table 3 is found. In some
embodiments, repression of a gene selected from Table 2 means that
at least -3 fold change in gene expression of a gene selected from
Table 3 is found. In some embodiments, repression of a gene
selected from Table 3 means that at least -4 fold change in gene
expression of a gene selected from Table 3 is found. In some
embodiments, the gene is one or more gene selected from SNORD13,
CYP24A1, RASL10A, CCL20, IGFBP3, LCN2, SRPX, SYTL2, ERLIN2, SPP1,
OPLAH, TMEM145, HLA-DMA, PCK2, ANG, RNASE4, KIF1B, GALNTL1, ACCN2,
MAP1LC3A, LAMP3, KISS1R, DDIT4L and CLYBL, or a combination
thereof. In some embodiments, the gene is selected from SNORD13,
CYP24A1, RASL10A, CCL20 and IGFBP3, or a combination thereof.
[0020] In some embodiments, the cancer comprise, or alternatively
consists essentially of, or yet further consists of, a solid tumor.
In some embodiments, the cancer is bladder, breast or prostate
cancer.
[0021] In some embodiments, the sample is bladder, breast or
prostate sample.
[0022] In some embodiments, the sample is a tissue sample
comprising and/or suspected of comprising cancer or tumor
cells.
[0023] In some embodiments, the sample is a blood or plasma
sample.
[0024] In still another aspect, this technology provides a
composition for treating cancer or for activation of tumor
suppressor function in a cell in need thereof, comprising, or
alternatively consisting essentially of, or yet further consisting
of, a carrier and one or more of an effective amount of a compound
of the formula:
##STR00003##
or a pharmaceutically acceptable salt, or a solvate of the compound
or the salt thereof or an equivalent of each thereof, or a
polynucleotide comprising, or alternatively consisting essentially
of, or yet further consisting of, VprBP shRNA1 (SEQ ID NO: 1:
5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2 (SEQ ID NO: 2:
5'-AATCACAGAGTATCTTAGA-3') Bub1 shRNA (SEQ ID NO:
3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent of each
thereof.
[0025] In some embodiments, the effective amount of the compound is
from about 1 mg/day to 10 g/day. In some embodiments, the effective
amount of the compound is about 1 mg/day, about 10 mg/day, about 50
mg/day, about 100 mg/day, about 1 g/day, or about 10 g/day, or
within any range between any two of these values (including
endpoints). In some embodiments, the effective amount of the
compound is from about 0.01 mg/kg to 100 mg/kg. In some
embodiments, the effective amount of the compound is about 0.01
mg/kg, about 0.1 mg/kg, 1 mg/kg, about 10 mg/kg, about 50 mg/kg, or
100 mg/kg, or within any range between any two of these values
(including endpoints).
[0026] In still another aspect, this technology provides a
composition comprising, or alternatively consisting essentially of,
or yet further consisting of, a carrier and a RNAi capable of
inhibiting VprBP expression. In one aspect, the RNAi is present in
the composition in an effective amount.
[0027] In some embodiments, the RNAi is selected from the group
consisting of a polynucleotide comprising, or alternatively
consisting essentially of, or yet further consisting of, a VprBP
shRNA1 (SEQ ID NO: 1: 5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2
(SEQ ID NO: 2: 5'-AATCACAGAGTATCTTAGA-3') and Bub1 shRNA (SEQ ID
NO: 3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent thereof.
[0028] In some embodiments, the effective amount of the compound is
about 0.01 mg/kg, about 0.1 mg/kg, 1 mg/kg, about 10 mg/kg, about
50 mg/kg, or 100 mg/kg, or within any range between any two of
these values (including endpoints).
[0029] In some embodiments, the carrier is a pharmaceutically
acceptable carrier or an in situ device.
[0030] In some embodiments, the device is a catheter.
[0031] In still another aspect, this technology provides a screen
to identify a potential therapeutic agent for inhibiting tumor
growth or for tumor suppression, and in one aspect a VprBP-related
tumor, comprising or alternatively consisting essentially of, or
yet further consisting of, contacting a candidate agent with VprBP
to initiate a kinase reaction, wherein the agent is a potential
therapeutic agent if a reduction of kinase activity as compared to
the kinase activity of VprBP in the absence of the agent is
observed.
[0032] In some embodiments, the agent is a small molecule.
[0033] In some aspects of the above-noted embodiments, the patient
is a non-human animal or a human patient. Non-human animals
include, for example, simians, murines, such as, rats, mice,
chinchilla, canine, equine, feline, leporids, such as rabbits,
livestock, sport animals and pets.
[0034] In one aspect, the disclosure provides an isolated peptide,
comprising, or alternatively consisting of, or yet further
consisting essentially of, one or more of the sequence
QTARKSTGGKAPRKQLATKAARK (SEQ ID NO: 12) or QTARKSTGGKAPRKQLATKAARK
(human histone H3 N-terminal tail corresponding to amino acids
5-27)-RKKRRQRRR (HIV1 TAT sequence) (SEQ ID NO: 11), or an
equivalent of each thereof, such as sequences having at least 80%,
or alternatively at least 90% or alternatively at least 95% amino
acid sequence identity and having the same or similar biological
activity to competitively inhibit VprBP-medicated H2AT120
phosphorylation. In one aspect, the isolated peptide further
comprises, or alternatively consists essentially of, or yet further
consists of, a detectable label. Methods to recombinantly or
chemically reproduce the isolated peptide are further provided
herein.
[0035] Also provided herein is an isolated polynucleotide that
encodes a peptide comprising or alternatively consisting of, or yet
further consisting essentially of, the sequence
QTARKSTGGKAPRKQLATKAARK (SEQ ID NO: 12) or QTARKSTGGKAPRKQLATKAARK
(human histone H3 N-terminal tail corresponding to amino acids
5-27)-RKKRRQRRR (HIV1 TAT sequence) (SEQ ID NO: 11), or an
equivalent of each thereof, such as sequences having at least 80%,
or alternatively at least 90% or alternatively at least 95% amino
acid sequence identity and having the same or similar biological
activity to competitively inhibit VprBP-medicated H2AT120
phosphorylation. In one aspect, the polynucleotide hybridized under
stringent conditions to the polynucleotide, or an equivalent
thereof, or their compliments.
[0036] In still another aspect, this technology provides isolated,
non-naturally occurring polynucleotide encoding VprBP or the
polypeptides as disclosed herein, or a polynucleic acid which has
at least 80%, 85%, 90% or 95% of sequence identity to a polynucleic
acid encoding VprBP, or a fragment thereof. In one aspect, the
non-naturally occurring polynucleotide comprises a cDNA or an
isolated naturally occurring polynucleotide having attached thereto
a non-naturally occurring element, such as a linker, a label or a
non-naturally occurring polynucleotide.
[0037] In some embodiments, the cDNA is a cDNA of a polynucleic
acid having a sequence encoding a polypeptide sequence comprising,
or alternatively consisting essentially of, or yet further
consisting of, a polynucleotide of the sequence:
Q-PLRTYSTGLLGGAMENQDI (SEQ ID NO: 4), EVALRQENKRPSPRKLS (SEQ ID NO:
5), or both, or an equivalent of each thereof.
[0038] In some embodiments, the cDNA is a cDNA of a polynucleic
acid comprising a sequence encoding a polypeptide sequence
comprising, or alternatively consisting essentially of, or yet
further consisting of, DPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRL (SEQ
ID NO: 6), or an equivalent thereof.
[0039] In some embodiments, the cDNA is a cDNA of a polynucleic
acid having a sequence encoding a polypeptide sequence comprising,
or alternatively consisting essentially of, or yet further
consisting of, YIDLKQTNDVL (SEQ ID NO: 7), FATEFV (SEQ ID NO: 8),
KLLEIPRPS (SEQ ID NO: 9), or QDAMERVCM (SEQ ID NO: 10), or two or
more of SEQ ID NO: 7 to SEQ ID NO: 10, or an equivalent of each
thereof.
[0040] In some embodiments, the cDNA is a cDNA of a polynucleic
acid having a sequence encoding a polypeptide sequence comprising,
or alternatively consisting essentially of, or yet further
consisting of, two or more of SEQ ID NO: 4 to SEQ ID NO: 10, or an
equivalent of each thereof. In some embodiments, the cDNA is a cDNA
of a polynucleic acid having a sequence encoding a polypeptide
sequence comprising, or alternatively consisting essentially of, or
yet further consisting of, all of SEQ ID NO: 4 to SEQ ID NO: 10, or
an equivalent of each thereof.
[0041] Polynucleotides (such as cDNA or RNAi) as used herein can be
combined with a vector or contained within a cell of delivery or
expression. Any art recognized method for therapeutic delivery or
expression of such are intended within the scope of this
disclosure.
[0042] Kits are further provided which contain the compositions
described herein and instructions for intended use.
BRIEF DESCRIPTION OF THE FIGURES
[0043] FIGS. 1A-1G show VprBP phosphorylates histone H2A at T120.
(FIG. 1A) Chromatin was prepared from human prostate cancer (DU145)
and normal (MLC) cell lines and subjected to western blotting with
the indicated antibodies. Ponceau S staining and b-actin served as
loading controls in all western blot analyses in this study.
Quantifications of the band intensities by densitometry are shown
below the western blots, and similar results were obtained from two
additional experiments. ac, acetylation; p, phosphorylation; me3,
trimethylation. (FIG. 1B) DU145 cells were infected with
lentiviruses expressing VprBP shRNA1 (lane 2) or nonspecific
control shRNA (lane 1), and chromatin fractions were analyzed by
western blotting as in (FIG. 1A). (FIG. 1C) Individual core
histones were incubated with recombinant VprBP in the presence of
[g-32P] ATP. The reactions were resolved by 15% SDS-PAGE and
analyzed by autoradiography (upper panel) and Coomassie blue
staining (lower panel). (FIG. 1D) VprBP contains the putative
kinase domain in the N-terminal region, the Lis homology motif in
the central region, and the WD repeat and D/E-rich motif in the
C-terminal region. Numbers denote amino acid positions. Sequence
alignment of the putative kinase domain in VprBP (SEQ ID NOS 4-5,
59 and 6-10, respectively, in order of appearance) with the kinase
domains of human CK1 (SEQ ID NOS 60-67, respectively, in order of
appearance) and Mut9p (SEQ ID NOS 68-69, 62 and 70-74,
respectively, in order of appearance) is shown in the lower panel.
The boxed regions correspond to the conserved kinase subdomains
I-III and V-IX. (FIG. 1E) Nucleosomes were reconstituted on a 207
bp 601 nt positioning sequence using recombinant histones and
incubated with wild-type VprBP or the indicated mutants. H2A
phosphorylation was detected by autoradiography. (FIG. 1F) Kinase
assays were performed as in (FIG. 1E) but using nucleosomes
containing wild-type, tailless, or mutant H2A (SEQ ID NOS 75-78,
respectively, in order of appearance). The residues that were
mutated are indicated at the top. The H2A mutations did not affect
histone octamer and nucleosome formation during reconstitution
(data not shown). (FIG. 1G) Nucleosomes containing H2A wild-type or
T120A mutant were incubated with VprBP and ATP. H2AT120p was
analyzed by western blotting with anti-H2AT120p antibody. See also
FIG. 5.
[0044] FIGS. 2A-2D show that VprBP is overexpressed in tumors and
required for cell proliferation. (FIG. 2A) Tissue microarrays
containing primary tumor and adjacent normal samples from cancer
patients were subjected to immunohistochemistry with VprBP and
H2AT120p antibodies. High-power magnifications are shown for six
representative samples. Scale bars correspond to 50 mm. See also
Table 1. (FIG. 2B) DU145 cells were depleted of VprBP and infected
with lentiviruses expressing the VprBP wild-type (WT) or VprBP
kinase-dead mutant K194R (KD). The levels of VprBP and H2AT120p
were determined by western blotting. (FIG. 2C) VprBP-depleted DU145
cells were complemented with VprBP WT or KD, and cell proliferation
was measured by MTT assay. Results represent the means.+-.SD of
three experiments performed in triplicate. (FIG. 2D) VprBP-depleted
DU145 cells were infected with VprBP WT or KD as in (FIG. 2C), and
the colonies grown up in soft agar were stained and counted. The y
axis indicates the number of colonies with a diameter of >0.05
mm per view. Three independent experiments in triplicate wells were
performed. Data represent the means.+-.SD of three independent
experiments. See also FIG. 6.
[0045] FIGS. 3A-3E show functional analysis of VprBP-mediated
H2AT120p. (FIG. 3A) Chromatin templates containing wild-type or
T120-mutated H2A were transcribed in the presence of Gal4-VP16,
p300+AcCoA, and/or VprBP as indicated above the panel. VprBP was
added to the reaction before p300. The results shown are
representative of three independent experiments. (FIG. 3B) Shown
are scatterplots of the global gene expression patterns comparing
VprBP-depleted DU145 cells with mock-depleted cells. Dots represent
expression values for the genes with a change >1.7-fold in
either of two independent experiments. (FIG. 3C) Clustering and
heatmap representation of the genes upregulated upon VprBP
depletion and related to cell death and proliferation. Yellow and
blue indicate high and low expression, respectively. See also
Tables 2 and 3. (FIG. 3D) RNA was isolated from VprBP-depleted
DU145 cells as in (FIG. 3B) and subjected to real-time qRT-PCR
using primers specific for the indicated genes and listed in
Experimatal Procedures. Expression levels were normalized to
b-actin level and shown relative to those of mock-depleted cells,
and were arbitrarily assigned a value of 1. Data represent the
means=SD of three independent experiments. (FIG. 3E) The levels of
H2AT120p, H2A, VprBP, and H3 at the OPN3 gene were assessed in
mock- and VprBP-depleted DU145 cells by ChIP analysis.
Precipitation efficiencies were determined for promoter (P),
transcription start site (TSS), and coding region (CR) by
quantitative PCR (qPCR) with primers listed in Experimental
Procedures. Quantitative results were averaged from three separate
determinations. Results represent the means.+-.SD of three
independent experiments. See also FIG. 7.
[0046] FIGS. 4A-4J show discovery and characterization of a
small-molecule VprBP inhibitor. (FIG. 4A) In vitro kinase assays
were performed with recombinant H2A and VprBP in the presence of
the indicated compounds (5 mM). The effects of the compounds were
evaluated by western blotting with H2AT120p antibody. (FIG. 4B)
DU145 cells were grown in the presence of the indicated
concentrations of either B32B3 or B20H6 for 24 hr and immunoblotted
with H2A and H2AT120p antibodies. (FIG. 4C) Molecular structure of
B32B3. (FIG. 4D) DU145 cells were treated with DMSO or 0.5 mM B32B3
for 24 hr. The cellular levels of H2AT120p were assessed by
immunostaining. (FIG. 4E) DU145 cells were treated with increasing
concentrations of B32B3 for 24 hr, and the colonies were counted 3
weeks after seeding the cells on soft agar. The data are the means
of three independent experiments .+-.SD. (FIG. 4F) Nude mice were
implanted with 1 3 107 DU145 cells on the left flank. Five days
after implantation, mice bearing established tumors were randomized
into groups and treated with twice-weekly i.p. injections of either
DMSO or B32B3 at a dose of 5 mg/kg (n=8 per group). Tumor volumes
(mm3) were measured at the indicated time points and shown as mean
tumor volumes .+-.SEM. (FIG. 4G) Mice were killed at day 25 of the
tumor growth, and the tumors were dissected and weighed. Mean tumor
weights .+-.SEM are shown, and the p value was calculated by
unpaired Student's t test. (FIG. 411) DU145 xenografts were excised
from DMSO-treated and B32B3-treated mice, and were analyzed by
immunohistochemistry. Representative view was photographed. (FIG.
4I) Relative mRNA levels of the VprBP target genes in DMSO-treated
(black bars) and B32B3-treated (1 mM, gray bars) DU145 cells were
determined by qRT-PCR. Data represent the means.+-.SD of three
independent experiments. (FIG. 4J) DU145 cells exposed to DMSO or 1
mM B32B3 were subject to ChIP analysis using the indicated
antibodies. The data are the means of three independent experiments
.+-.SD. See also FIG. 8.
[0047] FIGS. 5A-5M show phosphorylation of H2A T120 bp VprBP,
related to FIG. 1. (FIG. 5A) Chromatin was isolated from human
bladder (LD611) and breast (MDA-MB231) cancer cell lines and their
normal counterparts (Urotsa and MCF-10-2A). The levels of the
indicated histone modifications were assessed by Western blotting
as in FIG. 1A. (FIG. 5B) LD611 bladder and MDA-MB231 breast cancer
cell lines were infected with a VprBP shRNA and examined for the
indicated histone modifications by Western blotting. (FIG. 5C)
Recombinant VprBP proteins were expressed in Sf9 cells and purified
as described under Experimental Procedures. The purity of the
proteins used in this study was confirmed by SDS-PAGE and
subsequent silver staining. (FIG. 5D) The purity of the recombinant
VprBP wild type purified in (FIG. 5C) was determined by mass
spectrometry. (FIG. 5E) Individual core histones were incubated
with VprBP in the presence of [3H]-AcCoA or [3H]-SAM, and their
modifications were determined by autoradiography. As positive
controls, p300 (acetylating all four core histones) and Set7
(methylating H3K4) were included in the assays. (FIG. 5F) In vitro
kinase assays were performed as in FIG. 1C, but using reconstituted
nucleosomes containing untagged H2A (lanes 1 and 2) or Flag-tagged
H2A (lanes 3 and 4). (FIG. 5G) Mononucleosomes were immobilized on
streptavidin-agarose beads and incubated with VprBP in the presence
of 10 mM ATP. After extensive washing, intranucleosomal H2AT120p
was accessed by immunoblotting with H2A and H2AT120p antibodies.
(FIG. 5H) In vitro kinase assays were performed with recombinant
H2A and endogenous VprBP immunoprecipitated from DU145 cells. (FIG.
5I) The recombinant VprBP (5 .mu.g) was separated on an 8% SDS-PAGE
gel, denatured with 6M guanidine HCl for 1 h and renatured for 16
h. To detect autophosphorylation of VprBP, the gel was soaked in
kinase buffer in the presence of [.gamma.-32P]ATP (20 Ci/ml) for 1
h, washed stringently for 2 h, dried, and visualized by
autoradiography. (FIG. 5J) Wild type and mutant VprBP proteins were
run on a denaturing gel, refolded, and subjected to in situ kinase
assay as in FIG. 5I. (FIG. 5K) CD values were determined using 1
.mu.M VprBP proteins in the range of 200-260 nm. CD spectra are the
average of 20 measurements. (FIG. 5L) DU145 cells were infected
with Bub1 shRNA, and the levels of H2AT120p were determined by
Western blot analysis of cell extracts. (FIG. 5M) Whole cell
extract were prepared in MLC and DU145 cells, and total Bub1
expression levels were analyzed by Western blotting.
[0048] FIGS. 6A-6F show effects of knockdown and overexpression
VprBP on cell proliferation, related to FIG. 2. (FIG. 6A) DU145
cancer cells were depleted of VprBP using another shRNA, as
confirmed by Western blotting. (FIG. 6B) DU145 cells depleted of
VprBP in (FIG. 6A) were subjected to MTT assays over a period of 5
days. Results are the means.+-.S.D. of three experiments performed
in triplicate. (FIG. 6C) DU145 cells depleted of VprBP in (FIG. 6A)
were subjected to colony formation assays as described in FIG. 2D.
Data represent the means.+-.S.D. of three independent experiments.
(FIG. 6D) MLC cells were infected with lentiviruses expressing
VprBP, and the levels of VprBP and H2AT120p were assessed by
Western blotting. (FIG. 6E) VprBP was overexpressed in MLC cells as
in (FIG. 6D), and its effects on cell proliferation were determined
by MTT assay over a period of 5 days. Average and standard
deviation are shown for three independent experiments. (FIG. 6F)
Colony formation assays were carried out as in (FIG. 6C), but using
MLC cells overexpressing VprBP. Average and standard deviation of
three independent experiments are shown.
