U.S. patent application number 14/608493 was filed with the patent office on 2016-03-10 for polypeptides and immunizing compositions containing gram positive polypeptides and methods of use.
The applicant listed for this patent is EPITOPIX, LLC. Invention is credited to Daryll A. Emery, Lisa L. Herron-Olson, Darren E. Straub, Laura Wonderling.
Application Number | 20160068590 14/608493 |
Document ID | / |
Family ID | 36694403 |
Filed Date | 2016-03-10 |
United States Patent
Application |
20160068590 |
Kind Code |
A9 |
Emery; Daryll A. ; et
al. |
March 10, 2016 |
POLYPEPTIDES AND IMMUNIZING COMPOSITIONS CONTAINING GRAM POSITIVE
POLYPEPTIDES AND METHODS OF USE
Abstract
The present invention provides isolated polypeptides isolatable
from a Staphylococcus spp. Also provided by the present invention
are compositions that include one or more of the polypeptides, and
methods for making and methods for using the polypeptides.
Inventors: |
Emery; Daryll A.; (New
London, MN) ; Straub; Darren E.; (New London, MN)
; Herron-Olson; Lisa L.; (Minneapolis, MN) ;
Wonderling; Laura; (Des Moines, IA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
EPITOPIX, LLC |
Willmar |
MN |
US |
|
|
Prior
Publication: |
|
Document Identifier |
Publication Date |
|
US 20150210757 A1 |
July 30, 2015 |
|
|
Family ID: |
36694403 |
Appl. No.: |
14/608493 |
Filed: |
January 29, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13362992 |
Jan 31, 2012 |
8961979 |
|
|
14608493 |
|
|
|
|
12272021 |
Nov 17, 2008 |
8709760 |
|
|
13362992 |
|
|
|
|
11353459 |
Feb 14, 2006 |
8007811 |
|
|
12272021 |
|
|
|
|
60652843 |
Feb 14, 2005 |
|
|
|
Current U.S.
Class: |
424/139.1 ;
514/2.7 |
Current CPC
Class: |
C07K 16/1289 20130101;
C07K 2317/76 20130101; C07K 7/06 20130101; C07K 2317/34 20130101;
C07K 16/1285 20130101; C07K 2317/14 20130101; A61K 2039/505
20130101; A61K 38/00 20130101; A61K 39/085 20130101; A61K 39/00
20130101; Y10S 530/825 20130101; C07K 14/31 20130101; A61K 38/164
20130101; G01N 33/56938 20130101; A61P 31/04 20180101; A61K
2039/575 20130101; C07K 16/1271 20130101; C07K 7/08 20130101; C07K
16/1275 20130101 |
International
Class: |
C07K 16/12 20060101
C07K016/12; C07K 7/08 20060101 C07K007/08; C07K 14/31 20060101
C07K014/31; C07K 7/06 20060101 C07K007/06 |
Claims
1. A composition comprising: two isolated polypeptides having
molecular weights of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35
kDa, 33 kDa, or a combination thereof, wherein molecular weight is
determined by electrophoresis on a sodium dodecyl
sulfate-polyacrylamide gel, wherein the polypeptides are isolatable
from a Staphylococcus aureus when incubated in media comprising an
iron chelator and not isolatable when grown in the media without
the iron chelator, and wherein the composition protects an animal
against challenge with S. aureus ATCC strain 19636.
2-29. (canceled)
30. A method comprising: administering an effective amount of a
composition to a subject at risk of developing lesions caused by
infection by Staphylococcus aureus, the composition comprising: at
least five isolated polypeptides having molecular weights of 88
kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, or 33 kDa, wherein
molecular weight is determined by electrophoresis on a sodium
dodecyl sulfate-polyacrylamide gel; wherein the isolated
polypeptide having a molecular weight of 88 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 88 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:1, SEQ ID
NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID
NO:7, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID
NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ
ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:24,
SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID
NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:33,
and is expressed by Staphylococcus aureus ATCC strain 19636 at a
greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 55 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 55 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41,
SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID
NO:46, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ
ID NO:54, SEQ ID NO:57, SEQ ID NO:58, and SEQ ID NO:59, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 38
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 38 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:69,
SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:75, SEQ ID NO:76, and SEQ ID
NO:77, and is expressed by Staphylococcus aureus ATCC strain 19636
at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 37 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 37 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86,
SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID
NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:99, SEQ
ID NO:100, and SEQ ID NO:101, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; wherein the isolated polypeptide
having a molecular weight of 36 kDa comprises an amino acid
sequence having at least 95% identity to the amino acid sequence of
a reference polypeptide, wherein the reference polypeptide has a
molecular weight of 36 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:103, SEQ ID NO:104, SEQ ID
NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109,
and SEQ ID NO:110, and is expressed by Staphylococcus aureus ATCC
strain 19636 at a greater level when grown in medium comprising
1600 .mu.M 2,2-dipyridyl compared to when grown in the medium
without the 2,2-dipyridyl; wherein the isolated polypeptide having
a molecular weight of 35 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 35 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:112, SEQ ID NO:113, SEQ ID
NO:114, SEQ ID NO:115, SEQ ID NO:116, SEQ ID NO:117, SEQ ID NO:118,
SEQ ID NO:119, SEQ ID NO:120, SEQ ID NO:121, SEQ ID NO:122, SEQ ID
NO:123, and SEQ ID NO:124, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; and wherein the isolated
polypeptide having a molecular weight of 33 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 33 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:126, SEQ
ID NO:127, SEQ ID NO:128, SEQ ID NO:129, SEQ ID NO:130, SEQ ID
NO:131, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:135, SEQ ID NO:136,
SEQ ID NO:137, SEQ ID NO:138, SEQ ID NO:140, SEQ ID NO:142, and SEQ
ID NO:143, and is expressed by Staphylococcus aureus ATCC strain
19636 at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl.
31. The method of claim 30 wherein the subject is a mammal.
32. The method of claim 31 wherein the mammal is a human.
33. The method of claim 31 wherein the mammal is bovine, ovine,
porcine, caprine, cervine, bisontine, or equine.
34. The method of claim 30 wherein the subject is avian.
35. The method of claim 30 wherein the subject is a companion
animal.
36. The method of claim 30 wherein the composition is administered
prophylactically.
37. The method of claim 30 wherein an effective amount is an amount
effective to decrease the average size of lesions exhibited by the
subject compared to an untreated control.
38. The method of claim 30 wherein an effective amount is an amount
effective to decrease the number of lesions exhibited by the
subject compared to an untreated control.
39. The method of claim 30 wherein the lesion comprises a necrotic
skin lesion.
40. The method of claim 30 wherein the composition comprises the 88
kDa polypeptide, the 55 kDa polypeptide, the 38 kDa polypeptide,
the 37 kDa polypeptide, the 36 kDa polypeptide, the 35 kDa
polypeptide, and the 33 kDa polypeptide.