[0049] FIGS. 7A-7C show that H2AT120p is required for the
transrepression activity of VprBP, related to FIG. 3. (FIG. 7A) In
vitro transcription assays were performed using chromatin templates
containing wild type or T120-mutated H2A as in FIG. 3A, but in the
absence of ATP. (FIG. 7B) The 292 genes identified as being
upregulated upon VprBP knockdown from the microarray analysis were
subjected to functional enrichment analysis using DAVID. The blue
and red bars represent the number of enriched genes and p-values
for the enrichment, respectively. (FIG. 7C) ChIP assays of four
VprBP target genes (NOV, SOCS2, SOCS3 and TNFSF10) and one control
gene (RARRES1) were performed as in FIG. 3E using the indicated
antibodies. The precipitated DNA was quantified by qPCR with the
primers listed in Experimental Procedures. Results represent the
means.+-.S.D. of three independent experiments.
[0050] FIGS. 8A-8I show characterization of B32B3 as a
small-molecule VprBP kinase inhibitor, related to FIG. 4. (FIG. 8A)
DU145 cells were infected with mock lentiviruse, VprBP-expressing
shRNA lentivirus or Flag-VprBP-expressing lentivirus, and treated
with the indicated concentrations of B32B3 for 24 h. Changes in
H2AT120p as the results of B32B3 treatment were determined by the
quantitative estimates of Western band intensity. Results represent
the means.+-.S.D. of three independent experiments. (FIG. 8B) DU145
cells were treated with the indicated concentrations of B32B3 and
B20H6 for 72 h. Cell viability was measured by the MTT assay and
was normalized to cells not exposed to the compounds. Data
represent the means.+-.S.D. of three independent experiments. (FIG.
8C) MLC cells were grown in the presence of the indicated
concentrations of B32B2 for 24 h, and subjected to immunoblotting
with H2AT120p and H2A antibodies. (FIG. 8D) MLC cells were treated
with B32B3 at the indicated doses for 24 h, and cell viability was
assessed by MTT assay. Average and standard deviation of three
independent experiments are shown. (FIG. 8E) VprBP-mediated
H2AT120p was analyzed in the presence of increasing concentrations
of ATP and B32B3. (FIG. 8F) Body weights of vehicle or
B32B3-treated mice were monitored during the treatment period. Mean
body weights .+-.S.E.M. are shown. (FIG. 8G) B32B3 was spiked into
the indicated blank plasma to a concentration of 10 .mu.M. The
stability of B32B3 in plasma was determined by LC-MS/MS at the
indicated time points. Results are shown as the mean of three
independent experiments .+-.S.D. (FIG. 8H) B32B3 was administered
to mice (n=5) at a dose of 5 mg/kg. Blood samples were collected at
the indicated time points, and the concentration of B32B3 in plasma
was analyzed by HPLCcoupled mass spectrophotometry. The data are
shown as the mean.+-.S.D. (FIG. 8I) B32B3-treated DU145cells were
subjected to ChIP analysis as in FIG. 4I using indicated
antibodies. Average and standard deviation are shown for three
independent experiments.
[0051] FIG. 9 shows domain architecture and known mutation sites of
VprBP. VprBP contains the putative kinase domain in the N-terminus
and the Lis homology motif, WD repeats and D/E rich domains in the
C-terminus. Numbers denote amino acid positions. The positions of
known mutation in the kinase domain are indicated by letters along
with their positions. FIG. 9 discloses VprBP as SEQ ID NOS 4-5, 59,
6-9 and 79, respectively, in order of appearance, CK1 as SEQ ID NOS
60-66 and 80, respectively, in order of appearance and Mut9p as SEQ
ID NOS 68-69, 62, 70-73 and 81, respectively, in order of
appearance.
[0052] FIG. 10 shows VprBP functions in chromatin silencing. VprBP
is localized onto specific chromatin regions via its interaction
with the H3 N-terminal tail (NT) and phosphorylates H2A C-terminal
tail (CT) at T120 to establish a repressive chromatin state. Thus
free H3 tail peptides can prevent VprBP from binding to the
nucleosome and thereby inhibit H2AT120 phosphorylation
reactions.
DETAILED DESCRIPTION
[0053] Unless defined otherwise, all technical and scientific terms
used herein have the same meanings as commonly understood by one of
ordinary skill in the art to which this invention belongs. Although
any methods and materials similar or equivalent to those described
herein can be used in the practice or testing of the present
invention, the preferred methods, devices and materials are now
described. All technical and patent publications cited herein are
incorporated herein by reference in their entirety. Nothing herein
is to be construed as an admission that the invention is not
entitled to antedate such disclosure by virtue of prior
invention.
[0054] The practice of the present invention will employ, unless
otherwise indicated, conventional techniques of tissue culture,
immunology, molecular biology, microbiology, cell biology and
recombinant DNA, which are within the skill of the art. See, e.g.,
Sambrook and Russell eds. (2001) Molecular Cloning: A Laboratory
Manual, 3.sup.rd edition; the series Ausubel et al. eds. (2007)
Current Protocols in Molecular Biology; the series Methods in
Enzymology (Academic Press, Inc., N.Y.); MacPherson et al. (1991)
PCR 1: A Practical Approach (IRL Press at Oxford University Press);
MacPherson et al. (1995) PCR 2: A Practical Approach; Harlow and
Lane eds. (1999) Antibodies, A Laboratory Manual; Freshney (2005)
Culture of Animal Cells: A Manual of Basic Technique, 5.sup.th
edition; Gait ed. (1984) Oligonucleotide Synthesis; U.S. Pat. No.
4,683,195; Hames and Higgins eds. (1984) Nucleic Acid
Hybridization; Anderson (1999) Nucleic Acid Hybridization; Hames
and Higgins eds. (1984) Transcription and Translation; Immobilized
Cells and Enzymes (IRL Press (1986)); Perbal (1984) A Practical
Guide to Molecular Cloning; Miller and Calos eds. (1987) Gene
Transfer Vectors for Mammalian Cells (Cold Spring Harbor
Laboratory); Makrides ed. (2003) Gene Transfer and Expression in
Mammalian Cells; Mayer and Walker eds. (1987) Immunochemical
Methods in Cell and Molecular Biology (Academic Press, London); and
Herzenberg et al. eds (1996) Weir's Handbook of Experimental
Immunology.
[0055] The term "about" when used with numerical designations,
e.g., pH, temperature, time, amount, concentration and molecular
weight, including ranges, refers to approximations which are varied
(+) or (-) by increments of 1.0 or 0.1, as appropriate, or
alternatively by a variation of +/-15%, or alternatively 10%, or
alternatively 5% or alternatively 2%.
[0056] As used in the specification and claims, the singular form
"a", "an" and "the" include plural references unless the context
clearly dictates otherwise. For example, the term "a polypeptide"
includes a plurality of polypeptides, including mixtures
thereof.
[0057] As used herein, the term "comprising" is intended to mean
that the compositions and methods include the recited elements, but
do not exclude others. "Consisting essentially of" when used to
define compositions and methods, shall mean excluding other
elements of any essential significance to the combination for the
intended use. Thus, a composition consisting essentially of the
elements as defined herein would not exclude trace contaminants
from the isolation and purification method and pharmaceutically
acceptable carriers, such as phosphate buffered saline,
preservatives and the like. "Consisting of" shall mean excluding
more than trace elements of other ingredients and substantial
method steps for administering the compositions of this invention.
Embodiments defined by each of these transition terms are within
the scope of this invention.
[0058] The term "VprBP" refers to a nuclear protein that can
interact with HIV viral protein R and Cullin 4-DDB 1 ubiquitin
ligase complex which is reported in Li, W. et al. ((2010) Cell
140:477-490), including the wild type VprBP and mutated VprBP, such
as those described in the Experimental section.
[0059] The term "VprBP kinase activity" refers to VprBP's activity
of phosphorylating another protein. In some embodiments, the
protein that is phosphorylated by VprBP is a histone, a protein
found in eukaryotic cell nuclei that packages and orders the DNA
into structural units called nucleosomes, described in, for
example, Suganuma, T. et al. ((2011) Annu. Rev. Biochem.
80:473-499) and Banerjee, T. et al. ((2011) Mol. Cell. Biol.
31:4858-4873). In some embodiments, the protein that is
phosphorylated by VprBP is histone H2A at, for example, threonine
120.
[0060] The term "VprBR-related cancer" intends a cancer or tumor
that is caused by in whole or in part by the misregulation of VprBP
phosphorylation of a histone.
[0061] The term "H2AT120p" refers to histone H2A phosphorylated at
threonine 120.
[0062] The term "isolated" as used herein with respect to nucleic
acids, such as DNA or RNA, refers to molecules separated from other
DNAs or RNAs, respectively that are present in the natural source
of the macromolecule. The term "isolated peptide fragment" is meant
to include peptide fragments which are not naturally occurring as
fragments and would not be found in the natural state. The term
"isolated" is also used herein to refer to polypeptides and
proteins that are isolated from other cellular proteins and is
meant to encompass both purified and recombinant polypeptides. In
other embodiments, the term "isolated" means separated from
constituents, cellular and otherwise, in which the cell, tissue,
polynucleotide, peptide, polypeptide, protein, antibody or
fragment(s) thereof, which are normally associated in nature. For
example, an isolated cell is a cell that is separated form tissue
or cells of dissimilar phenotype or genotype. As is apparent to
those of skill in the art, a non-naturally occurring
polynucleotide, peptide, polypeptide, protein, antibody or
fragment(s) thereof, does not require "isolation" to distinguish it
from its naturally occurring counterpart.
[0063] The term "purified" refers to a composition being
substantially free from contaminants. With respect to
polynucleotides and polypeptides, purified intends the composition
being substantially free from contamination from polynucleotides or
polypeptides with different sequences. In certain embodiments, it
also refers to polynucleotides and polypeptides substantially free
from cell debris or cell culture media.
[0064] The term "recombinant" refers to, in one aspect, a form of
artificial DNA that is created by combining two or more sequences
that would not normally occur in their natural environment. In
another aspect, "recombinant" intends isolated DNA that is
replicated in an artificial system. A recombinant protein is a
protein that is derived from recombinant DNA.
[0065] The term "protein", "peptide" and "polypeptide" are used
interchangeably and in their broadest sense refer to a compound of
two or more subunit amino acids, amino acid analogs or
peptidomimetics. The subunits may be linked by peptide bonds. In
another embodiment, the subunit may be linked by other bonds, e.g.,
ester, ether, etc. A protein or peptide must contain at least two
amino acids and no limitation is placed on the maximum number of
amino acids which may comprise a protein's or peptide's sequence.
As used herein the term "amino acid" refers to either natural
and/or unnatural or synthetic amino acids, including glycine and
both the D and L optical isomers, amino acid analogs and
peptidomimetics.
[0066] "Homology" or "identity" or "similarity" refers to two
nucleic acid molecules that hybridize under stringent conditions to
the reference polynucleotide or its complement.
[0067] "Hybridization" refers to a reaction in which one or more
polynucleotides react to form a complex that is stabilized via
hydrogen bonding between the bases of the nucleotide residues. The
hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein
binding, or in any other sequence-specific manner. The complex may
comprise two strands forming a duplex structure, three or more
strands forming a multi-stranded complex, a single self-hybridizing
strand, or any combination of these. A hybridization reaction may
constitute a step in a more extensive process, such as the
initiation of a PCR reaction, or the enzymatic cleavage of a
polynucleotide by a ribozyme.
[0068] Examples of stringent hybridization conditions include:
incubation temperatures of about 25.degree. C. to about 37.degree.
C.; hybridization buffer concentrations of about 6.times.SSC to
about 10.times.SSC; formamide concentrations of about 0% to about
25%; and wash solutions from about 4.times.SSC to about
8.times.SSC. Examples of moderate hybridization conditions include:
incubation temperatures of about 40.degree. C. to about 50.degree.
C.; buffer concentrations of about 9.times.SSC to about
2.times.SSC; formamide concentrations of about 30% to about 50%;
and wash solutions of about 5.times.SSC to about 2.times.SSC.
Examples of high stringency conditions include: incubation
temperatures of about 55.degree. C. to about 68.degree. C.; buffer
concentrations of about 1.times.SSC to about 0.1.times.SSC;
formamide concentrations of about 55% to about 75%; and wash
solutions of about 1.times.SSC, 0.1.times.SSC, or deionized water.
In general, hybridization incubation times are from 5 minutes to 24
hours, with 1, 2, or more washing steps, and wash incubation times
are about 1, 2, or 15 minutes. SSC is 0.15 M NaCl and 15 mM citrate
buffer. It is understood that equivalents of SSC using other buffer
systems can be employed.
[0069] As used herein, the terms "treat", "treating," or
"treatment" and the like are used herein to mean obtaining a
desired pharmacologic and/or physiologic effect. The effect may be
prophylactic in terms of completely or partially preventing a
disorder or sign or symptom thereof and/or may be therapeutic in
terms of a partial or complete cure for a disorder and/or adverse
effect attributable to the disorder.
[0070] To "prevent" intends to prevent a disorder or effect in
vitro or in vivo in a system or subject that is predisposed to the
disorder.
[0071] The term "tumor suppression" refers to slowing down the
growth of a tumor, stopping the growth of a tumor or reducing the
size of existing tumor.
[0072] The term "inhibiting H2AT120p" refers to inhibiting the
phosphorylation of histone H2A on threonine 120 and/or inhibiting
the activity of histone H2A phosphorylated on threonine 120.
[0073] The term "VprBP inhibitor" refers to a compound or other
agent such as RNAi that reduces the activity of VprBP. In some
embodiments, the compound inhibits VprBP with a half maximal
inhibitory concentration (IC.sub.50) value of no more than about 10
.mu.M, or no more than about 5 .mu.M, or no more than about 1
.mu.M.
[0074] The term "small molecule VprBP inhibitor" refers to a VprBP
inhibitor with a molecular weight of no more than about 1,500
Daltons, or no more than about 1,000 Daltons, or no more than about
900 Daltons.
[0075] In some embodiments, the small molecule inhibitor of VprBP
is B32B3, a compound of the formula:
##STR00004##
or a pharmaceutically acceptable salt thereof or a solvate of the
compound or the salt thereof.
[0076] In some embodiments, the small molecule inhibitor of VprBP
can be prepared according methods and using intermediates known in
the art such as those described in U.S. Pat. No. 3,878,201 or PCT
International Application Publication No. WO 2013/072921 and T.
Baburaj a, S. Thambidurai, Synlett, 2011, 1993-1996.
[0077] In some embodiments, the small molecule inhibitor of VprBP
can be prepared according to Scheme 1:
##STR00005##
[0078] As shown in Scheme 1, Compound 1 (ChemExper, Belgium) can
react with Compound 2 to give Compound 3 in a hydrophilic solvent
such as ethanol, propanol, butanol, dioxane, etc., at an elevated
temperature such as about 75.degree. to 150.degree. C., optionally
in the presence of a catalytic amount of an acid, such hydrochloric
acid, sulfuric acid, nitric acid, hydrobromic acid, hydrogen
iodide, maleic acid, fumaric acid, etc. R in Compound 2 is H or an
amino protecting group, such as tert-butoxycarbonyl (Boc),
benzyloxycarbonyl (Cbz), or [(9-fluorenylmethyl)oxy]carbonyl
(Fmoc). When R is H, Compound 2 is 1H-indole-3-carbaldehyde
(ChemExper, Belgium) and the reaction in Scheme 1 produces B32B3
directly. When R is an amino protecting group, Compound 2 can be
prepared from 1H-indole-3-carbaldehyde with methods known in the
art. After reaction of Compound 1 and Compound 2, the protecting
group can be removed under conditions known in the art, such as
acidic condition when R is Boc, hydrogenation condition when R is
Cbz, and basic condition when R is Fmoc. Additional amino
protecting groups, the conditions to add a protect group to
1H-indole-3-carbaldehyde, and conditions to remove the protect
group are known in the art, for example, described in T. W. Greene
and P. G. M. Wuts, Protecting Groups in Organic Synthesis, Third
Edition, Wiley, New York, 1999, and references cited therein.
[0079] "Pharmaceutically acceptable salt" refers to salts of a
compound, which salts are suitable for pharmaceutical use and are
derived from a variety of organic and inorganic counter ions well
known in the art and include, when the compound contains an acidic
functionality, by way of example only, sodium, potassium, calcium,
magnesium, ammonium, and tetraalkylammonium; and when the molecule
contains a basic functionality, salts of organic or inorganic
acids, such as hydrochloride, hydrobromide, tartrate, mesylate,
acetate, maleate, and oxalate (see Stahl and Wermuth, eds.,
"HANDBOOK OF PHARMACEUTICALLY ACCEPTABLE SALTS," (2002), Verlag
Helvetica Chimica Acta, Zurich, Switzerland), for a discussion of
pharmaceutical salts, their selection, preparation, and use.
[0080] Generally, pharmaceutically acceptable salts are those salts
that retain substantially one or more of the desired
pharmacological activities of the parent compound and which are
suitable for in vivo administration. Pharmaceutically acceptable
salts include acid addition salts formed with inorganic acids or
organic acids. Inorganic acids suitable for forming
pharmaceutically acceptable acid addition salts include, by way of
example and not limitation, hydrohalide acids (e.g., hydrochloric
acid, hydrobromic acid, hydroiodic acid, etc.), sulfuric acid,
nitric acid, phosphoric acid, and the like.
[0081] Organic acids suitable for forming pharmaceutically
acceptable acid addition salts include, by way of example and not
limitation, acetic acid, trifluoroacetic acid, propionic acid,
hexanoic acid, cyclopentanepropionic acid, glycolic acid, oxalic
acid, pyruvic acid, lactic acid, malonic acid, succinic acid, malic
acid, maleic acid, fumaric acid, tartaric acid, citric acid,
palmitic acid, benzoic acid, 3-(4-hydroxybenzoyl) benzoic acid,
cinnamic acid, mandelic acid, alkylsulfonic acids (e.g.,
methanesulfonic acid, ethanesulfonic acid, 1,2-ethane-disulfonic
acid, 2-hydroxyethanesulfonic acid, etc.), arylsulfonic acids
(e.g., benzenesulfonic acid, 4 chlorobenzenesulfonic acid,
2-naphthalenesulfonic acid, 4-toluenesulfonic acid, camphorsulfonic
acid, etc.), glutamic acid, hydroxynaphthoic acid, salicylic acid,
stearic acid, muconic acid, and the like.
[0082] Pharmaceutically acceptable salts also include salts formed
when an acidic proton present in the parent compound is either
replaced by a metal ion (e.g., an alkali metal ion, an alkaline
earth metal ion, or an aluminum ion) or by an ammonium ion (e.g.,
an ammonium ion derived from an organic base, such as,
ethanolamine, diethanolamine, triethanolamine, morpholine,
piperidine, dimethylamine, diethylamine, triethylamine, and
ammonia).
[0083] A solvate of a compound is a solid-form of the compound that
crystallizes with less than one, one or more than one molecules of
solvent inside in the crystal lattice. A few examples of solvents
that can be used to create solvates, such as pharmaceutically
acceptable solvates, include, but are not limited to, water,
C.sub.1-C.sub.6 alcohols (such as methanol, ethanol, isopropanol,
butanol, and can be optionally substituted) in general,
tetrahydrofuran, acetone, ethylene glycol, propylene glycol, acetic
acid, formic acid, and solvent mixtures thereof. Other such
biocompatible solvents which may aid in making a pharmaceutically
acceptable solvate are well known in the art. Additionally, various
organic and inorganic acids and bases can be added to create a
desired solvate. Such acids and bases are known in the art. When
the solvent is water, the solvate can be referred to as a hydrate.
In some embodiments, one molecule of a compound can form a solvate
with from 0.1 to 5 molecules of a solvent, such as 0.5 molecules of
a solvent (hemisolvate, such as hemihydrate), one molecule of a
solvent (monosolvate, such as monohydrate) and 2 molecules of a
solvent (disolvate, such as dihydrate).
[0084] "RNA interference" (RNAi) refers to sequence-specific or
gene specific suppression of gene expression (protein synthesis)
that is mediated by short interfering RNA (siRNA).
[0085] "Short interfering RNA" (siRNA) refers to double-stranded
RNA molecules (dsRNA), generally, from about 10 to about 30
nucleotides in length that are capable of mediating RNA
interference (RNAi), or 11 nucleotides in length, 12 nucleotides in
length, 13 nucleotides in length, 14 nucleotides in length, 15
nucleotides in length, 16 nucleotides in length, 17 nucleotides in
length, 18 nucleotides in length, 19 nucleotides in length, 20
nucleotides in length, 21 nucleotides in length, 22 nucleotides in
length, 23 nucleotides in length, 24 nucleotides in length, 25
nucleotides in length, 26 nucleotides in length, 27 nucleotides in
length, 28 nucleotides in length, or 29 nucleotides in length. As
used herein, the term siRNA includes short hairpin RNAs (shRNAs). A
siRNA directed to a gene or the mRNA of a gene may be a siRNA that
recognizes the mRNA of the gene and directs a RNA-induced silencing
complex (RISC) to the mRNA, leading to degradation of the mRNA. A
siRNA directed to a gene or the mRNA of a gene may also be a siRNA
that recognizes the mRNA and inhibits translation of the mRNA. The
siRNA can be administered as naked DNA or within an expression or
delivery vehicle.
[0086] "Double stranded RNA" (dsRNA) refer to double stranded RNA
molecules that may be of any length and may be cleaved
intracellularly into smaller RNA molecules, such as siRNA. In cells
that have a competent interferon response, longer dsRNA, such as
those longer than about 30 base pair in length, may trigger the
interferon response. In other cells that do not have a competent
interferon response, dsRNA may be used to trigger specific
RNAi.
[0087] microRNA or miRNA are single-stranded RNA molecules of 21-23
nucleotides in length, which regulate gene expression. miRNAs are
encoded by genes from whose DNA they are transcribed but miRNAs are
not translated into protein (non-coding RNA); instead each primary
transcript (a pri-miRNA) is processed into a short stem-loop
structure called a pre-miRNA and finally into a functional miRNA.
Mature miRNA molecules are partially complementary to one or more
messenger RNA (mRNA) molecules, and their main function is to
down-regulate gene expression.
[0088] A siRNA vector, dsRNA vector or miRNA vector as used herein,
refers to a plasmid or viral vector comprising a promoter
regulating expression of the RNA. "siRNA promoters" or promoters
that regulate expression of siRNA, dsRNA, or miRNA are known in the
art, e.g., a U6 promoter as described in Miyagishi and Taira (2002)
Nature Biotech. 20:497-500, and a H1 promoter as described in
Brummelkamp et al. (2002) Science 296:550-3.
[0089] As used herein, "expression" refers to the process by which
polynucleotides are transcribed into mRNA and/or the process by
which the transcribed mRNA is subsequently being translated into
peptides, polypeptides, or proteins. If the polynucleotide is
derived from genomic DNA, expression may include splicing of the
mRNA in an eukaryotic cell.
[0090] Various proteins are also disclosed herein with their
GenBank Accession Numbers for their human proteins and coding
sequences. However, the proteins are not limited to human-derived
proteins having the amino acid sequences represented by the
disclosed GenBank Accession numbers, but may have an amino acid
sequence derived from other animals, particularly, a warm-blooded
animal (e.g., rat, guinea pig, mouse, chicken, rabbit, pig, sheep,
cow, monkey, etc.).
[0091] A "gene delivery vehicle" is defined as any molecule that
can carry inserted polynucleotides into a host cell. Examples of
gene delivery vehicles are liposomes, micelles, biocompatible
polymers, including natural polymers and synthetic polymers;
lipoproteins; polypeptides; polysaccharides; lipopolysaccharides;
artificial viral envelopes; metal particles; and bacteria, or
viruses, such as baculovirus, adenovirus and retrovirus,
bacteriophage, cosmid, plasmid, fungal vectors and other
recombination vehicles typically used in the art which have been
described for expression in a variety of eukaryotic and prokaryotic
hosts, and may be used for gene therapy as well as for simple
protein expression.
[0092] A polynucleotide of this invention can be delivered to a
cell or tissue using a gene delivery vehicle. "Gene delivery,"
"gene transfer," "transducing," and the like as used herein, are
terms referring to the introduction of an exogenous polynucleotide
(sometimes referred to as a "transgene") into a host cell,
irrespective of the method used for the introduction. Such methods
include a variety of well-known techniques such as vector-mediated
gene transfer (by, e.g., viral infection/transfection, or various
other protein-based or lipid-based gene delivery complexes) as well
as techniques facilitating the delivery of "naked" polynucleotides
(such as electroporation, "gene gun" delivery and various other
techniques used for the introduction of polynucleotides). The
introduced polynucleotide may be stably or transiently maintained
in the host cell. Stable maintenance typically requires that the
introduced polynucleotide either contains an origin of replication
compatible with the host cell or integrates into a replicon of the
host cell such as an extrachromosomal replicon (e.g., a plasmid) or
a nuclear or mitochondrial chromosome. A number of vectors are
known to be capable of mediating transfer of genes to mammalian
cells, as is known in the art and described herein.
[0093] Gene delivery vehicles also include DNA/liposome complexes,
micelles and targeted viral protein-DNA complexes. Liposomes that
also comprise a targeting antibody or fragment thereof can be used
in the methods of this invention. To enhance delivery to a cell,
the nucleic acid or proteins of this invention can be conjugated to
antibodies or binding fragments thereof which bind cell surface
antigens. In addition to the delivery of polynucleotides to a cell
or cell population, direct introduction of the proteins described
herein to the cell or cell population can be done by the
non-limiting technique of protein transfection, alternatively
culturing conditions that can enhance the expression and/or promote
the activity of the proteins of this invention are other
non-limiting techniques.
[0094] "Administration" can be effected in one dose, continuously
or intermittently throughout the course of treatment. Methods of
determining appropriate means and dosage of administration are
known to those of skill in the art and will vary with the
composition used for therapy, the purpose of the therapy, the
target cell being treated and the subject being treated. Single or
multiple administrations can be carried out with the dose level and
pattern being selected by the treating physician. Suitable dosage
formulations and methods of administering the agents are known in
the art. Route of administration can also be determined and method
of determining appropriate route of administration are known to
those of skill in the art and will vary with the composition used
for treatment, the purpose of the treatment, the health condition
or disease stage of the subject being treated and target cell or
tissue. Non-limiting examples of route of administration include
oral administration, nasal administration, injection and topical
application.
[0095] The term "effective amount" refers to a quantity sufficient
to achieve a beneficial or desired result or effect. In the context
of therapeutic or prophylactic applications, the effective amount
will depend on the type and severity of the condition at issue and
the characteristics of the individual subject, such as general
health, age, sex, body weight, and tolerance to pharmaceutical
compositions. The skilled artisan will be able to determine
appropriate amounts depending on these and other factors.
[0096] In the case of an in vitro application, in some embodiments
the effective amount will depend on the size and nature of the
application in question. It will also depend on the nature and
sensitivity of the in vitro target and the methods in use. The
skilled artisan will be able to determine the effective amount
based on these and other considerations. The effective amount may
comprise one or more administrations of a composition depending on
the embodiment.
[0097] A "subject," "individual" or "patient" is used
interchangeably herein, and refers to a vertebrate, preferably a
mammal, more preferably a human. Mammals include, but are not
limited to, murines, rats, rabbits, simians, bovines, ovines,
porcines, canines, felines, farm animals, sport animals, pets,
equines, and primates, particularly humans.
[0098] The agents and compositions can be used in the manufacture
of medicaments and for the treatment of humans and other animals by
administration in accordance with conventional procedures, such as
an active ingredient in pharmaceutical compositions.
[0099] An agent of the present invention can be administered for
therapy by any suitable route of administration. It will also be
appreciated that the preferred route will vary with the condition
and age of the recipient and the disease being treated.
[0100] A "composition" typically intends a combination of the
active agent, e.g., compound or composition, and a carrier, inert
(for example, a detectable agent or label) or active, such as an
adjuvant, diluent, binder, stabilizer, buffers, salts, lipophilic
solvents, preservative, adjuvant or the like and include
pharmaceutically acceptable carriers. Carriers also include
pharmaceutical excipients and additives proteins, peptides, amino
acids, lipids, and carbohydrates (e.g., sugars, including
monosaccharides, di-, tri-, tetra-oligosaccharides, and
oligosaccharides; derivatized sugars such as alditols, aldonic
acids, esterified sugars and the like; and polysaccharides or sugar
polymers), which can be present singly or in combination,
comprising alone or in combination 1-99.99% by weight or volume.
Exemplary protein excipients include serum albumin such as human
serum albumin (HSA), recombinant human albumin (rHA), gelatin,
casein, and the like. Representative amino acid/antibody
components, which can also function in a buffering capacity,
include alanine, glycine, arginine, betaine, histidine, glutamic
acid, aspartic acid, cysteine, lysine, leucine, isoleucine, valine,
methionine, phenylalanine, aspartame, and the like. Carbohydrate
excipients are also intended within the scope of this invention,
examples of which include but are not limited to monosaccharides
such as fructose, maltose, galactose, glucose, D-mannose, sorbose,
and the like; disaccharides, such as lactose, sucrose, trehalose,
cellobiose, and the like; polysaccharides, such as raffinose,
melezitose, maltodextrins, dextrans, starches, and the like; and
alditols, such as mannitol, xylitol, maltitol, lactitol, xylitol
sorbitol (glucitol) and myoinositol.
[0101] The term carrier further includes a buffer or a pH adjusting
agent; typically, the buffer is a salt prepared from an organic
acid or base. Representative buffers include organic acid salts
such as salts of citric acid, ascorbic acid, gluconic acid,
carbonic acid, tartaric acid, succinic acid, acetic acid, or
phthalic acid; Tris, tromethamine hydrochloride, or phosphate
buffers. Additional carriers include polymeric excipients/additives
such as polyvinylpyrrolidones, ficolls (a polymeric sugar),
dextrates (e.g., cyclodextrins, such as
2-hydroxypropyl-.quadrature.-cyclodextrin), polyethylene glycols,
flavoring agents, antimicrobial agents, sweeteners, antioxidants,
antistatic agents, surfactants (e.g., polysorbates such as "TWEEN
20" and "TWEEN 80"), lipids (e.g., phospholipids, fatty acids),
steroids (e.g., cholesterol), and chelating agents (e.g.,
EDTA).
[0102] As used herein, the term "pharmaceutically acceptable
carrier" encompasses any of the standard pharmaceutical carriers,
such as a phosphate buffered saline solution, water, and emulsions,
such as an oil/water or water/oil emulsion, and various types of
wetting agents. The compositions also can include stabilizers and
preservatives and any of the above noted carriers with the
additional proviso that they be acceptable for use in vivo.
Examples of pharmaceutically acceptable carriers include ion
exchangers, alumina, aluminum stearate, lecithin, serum proteins,
such as human serum albumin, buffer substances, such as phosphates,
glycine, sorbic acid, potassium sorbate, partial glyceride mixtures
of saturated vegetable fatty acids, water, salts or electrolytes,
such as protamine sulfate, disodium hydrogen phosphate, potassium
hydrogen phosphate, sodium chloride, zinc salts, colloidal silica,
magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based
substances, polyethylene glycol, sodium carboxymethylcellulose,
polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers,
polyethylene glycol and wool fat. For examples of carriers,
stabilizers and adjuvants, see Martin REMINGTON'S PHARM. SCI., 15th
Ed. (Mack Publ. Co., Easton (1975) and Williams & Williams,
(1995), and in the "PHYSICIAN'S DESK REFERENCE", 52.sup.nd ed.,
Medical Economics, Montvale, N.J. (1998).
[0103] The invention provides an article of manufacture, comprising
packaging material and at least one vial comprising a solution of a
VprBP inhibitor as described herein or its biological equivalent
with the prescribed buffers and/or preservatives, optionally in an
aqueous diluent, wherein said packaging material comprises a label
that indicates that such solution can be held over a period of 1,
2, 3, 4, 5, 6, 9, 12, 18, 20, 24, 30, 36, 40, 48, 54, 60, 66, 72
hours or greater. The invention further comprises an article of
manufacture, comprising packaging material, a first vial comprising
a VprBP inhibitor or its biological equivalent and a second vial
comprising an aqueous diluent of prescribed buffer or preservative,
wherein said packaging material comprises a label that instructs a
patient to reconstitute the therapeutic in the aqueous diluent to
form a solution that can be held over a period of twenty-four hours
or greater.
[0104] The VprBP inhibitor described herein as effective for their
intended purpose can be administered to subjects or individuals
identified by the methods herein as suitable for the therapy.
Therapeutic amounts can be empirically determined and will vary
with the pathology being treated, the subject being treated and the
efficacy and toxicity of the agent.
[0105] In various embodiments of the methods of the invention, the
VprBP inhibitor will be administered locally or systemically on a
continuous, daily basis, at least once per day (QD) and in various
embodiments two (BID), three (TID) or even four times a day.
Typically, the therapeutically effective daily dose will be at
least about 1 mg, or at least about 10 mg, or at least about 100 mg
or about 200-about 500 mg and sometimes, depending on the compound,
up to as much as about 1 g to about 2.5 g.
[0106] Dosage, toxicity and therapeutic efficacy of compositions
described herein can be determined by standard pharmaceutical
procedures in cell cultures or experimental animals, for example,
to determine the LD.sub.50 (the dose lethal to 50% of the
population) and the ED.sub.50 (the dose therapeutically effective
in 50% of the population). The dose ratio between toxic and
therapeutic effects is the therapeutic index and it can be
expressed as the ratio LD.sub.50/ED.sub.50. Compositions which
exhibit high therapeutic indices are preferred. While compounds
that exhibit toxic side effects may be used, care should be taken
to design a delivery system that targets such compounds to the site
of affected tissue in order to minimize potential damage to
uninfected cells and, thereby, reduce side effects.
[0107] In one aspect, the VprBP inhibitor is formulated in
biodegradable biospheres (e.g., micelles or liposomes) or are
coated on solid phase carriers such as or other devices.
[0108] The data obtained from the cell culture assays and animal
studies can be used in formulating a range of dosage for use in
humans. The dosage of such VprBP inhibitor lies preferably within a
range of circulating concentrations that include the ED.sub.50 with
little or no toxicity. The dosage may vary within this range
depending upon the dosage form employed and the route of
administration utilized. For any compound used in the methods, the
therapeutically effective dose can be estimated initially from cell
culture assays. A dose can be formulated in animal models to
achieve a circulating plasma concentration range that includes the
IC.sub.50 (i.e., the concentration of the test compound which
achieves a half-maximal inhibition of symptoms) as determined in
cell culture. Such information can be used to more accurately
determine useful doses in humans. Levels in plasma may be measured,
for example, by high performance liquid chromatography.
[0109] In some embodiments, an effective amount of a composition
sufficient for achieving a therapeutic or prophylactic effect,
ranges from about 0.000001 mg per kilogram body weight per
administration to about 10,000 mg per kilogram body weight per
administration. Suitably, the dosage ranges are from about 0.0001
mg per kilogram body weight per administration to about 100 mg per
kilogram body weight per administration. Administration can be
provided as an initial dose, followed by one or more "booster"
doses. Booster doses can be provided a day, two days, three days, a
week, two weeks, three weeks, one, two, three, six or twelve months
after an initial dose. In some embodiments, a booster dose is
administered after an evaluation of the subject's response to prior
administrations.
[0110] The skilled artisan will appreciate that certain factors may
influence the dosage and timing required to effectively treat a
subject, including but not limited to, the severity of the disease
or disorder, previous treatments, the general health and/or age of
the subject, and other diseases present. Moreover, treatment of a
subject with a therapeutically effective amount of the therapeutic
compositions described herein can include a single treatment or a
series of treatments.
[0111] As used herein, the term "detectable label" intends a
directly or indirectly detectable compound or composition that is
conjugated directly or indirectly to the composition to be
detected, e.g., N-terminal histadine tags (N-His), magnetically
active isotopes, e.g., .sup.115Sn, .sup.117sn and .sup.119Sn, a
non-radioactive isotopes such as .sup.13C and .sup.15N,
polynucleotide or protein such as an antibody so as to generate a
"labeled" composition. The term also includes sequences conjugated
to the polynucleotide that will provide a signal upon expression of
the inserted sequences, such as green fluorescent protein (GFP) and
the like. The label may be detectable by itself (e.g. radioisotope
labels or fluorescent labels) or, in the case of an enzymatic
label, may catalyze chemical alteration of a substrate compound or
composition which is detectable. The labels can be suitable for
small scale detection or more suitable for high-throughput
screening. As such, suitable labels include, but are not limited to
magnetically active isotopes, non-radioactive isotopes,
radioisotopes, fluorochromes, luminescent compounds, dyes, and
proteins, including enzymes. The label may be simply detected or it
may be quantified. A response that is simply detected generally
comprises a response whose existence merely is confirmed, whereas a
response that is quantified generally comprises a response having a
quantifiable (e.g., numerically reportable) value such as an
intensity, polarization, and/or other property. In luminescence or
fluorescence assays, the detectable response may be generated
directly using a luminophore or fluorophore associated with an
assay component actually involved in binding, or indirectly using a
luminophore or fluorophore associated with another (e.g., reporter
or indicator) component.
[0112] Examples of luminescent labels that produce signals include,
but are not limited to bioluminescence and chemiluminescence.
Detectable luminescence response generally comprises a change in,
or an occurrence of, a luminescence signal. Suitable methods and
luminophores for luminescently labeling assay components are known
in the art and described for example in Haugland, Richard P. (1996)
Handbook of Fluorescent Probes and Research Chemicals (6.sup.th
ed.). Examples of luminescent probes include, but are not limited
to, aequorin and luciferases.
[0113] Examples of suitable fluorescent labels include, but are not
limited to, fluorescein, rhodamine, tetramethylrhodamine, eosin,
erythrosin, coumarin, methyl-coumarins, pyrene, Malacite green,
stilbene, Lucifer Yellow, Cascade Blue.TM., and Texas Red. Other
suitable optical dyes are described in the Haugland, Richard P.
(1996) Handbook of Fluorescent Probes and Research Chemicals
(6.sup.th ed.).
[0114] In another aspect, the fluorescent label is functionalized
to facilitate covalent attachment to a cellular component present
in or on the surface of the cell or tissue such as a cell surface
marker. Suitable functional groups, including, but not are limited
to, isothiocyanate groups, amino groups, haloacetyl groups,
maleimides, succinimidyl esters, and sulfonyl halides, all of which
may be used to attach the fluorescent label to a second molecule.
The choice of the functional group of the fluorescent label will
depend on the site of attachment to either a linker, the agent, the
marker, or the second labeling agent.