41. A method comprising: administering an effective amount of a
composition to a subject at risk of developing a post-surgical
wound infection caused by Staphylococcus aureus, the composition
comprising: at least isolated polypeptides having molecular weights
of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, or 33 kDa,
wherein molecular weight is determined by electrophoresis on a
sodium dodecyl sulfate-polyacrylamide gel; wherein the isolated
polypeptide having a molecular weight of 88 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 88 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:1, SEQ ID
NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID
NO:7, SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID
NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ
ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:24,
SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID
NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:33,
and is expressed by Staphylococcus aureus ATCC strain 19636 at a
greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 55 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 55 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41,
SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID
NO:46, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ
ID NO:54, SEQ ID NO:57, SEQ ID NO:58, and SEQ ID NO:59, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 38
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 38 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:69,
SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:75, SEQ ID NO:76, and SEQ ID
NO:77, and is expressed by Staphylococcus aureus ATCC strain 19636
at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 37 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 37 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86,
SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID
NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:99, SEQ
ID NO: 100, and SEQ ID NO: 101, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; wherein the isolated polypeptide
having a molecular weight of 36 kDa comprises an amino acid
sequence having at least 95% identity to the amino acid sequence of
a reference polypeptide, wherein the reference polypeptide has a
molecular weight of 36 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:103, SEQ ID NO:104, SEQ ID
NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109,
and SEQ ID NO:10, and is expressed by Staphylococcus aureus ATCC
strain 19636 at a greater level when grown in medium comprising
1600 .mu.M 2,2-dipyridyl compared to when grown in the medium
without the 2,2-dipyridyl; wherein the isolated polypeptide having
a molecular weight of 35 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 35 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:112, SEQ ID NO:113, SEQ ID
NO:114, SEQ ID NO:115, SEQ ID NO:116, SEQ ID NO:117, SEQ ID NO:118,
SEQ ID NO:119, SEQ ID NO:120, SEQ ID NO:121, SEQ ID NO:122, SEQ ID
NO:123, and SEQ ID NO:124, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; and wherein the isolated
polypeptide having a molecular weight of 33 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 33 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:126, SEQ
ID NO:127, SEQ ID NO:128, SEQ ID NO:7, SEQ ID NO:130, SEQ ID
NO:131, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:135, SEQ ID NO:136,
SEQ ID NO:137, SEQ ID NO:138, SEQ ID NO:140, SEQ ID NO:142, and SEQ
ID NO:143, and is expressed by Staphylococcus aureus ATCC strain
19636 at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl.
42. The method of claim 41 wherein the subject is a mammal.
43. The method of claim 42 wherein the mammal is a human.
44. The method of claim 42 wherein the mammal is bovine, ovine,
porcine, caprine, cervine, bisontine, or equine.
45. The method of claim 41 wherein the subject is avian.
46. The method of claim 41 wherein the subject is a companion
animal.
47. The method of claim 41 wherein the composition is administered
prophylactically.
48. The method of claim 41 wherein the composition comprises the 88
kDa polypeptide, the 55 kDa polypeptide, the 38 kDa polypeptide,
the 37 kDa polypeptide, the 36 kDa polypeptide, the 35 kDa
polypeptide, and the 33 kDa polypeptide.
49. A method comprising: administering an effective amount of a
composition to a subject at risk of developing lesions caused by
infection by Staphylococcus aureus, the composition comprising: a
combination of antibodies that specifically binds at least five
polypeptides having molecular weights of 88 kDa, 55 kDa, 38 kDa, 37
kDa, 36 kDa, 35 kDa, or 33 kDa, wherein molecular weight is
determined by electrophoresis on a sodium dodecyl
sulfate-polyacrylamide gel; wherein the isolated polypeptide having
a molecular weight of 88 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 88 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3,
SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:9,
SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID
NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:19, SEQ
ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25,
SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID
NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:33, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 55
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 55 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41,
SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID
NO:46, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ
ID NO:54, SEQ ID NO:57, SEQ ID NO:58, and SEQ ID NO:59, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 38
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 38 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:69,
SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:75, SEQ ID NO:76, and SEQ ID
NO:77, and is expressed by Staphylococcus aureus ATCC strain 19636
at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 37 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 37 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86,
SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID
NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:99, SEQ
ID NO:100, and SEQ ID NO: 101, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; wherein the isolated polypeptide
having a molecular weight of 36 kDa comprises an amino acid
sequence having at least 95% identity to the amino acid sequence of
a reference polypeptide, wherein the reference polypeptide has a
molecular weight of 36 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:103, SEQ ID NO:104, SEQ ID
NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109,
and SEQ ID NO:110, and is expressed by Staphylococcus aureus ATCC
strain 19636 at a greater level when grown in medium comprising
1600 .mu.M 2,2-dipyridyl compared to when grown in the medium
without the 2,2-dipyridyl; wherein the isolated polypeptide having
a molecular weight of 35 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 35 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:112, SEQ ID NO:113, SEQ ID
NO:114, SEQ ID NO:115, SEQ ID NO:116, SEQ ID NO:117, SEQ ID NO:118,
SEQ ID NO:119, SEQ ID NO:120, SEQ ID NO:121, SEQ ID NO:122, SEQ ID
NO:123, and SEQ ID NO:124, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; and wherein the isolated
polypeptide having a molecular weight of 33 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 33 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:126, SEQ
ID NO:127, SEQ ID NO:128, SEQ ID NO:129, SEQ ID NO:130, SEQ ID
NO:131, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:135, SEQ ID NO:136,
SEQ ID NO:137, SEQ ID NO:138, SEQ ID NO:140, SEQ ID NO:142, and SEQ
ID NO:143, and is expressed by Staphylococcus aureus ATCC strain
19636 at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl.
50. The method of claim 49 wherein the subject is a mammal.
51. The method of claim 50 wherein the mammal is a human.
52. The method of claim 50 wherein the mammal is bovine, ovine,
porcine, caprine, cervine, bisontine, or equine.
53. The method of claim 49 wherein the subject is avian.
54. The method of claim 49 wherein the subject is a companion
animal.
55. The method of claim 49 wherein the composition is administered
prophylactically.
56. The method of claim 49 wherein an effective amount is an amount
effective to decrease the average size of lesions exhibited by the
subject compared to an untreated control.
57. The method of claim 49 wherein an effective amount is an amount
effective to decrease the number of lesions exhibited by the
subject compared to an untreated control.
58. The method of claim 49 wherein the lesion comprises a necrotic
skin lesion.
59. The method of claim 49 wherein the combination of antibodies
comprises polyclonal antibody.
60. The method of claim 49 wherein the combination of antibodies
comprises a combination of monoclonal antibodies.
61. The method of claim 49 wherein the combination of antibodies
specifically binds the 88 kDa polypeptide, the 55 kDa polypeptide,
the 38 kDa polypeptide, the 37 kDa polypeptide, the 36 kDa
polypeptide, the 35 kDa polypeptide, and the 33 kDa
polypeptide.
62. A method comprising: administering an effective amount of a
composition to a subject at risk of developing a post-surgical
wound infection caused by Staphylococcus aureus, the composition
comprising: a combination of antibodies that specifically binds at
least five polypeptides having molecular weights of 88 kDa, 55 kDa,
38 kDa, 37 kDa, 36 kDa, 35 kDa, or 33 kDa, wherein molecular weight
is determined by electrophoresis on a sodium dodecyl
sulfate-polyacrylamide gel; wherein the isolated polypeptide having
a molecular weight of 88 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 88 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3,
SEQ ID NO:4, SEQ ID NO:5, SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:9,
SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID
NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:19, SEQ
ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:24, SEQ ID NO:25,
SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID
NO:30, SEQ ID NO:31, SEQ ID NO:32, and SEQ ID NO:33, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 55
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 55 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41,
SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID
NO:46, SEQ ID NO:49, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ
ID NO:54, SEQ ID NO:57, SEQ ID NO:58, and SEQ ID NO:59, and is
expressed by Staphylococcus aureus ATCC strain 19636 at a greater
level when grown in medium comprising 1600 .mu.M 2,2-dipyridyl
compared to when grown in the medium without the 2,2-dipyridyl;
wherein the isolated polypeptide having a molecular weight of 38
kDa comprises an amino acid sequence having at least 95% identity
to the amino acid sequence of a reference polypeptide, wherein the
reference polypeptide has a molecular weight of 38 kDa as
determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:68, SEQ ID NO:69,
SEQ ID NO:70, SEQ ID NO:72, SEQ ID NO:75, SEQ ID NO:76, and SEQ ID
NO:77, and is expressed by Staphylococcus aureus ATCC strain 19636
at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl; wherein the isolated polypeptide having a molecular
weight of 37 kDa comprises an amino acid sequence having at least
95% identity to the amino acid sequence of a reference polypeptide,
wherein the reference polypeptide has a molecular weight of 37 kDa
as determined by sodium dodecyl sulfate-polyacrylamide gel
electrophoresis, comprises the amino acid sequences depicted in SEQ
ID NO:80, SEQ ID NO:82, SEQ ID NO:84, SEQ ID NO:85, SEQ ID NO:86,
SEQ ID NO:87, SEQ ID NO:89, SEQ ID NO:90, SEQ ID NO:91, SEQ ID
NO:94, SEQ ID NO:95, SEQ ID NO:96, SEQ ID NO:97, SEQ ID NO:99, SEQ
ID NO:100, and SEQ ID NO:101, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; wherein the isolated polypeptide
having a molecular weight of 36 kDa comprises an amino acid
sequence having at least 95% identity to the amino acid sequence of
a reference polypeptide, wherein the reference polypeptide has a
molecular weight of 36 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:103, SEQ ID NO:104, SEQ ID
NO:105, SEQ ID NO:106, SEQ ID NO:107, SEQ ID NO:108, SEQ ID NO:109,
and SEQ ID NO:110, and is expressed by Staphylococcus aureus ATCC
strain 19636 at a greater level when grown in medium comprising
1600 .mu.M 2,2-dipyridyl compared to when grown in the medium
without the 2,2-dipyridyl; wherein the isolated polypeptide having
a molecular weight of 35 kDa comprises an amino acid sequence
having at least 95% identity to the amino acid sequence of a
reference polypeptide, wherein the reference polypeptide has a
molecular weight of 35 kDa as determined by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis, comprises the amino
acid sequences depicted in SEQ ID NO:112, SEQ ID NO:113, SEQ ID
NO:114, SEQ ID NO:115, SEQ ID NO:116, SEQ ID NO:117, SEQ ID NO:118,
SEQ ID NO:119, SEQ ID NO:120, SEQ ID NO:121, SEQ ID NO:122, SEQ ID
NO:123, and SEQ ID NO:124, and is expressed by Staphylococcus
aureus ATCC strain 19636 at a greater level when grown in medium
comprising 1600 .mu.M 2,2-dipyridyl compared to when grown in the
medium without the 2,2-dipyridyl; and wherein the isolated
polypeptide having a molecular weight of 33 kDa comprises an amino
acid sequence having at least 95% identity to the amino acid
sequence of a reference polypeptide, wherein the reference
polypeptide has a molecular weight of 33 kDa as determined by
sodium dodecyl sulfate-polyacrylamide gel electrophoresis,
comprises the amino acid sequences depicted in SEQ ID NO:126, SEQ
ID NO:127, SEQ ID NO:128, SEQ ID NO:129, SEQ ID NO:130, SEQ ID
NO:131, SEQ ID NO:132, SEQ ID NO:134, SEQ ID NO:135, SEQ ID NO:136,
SEQ ID NO:137, SEQ ID NO:138, SEQ ID NO:140, SEQ ID NO:142, and SEQ
ID NO:143, and is expressed by Staphylococcus aureus ATCC strain
19636 at a greater level when grown in medium comprising 1600 .mu.M
2,2-dipyridyl compared to when grown in the medium without the
2,2-dipyridyl.
63. The method of claim 62 wherein the subject is a mammal.
64. The method of claim 63 wherein the mammal is a human.
65. The method of claim 63 wherein the mammal is bovine, ovine,
porcine, caprine, cervine, bisontine, or equine.
66. The method of claim 62 wherein the subject is avian.
67. The method of claim 62 wherein the subject is a companion
animal.
68. The method of claim 62 wherein the composition is administered
prophylactically.
69. The method of claim 62 wherein the combination of antibodies
specifically binds the 88 kDa polypeptide, the 55 kDa polypeptide,
the 38 kDa polypeptide, the 37 kDa polypeptide, the 36 kDa
polypeptide, the 35 kDa polypeptide, and the 33 kDa
polypeptide.
70. The method of claim 62 wherein the combination of antibodies
comprises polyclonal antibody.
71. The method of claim 62 wherein the combination of antibodies
comprises a combination of monoclonal antibodies.
Description
CONTINUING APPLICATION DATA
[0001] This application claims the benefit of U.S. Provisional
Application Ser. No. 60/652,843, filed Feb. 14, 2005, which is
incorporated by reference herein.
BACKGROUND
[0002] Gram-positive bacteria are a remarkably diverse group of
organisms that cause a variety of diseases in both humans and
animals. Some of the pathogens recognized as important in human
and/or animal health include bacteria belonging to the families of
Corynebacteriaceae, Enterococcacae, Micrococcaceae,
Mycobacteriaceae, Nocardiaceae, and Peptococcaceae, which include
such bacterial species as Actinomyces spp., Bifidobacterium spp.,
Corynebacterium spp., Enterococcus spp., Erysipelothrix spp.,
Eubacterium spp., Kytococcus spp., Lactobacillus spp., Micrococcus
spp., Mobiluncus spp., Mycobacteria spp., Peptostreptococcus spp.,
Propionibacterium spp., and Staphylococcus spp. These pathogens
cause a multitude of clinical manifestations in many different
animal species. The treatment for such infections has historically
been antibiotics that attack the common structures and functions of
gram-positive organisms. However, many of the more ubiquitous
gram-positive organisms have developed resistance to several
classes of antibiotics, making treatment of infections difficult.
The widespread use of antibiotics in the treatment of bacterial
diseases in both humans and food production animals is likely a
major contributing factor in the proliferation of
antibiotic-resistant strains of many species of gram-positive
organisms. Therefore, there is a great need to find different
treatments that prevent or eliminate infections by gram-positive
organisms in animals as well as humans.
Staphylococcal Infections in Agricultural Animals
[0003] In the agricultural industry a number of important diseases
are caused by gram-positive organisms. Examples of clinical
conditions caused by gram positive bacterial infections include,
mastitis, septicemia, pneumonia, osteomyelitis,
meningoencephalitis, lymphangitis, dermatitis, genital tract
infections, metritis, perinatal disease, pituitary abscesses,
arthritis, bursitis, orchitis, cystitis and pyelonephritis, caseous
lymphadenitis, tuberculosis, ulcerative lymphangitis, erysipelas,
laminitis, tyzzer's disease, tetanus, botulism, enteritis,
malignant edema, braxy, bacillary hemoglobinuria, enterotoxemia.
Staphylococcus spp., in particular, are capable of infecting many
different species of agricultural animals and can cause enormous
economic losses. For example, the United States dairy industry is
estimated to lose approximately $185 per coa annually due to
mastitis, a disease often caused by Staphylococcus aureus. Since
there are 9.5 million head of milking cows in the U.S., the annual
cost of mastitis is approximately $1.8 billion. This is
approximately 10% of the total value of farm milk sales, and about
two-thirds of this loss is due to reduced milk production in
sub-clinically infected cows. Other losses are due to discarded
abnormal milk and milk withheld from cows treated with antibiotic,
costs of early replacement of affected cows, reduced sale value of
culled cows, costs of drugs and veterinary services, and increased
labor costs. In addition to its prevalence within the bovine dairy
industry, mastitis caused by gram-positive cocci is also common
among goats and sheep. Additional animal diseases caused by S.
aureus include botryomycosis in horses, purulent synovitis and
osteomyelitis in poultry, snuffles in rabbits, abortions in swine,
and tick pyemia in lambs. Other species of staphylococci are major
skin pathogens of canine (S. intermedius) and swine (S. hycius). In
poultry species, staphylococcal pathogens cause endorcarditis and
septicemia.
Staphylococcal Infections in Humans
[0004] Staphylococcus spp. are also human pathogem causing a wide
variety of infections. Use species Staphylococcus aureus, a common
colonizer of human mucosa and skin, is an opportunistic pathogen
that can cause diverse human infectious. For example, S. aureus is
the causative agent of several skin infections, including impetigo,
furunculosis, cellulitus, and scalded skin syndrome, as well as
potentially fatal post-surgical wound infections. In addition, the
exposure of immunocompromised individuals to S. aureus in hospital
setings has resulted in organ infections such as pneumonia, urinary
tract infections, osteomyelitis, arthritis, bacteremia, and
endocarditis. S. aureus is also the causative agent of toxinoses,
most notably toxic shock syndrome and food poisoniog. Food
poisoning caused by the staphylococcal enterotoxtn B is the most
common cause of food-borne illness, surpassing even salmonellosis,
campylobacteriosis and listeriosis. Other species of staphylococci
also cause human disease; S. epidermidis, S. haemolyticus and S.
hominis commonly infect implanted medical devices and S.
saprophyticus is associated with urinary tract infections is
women.