Methods and Compostions
[0115] This disclosure provides a method for one or more of:
[0116] a. inhibiting the growth of a cancer cell;
[0117] b. activating tumor suppressor function in a cell comprising
functional tumor suppressor genes; and
[0118] c. inhibiting H2AT120P in a cell comprising functional
H2AT120P,
comprising, or alternatively of consisting essentially of, or yet
further consisting of contacting the cell with an effective amount
of an agent that inhibits VprBP kinase activity in the cell. In one
aspect, the cell to be contacted is one that expresses VprBP kinase
activity and/or one with tumor suppressor activity. In one aspect,
the cell is a cancer cell and the cancer is a VprBR-related cancer,
e.g., one that is selected from the group of a bladder cancer, a
breast cancer or a prostate cancer. In a further aspect, the cancer
is VprBR kinase-related in that the cancer is the result of lack of
functional VprBR kinase activity in the cell or tissue. The cell
can be of any appropriate species, e.g., a mammalian or a human
cell. In one aspect, the inhibitor is a synthetic peptide
comprising a HIV1 TAT sequence and the H3 N-terminal tail domain
which corresponds to amino acids 5-27 (QTARKSTGGKAPRKQLATKAARK
(human histone H3 N-terminal tail corresponding to amino acids
5-27)-RKKRRQRRR (HIV1 TAT sequence)) (SEQ ID NO: 11), and sequences
having at least 80% amino acid sequence identity and having the
same or similar biological activity. Since the regulation of
H2AT120 phosphorylation is important in the control of cell growth
and the establishment and maintenance of gene silencing, the
present invention should make it possible to detect and regulate
VprBP dysfunction related to cancer development. In addition, the
invention provides a method of reducing H2AT120 phosphorylation by
using histone H3 tail peptides which block VprBP kinase activity
and therefore reduce VprBP carcinogenic potential in cancer
cells.
[0119] This disclosure also provides a method for inhibiting the
growth of a cancer cell in a patient or treating cancer in a
patient, comprising administering to the patient in need thereof an
effective amount of VprBR kinase-specific RNAi or a small molecule
inhibitor of VprBP. In one aspect, the cell to be contacted is one
that expresses VprBP kinase activity and/or one with tumor
suppressor activity. In one aspect, the cancer is selected from the
group of a bladder cancer, a breast cancer or a prostate cancer. In
a further aspect, the cancer is VprBR kinase-related in that the
cancer is the result of lack of functional VprBR kinase activity in
the cell or tissue. The patient is a mammal or a human patient.
[0120] The above methods can be performed in vitro or in vivo, and
with an agent comprising, or alternatively consisting essentially
of, or yet further consisting of, a VprBR kinase-specific RNAi or a
small molecule inhibitor of VprBP. The polynucleotides include for
example those which are, or that encode VprBR kinase-specific RNA
interference (RNAi) such as siRNA, miRNA dsRNA, mRNA and antisense
RNA, as well DNA, such as in gene therapy applications.
[0121] In one aspect, the small molecule inhibitor of VprBP is a
compound of the formula:
##STR00006##
or a pharmaceutically acceptable salt thereof or a solvate of the
compound or the salt thereof or an equivalent thereof.
[0122] In another aspect, VprBR kinase-specific RNAi is selected
from the group consisting of a reference polynucleotide of VprBP
shRNA1, comprising, or alternatively consisting essentially of, or
yet further consisting, or a sequence of one or more of (SEQ ID NO:
1: 5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2 (SEQ ID NO: 2:
5'-AATCACAGAGTATCTTAGA-3') and Bub1 shRNA (SEQ ID NO:
3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent of each thereof,
wherein an equivalent thereof comprises a polynucleotide that has
at least 80% sequence identity to the reference polynucleotide and
inhibits VprBP kinase activity and/or one that hybridizes under
conditions of high stringency to the reference polynucleotide or
its complement, wherein conditions of high stringency comprise
hybridization reaction at about 60.degree. C. in about 1.times.SSC,
and inhibits VprBP kinase activity.
[0123] In one aspect, the methods are practiced by administering an
effective amount of, or by contacting the cell with, a synthetic
peptide comprising, or alternatively consisting essentially of, or
yet further consisting of, a HIV1 TAT sequence and the H3
N-terminal tail domain which corresponds to amino acids 5-27
(QTARKSTGGKAPRKQLATKAARK (human histone H3 N-terminal tail
corresponding to amino acids 5-27)-RKKRRQRRR (HIV1 TAT sequence))
(SEQ ID NO: 11), and sequences having at least 80% amino acid
sequence identity and having the same or similar biological
activity. Since the regulation of H2AT120 phosphorylation is
important in the control of cell growth and the establishment and
maintenance of gene silencing, the present invention should make it
possible to detect and regulate VprBP dysfunction related to cancer
development.
[0124] This disclosure also provides a method of determining
whether a patient is more likely or less likely to be diagnosed
with a VprBR-related cancer, comprising or alternatively consisting
essentially of, or yet further consisting of screening a sample
isolated from the patient for the presence of VprBP in a sample of
the patient, wherein the presence of VprBP is an indication that
the patient is more likekly to be diagnosed with a VprBR-related
cancer in the patient and an absence of VprBR is an indication that
the patient is less likely to be diagnosed with a VprBR-related
cancer, and optionally administering to the patient identified as
more likely to be diagnosed with cancer an effective amount of an
agent that inhibits VprBP kinase activity. In one aspect, an
overexpression of VprBP is indicative of a cancer in the patient
and normal or under expression of VprBP is an indicative that the
patient is less likely to be diagnosed with a VprBR-related cancer.
In one aspect, the cancer is selected from the group of a bladder
cancer, a breast cancer or a prostate cancer. In a further aspect,
the patient is a mammal such as a human patient. The sample can be
a cell sample such as a bladder cell, breast cell or prostate cell.
The cell can be a human cell or a mammalian cell.
[0125] Also provided are methods for determining the effectiveness
of treating a VprBR-related cancer in a patient by VprBP
inhibition, comprising comparing the expression level of one or
more gene selected from Tables 2 and 3 in a sample isolated of the
patient before treatment by administration of a VprBP inhibiting
agent with the expression level of the one or more gene in a sample
of the patient after treatment, wherein an increased expression of
a gene selected from Table 2 or decreased expression of a gene
selected from Table 3 is indicative of positive effectiveness of
VprBP inhibition in treating the cancer in the patient. In one
aspect, the cancer is selected from the group of a bladder cancer,
a breast cancer or a prostate cancer. In a further aspect, the
patient is a mammal such as a human patient. The sample can be a
cell sample such as a bladder cell, breast cell or prostate
cell.
[0126] Compositions are further provided herein. In one aspect, the
composition comprises, or alternatively consists essentially of, or
yet further consists of, a carrier and a compound of the
formula:
##STR00007##
or a pharmaceutically acceptable salt thereof, a solvate or a salt
of the sovate or an equivalent of each thereof.
[0127] In one aspect, the compound is present in the composition in
an amount from about 0.01 mg to 10 g/day or 1 mg/day to 10
g/day.
[0128] Further provided are compositions comprising, or
alternatively consisting essentially of, or yet further consisting
of a carrier and a VprBR kinase-specific RNAi. In one aspect, the
VprBR kinase-specific RNAi is selected from the group of reference
polynucleotides that consists essentially of or consist of VprBP
shRNA1 (SEQ ID NO: 1: 5'-CGAGAAACTGAGTCAAATGAA-3'), VprBP shRNA2
(SEQ ID NO: 2: 5'-AATCACAGAGTATCTTAGA-3') and Bub1 shRNA (SEQ ID
NO: 3:5'-CGAGGTTAATCCAGCACGTAT-3'), or an equivalent thereof,
wherein an equivalent thereof comprises a polynucleotide that has
at least 80% sequence identity to the reference polynucleotide and
inhibits VprBP kinase activity, and/or one that hybridizes under
conditions of high stringency to the reference polynucleotide or
its complement, wherein conditions of high stringency comprise
hybridization reaction at about 60.degree. C. in about 1.times.SSC
and inhibits VprBP kinase activity.
[0129] The polynucleotides of this disclosure can be replicated
using conventional recombinant techniques in a mammalian or human
host system. Alternatively, the polynucleotides can be replicated
using PCR technology. PCR is the subject matter of U.S. Pat. Nos.
4,683,195; 4,800,159; 4,754,065; and 4,683,202 and described in
PCR: The Polymerase Chain Reaction (Mullis et al. eds, Birkhauser
Press, Boston (1994)) and references cited therein. Yet further,
one of skill in the art can use the sequences provided herein and a
commercial DNA synthesizer to replicate the DNA. Accordingly, this
disclosure also provides a process for obtaining the
polynucleotides of this disclosure by providing the linear sequence
of the polynucleotide, appropriate primer molecules, chemicals such
as enzymes and instructions for their replication and chemically
replicating or linking the nucleotides in the proper orientation to
obtain the polynucleotides. In a separate embodiment, these
polynucleotides are further isolated. Still further, one of skill
in the art can operatively link the polynucleotides to regulatory
sequences for their expression in a host cell, described below. The
polynucleotides and regulatory sequences are inserted into the host
cell (prokaryotic or eukaryotic) for replication and amplification.
The DNA so amplified can be isolated from the cell by methods well
known to those of skill in the art. A process for obtaining
polynucleotides by this method is further provided herein as well
as the polynucleotides so obtained.
[0130] Also provided are host cells comprising one or more of the
polypeptides or polynucleotides of this disclosure. In one aspect,
the polypeptides are expressed and can be isolated from the host
cells. In another aspect, the polypeptides are expressed and
secreted. In yet another aspect, the polypeptides are expressed and
present on the cell surface (extracellularly). Suitable cells
containing the inventive polypeptides include prokaryotic and
eukaryotic cells, which include, but are not limited to bacterial
cells, algae cells, yeast cells, insect cells, plant cells, animal
cells, mammalian cells, murine cells, rat cells, sheep cells,
simian cells and human cells. A non-limiting example of algae cells
is red alga Griffithsia sp. from which Griffithsin was isolated
(Toshiyuki et al. (2005) J. Biol. Chem. 280(10):9345-53). A
non-limiting example of plant cells is a Nicotiana benthamiana leaf
cell from which Griffithsin can be produced in a large scale
(O'Keefe (2009) Proc. Nat. Acad. Sci. USA 106(15):6099-6104).
Examples of bacterial cells include Escherichia coli (Giomarelli et
al. (2006), supra), Salmonella enteric, Streptococcus gordonii and
lactobacillus (Liu et al. (2007) Cellular Microbiology 9:120-130;
Rao et al. (2005) PNAS 102:11993-11998; Chang et al. (2003) PNAS
100(20):11672-11677; Liu et al. (2006) Antimicrob. Agents &
Chemotherapy 50(10):3250-3259). The cells can be purchased from a
commercial vendor such as the American Type Culture Collection
(ATCC, Rockville Md., USA) or cultured from an isolate using
methods known in the art. Examples of suitable eukaryotic cells
include, but are not limited to 293T HEK cells, as well as the
hamster cell line CHO, BHK-21; the murine cell lines designated
NIH3T3, NS0, C127, the simian cell lines COS, Vero; and the human
cell lines HeLa, PER.C6 (commercially available from Crucell) U-937
and Hep G2. A non-limiting example of insect cells include
Spodoptera frugiperda. Examples of yeast useful for expression
include, but are not limited to Saccharomyces, Schizosaccharomyces,
Hansenula, Candida, Torulopsis, Yarrowia, or Pichia. See e.g., U.S.
Pat. Nos. 4,812,405; 4,818,700; 4,929,555; 5,736,383; 5,955,349;
5,888,768 and 6,258,559.
[0131] For the compositions of this disclosure, the carrier is a
pharmaceutically acceptable carrier or an in situ device. In one
aspect, the device is a catheter.
[0132] Also provided are reference of a sequence selected from the
group of:
[0133] a. Q-PLRTYSTGLLGGAMENQDI (SEQ ID NO: 4);
[0134] b. EVALRQENKRPSPRKLS (SEQ ID NO: 5);
[0135] c. DPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRL (SEQ ID NO:
6);
[0136] d. YIDLKQTNDVL (SEQ ID NO: 7);
[0137] e. FATEFV (SEQ ID NO: 8);
[0138] f. KLLEIPRPS (SEQ ID NO: 9);
[0139] g. QDAMERVCM (SEQ ID NO: 10);
[0140] h. QTARKSTGGKAPRKQLATKAARK (human histone H3 N-terminal tail
corresponding to amino acids 5-27)-RKKRRQRRR (HIV1 TAT sequence)
(SEQ ID NO: 11); or
[0141] i. a polypeptide comprising at least two of a. through h.;
or
[0142] j. or an equivalent thereof, wherein an equivalent thereof
comprises a polypeptide that has at least 80% sequence identity to
the reference polypeptide, and/or a polypeptide encoded by a
polynucleotide that hybridizes under conditions of high stringency
to a polynucleotide or its complement that encodes the reference
polypeptide, wherein conditions of high stringency comprise
hybridization reaction at about 60.degree. C. in about
1.times.SSC.
[0143] Isolated polynucleotides encoding the polypeptides are
further provided. The polypeptides and/or polynucleotides can be
combined with a carrier, such as a pharmaceutically acceptable
carrier or contained within a host cell, e.g., a mammalian
cell.
[0144] Polypeptides comprising the amino acid sequences for use in
the methods of the disclosure can be prepared by expressing
polynucleotides encoding the polypeptide sequences of this
disclosure in an appropriate host cell. This can be accomplished by
methods of recombinant DNA technology known to those skilled in the
art. Accordingly, this disclosure also provides methods for
recombinantly producing the polypeptides of this disclosure in a
eukaryotic or prokaryotic host cells, as well as the isolated host
cells used to produce the proteins. The proteins and polypeptides
of this disclosure also can be obtained by chemical synthesis using
a commercially available automated peptide synthesizer such as
those manufactured by Perkin Elmer/Applied Biosystems, Inc., Model
430A or 431A, Foster City, Calif., USA. The synthesized protein or
polypeptide can be precipitated and further purified, for example
by high performance liquid chromatography (HPLC). Accordingly, this
disclosure also provides a process for chemically synthesizing the
proteins of this disclosure by providing the sequence of the
protein and reagents, such as amino acids and enzymes and linking
together the amino acids in the proper orientation and linear
sequence.
[0145] It is known to those skilled in the art that modifications
can be made to any peptide to provide it with altered properties.
Polypeptides of the disclosure can be modified to include unnatural
amino acids. Thus, the peptides may comprise D-amino acids, a
combination of D- and L-amino acids, and various "designer" amino
acids (e.g., .beta.-methyl amino acids, C-.alpha.-methyl amino
acids, and N-.alpha.-methyl amino acids, etc.) to convey special
properties to peptides. Additionally, by assigning specific amino
acids at specific coupling steps, peptides with .alpha.-helices,
.beta. turns, .beta. sheets, .alpha.-turns, and cyclic peptides can
be generated. Generally, it is believed that .alpha.-helical
secondary structure or random secondary structure is preferred.
[0146] In a further embodiment, subunits of polypeptides that
confer useful chemical and structural properties will be chosen.
For example, peptides comprising D-amino acids may be resistant to
L-amino acid-specific proteases in vivo. Modified compounds with
D-amino acids may be synthesized with the amino acids aligned in
reverse order to produce the peptides of the disclosure as
retro-inverso peptides. In addition, the present disclosure
envisions preparing peptides that have better defined structural
properties, and the use of peptidomimetics, and peptidomimetic
bonds, such as ester bonds, to prepare peptides with novel
properties. In another embodiment, a peptide may be generated that
incorporates a reduced peptide bond, i.e.,
R.sub.1--CH.sub.2NH--R.sub.2, where R.sub.1, and R.sub.2 are amino
acid residues or sequences. A reduced peptide bond may be
introduced as a dipeptide subunit. Such a molecule would be
resistant to peptide bond hydrolysis, e.g., protease activity. Such
molecules would provide ligands with unique function and activity,
such as extended half-lives in vivo due to resistance to metabolic
breakdown, or protease activity. Furthermore, it is well known that
in certain systems constrained peptides show enhanced functional
activity (Hruby (1982) Life Sciences 31:189-199 and Hruby et al.
(1990) Biochem J. 268:249-262); the present disclosure provides a
method to produce a constrained peptide that incorporates random
sequences at all other positions.
[0147] Non-classical amino acids may be incorporated in the
peptides of the disclosure in order to introduce particular
conformational motifs, examples of which include without
limitation: 1,2,3,4-tetrahydroisoquinoline-3-carboxylate
(Kazrnierski et al. (1991) J. Am. Chem. Soc. 113:2275-2283);
(2S,3S)-methyl-phenylalanine, (2S,3R)-methyl-phenylalanine,
(2R,3S)-methyl-phenylalanine and (2R,3R)-methyl-phenylalanine
(Kazmierski & Hruby (1991) Tetrahedron Lett. 32(41):5769-5772);
2-aminotetrahydronaphthalene-2-carboxylic acid (Landis (1989) Ph.D.
Thesis, University of Arizona);
hydroxy-1,2,3,4-tetrahydroisoquinoline-3-carboxylate (Miyake et al.
(1989) J. Takeda Res. Labs. 43:53-76) histidine isoquinoline
carboxylic acid (Zechel et al. (1991) Int. J. Pep. Protein Res.
38(2):131-138); and HIC (histidine cyclic urea), (Dharanipragada et
al. (1993) Int. J. Pep. Protein Res. 42(1):68-77) and
(Dharanipragada et al. (1992) Acta. Crystallogr. C.
48:1239-1241).
[0148] The following amino acid analogs and peptidomimetics may be
incorporated into a peptide to induce or favor specific secondary
structures: LL-Acp (LL-3-amino-2-propenidone-6-carboxylic acid), a
.beta.-turn inducing dipeptide analog (Kemp et al. (1985) J. Org.
Chem. 50:5834-5838); .beta.-sheet inducing analogs (Kemp et al.
(1988) Tetrahedron Lett. 29:5081-5082); .beta.-turn inducing
analogs (Kemp et al. (1988) Tetrahedron Lett. 29:5057-5060);
.alpha.-helix inducing analogs (Kemp et al. (1988) Tetrahedron
Lett. 29:4935-4938); .alpha.-turn inducing analogs (Kemp et al.
(1989) J. Org. Chem. 54:109:115); analogs provided by the following
references: Nagai & Sato (1985) Tetrahedron Lett. 26:647-650;
and DiMaio et al. (1989) J. Chem. Soc. Perkin Trans. p. 1687; a
Gly-Ala turn analog (Kahn et al. (1989) Tetrahedron Lett. 30:2317);
amide bond isostere (Clones et al. (1988) Tetrahedron Lett.
29:3853-3856); tetrazole (Zabrocki et al. (1988) J. Am. Chem. Soc.
110:5875-5880); DTC (Samanen et al. (1990) Int. J. Protein Pep.
Res. 35:501:509); and analogs taught in Olson et al. (1990) J. Am.
Chem. Sci. 112:323-333 and Garvey et al. (1990) J. Org. Chem.
56:436. Conformationally restricted mimetics of beta turns and beta
bulges, and peptides containing them, are described in U.S. Pat.
No. 5,440,013.
[0149] It is known to those skilled in the art that modifications
can be made to any peptide by substituting one or more amino acids
with one or more functionally equivalent amino acids that does not
alter the biological function of the peptide. In one aspect, the
amino acid that is substituted by an amino acid that possesses
similar intrinsic properties including, but not limited to,
hydrophobicity, size, or charge. Methods used to determine the
appropriate amino acid to be substituted and for which amino acid
are know to one of skill in the art. Non-limiting examples include
empirical substitution models as described by Dahoff et al. (1978)
In Atlas of Protein Sequence and Structure Vol. 5 suppl. 2 (ed. M.
O. Dayhoff), pp. 345-352. National Biomedical Research Foundation,
Washington D.C.; PAM matrices including Dayhoff matrices (Dahoff et
al. (1978), supra, or JTT matrices as described by Jones et al.