Virulence Mechanisms of Staphylococci
[0005] Staphylococci infect a variety of host tissues and evade the
immune system through the production of several types of secreted
proteins, surface expressed virulence factors and metabolic systems
designed for survival amidst the limited resources and active
defenses associated with the host environment. Colonization is the
necessary first step in establishing infection; numerous factors
including capsule, lipoteichoic acid, and teichoicc acid are common
structural components contributing to colonization. In addition,
surface proteins such as staphylococcal fibronectin-binding protein
and bone-sialoprotein binding proteins specifically bind host
tissue components. Toxins are commmonly produced among
staphylococcal pathogens and are highly damaging; several human
diseases, including food poisoning, toxic shock syndrome and
exfoliative skin conditions, are the direct result of extracellular
secreted toxix proteins. A single isolate may encode genes for
20-30 different secreted toxins. Some of the secreted protein
products are superantigens that can bind nonspecifically to the MHC
class II molecule of an antigen-presenting cell and,
simultaneously, to the T-cell receptor of a T cell. The binding
induces T cell signaling and leads to the release of high levels of
proinflammatory factors, ultimately inducing host damage due to the
overwhelming immune response. Another class of virulence factors
expressed on the surface disguise the bacteria from the host immune
system. For example, the S. aureus surface-expressed Protein A
inhibits opsonization and phagocytosis by binding of the Fc
component of host antibody. Numerous proteases, hemolysins (alpha,
beta, gamma and delta), nucleases, lipases, hyaluronidase, and
collagenase also aid bacteria in extracting nutrients from
surrounding cells and protecting them against host defenses.
Antibiotic Resistance Among Staphylococci
[0006] The CDC estimates that each year nearly 2 million people in
the United States acquire a nosocomial infection, resulting in
90,000 deaths annually. Of these fatal infections, 70% are caused
by antibiotic-resistant bacteria. The increase in
antibiotic-resistance among microbial species is particularly
pronounced in skin and mucosal colonizers such as S. aureus. For
example, the vast majority of S. aureus isolated from hospital
settings are resistant to penicillin, and 50% are also resistant to
the semisynthetic pencillins, such as methicillin, nafcillin, and
oxacillin. These isolates, referred to as MRSA (methicillin
resistant S. aureus) were first seen in the 1970s, and are now
firmly established in hospital settings. Recently there have been
several cases of MRSA infections in the community, where the
infected individuals had no previous exposure to hospitals or
healthcare workers. This alarming trend is intensified by the
isolation of MRSA isolates that are less susceptible to vancomycin,
a glycopeptide used to treat MRSA. Very few strains have been shown
to be truly resistant to vancomycin according to the CDC's
definition of vancomycin resistance, but several MRSA strains have
been characterized as consisting of subpopulations with reduced
susceptibility to vancomycin, or VISA (vancomycin intermediate S.
aureus). Since the isolation of vancomycin resistant and vancomycin
intermediate strains is a relatively new development, there is
little data concerning their prevalence in hospitals and/or the
community. Occasionally, VRSA (vancomycin resistant S. aureus) with
full resistance to vancomycin and carrying a resistance plasmid
likely acquired from Enterococcus spp. have also been recovered
from humans.
Strategies for the Prevention and Treatment of Staphylococcus
Infections
[0007] The emergence of numerous gram-positive pathogens that are
resistant to multiple antibiotics has fueled research efforts aimed
at developing preventative vaccines to protect against disease.
Vaccines are designed to be administered to patients in order to
elicit a long-term memory response from the immune system, so that
if the pathogen is encountered at a future time, the immune system
can more quickly and efficiently clear the pathogen. To date, a
broadly-protective vaccine against gram-positive pathogens
associated with a number of severe human diseases, particularly
those disease associated with staphylococcal infections, is not
available. Vaccine development approaches for the prevention of
staphylococcal infections include those reporting the use of
microbial surface components recognizing adhesion matrix molecules
[MSCRAMMS (Nilsson et al. 1998. J Clin Invest 101:2640-9; Menzies
et al. 2002. J Infect Dis 185:937-43; Fattom et al. 2004. Vaccine
22:880-7], surface polysaccharides (McKenney et al. 2000; McKenney
et al. 1999. Science 284:1523-7; Maira-Litran et al. 2002. Infect
Immun 70:4433-40; Maira-Litran et al. 2004. Vaccine 22:872-9;
Maira-Litran et al. 2005 Infect Immun 73:6752-62) and mutated
exoproteins (Lowell et al. 1996. Infect Immun 64:4686-93; Stiles et
al. 2001. Infect Immun 69:2031-6; Gampfer et al. 2002. Vaccine
20:3675-84), as antigens in subunit vaccine compositions, as well
as one live avirulent strain (Reinoso et al. 2002. Can J Vet Res
66:285-8) and several DNA vaccine approaches (Ohwada et al. 1999. J
Antimocrob Chemother 44:767-74); Brouillette et al. 2002. Vaccine
20:2348-57; Senna et al. 2003. Vaccine 21:2661-6). Although many of
these compositions have shown some degree of protection, they have
achieved little cross-protection against diverse staphylococcal
strains and have additionally failed to elicit substantial immune
responses in immunocompromised patients, an important at-risk
population for nosocomial infections.
[0008] The most severe staphylococcal diseases are those mediated
by the aforementioned supermantigenic pyrogenic exotoxins (SPEs)
that nonspecifically stimulate T-cells independent of antigen
presentation. Such diseases include toxic shock syndrome,
exfoliative skin disease, and possibly Kawasaki syndrome. For these
SPE-mediated diseases, immunotherapentic agents that boost the
immune system during an active infection are often more effective
than vaccines, which are typically administered prior to injection.
The overwhelming nature of the immune response to SPE necessitates
rapid reduction in toxin activity as the first objective in
therapy. To date, toxin neutralisation in S. aureus-mediated
disease has been most effectively accomplished by the
administration of intravenous human immunoglobulin (IVJG), a
purified, concentrated human antibody preparation from several
thousand human donors (Takei et al. 1993. J Clin Invest 91:602-7;
Stohl and Elliot. 1996, Clin Immunol Immunopathol 79:122-33). The
widespread distribution of S. aureus, which colonises approximately
30% of healthy human adults, coincides with high exposure rates for
the majority of the population, so the level of anti-staphylococcal
anti-toxin antibodies in IVIG is often sufficient to neutralize
toxin long enough to stabilize the immune response until the
bacterial load is reduced with antibiotics (Schlievert, 2001. J
Allergy Clin Immunol 108(4 Suppl):S107-110). IVIG preparations from
multiple manufacturers have been shown to neutralize toxin in
proliferation assays with human peripheral blood mononuclear cells,
inhibit toxin-induced human T cell-driven B cell differentiation in
vitro (Stohl and Elliot. 1996. Clin Immunol Immunopathol 79:122-33;
Stohl and Elliott. 1995. J Immunol 155:1838-50; Stohl et al 1994. J
Immunol 353:117-27) and reduce IL-4 and IL-2 secretion in PBMCs
stimulated with staphylococcal enterotoxin B (Takei et al 1993. J
Clin Invest 91:602-7; Darenberg et al. 2004. Clin Infect Dis
38:836-42). IVIG therapy, with its proven ability to neutralize
SPE, is now a recommended therapy for Kawasaki syndrome and is
gaining favor as a treatment method for staphylococcal toxic shock
syndrome (Schlievert 2001. J Allergy Clin Immunol 108(4
Suppl):S107-110). Use of IVIG as an immunoprotective wound lavage
during surgery has also been investigated in mice (Poelstra et al.
2000. Tissue Eng 6(4:401-411). Although standard IVIG has utility
for limiting the advance of some staphylococcal SPE-mediated
disease, the safety, efficacy and consistency of human IVIG
preparations generated from thousands of unselected human donors
remains controversial (Baker et al. 1992. N Engl J Med 327:213-9;
Miller et al. 2001. J Allergy Clin Immunol 108:S91-4; Sacher, 2001.
J Allergy Clin Immunol 108:S139-46; Darenberg et al. 2004. Clin
Infect Dis 38:836-42). Furthermore, the benefit of IVIG in
preventing some staphylococcal infections is doubtful (Baker et al.
1992. N Engl J Med 327:213-9; Hill, H. R. 2000. J Pediatr
137:595-7; Darenberg et al. 2004. Clin Infect Dis 38:836-42). In
order to increase the effectiveness of IVIG in treating
staphylococcal infections in certain at-risk populations, a
plasma-derived, donor-selected, polyclonal anti-staphylococcal
human IgG with high titers of antibody directed toward the
staphylococcal MSCRAMMS clumping factor A (ClfA) and
fibrinogen-binding protein G (SdrG) was created and tested with
success in very low birthweight infants to prevent stephylococcal
sepsis (Vernachio et al. 2003. Antimicrob Agents Chemother
47:3400-6; Bloom et al. 2005. Pediatr Infect Dis J 24:858-866;
Capparelli et al. 2005. Antimicrob Agents Chemother 49:4121-7). A
specific humanized monoclonal antibody toward the S. aureus MSCRAMM
Clumping factor A, is also being developed. The antibody was
selected from a pool of thousands of murine anti-ClfA antibodies
for its ability to bind ClfA in a manner that abrogates S. aureus
binding to human fibronectin and was subsequently humanized by
mutating specific targeted residues to mimic the homologous human
germline subgroup antibody (Hall et al. 2003. Infect Immun
71:6864-70; Domanski et al. 2005. Infect Immun 73:5229-32). The
specific antibody is being designed for use in conjunction with
antibiotics for the treatment of severe life-threatening S. aureus
infection, although animal studies also demonstrated a prophylactic
protective effect.
SUMMARY
[0009] The present invention provides compositions including two or
more isolated polypeptides. The two isolated polypeptides may have
a molecular weight of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35
kDa, 33 kDa, or a combination thereof. For instance, a composition
xmy include isolated proteins of 88 kDa and 35 kDa. In some aspects
the composition may include isolated polypeptides having moleular
weights of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, and 33
kDa. The molecular weight is determined by electrophoresis on a
sodium dodecyl sulfate-polyacrylamide gel. The polypeptides are
isolatable from a Staphylococcus aureus when incubated in media
including an iron chelator and not isolatable when grown in the
media without the iron chelator. The compositions protects an
animal, such as a mouse or cow or human, against challenge with an
S. aureus strain, for instance ATCC strain 19636. The composition
may further include a pharmaceutically acceptable carrier, and may
further include an isolated polypeptide having a molecular weight
of 150 kDa, 132 kDa 120 kDa, 75 kDa, 58 kDa, 50 kDa, 44 kDa, 43
kDa, 41 kDa, 40 kDa, or a combination thereof, and isolatable from
a S. aureus when grown in the media without the iron chelator. In
some aspects the polypeptides of the composition may be isolated
from S. aureus ATCC strain 19636.
[0010] The present invention also provides methods for using the
compositions. In one aspect the method is for treating in infection
in a subject, and includes administering an effective amount of a
composition of the present invention to a subject having or at risk
of having an infection caused by a Staphylococcus spp. In another
aspect, the method is for treating a symptom in a subject, and it
includes administering an effective amount of a composition of the
present invention to a subject having an infection caused by a
Staphylococcus spp. The subject may be a mammal, such as a human,
horse or cow. The Staphylococcus spp, may be S. aureus.
[0011] The present invention further provides methods for using
antibody, for instance, polyclonal antibody, that specifically
binds poiypephdes of the present invention. In one aspect, the
method is for treating an infection in a subject, and includes
administering an effective amount of a composition to a subject
having or at risk of having an infection caused by a Staphylococcus
spp., wherein the composition includes antibody that specifically
binds two isolated polypeptides of the present invention. In
another aspect, the method is for treating a symptom in a subject,
and includes administering an effective amount of a composition to
a subject having an infection caused by a Staphylococcus spp.,
wherein the composition includes antibody that specifically binds
two isolated polypeptides of the present invention. The subject may
be a mammal, such as a human, horse, or cow. The Staphylococcus
spp. may be S. aureus.
[0012] Also provided by tire present invention are methods for
decreasing colonization in a subject. In one aspect, the method
includes administering an effective amount of a composition of the
present invention to a subject colonized by a Staphylococcus spp.
In another aspect, the method includes administering an effective
amount of a composition to a subject colonized by Staphylococcus
spp., wherein the composition includes antibody that specifically
binds two isolated polypeptides of the present invention.
[0013] The present invention provides a kit for detecting antibody
that specifically binds a polypeptide. The kit includes, in
separate containers, an isolated polypeptide of the present
invention, and a reagent that detects an antibody that specifically
binds the polypeptide.
[0014] The present invention further provides a composition
including two isolated polypeptides having molecular weights
selected from 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, and
33 kDa, wherein molecular weight is determined by electrophoresis
on a sodium dodecyl sulfate-polyacrylamide gel. Each polypeptide of
the composition has a mass fingerprint of at least 80% similarity
to a mass fingerprint of a polypeptide of the same molecular weight
polypeptide expressed by Staphylococcus aureus ATCC strain 19636,
wherein the polypeptide is isolatable from a Staphyhcoccus aureus
when incubated in media comprising an iron chelator and not
isolatable when grown is the media without the iron chelator. For
instance, the isolated polypeptide with a molecalar weight of 88
kDa has a mass fingerprint of at least 80% similarity to a mass
fingerprint of a 88 kDa polypeptide expressed by Staphylococcus
aureus ATCC strain 19636, and the isolated polypeptide with a
molecular weight of 55 kDa has a mass fingerprint of at least 80%
similarity to a mass fingerprint of a 55 kDa polypeptide expressed
by Staphylococcus aureus ATCC strain 19636.
BRIEF DESCRIPTION OP THE FIGURES
[0015] FIG. 1 The electrophoretic profile of the proteins of
different strains Staphylococcus aureus derived from different
species grown with and without iron (lanes marked Fe++ and DP,
respectively).
[0016] FIG. 2. The difference in mortality between vaccinated and
non-vaccinated mice after homologous and heterologoas challenge
with Staphylococcus aureus.
[0017] FIG. 3. Kaplan-Meier survival curve showing percent survival
after vaccination and homologous challenge with S. aureus ATCC
19636.
[0018] FIG. 4. Kaplan-Meier survival curve showing percent survival
after vaccination and heterologous challenge with S. aureus ATCC
19636.
[0019] FIG. 5. The Kaplan-Meier survival curve showing percent
survival after passive immunization and homologous challenge with
S. aureus ATCC 19636.
[0020] FIG. 6. The Kaplan-Meier survival curve showing percent
survival after passive immunisation and heterologous challenge with
S. aureus strain 1477.
DETAILED DESCRIPTION OF PREFERRED EMBODIMENTS OF THE INVENTION
[0021] The present invention provides polypeptides and compositions
including polypeptides. As used herein, "polypeptide" refers to a
polymer of amino acids linked by peptide bonds. Thus, for example,
the terms peptide, oligopeptide, protein, and enzyme are included
within the definition of polypeptide. This term also includes
post-expression modifications of the polypeptide, such as
glycosylations, acetylations, phosphorylations, and the like. The
term polypeptide does not connote a specific length of a polymer of
amino acids. A polypeptide may be isolatable directly from a
natural source, or can be prepared with the aid of recombinant,
enzymatic, or chemical techniques. In the case of a polypeptide
that is naturally occurring, such a polypeptide is typically
isolated. An "isolated" polypeptide is one that has been removed
from its natural environment. For instance, an isolated polypeptide
is a polypeptide that has been removed from the cytoplasm or from
the membrane of a cell, and many of the polypeptides, nucleic
acids, and other cellular material of its natural environment are
no longer psesent. An "isolatable" polypeptide is a polypeptide
that could be isolated from a particular source. A "purified"
polypeptide is one that is at least 60% free, preferably at least
75% free, and most preferably at least 90% free from other
components with which they are naturally associated. Polypeptides
that are produced outside the organism in which they naturally
occur, e.g., through chemical or recombinant means, are considered
to be isolated and purified by definition, since they were never
present in a natural environment. As used herein, a "polypeptide
fragment" refers to a portion of a polypeptide that results from
digestion of a polypeptide with a protease. Unless otherwise
specified, "a," "an," "the," and "at least one" are used
interchangeably and mean one or more than one. The terms
"comprises" and variation thereof do not have a limiting mailing
where these terms appear in the description and claims.