(1992) Comput. Appl. Biosci. 8:275-282 and Gonnet et al. (1992)
Science 256:1443-1145; the empirical model described by Adach &
Hasegawa (1996) J. Mol. Evol. 42:459-468; the block substitution
matrices (BLOSUM) as described by Henikoff & Henikoff (1992)
Proc. Natl. Acad. Sci. USA 89:1-1; Poisson models as described by
Nei (1987) Molecular Evolutionary Genetics. Columbia University
Press, New York.; and the Maximum Likelihood (ML) Method as
described by Muller et al. (2002) Mol. Biol. Evol. 19:8-13.
RNAi or siRNA
[0150] A siRNA can be designed following procedures known in the
art. See, e.g., Dykxhoorn, D. M. and Lieberman, J. (2006) "Running
Interference: Prospects and Obstacles to Using Small Interfering
RNAs as Small Molecule Drugs," Annu. Rev. Biomed. Eng. 8:377-402;
Dykxhoorn, D. M. et al. (2006) "The silent treatment: siRNAs as
small molecule drugs," Gene Therapy, 13:541-52; Aagaard, L. and
Rossi, J. J. (2007) "RNAi therapeutics: Principles, prospects and
challenges," Adv. Drug Delivery Rev. 59:75-86; de Fougerolles, A.
et al. (2007) "Interfering with disease: a progress report on
siRNA-based therapeutics," Nature Reviews Drug Discovery 6:443-53;
Krueger, U. et al. (2007) "Insights into effective RNAi gained from
large-scale siRNA validation screening," Oligonucleotides
17:237-250; U.S. Patent Application Publication No. 2008/0188430;
and U.S. Patent Application Publication No. 2008/0249055.
[0151] siRNAs can be made with methods known in the art. See, e.g.,
Dykxhoorn, D. M. and Lieberman, J. (2006) "Running Interference:
Prospects and Obstacles to Using Small Interfering RNAs as Small
Molecule Drugs," Annu. Rev. Biomed. Eng. 8:377-402; Dykxhoorn, D.
M. et al. (2006) "The silent treatment: siRNAs as small molecule
drugs," Gene Therapy, 13:541-52; Aagaard, L. and Rossi, J. J.
(2007) "RNAi therapeutics: Principles, prospects and challenges,"
Adv. Drug Delivery Rev. 59:75-86; de Fougerolles, A. et al. (2007)
"Interfering with disease: a progress report on siRNA-based
therapeutics," Nature Reviews Drug Discovery 6:443-53; Krueger, U.
et al. (2007) "Insights into effective RNAi gained from large-scale
siRNA validation screening," Oligonucleotides 17:237-250; U.S.
Patent Application Publication No. 2008/0188430; and U.S. Patent
Application Publication No. 2008/0249055.
[0152] A siRNA may be chemically modified to increase its stability
and safety. See, e.g., Dykxhoorn, D. M. and Lieberman, J. (2006)
"Running Interference: Prospects and Obstacles to Using Small
Interfering RNAs as Small Molecule Drugs," Annu. Rev. Biomed. Eng.
8:377-402 and U.S. Patent Application Publication No.
2008/0249055.
Antibody Compositions
[0153] The disclosure, in another aspect, provides an antibody that
binds an isolated polypeptide of the disclosure. The antibody can
be a polyclonal antibody, a monoclonal antibody, a chimeric
antibody, a humanized antibody or a derivative or fragment thereof
as defined below. In one aspect, the antibody is detectably labeled
or further comprises a detectable label conjugated to it.
[0154] Also provided is a composition comprising the antibody and a
carrier. Further provided is a biologically active fragment of the
antibody, or a composition comprising the antibody fragment.
Suitable carriers are defined supra.
[0155] Further provided is an antibody-peptide complex comprising,
or alternatively consisting essentially of, or yet alternatively
consisting of, the antibody and a polypeptide specifically bound to
the antibody. In one aspect, the polypeptide is the polypeptide
against which the antibody is raised.
[0156] This disclosure also provides an antibody capable of
specifically forming a complex with a protein or polypeptide of
this disclosure, which are useful in the therapeutic methods of
this disclosure. The term "antibody" includes polyclonal antibodies
and monoclonal antibodies, antibody fragments, as well as
derivatives thereof (described above). The antibodies include, but
are not limited to mouse, rat, and rabbit or human antibodies.
Antibodies can be produced in cell culture, in phage, or in various
animals, including but not limited to cows, rabbits, goats, mice,
rats, hamsters, guinea pigs, sheep, dogs, cats, monkeys,
chimpanzees, apes, etc. The antibodies are also useful to identify
and purify therapeutic polypeptides.
Combination Therapy
[0157] The compositions and related methods of the present
invention may be used in combination with the administration of
other antitumor therapies. These include, but are not limited to,
the administration of chemotherapy, surgery, and/or radiation.
[0158] The additional therapeutic treatment can be added prior to,
concurrent with, or subsequent to methods or compositions described
herein, and can be contained within the same formulation or as a
separate formulation.
Screening Assays
[0159] The present invention provides methods or in vitro screening
assays for screening candidate agents to identify a potential
therapeutic agent of inhibiting tumor growth or for tumor
suppression, comprising contacting a candidate agent with VprBP,
initiating a kinase reaction, wherein the agent is a potential
therapeutic agent if a reduction of kinase activity as compared to
the kinase activity of VprBP in the absence of the agent is
observed.
Kits
[0160] Also provided are kits comprising, or alternatively
consisting essentially of, or yet further consisting of, a
polynucleotide, a polypeptide or compound of this disclosure and
optionally, instructions for use in the therapeutic, diagnostic
and/or screening methods disclosed herein.
Experimental
Experiment No. 1
[0161] Histone modifications play important roles in the regulation
of gene expression and chromatin organization. VprBP has been
implicated in transcriptionally silent chromatin formation and
cell-cycle regulation, but the molecular basis underlying such
effects remains unclear. Here Applicants report that VprBP
possesses an intrinsic protein kinase activity and is capable of
phosphorylating histone H2A on threonine 120 (H2AT120p) in a
nucleosomal context. VprBP is localized to a large set of tumor
suppressor genes and blocks their transcription, in a manner that
is dependent on its kinase activity toward H2AT120. The functional
significance of VprBP-mediated H2AT120p is further underscored by
the fact that RNAi knockdown and small-molecule inhibition of VprBP
reactivate growth regulatory genes and impede tumor growth.
Applicants' findings establish VprBP as a major kinase responsible
for H2AT120p in cancer cells and suggest that VprBP inhibition
could be a new strategy for the development of anticancer
therapeutics.
[0162] The formation of silent chromatin plays important roles in
the regulation of gene expression and maintenance of chromosome
stability in eukaryotes. Inactive chromatin domains are often
associated with distinct histone modifications (Suganuma, T. et al.
(2011) Annu. Rev. Biochem. 80:473-499). Like other histone
modifications, histone phosphorylation has been linked to various
cellular processes such as transcriptional regulation and DNA
repair (Banerjee, T. et al. (2011) Mol. Cell. Biol. 31:4858-4873).
Histone phosphorylation can occur on serine, threonine, and
tyrosine residues and constitutes a part of the signal to influence
chromatin structure and factor recruitment. For example,
phosphorylations of H3S10, H3S28, and H2B S32 are linked to the
expression of proto-oncogenes such as c-fos, c-jun, and c-myc
(Choi, H. S. et al. (2005) Cancer Res. 65:5818-5827; Lau, A. T. et
al. (2011) J. Biol. Chem. 286:26628-26637; Lau, P. N. et al. (2011)
Proc. Natl. Acad. Sci. USA 108:2801-2806). Phosphorylations of
H3S10, H3T11, and H3 S28 play a role in combination with H3
acetylation in transcription activation and cell proliferation
(Gehani, S. S. et al. (2010) Mol. Cell 39:886-900; Lau, P. N. et
al. (2011) Proc. Natl. Acad. Sci. USA 108:2801-2806; Lo, W. S. et
al. (1998) J. Mol. Biol. 276:19-42; Shimada, M. et al. (2008) Cell
132:221-232; Yang, W. et al. (2012) Cell 150:685-696). Conversely,
H2AS1 phosphorylation inhibits chromatin transcription, and H3
preacetylation interferes with this repressive modification (Zhang,
Y. et al. (2004) J. Biol. Chem. 279:21866-21872). In some cases,
histone phosphorylation facilitates nucleosome binding by proteins
containing phospho-binding modules and restricts their activity as
downstream effectors around a specific region. While a large number
of phosphorylation sites have been identified in core histones, the
identification of kinases responsible for these modifications
remains an area of intensive investigation. VprBP is a large
nuclear protein that can interact with HIV viral protein R and
Cullin 4-DDB 1 ubiquitin ligase complex (Li, W. et al. (2010) Cell
140:477-490). The cellular function of VprBP has been studied
mainly with respect to its role in regulating Cullin 4 E3 ubiquitin
ligase activity and cell-cycle progression (Hrecka, K. et al.
(2007) Proc. Natl. Acad. Sci. USA 104:11778-11783; McCall, C. M. et
al. (2008) Mol. Cell. Biol. 28, 5621-5633). However, more recent
studies have implicated VprBP in a much wider range of cellular
processes, as exemplified by its engagement in JNK-mediated
apoptosis during cellcompetition process (Tamori, Y. et al. (2010)
PLoS Biol. 8:e1000422). Another striking example is the
demonstration made by us that VprBP acts as an effector that binds
histone H3 tails protruding from nucleosomes and establishes
chromatin silencing in cancer cells (Kim, K. et al. (2012) Mol.
Cell. Biol. 32:783-796). These results clearly indicate that VprBP
plays a negative regulatory role in transcription, but precisely
how VprBP mediates its effects on the formation of repressive
chromatin domain is poorly understood.
[0163] Here Applicants report that VprBP has an intrinsic kinase
activity and phosphorylates histone H2A at threonine 120.
Functional studies reveal that H2AT120p by VprBP is sufficient to
repress chromatin transcription. RNA interference (RNAi)-mediated
knockdown of VprBP impairs H2AT120p, transactivates a large set of
tumor suppressor genes, and inhibits cell proliferation.
Furthermore, using a highly potent and selective inhibitor for
VprBP, Applicants show that downregulation of VprBP-mediated
H2AT120p impedes cancer cell proliferation and xenograft tumor
progression.
Results
VprBP Possesses Kinase Activity and Phosphorylates Threonine 120 of
Histone H2A
[0164] Given that dysregulation of histone-modifying activities is
linked to human cancers (Chi, P. et al. (2010) Nat. Rev. Cancer
10:457-469; Dawson, M. A. et al. (2012) Cell 150:12-27), Applicants
reasoned that VprBP expression in cancer cells might influence
specific histone modifications. As expected, western blotting of
cell lysates confirmed that VprBP is expressed highly in DU145
prostate, LD611 bladder, and MDA-MB231 breast cancer cell lines but
minimally in their corresponding normal counterparts (FIGS. 1A and
5A). In exploring whether any histone modifications are altered in
the cancer cell lines, Applicants detected much higher levels of
H2AT120p in chromatin fractions. To assess the relationship between
VprBP expression and H2AT120p more directly, Applicants examined a
possible effect of VprBP depletion. Upon the stable knockdown of
VprBP, the abundant H2AT120p found in the cancer cell lines was
drastically reduced, but changes in other modifications were much
less pronounced or absent (FIGS. 1B and 5B).
[0165] The data above suggest that VprBP may be of particular
importance for H2AT120p reactions in cancer cells. To test this
possibility, Applicants incubated free individual histones with
[g-32P]-ATP and recombinant VprBP produced in baculovirus-infected
insect cells. The integrity and purity of the VprBP protein were
confirmed by silver-stained SDS-PAGE (FIG. 5C) and mass
spectrometry (FIG. 5D). Autoradiograph of the kinase reaction
products showed a robust phosphorylation of H2A, but not other core
histones (FIG. 1C). Expectedly, VprBP showed no enzymatic activity
in our in vitro HAT and HMT assays (FIG. 5E). As the core histones
exist within nucleosomes in the cell nucleus, kinase assays were
repeated with nucleosomes reconstituted from recombinant histones
and the 601 nucleosome positioning sequence (Lowary, P. T. et al.
(1998) J. Mol. Biol. 276:19-42). VprBP generated clear labeling of
H2A in the nucleosome after autoradiography (FIG. 5F). These
results were further corroborated by in vitro kinase assays with
nucleosomes immobilized on agarose beads (FIG. 5G) and with VprBP
immunoaffinity purified from DU145 cell lysates (FIG. 5H). In
additional support, the in-gel autophosphorylation assays showed a
phosphorylated band at the expected molecular weight of VprBP (FIG.
5I).
[0166] Consistent with these findings, sequence alignments with CK1
and Mut9p kinases identified 8 out of the 12 protein kinase
subdomains (Hanks, S. K. et al. (1988) Science 241:42-52; Taylor,
S. S. et al. (1992) Annu. Rev. Cell Biol. 8:429-462) in the
N-terminal region of VprBP (FIG. 1D, residues 141-500). The lysine
residue in the subdomain II is critical for kinase enzymatic
activity (Casas-Mollano, J. A. et al. (2008) Proc. Natl. Acad. Sci.
USA 105:6486-6491; Zhai et al., 1992). VprBP does not have this
conserved residue in its subdomain II but has lysine 194
immediately adjacent to the subdomain II. Notably, mutation of this
lysine residue completely abrogated kinase activity (FIG. 1E, lanes
1 and 2; FIG. 5J, lanes 1 and 2). Mutation at either D361 or K363
that is conserved in the subdomain VI also impaired the catalytic
activity (FIG. 1E, lanes 3 and 4; FIG. 5J, lanes 3 and 4). On the
contrary, mutation of L378 lying outside the conserved subdomains
did not affect VprBP kinase activity (FIG. 1E, lane 6; FIG. 5J,
lane 5). These results exclude the possibility that the observed
H2AT120p is due to a contaminating kinase in the preparation of
recombinant VprBP. All VprBP mutants exhibited circular dichroism
spectra almost identical to those of the wild-type VprBP (FIG. 5K),
thus ruling out the possibility that the altered structure of the
VprBP mutants is responsible for their reduced kinase activity.
[0167] In determining VprBP phosphorylation sites in H2A,
Applicants found that simultaneous deletion of the N- and
C-terminal tails of H2A blocks H2A phosphorylation by VprBP (FIG.
1F, lanes 1-4). Moreover, VprBP-mediated phosphorylation is
completely abolished by mutation of T120, whereas mutations of six
other potential modification sites on the tail domains had little
effect (lanes 5-14). Western blot analysis of the kinase reactions
using anti-H2AT120p antibody further confirmed that VprBP
stimulates the phosphorylation of H2AT120 in the nucleosome (FIG.
1G).
VprBP-Mediated H2AT120p is Highly Abundant in Tumors and Necessary
for Cancer Cell Proliferation
[0168] To decipher the clinical significance of VprBP-mediated
H2AT120p, Applicants next analyzed the levels of VprBP and H2AT120p
in multiple patient-matched normal and tumor tissue microarray
(FIG. 2A; Table 1). Immunohistochemical analysis on 16 types of
organ cancer with matched adjacent normal tissue demonstrated a
clear link between elevated expression of VprBP and increased
levels of H2AT120p in more than 70% of the tumor samples. This
trend was more evident in bladder, breast, and prostate tumor
samples. In cases where there was no change in VprBP expression,
the same trend was observed for H2AT120p. These findings validate
the results from cell lines and support the conjecture that VprBP
possesses oncogenic properties and its kinase activity contributes
to the observed changes. To address this issue, Applicants tested
the effects of VprBP depletion on the proliferation of DU145 cancer
cells. Expectedly, much lower levels of VprBP were detected in
VprBP-depleted cells compared to mock-depleted cells, and the
observed reduction of VprBP correlated well with decreased H2AT120p
(FIGS. 2B and 6A). MTT assays over a 5-day time course also
revealed that VprBP depletion gradually decreased the viability of
cancer cells and that the expression of VprBP wildtype, but not
VprBP K194R kinase-dead mutant, restored H2AT120p and cell
proliferation rates (FIGS. 2C and 6B). Analogously, VprBP depletion
interfered with cell proliferation and thus reduced the number of
colony-forming cells; colony numbers increased to about 75% of
undepleted cells after the expression of wild-type but not
K194R-mutated VprBP in the depleted cells (FIGS. 2D and 6C).
Consistent with these observations, VprBP overexpression in MLC
cells containing low levels of VprBP increased H2AT120p, thereby
facilitating cell proliferation and colony formation (FIGS.
6D-6F).
VprBP-Mediated H2AT120p Inactivates Cell Growth Regulatory
Genes
[0169] As VprBP has been reported to act as a negative regulator of
chromatin transcription (Kim, K. et al. (2012) Mol. Cell. Biol.
32:783-796), Applicants sought to determine whether H2AT120p is
required for VprBP function. In the absence of VprBP, high levels
of transcription from chromatin reconstituted from G5ML-601 array
DNA and recombinant histones were achieved by Gal4-VP16 and p300
(FIG. 3A, lanes 1 and 2). When chromatin was phosphorylated by
VprBP, significant repression of transcription was evident (lanes 3
and 4). Intriguingly, however, the ability of VprBP to block
transcription was compromised upon mutation of H2AT120 in chromatin
(lanes 9 and 10) or omission of ATP from the reaction (FIG. 7A).
Furthermore, addition of VprBP kinase-dead mutant to transcription
reactions had no detectable effect on transcription (FIG. 3A, lanes
5, 6, 11, and 12), strongly arguing that H2AT120p is the cause of
the observed repression.
[0170] Next, Applicants performed comprehensive microarray analysis
with total RNA isolated from mock- or VprBP-depleted DU145 cancer
cells. With a fold-change cutoff of >1.7 and stringent
p<0.005, the gene expression profiling showed that 292 genes
were activated and 208 genes were repressed (FIG. 3B; Tables 2 and
3) in response to VprBP knockdown. Many of the genes upregulated
upon VprBP depletion encode cell proliferation and growth
regulators (FIG. 7B), including those known to be key regulatory
components for cancer initiation and progression (FIG. 3C). The
transcriptional changes detected by microarray were validated by
qRT-PCR of eight genes whose expression was increased upon VprBP
depletion, and one unaffected control gene (FIG. 3D). To check
whether the candidate target genes harbor VprBP and H2AT120p,
Applicants conducted ChIP assays. In mock-depleted cells, VprBP
occupied the promoter and coding regions of the target genes, and
H2AT120p showed similar distribution across the loci (FIGS. 3E and
7C). Consistent with previous studies (Schones, D. E. et al. (2008)
Cell 132:887-898), nucleosomes are depleted in the vicinity of a
transcription start site (TSS), as indicated by the low levels of
H2A and H3. For this reason, ChIP analysis exhibited low levels of
VprBP and H2AT120p over the TSS of the target genes. Importantly,
VprBP depletion resulted in greatly reduced levels of VprBP and
concomitant loss of H2AT120p at the candidate target genes,
reinforcing the conclusion that H2AT120p observed in these genes is
dependent of VprBP. In the case of the RARRES1 gene, which is not
affected by VprBP knockdown (FIG. 3D), the H2AT120p levels were low
and remained unchanged under control and VprBP knockdown conditions
(FIG. 7C).
B32B3 is a Potent and Selective Inhibitor of VprBP and Suppresses
Tumor Growth
[0171] The fact that VprBP knockdown abrogates H2AT120p and slows
cancer cell growth prompted us to look for highly potent and
selective inhibitors for VprBP. To this end, Applicants' inhouse
small-molecule library of 5,000 compounds was screened. When the
inhibitory potential of the compounds was assessed by in vitro
kinase assays, two of them (0.002% hit rate), designated as B32B3
and B20H6, inhibited VprBP and decreased H2AT120p at a
concentration of 5 mM (FIG. 4A). To evaluate their cellular
effects, DU145 cells were treated with the compounds in the
concentration range of 0-5 mM for 24 hr. B32B3 potently inhibited
H2AT120p with a half-maximal inhibitory concentration (IC50) value
of 0.5 mM, as evaluated by western blotting and immunostaining
(FIGS. 4B, 4D, and 8A). The observed reduction in H2AT120p was
paralleled by inhibition of cell proliferation (FIGS. 4E and 8B).