[0022] A polypeptide of the present invention may be characterized
by molecular weight, mass fingerprint, or the combination thereof.
The molecular weight of a polypeptide, typically expressed in
kilodaltons (kDa), can be determined using routine methods
including, for instance, gel filtration, gel electrophoresis
including sodium dodecyl sulfate (SDS) polyacrylamide gel
electrophoresis (PAGE), capillary electrophoresis, mass
spectrometry, and liquid, chromatography including HPLC.
Preferably, molecalar weight is determined by resolving a
polypeptide using an SDS polyacrylamide gel having a stacking gel
of about 4% and a resolving gel of about 10% and/or reducing and
denaturing conditions. Unless indicated otherwise, molecular weight
refers to molecular weight as determined by SDS-PAGE. As used
herein, a "mass fingerprint" refers to a population of polypeptide
fragments obtained from a polypeptide after digestion with
protease. Typically, the polypeptide fragments resulting from a
digestion are analysed using a mass spectrometric method. Each
polypeptide fragment is characteriaed by a mass, or by a mass (m)
to charge (z) ratio, which is referred to as an "m/z ratio" or an
"m/z value". Methods for generating a mass fingerprint of a
polypeptide are routine. An example of such a method is disclosed
in Example 13.
[0023] Polypeptides of the present invention may be metal regulated
polypeptides. As used herein, a "metal regulated polypeptide" is a
polypeptide that is expressed by a microbe at a greater levels when
the microbe is grown in low metal condidoos compared to growth of
the same microbe in high metal conditions. Low metal and high metal
conditions are described herein. For instance, one class of metal
regulated polypeptide produced by Staphylococcus spp. not expressed
at detectable levels during growth of the microbe in high metal
conditions but is expressed at detectable levels during growth in
low metal conditions. Examples of such metal regulated polypeptides
isolatable from S. aureus after growth in low iron conditions have
molecular weights of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35
kDa, and 33 kDa. Examples of such metal regulated polypeptides
isolatable from S. aureus after growth in low zinc or low copper
conditions have molecular weights of 115 kDa, 88 kDa, 80 kDa, 71
kDa, 69 kDa, 35 kDa, 30 kDa, 29 kDa, and 27 kDa.
[0024] The present invention also includes polypeptides that are
not metal regulated. Such polypeptides are expressed in the
presence of a metal ion such as ferric chloride, and also expressed
when grown in low iron conditions. Examples of such polypeptides
isolatabie from S. aureus have molecular weights of 150 kDa, 132
kDa, 120 kDa, 75 kDa, 58 kDa, 50 kDa, 44 kDa, 43 kDa, 41 kDa, and
40 kDa.
[0025] Whether a polypeptide is a metal regulated polypeptide or
not can be determined by methods useful for comparing the presence
of polypeptides, including, for example, gel filtration, gel
electrophoresis including sodium dodecyl sulfate-polyacrylamide gel
electrophoresis (SDS-PAGE), capillary electrophoresis, mass
spectrometry, and liquid chromatography including HPLC. Separate
cultures of a microbe are grown under high metal conditions and
under low metal conditions, polypeptides of the present invention
are isolated as described herein, and the polypeptides present in
each culture are resolved and compared. Typically, an equal amount
of polypeptides from each culture is used. Preferably, the
polypeptides are resolved using an SDS polyacrylamide get having a
stacking gel of about 4% and a resolving gel of about 10% under
reducing and denaturing conditions. For instance, 30 micrograms
(.mu.g) of total polypeptide from each culture may be used and
loaded into wells of a gel. After running the gel and staining the
polypeptides with Coomasie Brilliant Blue, the two lanes can be
compared. When determining whether a polypeptide is or is not
expressed at a detectable level, 30 .mu.g of total polypeptide from
a culture is resolved on an SDS-PAGE gel and stained with Coomasie
Brilliant Blue using methods knows in the art. A polypeptide that
can be visualised by eye is considered to be expressed at a
detectable level, while a polypeptide that cannot be visualized by
eye is considered to not be expressed at a detectable level.
[0026] Polypeptides of the present indention may have immunogenic
activity. "Immunogenic activity" refers to the ability of a
polypeptide to elicit an mumnological response in an animal. An
immunological response to a polypeptide is the development in an
animal of a cellular and/or antibody-mediated immune response to
the polypeptide. Usually, an immunological response includes but is
not limited to one or more of the following effects: the production
of antibodies, B cells, helper T cells, suppressor T cells, and/or
cytotoxic T cells, directed to an epitope or epitopes of the
polypeptide. "Epitope" relets to the site on an antigen to which
specific B cells and/or T cells respond so that antibody is
produced. The immunogenic activity may be protective. "Protective
immunogenic activity" refers to the ability of a polypeptide to
elicit an immunological response in an animal that prevents or
inhibits infection by Staphylococcus spp., for instance, S. aureus.
Whether a polypeptide has protective immunogenic activity can be
determined by methods known in the art, for instance as described
is Examples 5, 9, or 12. For example, a polypeptide of the present
invention, or combination of polypeptides of the present invention,
protect a rodent such as a mouse against challenge with a
Staphylococcus spp. A polypeptide of the present invention may have
seronctive activity. "Seroactive activity" refers to the ability of
a candidate polypeptide to react with antibody present in
convalescent serum from an animal infected with a Staphylococcus
spp., for instance, S. aureus. In some aspects, the convalescent
serum may be from an animal infected with the ATCC isolate 19636,
strain SAAV1, strain 2176, or strain 1477. Polypeptides of the
present invention may have immunoregulatory activity.
"Immunoregulatory activity" refers to the ability of a polypeptide
to act in a nonspecific manner to enhance an immune response to a
particular antigen. Methods for determining whether a polypeptide
has immunoregulatory activity are known in the art.
[0027] A polypeptide of the present invention may have the
characteristics of a polypeptide expressed by a reference microbe.
The characteristics can include both molecular weight and mass
fingerprint. The reference microbe can be a gram positive,
preferably a member of the family Micrococcaceae, preferably,
Staphylococcus spp., more preferably, Staphylococcus aureus.
Preferred examples of strain are detailed in Table 1.
TABLE-US-00001 TABLE 1 Bacterial strains. Bacterial cell Laboratory
designation S. aureus ATCC isolate 19636 S. aureus strain SAAV1 S.
aureus strain 1477 S. aureus strain 2176
[0028] When the reference microbe is S. aureus ATCC isolate 19636,
a candidate polypeptide is considered to be a polypeptide of the
present invention if it has a molecular weight of 88 kDa, 55 kDa,
38 kDa, 37 kDa, 36 kDa 35 kDa, or 33 kDa, and has a mass
fingerprint that is similar to the mass fingerprint of a metal
regulated polypeptide expressed by a reference microbe and having a
molecular weight of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa 35 kDa,
or 33 kDa, respectively. Preferably, such polypeptides are metal
regulated. For instance, a candidate polypeptide is a polypeptide
of the present invention if it has a molecular weight of 88 kDa and
has a mass fingerprint similar to the mass fingerprint of an 88 kDa
metal regulasted polypeptide produced by the reference strain S.
aureus ATCC isolate 19636.
[0029] When the reference microbe is S. aureus isolate SAAV1, a
candidate polypeptide is considered to be a polypeptide of the
present invention if it has a molecular weight (as determined by
SDS-PAGE) of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, or 33
kDa, and has a mass fingerprint that is similar to the mass
fingerprint of a polypeptide expressed by a reference microbe and
having a molecular weight (as determined by SDS-PAGE) of 88 kDa, 55
kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, or 33 kDa, respectively.
Preferably, such polypeptides are metal regulated. For instance, a
candidate polypeptide is a polypeptide of the present invention if
it has a molecular weight of 88 kDa and has a mass fingerprint
similar to the mass fingerprint of an 88 kDa metal regulated
polypeptide produced by the reference strain S. aureus isolate
SAAV1.
[0030] When the reference microbe is S. aureus strain 2176, a
candidate polypeptide is considered to be a polypeptide of the
present invention if it has a molecular weight (as determined by
SDS-PAGE) of 88 kDa, 80 kDa, 65 kDa, 55 kDa, 37 kDa, 36 kDa, 35
kDa, 33 kDa, or 32 kDa, and has a mass fingerprint that is similar
to the mass fingerprint of a polypeptide expressed by a reference
microbe and having a molecular weight (as determined by SDS-PAGE)
of 88 kDa, 80 kDa, 65 kDa, 55 kDa, 37 kDa, 36 kDa, 35 kDa, 33 kDa,
or 32 kDa, respectively. Preferably, such polypeptides are metal
regulated. For instance, a candidate polypeptide is a polypeptide
of the present invention if it has a molecular weight of 88 kDa and
has a mass fingerprint similar to the mass fingerprint of an 88 kDa
metal regulated polypeptide produced by the reference strain S.
aureus isolate 2176.
[0031] When the reference mierohc is S. aureus strain 1477, a
candidate polypeptide is considered to be a polypeptide of the
present invention if it isas a molecular weight (as determined by
SDS-PAGE) of 88 kDa, 80 kDa, 65 kDa, 55 kDa, 37 kDa, 36 kDa, 35
kDa, 33 kDa, or 32 kDa, and has a mass fingerprint that is similar
to the mass fingerprint of a polypeptide expressed by a reference
microbe and saving a molecular Weight (as determined by SDS-PAGE)
of 88 kDa, 80 kDa, 65 kDa, 55 kDa, 37 kDa, 36 kDa, 35 kDa, 33 kDa,
or 32 kDa, respectively. Preferably, such polypeptides are metal
regulated. For instance, a candidate polypeptide is a polypeptide
of the present invention if it has a molecular weight of 88 kDa and
has a mass fingerprint similar to the mass fingerprint of an 88 kDa
metal regulated polypeptide produced by the reference strain S.
aureus isolate 1477.
[0032] The polypeptides expressed by a reference microbe and
referred to above by molecular weight can be obtained by growth of
the reference microbe under low metal conditions and the subsequent
isolation of a polypeptide by the processes disclosed herein. A
candidate polypeptide is isolatable from a microbe, preferably a
gram, positive microbe, more preferably, a member of the family
Micrococcaceae, preferably, Staphylococcus spp., more preferably,
Staphylococcus aureus.
[0033] Other gram positive microbes from which polypeptides can be
isolated include Cornebacterium spp., Enterococcus spp.,
Erysipelothrix spp., Kytococcus spp., and Micrococcus spp.,
Mycobacterium spp., and Erysipelothrix spp. A candidate polypeptide
may also be produced using recombinant, enzymatic, or chemical
techniques.
[0034] A candidate polypeptide may be evaluated by mass
spectrometry analysis to determine whether the candidate
polypeptide has a mass fingerprint similar to one of the
polypeptides expressed by a reference microbe and referred to above
by molecnlar weight. Typically, the candidate polypeptide is
isolated, for instance by resolving the candidate polypeptide by
gel electrophoresis and excising the portion of the gel containing
the candidate polypeptide. Any gel electrophoresis method that
separates polypeptides based on differing characteristics can be
used, including 1 dimensional or 2 dimensional gel electrophoresis,
as well as liquid chromatographic separation based on, for
instance, hydrophobicity, pl, or size. The candidate polypeptide is
fragmented, for instance by digestion with a protease. Preferably,
the protease cleaves the peptide bond on the carboxy-terminal side
of the amino acid lysine and the amino acid arginine, except when
the amino acid following the lysine or the arginine is a proline.
An example of such a protease is trypsin. Methods for digesting a
polypeptide with trypsin are realise and known in the art. An
example of such a method is disclosed in Example 13.
[0035] Methods for the mass spectrometric analysis of polypeptides
are routine and known in the art and include, but are not limited
to, matrix assisted laser desorption/ionization time of flight mass
spectroscopy (MALDI-TOF MS). Typically, a mixture containing the
polypeptide fragments obtained from a candidate polypeptide is
mixed with a matrix that functions to transform the laser energy to
the sample and produce ionized, preferably monoisotopse,
polypeptide fragments. Examples of matrices that can be used
include, for instance, sinapinic acid or cyano-4-hydroxycinnamic
acid. An sample of a method for the analysis of polypeptides by
MALDI-TOF MS is described in Example 13. The ionized polypeptide
fragments are separated according to their m/z ratio, and detected
to yield a spectmm of m/z ratio versus intensity. The spectrum
includes m/z values that represent the polypeptide fragments
derived from the candidate, polypeptide. For any givers
polypeptide, the amount of each polypeptide fragment reaching from
a trypsin digestion should be equimolar. However, it is known that
trypsin digestion is not always 100% efficient, for instance, some
sites are more efficiently cleaved. Thus, when MALDI-TOF MS is used
to determine m/z values, the intensity of each m/z value is
typically not identical. Generally, a spectrum has a background
level of noise present across most of the x-axis (i.e., the axis
having the values of the m/z ratios). This background level of
noise varies depending on the running conditions and the machine
used, and is easily identified by visual inspection of the
spectrum. An m/z value is generally considered to represent a
polypeptide fragment when the intensity is at least 2 times
greater, at least 3 times greater, or at least 4 times greater than
the background level of noise. The spectrum usually includes other
m/z values that are artifacts resulting from, for instance,
incomplete digestion, over digestion, other polypeptides that may
be present in the mixture, or the protease used to digest the
polypeptide including m/z values resulting from autolysis of the
protease. This method of digesting a polypeptide with a protease is
recognized in the art as resulting in a mass fingerprint of great
specificity that can be used to accurately characterize the
polypeptide and distinguish it from other polypeptides.
[0036] In this aspect of the invention, when a candidate
polypeptide is analyzed by mass spectroscopy, preferably both the
candidate polypeptide and the polypeptide from the reference
microbe are prepared and analyzed together, thereby decreasing any
potential artifacts resulting from differences in sample handling
and running conditions. Preferably, all reagents used to prepare
and analyse the two polypeptides are the same. For instance, the
polypeptide from the reference microbe and the candidate
polypeptide are isolated under substantially the same conditions,
fragmented under substantially the same conditions, and analyzed by
MALDI-TOF MS on the same machine under substantially the same
conditions. A mass fingerprint of a candidate polypeptide is
considered to be similar to the mass fingerprint of a polypeptide
from a reference microbe when at least 80%, at least 90%, at least
95%, or substantially all of the m/z values present in the spectrum
of the reference microbe polypeptide and above the background level
of noise are also present in the spectrum of the candidate
polypeptide.
[0037] In another aspect, a polypeptide is considered to be a
polypeptide of the present invention if it has a molecular weight
of a reference polypeptide described in Table 2, 3, 4, or 5 and has
a mass fingerprint that includes the population of polypeptide
fragments of the reference polypeptide as listed in Table 2, 3, 4,
or 5. For instance, a polypeptide of the present invention includes
a polypeptide of 88 kDa and a mass fingerprint that includes
polypeptide fragments having masses of HVDVR, YSYER, IIGDYRR,
IFTDYRK, ELKELGQK, YAQVKPIR, QMQFFGAR, SMQPFGGIR, VSGYAVNFIK,
NHATAWQGFK, LWEQVMQLSK, SLGKEPEDQNR, DGISNTFSIVPK, AGVITGLPDAYGR,
TSTFLDIYAER, SMQPFGGIRMAK, THNQGVFDAYSR, KAGVITGLPDAYGR,
TLLYAJNGGKDEK, IEMALHDTEIVR, AGEPFAPGANPMHGR, VALYGVDFLMEEK,
KTHNQGVFDAYSR, YGFDLSRPAENFK, TSSIQYENDDIMR, KAGEPFAPGANPMHGR,
RVALYGVDFLMEEK, LWEQVMQLSKEER, MLETNKNHATAWQGFK, MHDFNTMSTEMSEDVIR,
YGNNDDRVDDIAVDLVER, ETLIDAMEHPEEYPQLTIR, YAQVKPIRNEEGLVVDFEIEGDFPK.