By comparison, B20H6 failed to produce any detectable changes in
H2AT120p and cell growth after treatment (FIG. 4B, lanes 7-12; and
FIG. 8B), suggesting that this compound might be relatively
unstable with poor cellular uptake. Importantly, the knockdown of
VprBP sensitized DU145 cells to B32B3 with a circa 2-fold decrease
in the IC50, whereas B32B3 was considerably less potent in DU145
cells overexpressing VprBP (FIG. 8A). Furthermore, B32B3 treatment
at concentrations up to 5 mM minimally antagonized the
proliferation of MLC cells lacking VprBP-mediated H2AT120p (FIGS.
8C and 8D). These results indicate that B32B3 preferentially
targets cancer cells exhibiting high levels of VprBP and H2AT120p.
That the IC50 value of B32B3 was increased in the presence of
incremental concentrations of ATP argues strongly that B32B3
competes with ATP and may bind to the kinase active site (FIG. 8E).
Additionally, when tested against a panel of 33 human kinases,
B32B3 showed greater than 100-fold selectivity for VprBP over 33
other kinases with an IC50 of 0.6 mM (Table 4). Thus, although
Applicants cannot exclude the possibility that other kinases that
were not included in the selectivity screen might be affected,
B32B3 can be defined as a highly specific VprBP inhibitor at
present.
[0172] A key question that arises from our findings is whether
B32B3 exhibits antitumor efficacy through its VprBP inhibitory
activity. To address this question, Applicants inoculated 1 3 107
DU145 cancer cells into nude mice and treated tumor xenografts with
intraperitoneal injections of B32B3 at a dose of 5 mg/kg twice a
week over 3 weeks. Tumor growth was inhibited, as calculated the
day after the last treatment of B32B3, by 70%-75% (FIGS. 4F and
4G). At these doses, B32B3 appeared to be well tolerated in mice,
and it did not cause any significant weight loss during treatment
(FIG. 8F). In evaluating the pharmacokinetic properties of B32B3,
Applicants found that B32B3 has a half-life of approximately 7 hr
in mouse plasma and a Cmax of 1 mM at a dose of 5 mg/kg in mice
(FIGS. 8G and 8H). To correlate B32B3 antitumor activity with VprBP
inhibition, DU145 xenograft tumors explanted from DMSO- or
B32B3-treated mice were analyzed by immunohistochemistry. The
levels of H2AT120p were greatly decreased in the tumors of
B32B3-treated mice, compared to DMSO-treated controls (FIG. 4H). To
elucidate the mechanistic basis of the B32B3 effects, Applicants
tested if the compound could rescue the transcriptional inhibition
caused by VprBP. As summarized in FIG. 4I, treatment of DU145 cells
with B32B3 (1 mM) resulted in, albeit to a varying extent, higher
expression of VprBP target genes. Because H2AT120p is essential for
VprBP transrepression, Applicants also examined the effects of
B32B3 on H2AT120p at the target genes. VprBP was present at high
levels at both promoter and coding regions, which did not alter
upon B32B3 treatment. However, H2AT120p at the regions was reduced
by 70%, following B32B3 treatment at the same dose (FIGS. 4J and
8I). B32B3 thus displays anticancer properties at least in part, by
interfering with VprBP-mediated H2AT120p at the target genes.
DISCUSSION
[0173] This work describes the systematic biochemical and cellular
analysis of VprBP and unveils a surprising mechanism underlying the
formation of repressive chromatin by VprBP. A key finding is that
the N-terminal region of VprBP possesses a previously unrecognized
kinase activity for H2AT120. VprBP contains 8 out of the 12
conserved protein kinase subdomains, and mutations of these
subdomains abolish the catalytic activity, further confirming that
VprBP is a bona fide protein kinase. Interestingly, while most
histone kinases identified so far are incapable of phosphorylating
nucleosomal histones, VprBP displays an unusual additional activity
as an effective kinase of nucleosomes. In this respect, VprBP
resembles Drosophila NHK-1, which catalyzes phosphorylation of
H2AT119 (equivalent to human H2AT120) in the nucleosomal context
(Aihara, H. et al. (2004) Genes Dev. 18:877-888). It has been
reported that Bub1 acts as a centromere-specific kinase for H2AS121
(H2AT120 in human) during prometaphase and metaphase in fission
yeast (Kawashima, S. A. et al. (2010) Science 327:172-177).
Applicants' attempts to detect any significant changes in H2AT120p
in Bub1-depleted DU145 cells have been unsuccessful (FIG. 5L),
probably because Applicants have used unsynchronized interphase
cells. Applicants also observed that Bub1 is expressed at similar
levels in MLC normal and DU145 cancer cells (FIG. 5M). It thus
appears that the role of VprBP-mediated H2A phosphorylation is
distinct from that of Bub1-mediated H2A phosphorylation. Further
structural and biological analyses of VprBP and Bub1 would be
helpful for understanding the functional differences of these two
kinases.
[0174] There has been no demonstration that H2AT120p is involved in
the regulation of gene expression, although recently this
possibility has been discussed. Our well-defined in vitro assay
system allows us to provide the first direct connection between
H2AT120p and transcriptional repression. Importantly, blocking
VprBP-mediated H2AT120p by point mutation, Applicants have been
able to verify that H2AT120p is a critical determinant of
repressive action of VprBP. In accord with these in vitro data,
gene expression profiling demonstrated that VprBP downregulates 292
genes, many of which are involved in cell proliferation and
programmed cell death. An intriguing question raised by these
results is how H2AT120p by VprBP modulates chromatin transcription.
One possible mechanism is that H2AT120p can affect the occurrence
of other histone modifications on the same or different histone
tails. Recent work from our lab has shown that VprBP interacts with
HDAC1, thereby inhibiting H3 acetylation at p53 target genes (Kim,
K. et al. (2012) Mol. Cell. Biol. 32:783-796). This suggests that
H2AT120p at target genes may influence HDAC1 activity required for
gene repression. Another possibility is that H2AT120p could serve
as an integrating platform for repressor proteins. Considering the
fact that the centromere cohesion protector shugoshin recognizes
H2AT120p and recruits heterochromatin protein Swi6/HP1 at
centromeres in fission yeast (Kawashima, S. A. et al. (2010)
Science 327:172-177; Yamagishi, Y. et al. (2008) Nature
455:251-255), the recruitments of factors to specific chromatin
domains are likely to be part of the mechanisms for VprBP-induced
gene silencing. Another question unsolved in our study is how VprBP
is initially localized at target genes. A likely model is that
VprBP physically associates with gene specific factors to influence
the transcription of target genes, as supported by our recent
finding that VprBP-p53 interaction is a key event in VprBP action
on p53 target genes (Kim, K. et al. (2012) Mol. Cell. Biol.
32:783-796). Thus, more extensive studies of VprBP interaction with
DNA-binding factors and other coregulators would provide a
molecular explanation to gene-specific function of VprBP.
[0175] VprBP expression is significantly higher in breast, bladder,
and prostate cancer tissues compared to their benign counterparts.
The observation that VprBP knockdown significantly decreased
H2AT120p and cancer cell growth indicates that VprBP could be an
ideal target for cancer therapy. As the first step toward checking
this possibility, Applicants screened large numbers of compounds in
a high-throughput manner and identified B32B3 as a selective
inhibitor of VprBP. B32B3 is thought to inhibit VprBP kinase
activity by competing with ATP. Importantly, B32B3 recapitulates
the most molecular phenotypes that arise from VprBP knockdown: (1)
the reduction of H2AT120p at target genes, (2) higher expression of
VprBP target genes, and (3) the impairment of cancer cell growth.
Thus, B32B3 represents a unique tool to investigate the regulatory
pathways governing H2AT120p in physiological and tumorigenic
conditions. Moreover, the selectivity for cancer cells in culture
and our ability to demonstrate efficacy in a mouse model of VprBP
at doses that were well tolerated suggest that inhibition of VprBP
by B32B3 may provide a pharmacological basis for therapeutic
intervention against cancers.
Experimental Procedures
In Vitro Kinase and Transcription Assays
[0176] Recombinant mononucleosomes and nucleosome arrays were
reconstituted using recombinant histone octamers as recently
described (Jaskelioff, M. et al. (2000) Mol. Cell. Biol.
20:3058-3068; Robinson, P. J. et al. (2008) J. Mol. Biol.
381:816-825). For kinase assays, recombinant VprBP was incubated
with free histones (1 mg) or reconstituted nucleosomes (2 mg) in
kinase buffer (50 mM Tris-HCl [pH 7.5], 20 mM EGTA, 10 mM MgCl2, 1
mM DTT, and 1 mM b-glycerophosphate) containing 10 mCi of [g-32P]
ATP and 4 mM ATP for 30 min at 30_C. Proteins from each reaction
were separated by SDS-PAGE, Coomassie blue stained, dried, and
visualized by autoradiography. To create VprBP inhibitors, a
collection of 5,000 compounds was screened in the same kinase
assays at a final concentration of 5 mM. The selectivity of B32B3
toward VprBP kinase was assessed in a panel of 33 kinases listed in
Table 4. In vitro transcription assays were as described (Kim, K.
et al. (2012) Mol. Cell. Biol. 32:783-796), except that G5ML-601
nucleosome arrays (100 ng) and Gal4-VP16 (15 ng) were used for the
reactions. Recombinant VprBP (25 or 50 ng) and ATP (10 mM) were
added before p300 (20 ng) and AcCoA (10 mM).
Mice Xenografts
[0177] All animal experiments were performed according to protocols
approved by the Institutional Animal Care and Use Committee. Tumor
xenografts were established by subcutaneous injection of 1 3 107
DU145 cells into 8-weekold female nude mice (n=8). At day 5 after
injection, the mice bearing DU145 tumor xenografts were treated
with twice-weekly i.p. injections of either DMSO or B32B3 at a dose
of 5 mg/kg throughout the duration of the experiment. Tumor
dimension was measured by calipers twice a week, and tumor mass was
calculated as described (Heo, K. et al. (2012) Oncogene
32:2510-2520). The mice were killed by asphyxiation with CO2, and
tumors were excised and weighed 25 day after the cell injection. To
analyze the H2AT120p, formalin-fixed and paraffin-embedded sections
(5 mm) from DU145 tumor xenografts were subject to
immunohistochemistry. Animal studies were conducted under approved
institutional protocols.
Accession Numbers
[0178] The NCBI GEO accession number for microarray data reported
in this application is GSE50414.
Cell Culture, Constructs and Antibodies
[0179] MDA-MB231, LD611 and DU145 cells were cultured in Dulbecco's
modified Eagle's medium (DMEM) supplemented with 10% FBS. MCF-10-2A
cells were grown in a 1:1 mixture of DMEM and Ham's F12
supplemented with 20 ng/ml epidermal growth factor, 100 ng/ml
cholera toxin, 0.01 mg/ml insulin, 500 ng/ml hydrocortisone, and 5%
horse serum. Urotsa cells were grown in DMEM low glucose containing
10% FBS. MLC cells were grown in T medium containing 10% FBS. To
express VprBP using the baculovirus system, VprBP cDNA was
subcloned into the EcoRI and XhoI sites of pFASTBAC vector with an
N-terminal His epitope. To generate VprBP mutants, VprBP cDNA was
mutated by the QuikChange.RTM. II site-directed mutagenesis kit
(Agilent Technologies) before the construction. For mammalian
expression of VprBP wild type and mutants, the corresponding cDNAs
were amplified by PCR and ligated into the EcoRI and SalI sites of
lentiviral expression vector pLenti-Hygro (addgene) containing 5'
FLAG coding sequence. For bacterial expression of human H2A
proteins, H2A cDNA was inserted into the NdeI and BamHI sites of
pET-11a or pET-11d vector in frame with FLAG sequences. Single- or
multiple-residue substitutions in H2A were made by QuickChange kit
and verified by DNA sequencing. Antibodies specific for H3ac, H4ac,
H2Aac, H2Bac, H3K27me3, H3S10p and H2A were from Millipore;
antibodies for H3K4me3, H3K9me3 and H2AT120p (for Western blotting)
were from Active Motif; antibodies for H3K36me3 and H2AT120p (for
immunostaining and ChIP) were from Abcam; antibody for VprBP was
from Proteintech Group; antibody for Bub1 was from GeneTex; and
antibody for actin was from Sigma.
Chromatin Extraction
[0180] Cells were lyzed by suspending in buffer A (10 mM HEPES, pH
7.4, 10 mM KCl, 1.5 mM MgCl2, 0.34 M sucrose, 10% glycerol, 1 mM
DTT, 5 mM .beta.-glycerophosphate, 10 mM NaF, protease inhibitor,
and 0.2% TritonX-100) and incubating on ice for 8 min. Nuclei were
isolated by centrifugation (1,300.times.g for 10 min at 4.degree.
C.), and the supernatant was discarded. The resulting nuclei pellet
was resuspended in buffer B (3 mM EDTA, 0.2 mM EGTA, 1 mM DTT, 5 mM
.beta.-glycerophosphate, 10 mM NaF, and protease inhibitor) and
incubated for 30 min on ice. The suspension was centrifuged
(1,700.times.g for 5 min at 4.degree. C.) and then the pellet was
washed with buffer B three times. The chromatin pellet was
sonicated in Laemli sample buffer.
Recombinant Proteins
[0181] His-VprBP wild type and mutants were expressed using a
baculovirus vector in insect (Sf9) cells. The expressed proteins
were initially purified with Ni-NTA agarose (Novagen), and further
purified with Q Sepharose (GE healthcare) column according to
standard procedures. The purity and intactness of the recombinant
VrpBP proteins were confirmed by quantitative LC-MS/MS and Western
blotting. Recombinant histones were expressed in Escherichia coli
Rosetta 2 (DE3) pLysS cells (Novagen) and purified as described
previously (Dyer, P. N. et al. (2004) Methods Enzymol.
375:23-44).
In-Gel Kinase Assay
[0182] In-gel kinase assay was performed as described (Wooten, M.
W. (2002) Sci. STKE 2002:115) with minor modifications. Briefly,
wild type and mutant VprBP proteins (5 .mu.g) were resolved on an
8% SDS-PAGE gel, and the VprBP proteins in the gel were denatured
in denaturation buffer (50 mM Tris-HCl, pH 8.0, 20 mM DTT and 6 M
Guanidine HCl) for 1 h at room temperature and were renatured for
16 h at 4.degree. C. in renaturation buffer (50 mM Tris-HCl, pH
8.0, 5 mM DTT, 0.04% Tween-20, 100 mM NaCl and 5 mM MgCl2). The
kinase reaction was initiated in 15 ml of kinase buffer (25 mM
Hepes, pH 7.4, 20 mM MgCl2, 5 mM NaF, 1 mM DTT) containing 50 .mu.M
ATP and 20 Ci of [.gamma.-32P] ATP for 1 h at 30.degree. C. The
reaction was terminated by washing the gel with a fixing solution
containing 10 mM sodium pyrophosphate and 5% trichloroacetic acid
for 2 h. The gel was dried and subjected to autoradiography.
Circular Dichroism (CD) Spectroscopy
[0183] CD measurements were recorded using a Jasco J-810
spectropolarimeter with a 0.1 cm pathlength cuvette and a protein
concentration of 1 .mu.M. Circular dichroism spectra were obtained
at 25.degree. C. in phosphate buffer (10 mM sodium phosphate and 50
mM NaCl, pH 7.4). For each sample, 20 scans from 200 to 260 nm were
averaged.
Immunostaining
[0184] The levels of VprBP and H2AT120p in tumors tissues were
determined in FDA human tumor organ tissue microarray, which
includes 16 types of organ cancer with matched or unmatched
adjacent normal tissue (US Biomax, Inc). The formalin-fixed,
paraffin-embedded sections were blocked by treating with blocking
reagent (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.3% Triton X-100,
and 5% normal goat serum) for 30 min at room temperature and
incubated with VprBP and H2AT120p antibodies at 4.degree. C.
overnight. Immunodetection was performed using ABC reagent
(Vectorstain). DAB (Vector Lab) was used for color development and
hematoxylin (Sigma) was used for counterstaining. The intensity and
distribution patterns of staining were evaluated by
semiquantitative immunohistochemical assessment. The intensity of
staining was graded from - to +++ (-, no staining; +, weak
staining; ++, moderate staining; and +++, strong staining). The
distribution of staining was classified from 0 to 3 (0, 0-20%; 1,
21-50%; 2, 51-80%; 3, 81-100%). For immunofluorescence of DU145
cells, cells were treated with DMSO or B32B3 (0.5 .mu.M) for 24 h
and fixed with 4% paraformaldehyde for 15 min. The corresponding
samples were permeabilized with 0.3% Triton X-100 for 15 min and
immunostained with H2AT120p antibody.
RNA Interference
[0185] DNA oligonucleotides encoding VprBP shRNA1
(5'-CGAGAAACTGAGTCAAATGAA-3') (SEQ ID NO: 1), VprBP shRNA2
(5'-AATCACAGAGTATCTTAGA-3') (SEQ ID NO: 2) and Bub1 shRNA
(5'-CGAGGTTAATCCAGCACGTAT-3') (SEQ ID NO: 3) were subcloned into
pLKO.1-puro (Addgene) lentiviral vector according to standard
procedures. To produce virus particles, 293T cells were
cotransfected with the plasmids encoding VSV-G, NL-BH and the
shRNAs. Two days after transfection, the soups containing the
viruses were collected and used to infect cancer cells in the
presence of polybrene (8 .mu.g/ml).
Cell Proliferation and Colony Formation Assays
[0186] Cell proliferation was assessed by the
3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT)
assay as previously described (Kim, K. et al. (2012) Mol. Cell
Biol. 32:783-796). To evaluate IC50 of compound B32B3 and B20H6,
DU145 cells were treated with various concentrations (0.001, 0.005,
0.01, 0.05, 0.1, 1, 5, 10, and 20 .mu.M) of compounds for 72 h and
viability was measured by MTT assays. For soft agar colony
formation assays, DU145 cells were treated with B32B3 (0.5, 1, and
3 .mu.M). Cells were suspended in semisolid medium (DMEM 10% FBS
plus 0.3% ultra pure noble agar) at concentrations of
2.times.10.sup.5 cells/ml, added over a layer of 0.6% agar in RPMI
on 35 mm plate and incubated for an additional 21 days. The
colonies in each well were stained with 0.005% crystal violet in
20% ethanol, counted and photographed. All assays were run in
triplicate, and results presented are the average of three
individual experiments.
Microarray and qRT-PCR
[0187] Total RNA was isolated from mock- or VprBP-depleted cells
using the TRIzol reagent according to the manufacturer's
instructions (Invitrogen). Gene expression microarray experiments
were conducted using a whole-genome expression array (Human HT-12
v4 Expression BeadChip, Illumina). This high density
oligonucleotide array chip targets more than 47000 probe sequences
derived from National Center for Biotechnology Information
Reference Sequence (NCBI) RefSeq Release 38 (Nov. 7, 2009) and
other sources. Data were processed and analyzed by the ArrayPipe
software (www.pathogenomics.ca/arraypipe). Genes whose expression
level was increased or decreased by a factor of >1.7 after VprBP
knockdown are listed in Tables 2 and 3. For qRT-PCR, total RNA was
extracted as described for microarray and subjected to RT reactions
with the use of PerfeCta.RTM. SYBR Green FastMix (Quanta
BIOSCIENCES) and an iCycler IQ5 real time cycler (Bio-Rad). The
specificity of the amplification reactions were monitored by
melting curve analysis. Assays were normalized to .beta.-actin mRNA
levels. The following primers were used for qRT-PCR:
TABLE-US-00001 BMF (5'-CTCAGCCGACTTCAGCTCTT-3' (SEQ ID NO: 13) and
5'-AGCCAGCATTGCCATAAAAG-3' (SEQ ID NO: 14)), NKX3-1
(5'-AGAAAGGCACTTGGGGTCTT-3' (SEQ ID NO: 15) and
5'-TCCGTGAGCTTGAGGTTCTT-3' (SEQ ID NO: 16)), NOV
(5'-ACGAGCTTTTGTCTCCGAAA-3' (SEQ ID NO: 17) and
5'-ACACCAGACAGCATGAGCAG-3' (SEQ ID NO: 18)), OPN3
(5'-GATCCCTTTTGCAGCTTCTG-3' (SEQ ID NO: 19) and
5'-TTTGGACCCATTGGTTTTGT-3' (SEQ ID NO: 20)), SOCS2
(5'-AAAAGAGGCACCAGAAGGAA-3' (SEQ ID NO: 21) and
5'-GTCCGCTTATCCTTGCACAT-3' (SEQ ID NO: 22)), SOCS3
(5'-GCCACCTACTGAACCCTCCT-3' (SEQ ID NO: 23) and
5'-ACGGTCTTCCGACAGAGATG-3' (SEQ ID NO: 24)), TNFSF10
(5'-TTCACAGTGCTCCTGCAGTC-3' (SEQ ID NO: 25) and
5'-ACGGAGTTGCCACTTGACTT (SEQ ID NO: 26)), and TOB1
(5'-GGTGAAAAGGGACCAGTGAA-3' (SEQ ID NO: 27) and
5'-TGGAGAGCTGGACACTGATG (SEQ ID NO: 28)).
Chromatin Immunoprecipitation (ChIP)
[0188] Mock-depleted or VprBP-depleted DU145 cells were grown to
70-80% confluence, cross-linked with 1% formaldehyde for 10 min,
and processed for ChIP as recently described (Kim, K. et al. (2012)
Mol. Cell Biol. 32:783-796). ChIP assays on B32B2-treated cells
were performed in a similar manner, except that DU145 cells were
treated with DMSO or 1 .mu.M B32B3 for 24 h. All samples were run
in triplicate and results were averaged. Sequences of the primers
used for
TABLE-US-00002 NOV (promoter, 5'-GCACCAGTGTTGAAGTGTGG-3' (SEQ ID
NO: 29) and 5'-GGCATGCTTGTCATCTCTCA-3' (SEQ ID NO: 30); TSS,
5'-GCCCTAAGGAGAGCAGCAC-3' (SEQ ID NO: 31) and
5'-TTCGCTGTAGATTGGCACTG-3' (SEQ ID NO: 32); coding,
5'-CTGCTCATGCTGTCTGGTGT-3' (SEQ ID NO: 33) and
5'-AGCTGCAGGAGAAGAGGTCA (SEQ ID NO: 34)), OPN3(promoter,
5'-TAGCTTGCACAAACCCTGTG-3' (SEQ ID NO: 35) and
5'-TGTGGTTGCACAATCCCTAA-3' (SEQ ID NO: 36); TSS,
5'-GAAGGTGCCCAGCCAGTG-3' (SEQ ID NO: 37) and 5'-
GCCTGCTCTAGCCATTGTG-3' (SEQ ID NO: 38); coding,
5'-CAGGACTCCATTCCTGTGGT-3'(SEQ ID NO: 39) and
5'-GGTTTCGTGCCTTGTTGAGT-3' (SEQ ID NO: 40)), SOCS2 (promoter,
5'-GAAACGGGGTTGGCTGTAG-3' (SEQ ID NO: 41) and
5'-GTCGCAATACACAGGCTTCA-3' (SEQ ID NO: 42); TSS,
5'-ATCCTCGAGGCTTTTGTGTG-3' (SEQ ID NO: 43) and
5'-TCCCCCGTTAACGTTTAATTT-3' (SEQ ID NO: 44); coding,
5'-AGGATCTGGGGAGAAAGAGC-3' (SEQ ID NO: 45) and
5'-GGGTCATGAGAGAAGGGTCA-3' (SEQ ID NO: 46)), SOCS3 (promoter, 5'-
CCGGAAATTCTCTCCTGCTA-3' (SEQ ID NO: 47) and
5'-GGAGAGCTCGAGGTGGAAC-3' (SEQ ID NO: 48); TSS,
5'-CTCTCGTCGCGCTTTGTCT-3' (SEQ ID NO: 49) and
5'-GGAGCAGGGAGTCCAAGTC-3' (SEQ ID NO: 50); coding,
5'-ATGGTCACCCACAGCAAGTT-3' (SEQ ID NO: 51) and
5'-GCTGCACATTGGACTCAAAA-3' (SEQ ID NO: 52)), and TNFSF10 (promoter,
5'-AAAATTAGCTGGGCATGGTG-3' (SEQ ID NO: 53) and
5'-AACCTCCACCTCCCAGATTC-3' (SEQ ID NO: 54); TSS,
5'-GGGACAGTTGCAGGTTCAAT-3' (SEQ ID NO: 55) and
5'-GGAGCACTGTGAAGATCACG-3' (SEQ ID NO: 56); coding,
5'-ATCCAAAGGGACTGGAGCTT-3' (SEQ ID NO: 57) and 5'-
GCTGCACATTGGACTCAAAA-3' (SEQ ID NO: 58)).
quantitative real time PCR (qPCR) are as follows:
B32B3 Stability Assessment
[0189] To assess the metabolic stability of B32B3 in mouse, dog,
monkey, and human plasma, the compound was spiked into blank plasma
to a concentration of 10 .mu.M. At 0, 15, 30, 60, 90, and 120 min
time points, a 30 .mu.l aliquot was collected and mixed with 270
.mu.l acetonitrile solution for protein precipitation. After
centrifugation, the supernatant was analyzed by LC-MS/MS. In vitro
half-life of B32B3 in plasma was calculated using the slope (k) of
the log-linear regression from the concentration remaining parent
compound versus time.
T.sub.1/2=-ln 2/k
Mouse Pharmacokinetics of B32B3
[0190] Mouse pharmacokinetic study was carried out using mice (n=5)
that were fasted for 12 h prior to and 2 h after dosing with B32B3
(5 mg/kg). Blood samples were collected from orbital sinus at 10,
30, 60, 120, 240, and 480 min post dose. The plasma was separated
from blood samples by centrifugation and analyzed in the Agilent
1200 HPLC system coupled to Agilent 6460A QQQ mass
spectrophotometer. The plasma concentration-time data were analyzed
by noncompartmental analysis using WinNonlin version 4.1
(Pharsight).
[0191] It is to be understood that while the invention has been
described in conjunction with the above embodiments, that the
foregoing description and examples are intended to illustrate and
not limit the scope of the invention. Other aspects, advantages and
modifications within the scope of the invention will be apparent to
those skilled in the art to which the invention pertains.
[0192] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention belongs. All
nucleotide sequences provided herein are presented in the 5' to 3'
direction.
[0193] The inventions illustratively described herein may suitably
be practiced in the absence of any element or elements, limitation
or limitations, not specifically disclosed herein. Thus, for
example, the terms "comprising", "including," containing", etc.
shall be read expansively and without limitation. Additionally, the
terms and expressions employed herein have been used as terms of
description and not of limitation, and there is no intention in the
use of such terms and expressions of excluding any equivalents of
the features shown and described or portions thereof, but it is
recognized that various modifications are possible within the scope
of the invention claimed.
[0194] Thus, it should be understood that although the present
invention has been specifically disclosed by preferred embodiments
and optional features, modification, improvement and variation of
the inventions embodied therein herein disclosed may be resorted to
by those skilled in the art, and that such modifications,
improvements and variations are considered to be within the scope
of this invention. The materials, methods, and examples provided
here are representative of preferred embodiments, are exemplary,
and are not intended as limitations on the scope of the
invention.
[0195] The invention has been described broadly and generically
herein. Each of the narrower species and subgeneric groupings
falling within the generic disclosure also form part of the
invention. This includes the generic description of the invention
with a proviso or negative limitation removing any subject matter
from the genus, regardless of whether or not the excised material
is specifically recited herein.
[0196] In addition, where features or aspects of the invention are
described in terms of Markush groups, those skilled in the art will
recognize that the invention is also thereby described in terms of
any individual member or subgroup of members of the Markush
group.
TABLE-US-00003 TABLE 1 Immunohistochemical staining of VprBP and
H2A T120p in tissue microarray of human specimens, related to FIG.
2. VprBP H2A T120p No. Organ Pathology diagnosis Grade Stage
staining staining 1 Esophagus Squamous cell carcinoma 3 IIa 3/++
3/+ 2 Esophagus Squamous cell carcinoma 3 IIa 2/++ 2/+ 3 Esophagus
Adenocarcinoma 1 IIa 3/++ 3/++ 4 Esophagus Cancer adjacent normal
0/- 0/- esophagus tissue of No. 1 5 Esophagus Cancer adjacent
normal 0/+ 0/+ esophagus tissue 6 Esophagus Cancer adjacent normal
0/+ 0/- esophagus tissue (fibrous tissue and blood vessel) 7
Stomach Adenocarcinoma 3 Ib 1/++ 1/++ 8 Stomach Adenocarcinoma IIIa
1/+ 0/+ 9 Stomach Adenocarcinoma (stomach 2 IV 0/++ 1/++ tissue) 10
Stomach Cancer adjacent normal 0/+ 0/+ stomach tissue 11 Stomach
Cancer adjacent normal 0/+ 0/+ stomach tissue 12 Stomach Cancer
adjacent normal 0/+ 0/+ stomach tissue of No. 9 13 Colon
Adenocarcinoma 2 IIb 0/+ 0/+ 14 Colon Adenocarcinoma 2-3 IIa 2/++
3/+++ 15 Colon Mucinous Adenocarcinoma 3 III 2/+++ 3/+++ 16 Colon
Cancer adjacent normal colon 0/+ 0/+ tissue 17 Colon Cancer
adjacent normal colon 0/- 0/+ tissue of No. 15 18 Colon Cancer
adjacent normal colon 0/- 1/+ tissue 19 Rectum Adenocarcinoma 1 IIP
0/+ 0/+ 20 Rectum Adenocarcinoma 3 IIP 1/+ 1/+ 21 Rectum
Adenocarcinoma 3 III 0/- 0/- 22 Rectum Cancer adjacent normal
rectum 0/- 0/- tissue of No. 19 23 Rectum Cancer adjacent normal
rectum 0/+ 0/+ tissue of No. 20 24 Rectum Cancer adjacent normal
rectum 0/- 0/- tissue of No. 21 25 Liver Hepatocellular carcinoma 2
II 2/++ 2/++ 26 Liver Hepatocellular carcinoma 2 II 2/++ 2/++ 27
Liver Hepatocellular carcinoma 2 II 3/+++ 3/+++ 28 Liver Cancer
adjacent normal liver 0/+ 1/+ tissue 29 Liver Cancer adjacent
normal liver 1/+ 1/+ tissue 30 Liver Cancer adjacent normal liver
1/+ 1/+ tissue of No. 27 31 Lung Adenocarcinoma 2 II 3/+++ 3/+++ 32
Lung Adenocarcinoma 3 I 3/++ 3/++ 33 Lung Squamous cell carcinoma 3
I 3/++ 3/+++ 34 Lung Cancer adjacent normal lung 0/- 0/- tissue of
No. 31 35 Lung Cancer adjacent normal lung 0/- 0/+ tissue 36 Lung
Cancer adjacent normal lung 0/- 0/- tissue of No. 33 37 Kidney
Clear cell carcinoma 1 II 3/++ 3/++ 38 Kidney Clear cell carcinoma
(sparse) I 0/- 0/- 39 Kidney Clear cell carcinoma 1 I 1/+ 2/++ 40
Kidney Cancer adjacent normal kidney 0/- 0/- tissue 41 Kidney
Cancer adjacent normal kidney 0/- 0/- tissue of No. 39 42 Kidney
Cancer adjacent normal kidney 0/- 0/- tissue 43 Breast Invasive
ductal carcinoma 2 IIIb 2/+++ 2/+++ 44 Breast Invasive ductal
carcinoma 2 IIb 2/++ 2/++ 45 Breast Invasive ductal carcinoma 2
IIIb 2/++ 2/++ 46 Breast Cancer adjacent normal breast 0/- 0/-
tissue (fibrofatty tissue and blood vessel) of No. 43 47 Breast
Cancer adjacent normal breast 0/- 0/- tissue of No. 44 48 Breast
Cancer adjacent normal breast 0/- 0/+ tissue 49 Uterine Squamous
cell carcinoma 1 IIIa 3/+++ 2/++ cervix 50 Uterine Squamous cell
carcinoma 2 Ib 2/++ 2/++ cervix 51 Uterine Squamous cell carcinoma
1 Ib 2/++ 3/++ cervix 52 Uterus Cancer adjacent normal uterine 0/+
0/- cervix tissue 53 Uterus Cancer adjacent normal 0/- 0/- cervical
canal tissue 54 Uterus Cancer adjacent normal uterine 0/- 0/+
cervix tissue 55 Ovary Serous adenocarcinoma 3 I 2/+++ 2/++ 56
Ovary Serous papillary 2 Ia 2/++ 3/+++ adenocarcinoma 57 Ovary
Serous papillary 2 I 2/++ 2/++ adenocarcinoma 58 Ovary Cancer
adjacent normal ovary 0/- 0/+ tissue 59 Ovary Cancer adjacent
normal ovary 0/- 0/+ tissue 60 Ovary Cancer adjacent normal ovary
0/+ 0/+ tissue 61 Bladder Transitional cell carcinoma II 1/++ 1/++
(fibrous tissue and blood vessel) 62 Bladder Transitional cell
carcinoma 2 II 3/++ 2/++ 63 Bladder Transitional cell carcinoma 3
III 2/+++ 3/+++ 64 Bladder Cancer adjacent normal 0/- 0/+ bladder
tissue 65 Bladder Cancer adjacent normal 0/- 0/+ bladder tissue
(fibrous tissue and blood vessel) of No. 62 66 Bladder Cancer
adjacent normal 0/+ 0/+ bladder tissue 67 Lymph Diffuse B-cell
lymphoma of 1/+ 2/++ node left groin 68 Lymph Diffuse B-cell
lymphoma of 1/+ 1/+ node right submaxillary 69 Lymph Diffuse B-cell
lymphoma of 2/++ 1/+ node left groin 70 Lung Cancer adjacent normal
lymph 0/- 1/+ node tissue 71 Cardina Cancer adjacent normal lymph
0/+ 1/+ node tissue 72 Cardina Cancer adjacent normal lymph 1/+ 1/+
node tissue 73 Skin Squamous cell carcinoma 1 II 0/- 0/- 74 Skin
Squamous cell carcinoma 2 II 2/+++ 2/+++ 75 Skin Squamous cell
carcinoma 3 II 3/++ 2/++ 76 Skin Cancer adjacent normal skin 0/-
0/- tissue (sparse) 77 Skin Cancer adjacent normal skin 0/- 0/-
tissue of No. 74 78 Skin Cancer adjacent normal skin 0/- 0/- tissue
79 Cerebrum Astrocytoma (brain tissue) 0/- 0/- 80 Cerebrum
Astrocytoma 2 0/+ 1/+ 81 Cerebrum Astrocytoma 2 2/++ 2/++ 82
Cerebrum Cancer adjacent normal brain 0/- 0/- tissue 83 Cerebrum
Cancer adjacent normal brain 0/+ 0/+ tissue 84 Cerebrum Cancer
adjacent normal brain 0/- 0/- tissue 85 Prostate Adenocarcinoma 1
II 3/+++ 3/+++ 86 Prostate Adenocarcinoma 2 II 2/++ 2/++ 87
Prostate Adenocarcinoma 2-3 IV 2/++ 2/++ 88 Prostate Cancer
adjacent normal 0/- 0/+ prostate tissue 89 Prostate Cancer adjacent
normal 0/- 0/- prostate tissue 90 Prostate Cancer adjacent normal
0/- 0/- prostate tissue 91 Pancreas Adenocarcinoma 2 I 0/+ 1/+ 92
Pancreas Adenocarcinoma (fibrous I 0/+ 0/+ tissue) 93 Pancreas
Adenocarcinoma 3 II 0/+ 0/+ 94 Pancreas Cancer adjacent normal 0/+
0/+ pancreas tissue 95 Pancreas Cancer adjacent normal 0/+ 0/+
pancreas tissue of No. 92 96 Pancreas Cancer adjacent normal 0/+
0/+ pancreas tissue
TABLE-US-00004 TABLE 2 List of the genes upregulated in
VprBP-depleted DU145 cells, related to FIG. 3. Fold Fold Fold Probe
ID change Probe ID change Probe ID change LOC100008589 10.95621
SPNS2 2.36224 C14orf138 2.04492 IL11 8.49622 PPP1R15A 2.35618 MEPCE
2.04475 LOC100132564 5.57178 PPIF 2.34898 C1orf182 2.03745 RMRP
5.13069 TMEM156 2.34461 RNU1G2 2.02637 SCARNA18 4.73627 TOB1
2.34228 LOC100134364 2.02278 LOC100008588 4.61836 SNORD3D 2.34112
CIDECP 2.01347 CD24 4.18359 SFXN1 2.33802 NEXN 2.00898 SCARNA11
4.09227 NTN4 2.33693 SLC7A6 2.00493 LOC100133565 3.75485
LOC100132761 2.31059 PCGF6 2.00423 SLC22A18AS 3.6869 SOD2 2.30992
ACYP2 2.00084 Hs.543887 3.53457 DUSP5 2.27879 OPN3 1.9963 KIAA1644
3.46544 INA 2.27157 TJP2 1.99396 MIR1978 3.36967 RNU4ATAC 2.26518
SLC30A1 1.99278 NOV 3.20252 PIGW 2.24255 TRNP1 1.99278 SCARNA14
3.13199 SNORA79 2.24197 PSTK 1.99014 SCARNA8 3.08548 PTGES 2.23998
RNU1-3 1.98478 C6orf48 3.01226 LOC389286 2.22735 DPM2 1.98164
SCARNA16 3.01107 ATF5 2.21293 LOC653610 1.98004 CYP1B1 2.91347
AP1G2 2.20253 VGLL4 1.97867 CYP1A1 2.85512 APITD1 2.19888 PPP3CA
1.97129 BMF 2.84271 LOC645381 2.19595 S100A8 1.96175 TXNIP 2.81931
ITGB2 2.19175 DSTN 1.96022 KCNF1 2.78863 TMEM79 2.17597 ZNF185
1.95996 LOC100132240 2.78373 F3 2.17507 RIOK1 1.95656 UBC 2.75736
PMEPA1 2.15113 MIR1974 1.95551 IGFBP4 2.75471 RNU6ATAC 2.14132
BEND6 1.95473 LPAR1 2.71654 HPCAL1 2.13553 HERC4 1.95369 HIF1A
2.70422 DGCR14 2.12664 C12orf49 1.94948 PPAP2B 2.6787 LOC100132771
2.12214 TNFAIP2 1.94675 AMHR2 2.64693 KLRC3 2.12096 SOCS3 1.94608
RN7SK 2.63914 NCRNA00094 2.10456 DICER1 1.94387 SOCS2 2.62458
ZC3H14 2.10195 RNU1-5 1.94225 SIK1 2.61433 SLPI 2.10091 GEM 1.94147
SYDE1 2.60886 Hs.545589 2.10006 STX1A 1.93722 SCARNA23 2.55733
CCNJL 2.0949 C22orf13 1.93676 MICB 2.49549 C10orf140 2.0934 C1orf86
1.93647 SNORD3A 2.48247 LOC653354 2.08902 SMOX 1.93596 CFL2 2.46382
TNFRSF10D 2.08423 G0S2 1.93484 IL6R 2.44937 C3 2.07775 UCN 1.93312
LOC653879 2.44676 HAS3 2.07037 KGFLP1 1.93078 SNORD3C 2.44287 COX11
2.06194 LOC344887 1.92947 LOC441763 2.43446 ATP6V0E2 2.05825
LOC642118 1.9271 SLAIN1 2.43177 ICMT 2.0546 COTL1 1.92546 RCAN1
2.42618 SUSD2 2.05412 FOXE1 1.92539 RRAD 2.40797 F13A1 2.05061
Hs.575603 1.92446 PPAPDC1A 2.40078 STAG3L4 2.04663 REPIN1 1.92219
C9orf6 1.91099 OXTR 1.81509 RASD1 1.91895 NUP160 1.91023 IDS
1.81451 C19orf33 1.91508 LOC100133511 1.90821 UCRC 1.81374 PDE3B
1.75473 FAM46C 1.8969 RHOD 1.81198 CLCF1 1.75445 PHF14 1.89165
TNRC6B 1.81057 PPARG 1.75354 SH2D4A 1.89006 RAB23 1.81035 MCTP1
1.7522 RAB21 1.88609 ZFAND2A 1.80936 RAB30 1.75208 ST6GALNAC6
1.88472 TGFB2 1.80851 EIF6 1.7516 Hs.565887 1.88382 MORN2 1.80789
TSEN2 1.75139 HSD17B12 1.88248 LOC100130992 1.80648 CD7 1.7475
LOC113386 1.88008 LOC100129828 1.8052 TCF3 1.74646 TAF5L 1.87947
HNRPUL2 1.80508 USP12 1.7454 STIM2 1.87827 KIAA2010 1.80332 AGPAT5
1.74504 RNU6-15 1.87587 SPOCD1 1.80293 BEGAIN 1.74238 KIAA1683
1.87508 RNU4-2 1.8029 LOC728640 1.74212 TCTA 1.8746 BCL7B 1.79941
ODF2 1.74148 GPR137B 1.87293 FGF2 1.7985 MED1 1.74124 MPDU1 1.86958
CASD1 1.79472 HMOX1 1.73955 RNF7 1.86801 REEP3 1.79401 LOC645676
1.73679 CLDN15 1.86474 RCL1 1.78888 LOC339804 1.73625 RNU6-1
1.86224 HBEGF 1.78832 NKX3-1 1.73619 RNU1A3 1.86106 ZCWPW1 1.78801
TGM2 1.73592 ZC3H8 1.85225 CGGBP1 1.78799 MIB2 1.73494 PPARBP
1.85133 BRPF3 1.78795 HIST1H2BK 1.73493 KYNU 1.84888 GLCCI1 1.78469
Hs.556082 1.73316 AKIRIN1 1.84823 TOMM34 1.78467 ODC1 1.73164
MAPKAPK2 1.84637 BTBD7 1.78078 CCNYL1 1.73042 SMG7 1.84559 S100A13
1.77958 GTF2IRD2B 1.73017 RNY1 1.84555 FBXW2 1.77898 C21orf2
1.72741 Hs.534061 1.84254 PINK1 1.77891 Hs.568329 1.72736 DLK2
1.8403 RPL34 1.77762 DDX10 1.72735 TNFSF10 1.83912 TRIM44 1.77663
LGR4 1.72658 F8A1 1.83828 DYRK3 1.77298 OBFC2A 1.72458 SCML2
1.83782 DYSF 1.77256 KCMF1 1.72451 ISCA1 1.8371 IGF2BP3 1.77216
GPX1 1.72445 LOC401233 1.83563 CHN1 1.7721 BAD 1.72434 DNAJC25
1.8356 DPP9 1.76985 RNY4 1.72133 Hs.91389 1.83318 ARPC1A 1.76981
USP22 1.72014 GBP1 1.83181 CBLL1 1.76954 ZNHIT6 1.71805 KIAA1666
1.83127 PVT1 1.7684 LOC653450 1.71697 PPL 1.82944 PEF1 1.76753
IL1RL1 1.71563 LOC402617 1.82572 TMEM217 1.76675 Hs.540724 1.7147
SPNS2 1.82448 C6orf66 1.76323 KLK3 1.71446 KLF10 1.82281 H2AFY
1.76152 TMEM180 1.71051 FAM168B 1.82222 C9orf169 1.76142 HRB
1.70994 GLRX2 1.82176 LAT 1.76057 LOC387763 1.70986 LOC441481
1.82061 MAX 1.75785 C19orf48 1.70956 CPM 1.81512 CTRL 1.75487 AGFG1
1.70904 IL4R 1.70707 C1GALT1 1.70454 OAZ2 1.70851 REV3L 1.70646
RBKS 1.70249 ZNF219 1.70716 WNT7A 1.70604 LOC727945 1.70176 RNU4-1
1.70594 SCARNA20 1.70017
TABLE-US-00005 TABLE 3 List of the genes downregulated in
VprBP-depleted DU145 cells, related to FIG. 3. Probe ID Fold change
Probe ID Fold change Probe ID Fold change SNORD13 -4.76013 STMN3
-2.69955 VTA1 -2.36258 CYP24A1 -4.69112 HOMER2 -2.69622 PFKL
-2.35716 RASL10A -4.50653 VPRBP -2.69554 CA2 -2.35239 CCL20
-4.33102 FBXO4 -2.66715 SEPT5 -2.3515 IGFBP3 -4.12725 ADAM23
-2.66614 CBS -2.32465 LCN2 -3.99251 HLA-DOB -2.64214 DDIT4 -2.31864
SRPX -3.89196 PTPRE -2.63881 RIMS3 -2.31602 SYTL2 -3.72792 DDAH1
-2.62998 GNG4 -2.31208 ERLIN2 -3.708 SELM -2.61246 B4GALNT1
-2.31172 SPP1 -3.64917 CFD -2.61173 NMD3 -2.30645 OPLAH -3.56388
LOC730415 -2.60748 KCNQ2 -2.30063 TMEM145 -3.55171 MCOLN2 -2.60564
ECHDC3 -2.29554 HLA-DMA -3.54901 NICN1 -2.59474 MOSPD3 -2.29472
PCK2 -3.39215 SCNN1A -2.57872 AIF1L -2.29356 ANG -3.3747 CYP4F11
-2.56978 CRIP1 -2.28066 RNASE4 -3.34991 EFHD1 -2.56425 HSPA5
-2.26752 KIF1B -3.2912 DPYSL4 -2.54773 LTBP4 -2.26681 GALNTL1
-3.2398 RBP1 -2.54231 F12 -2.26624 ACCN2 -3.23115 WFDC3 -2.52798
KCNK15 -2.26529 MAP1LC3A -3.09754 STAT4 -2.51561 RDH10 -2.24289
LAMP3 -3.06117 BBS7 -2.51497 LEPREL2 -2.24037 KISS1R -3.01598 CBLC
-2.51361 PAQR8 -2.23745 DDIT4L -3.00965 CDC42EP5 -2.50702 TUBB2B
-2.2258 CLYBL -3.00486 EPHX2 -2.50536 CLDN7 -2.22503 H1FX -2.9432
NUDT18 -2.49831 SEZ6L2 -2.22419 PRPH -2.94106 PGM2L1 -2.48024
HLA-DRB1 -2.22167 GLO1 -2.94083 ULBP1 -2.47582 MXRA7 -2.21861 EGR1
-2.93183 ELOVL4 -2.46244 CYP26B1 -2.21718 PRODH -2.90908 ASNS
-2.46226 OXCT1 -2.21436 TMEM107 -2.88271 CMTM4 -2.45959 PLOD1
-2.20886 TMSB15A -2.86058 AHCTF1 -2.45763 TMEM45A -2.20746 FLJ20444
-2.8544 MAP4K1 -2.45566 SNX10 -2.2021 UPK1A -2.8322 FXYD6 -2.44858
S100A4 -2.19894 STS-1 -2.82727 TM7SF2 -2.43709 PIGZ -2.19516 LRRN2
-2.80333 COL6A1 -2.43078 WISP2 -2.193 PDIA4 -2.79743 MTX2 -2.41788
GNG7 -2.18561 GALC -2.77678 UBASH3B -2.40128 HSPB8 -2.15889 FUCA1
-2.75977 GOLSYN -2.39573 OSGIN2 -2.15606 TSTD1 -2.74491 H1F0
-2.39163 SLC2A3 -2.15503 CXorf61 -2.73964 MAPT -2.38724 MLLT11
-2.1339 RAB26 -2.73737 DHRS3 -2.37749 GNAI3 -2.13342 FGFBP1
-2.73291 MPZL2 -2.37523 CUGBP2 -2.13211 MGC39900 -2.72135 GXYLT1
-2.3664 JAZF1 -2.1315 HLA-DPA1 -2.71792 SGK -2.36494 ABHD1 -2.12012
CYP26A1 -2.70874 PARM1 -2.36369 SIRT4 -2.11814 SLC24A6 -2.70779
GRHPR -2.36322 N4BP1 -2.11786 CERCAM -2.10843 BDNF -1.79092 ROR1
-2.11773 FAM84B -2.10647 MAOA -1.79078 RDM1 -2.1113 ESPL1 -2.01313
DECR1 -1.73255 ZFC3H1 -1.85227 RPRML -2.00454 FKBP5 -1.73199 IDH1
-1.85147 NSL1 -2.00364 LRRC45 -1.73121 GJB2 -1.84965 SH3BGRL2
-2.00204 NRG4 -1.73096 ECM1 -1.82754 NDRG1 -2.00143 PYCR1 -1.73012
CRELD2 -1.8274 HES7 -2.00073 PQLC3 -1.72937 PLCG2 -1.82466 FEZ1
-1.99933 NES -1.71073 DNAJC4 -1.79501 FLJ22536 -1.99034 CYP4V2
-1.70899 CACNA2D2 -1.79385 MKRN1 -1.99011 TFPI -1.70884 RBP7
-1.79384 CHST13 -1.95803 WFDC2 -1.70331 CEP70 -1.79346 CENTA1
-1.95223 PRSS12 -1.70275 ACSM3 -1.79277 CXCL2 -1.93765 MAPK3
-1.70214 CTSH -1.79174 STRADB -1.9103 MOCOS -1.7021 CNTN1 -1.86233
NCAPG2 -1.91024 PPFIA4 -1.70174 SSH3 -1.86181 FBXO2 -1.90867 KDELR3
-1.70166 TCIRG1 -1.86102 RPS6KA5 -1.90636 RALBP1 -1.70153 CIB2
-1.86029 PKD2 -1.90543 ASNSD1 -1.7009 GLT25D2 -1.85831 SLC35C1
-1.90514 CXCL1 -1.70045 EFEMP2 -1.85527 ID2 -1.90325 ASNSD1 -1.7009
PALM -1.85364 NRBP2 -1.90295 CXCL1 -1.70045 MXD3 -1.85281 ZWILCH
-1.89623 CHST6 -1.89448 HMGCL -1.88948 FGFR3 -1.89613 THBS3
-1.89045 XPR1 -1.88925
TABLE-US-00006 TABLE 4 Inhibition of human kinases by B32B3,
related to FIG. 4. Kinase IC.sub.50 (.mu.M) Kinase IC.sub.50
(.mu.M) VprBP 0.6 DNAPK >10 AKT1 >10 DYRK1 >10 AKT3 >10
EEF2K >10 ATM >10 GSK3.beta. >10 ATR >10 HCK >10
AURKA >10 LCK >10 AURKB >10 PKM2 >10 BCK >10 PKN2
>10 BUB1 >10 PRKCD >10 CDK2 >10 PLK1 >10 CDK7 >10
PLK2 >10 CDK9 >10 RSK2 8.6 CDK18 >10 RSK3 >10 CHK1
>10 STK25 >10 CHK2 >10 STK33 >10 CSNK1D >10 SYK
>10 CSK1E >10 VRK2 >10
Sequence CWU 1
1
81121DNAHomo sapiens 1cgagaaactg agtcaaatga a 21219DNAHomo sapiens
2aatcacagag tatcttaga 19321DNAHomo sapiens 3cgaggttaat ccagcacgta t
21420PRTHomo sapiens 4Gln Pro Leu Arg Thr Tyr Ser Thr Gly Leu Leu
Gly Gly Ala Met Glu 1 5 10 15 Asn Gln Asp Ile 20 517PRTHomo sapiens
5Glu Val Ala Leu Arg Gln Glu Asn Lys Arg Pro Ser Pro Arg Lys Leu 1
5 10 15 Ser 639PRTHomo sapiens 6Asp Pro Asp Arg Met Phe Val Glu Leu
Ser Asn Ser Ser Trp Ser Glu 1 5 10 15 Met Ser Pro Trp Val Ile Gly
Thr Asn Tyr Thr Leu Tyr Pro Met Thr 20 25 30 Pro Ala Ile Glu Gln
Arg Leu 35 711PRTHomo sapiens 7Tyr Ile Asp Leu Lys Gln Thr Asn Asp
Val Leu 1 5 10 86PRTHomo sapiens 8Phe Ala Thr Glu Phe Val 1 5
99PRTHomo sapiens 9Lys Leu Leu Glu Ile Pro Arg Pro Ser 1 5
109PRTHomo sapiens 10Gln Asp Ala Met Glu Arg Val Cys Met 1 5
1132PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 11Gln Thr Ala Arg Lys Ser Thr Gly Gly Lys Ala
Pro Arg Lys Gln Leu 1 5 10 15 Ala Thr Lys Ala Ala Arg Lys Arg Lys
Lys Arg Arg Gln Arg Arg Arg 20 25 30 1223PRTHomo sapiens 12Gln Thr
Ala Arg Lys Ser Thr Gly Gly Lys Ala Pro Arg Lys Gln Leu 1 5 10 15
Ala Thr Lys Ala Ala Arg Lys 20 1320DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
13ctcagccgac ttcagctctt 201420DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 14agccagcatt gccataaaag
201520DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 15agaaaggcac ttggggtctt 201620DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
16tccgtgagct tgaggttctt 201720DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 17acgagctttt gtctccgaaa
201820DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 18acaccagaca gcatgagcag 201920DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
19gatccctttt gcagcttctg 202020DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 20tttggaccca ttggttttgt
202120DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 21aaaagaggca ccagaaggaa 202220DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
22gtccgcttat ccttgcacat 202320DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 23gccacctact gaaccctcct
202420DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 24acggtcttcc gacagagatg 202520DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
25ttcacagtgc tcctgcagtc 202620DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 26acggagttgc cacttgactt
202720DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 27ggtgaaaagg gaccagtgaa 202820DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
28tggagagctg gacactgatg 202920DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 29gcaccagtgt tgaagtgtgg
203020DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 30ggcatgcttg tcatctctca 203119DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
31gccctaagga gagcagcac 193220DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 32ttcgctgtag attggcactg
203320DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 33ctgctcatgc tgtctggtgt 203420DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
34agctgcagga gaagaggtca 203520DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 35tagcttgcac aaaccctgtg
203620DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 36tgtggttgca caatccctaa 203718DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
37gaaggtgccc agccagtg 183819DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 38gcctgctcta gccattgtg
193920DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 39caggactcca ttcctgtggt 204020DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
40ggtttcgtgc cttgttgagt 204119DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 41gaaacggggt tggctgtag
194220DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 42gtcgcaatac acaggcttca 204320DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
43atcctcgagg cttttgtgtg 204421DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 44tcccccgtta acgtttaatt t
214520DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 45aggatctggg gagaaagagc 204620DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
46gggtcatgag agaagggtca 204720DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 47ccggaaattc tctcctgcta
204819DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 48ggagagctcg aggtggaac 194919DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
49ctctcgtcgc gctttgtct 195019DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 50ggagcaggga gtccaagtc
195120DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 51atggtcaccc acagcaagtt 205220DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
52gctgcacatt ggactcaaaa 205320DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 53aaaattagct gggcatggtg
205420DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 54aacctccacc tcccagattc 205520DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
55gggacagttg caggttcaat 205620DNAArtificial SequenceDescription of
Artificial Sequence Synthetic primer 56ggagcactgt gaagatcacg
205720DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 57atccaaaggg actggagctt 205820DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
58gctgcacatt ggactcaaaa 20592PRTHomo sapiens 59Ser Gly 1
6014PRTHomo sapiens 60Lys Leu Val Arg Lys Ile Gly Ser Gly Ser Phe
Gly Asp Ile 1 5 10 6117PRTHomo sapiens 61Glu Val Ala Val His Leu
Glu Ser Gln Lys Ala Arg His Pro Gln Leu 1 5 10 15 Leu 622PRTHomo
sapiens 62Tyr Gly 1 6325PRTHomo sapiens 63Asp Tyr Asn Val Leu Val
Met Asp Leu Leu Gly Pro Ser Leu Glu Asp 1 5 10 15 Leu Phe Asn Phe
Cys Ser Arg Arg Phe 20 25 6411PRTHomo sapiens 64His Arg Asp Ile Lys
Pro Asp Asn Phe Leu Met 1 5 10 656PRTHomo sapiens 65Phe Leu Ile Asp
Phe Gly 1 5 668PRTHomo sapiens 66Pro Tyr Arg Glu Asp Lys Asn Leu 1
5 679PRTHomo sapiens 67Arg Asp Asp Met Glu Ser Leu Gly Tyr 1 5
6821PRTHomo sapiens 68Tyr Ile Pro Asp Lys Lys Leu Gly Lys Gly Gly
Phe Gly Gln Val Trp 1 5 10 15 Leu Gly Arg Arg Val 20 6919PRTHomo
sapiens 69Gln Val Ala Leu His Phe Glu His Lys Ser Ser Lys Gly Cys
Ala Ala 1 5 10 15 Gly Pro Pro 7025PRTHomo sapiens 70Asp Phe Tyr Ile
Met Val Met Asp Leu Leu Gly Pro Ser Leu Trp Asp 1 5 10 15 Val Trp
Asn Gln Gln Gly Gln Arg Leu 20 25 7111PRTHomo sapiens 71His Gly Asp
Ile Lys Pro Glu Asn Phe Leu Leu 1 5 10 726PRTHomo sapiens 72Tyr Leu
Val Asp Leu Gly 1 5 737PRTHomo sapiens 73Lys Tyr Asp Gln Arg Pro
Asp 1 5 749PRTHomo sapiens 74Arg Asp Asp Leu Glu Ser Leu Ala Tyr 1
5 755PRTHomo sapiens 75Ser Gly Arg Gly Lys 1 5 769PRTHomo sapiens
76Ala Lys Ala Lys Thr Arg Ser Ser Arg 1 5 775PRTHomo sapiens 77Thr
Ile Ala Gln Gly 1 5 7813PRTHomo sapiens 78Pro Lys Lys Thr Glu Ser
His His Lys Ala Lys Gly Lys 1 5 10 7927PRTHomo sapiens 79Ser Tyr
Asn Gln Gln Ala Met Glu Arg Val Cys Met Met Pro His Asn 1 5 10 15
Val Leu Ser Asp Val Val Asn Tyr Thr Leu Trp 20 25 8024PRTHomo
sapiens 80Gln Ser Arg Arg Asp Asp Met Glu Ser Lys Gly Tyr Val Leu
Met Tyr 1 5 10 15 Phe Asn Arg Thr Ser Leu Pro Trp 20 8124PRTHomo
sapiens 81Ser Ser Arg Arg Asp Asp Leu Glu Ser Leu Ala Tyr Thr Leu
Ile Phe 1 5 10 15 Leu Leu Lys Gly Arg Leu Pro Trp 20
* * * * *