The mass fingerprint of a candidate polypeptide can be determined
by a mass spectrometric method, for instance by MALDI-TOF MS. The
mass fingerprint of a candidate polypeptide will generally have
additional polypeptide fragments and therefore additional m/z
values other than those listed for a polypeptide in Table 2, 3, 4,
or 5. Preferably, when the candidate polypeptide is being compared
to a polypeptide in Table 2, 3, 4, or 5, the candidate polypeptide
is isolatable from a microbe, preferably a gram positive microbe,
more preferably, a member of the family Micrococcaceae, preferably,
Staphylococcus spp., more preferably, Staphylococcus aureus. Other
grain positive microbes include Corynebacterium spp., Enterococcus
spp., Erysipelothrix spp., Kytococcus spp., Listeria spp.,
Micrococcus spp., and Mycobacterium spp., and Erysipelothrix spp. A
candidate polypeptide can be obtained by growth of a microbe under
low metal conditions and the subsequent isolation of a polypeptide
by the processes described herein.
[0038] If is well known in the art that modifications of amino
acids can be accidentally introduced during sample handling, such
as oxidation, and formation of carbamidomethyl derivatives.
Further, thus types of modifications alter the m/z value of a
polypeptide fragment. For instance, if a polypeptide fragment
contains a methionine that is oxidized, the m/z value will be
increased by 16 relative to the same fragment that does not contain
the oxidized methionine. Accordingly, those polypeptide fragments
in Tables 2, 3, 4, or 5 having the notation "oxidation (M)" have an
m/z value that is increased by 16 relative to the same fragment
that does not contain the oxidized methionine. It is understood
that the polypeptide fragments of Table 2, 3, 4, or 5 can be
modified during sample handling.
TABLE-US-00002 TABLE 2 Characteristics of polypeptides obtained
from S. aureus ATCC isolate 19636. Approximate m/z value of
molecular polypeptide weight in fragments Polypeptide kilodaltons
resulting from designation (kDa).sup.1 trypsin digest.sup.2
Predicted amino acid sequence of the polypeptide fragment P23 88
625.4 HVDVR 717.3 YSYER 892.5 IIGDYRR 942.5 IFTDYRK 944.5 ELKELGQK
974.6 YAQVKPIR 984.5 QMQFFGAR 992.5 SMQPFGGIR 1097.6 VSGYAVNFIK
1159.5 NHATAWQGFK 1261.7 LWEQVMQLSK 1272.7 SLGKEPEDQNR 1277.7
DGISNTFSIVPK 1289.7 AGVITGLPDAYGR 1315.7 TSTFLDIYAER 1322.7
SMQPFGGIRMAK 1394.7 THNQGVFDAYSR 1417.8 KAGVITGLPDAYGR 1421.8
TLLYAINGGKDEK 1426.8 IEMALHDTEIVR 1508.8 AGEPFAPGANPMHGR 1513.8
VALYGVDFLMEEK 1522.8 KTHNQGVPDAYSR 1543.8 YGFDLSRPAENFK 1571.8
TSSIQYENDDIMR 1636.9 KEGEPFAPGANPMHGR 1670.0 RVALYGVDFLMEEK 1676.0
LWEQVMQLSKEER 1876.2 MLENTNKNHATAWQGFK 2043.1 MHDFNTMSTEMSEDVIR
2078.2 YGNNDDRVDDIAVDLVER 2285.5 ETLIDAMEHPEEYPQLTIR 2892.9
YAQVKPIRNEEGLVVDFEIEGDFPK P25 55 783.6 LHSWLK 911.7 KLHSWLK 937.6
TYTFHLR 996.6 KFDGTGPFK 1025.6 QAIGHMVNR 1063.6 KWDVSEDGK 1185.6
IYNSIDDAFK 1277.6 NLEMAMYYDK 1324.7 ENKQLTYTTVK 1346.7 AESLLDEAGWKK
1381.8 TVRQAIGHMVNR 1394.8 TYTFHLRDDVK 1400.7 KGETNFAFTDDR 1419.7
FHDGTPFDADAVK 1422.8 NVTDINFDMPTR 1428.8 DKIYNSIDDAFK 1483.8
EQAEYLQAEFKK 1509.8 VMPAGETAFLSMKK 1547.9 FHDGTPFDADAVKK 1550.9
NVTDINFDMPTRK 1559.9 LNINGETSDKIAER 1788.1 EILDGQEKPATQLFAK 1930.1
GSSSQKEQAEYLQAEFK 1946.0 DESADFNKNDQYWGEK 2100.4
IAKEILDGQEKPATQLFAK 2239.3 VSFTQSQYELPFNEMQYK 2493.5
EAYQPALAELAMPRPYVFVSPK + Oxidation (M) 2900.6
DIGDMNPHVYGGSMSAESMIYEPLVR + 2 Oxidation (M) 2916.6
DIGDMNPHVYGGSMSEESMIYEPLVR + 3 Oxidation (M) P26 38 993.6 IVYVGADEK
996.7 QALNNPVLK 1237.7 ETVKIENNYK 1272.7 ENPDVILAMDR 1502.0
IAATKPEVIFISGR 1507.9 NAVVLDYGALDVMK 1523.9 ALPNFLESFKDDK 1559.9
LWYFAAGSTTTTIK 1716.0 FGGLVYDTLGFNAVDK 1737.0 IVYVGADEKNLIGSMK
1844.1 FGGLVYDTLGFNAVDKK 1929.1 GRFGGLVYDTLGFNAVDK 1998.2
TVMYLLVNEGELSTFGPK 2234.4 EVNFDKIAATKPEVIFISGR 3143.8
VSNSNHGQNVSNEYVNKENPDVILAMDR P27 37 699.5 FEYIK 729.4 DAWPLK 792.5
ASVVNFR 852.4 VYDQLSK 987.5 HAMGTTEIK 1008.5 LIDDLYEK 1020.5
YKDAWPLK 1074.5 EKEAEDLLK 1083.6 LKPDLIVASK 1169.5 FEYIKNDLK 1182.5
KTESEWTSSK 1184.5 YDDKVAAFQK 1223.5 NEKVYDQLSK 1278.6 IAPTVSTDTVFK
1497.6 TESEWTSSKEWK 1502.7 DAWPLKASVVNFR 1558.8 QVDNGKDIIQLTSK
1605.8 LIDDLYEKLNIEK 1623.8 IVGQEPAPNLEEISK 1712.8 ESIPLMNADHIFVVK
1800.9 IYAGGYAGEILNDLGFK 1957.0 IYAGGYAGEILNDLGFKR 2252.0
NNQVSDDLDEITWNLAGGYK 3383.9 RVVTLYQGATDVAVSLGVKPVGAVESWTQKPK P28 36
646.4 DVWAR 725.5 IIKPVR 1068.4 IGDYTSVGTR 1185.5 KQPNLEEISK 1327.6
LKPDLIIADSSR 1343.6 VDIVDRDVWAR 2080.9 GPYLQLDTEHLADLNPER 2438.1
AGLLAHPNYSYVQGFLNELGFK 2789.4 IVVLEYSFADALAALDVKPVGIADDGK P29 35
760.5 AGWAEVK 1012.6 TVDIPKDPK 1107.6 KDWEETTAK 1204.7 VAPTVVVDYNK
1238.6 YLEQQEMLGK 1244.6 LYTYGDNWGR 1259.7 IAVVAPTYAGGLK 1281.7
GGEVLYQAFGLK 1516.8 AGWAEVKQEEIEK 1683.9 LGANIVAVNQQVDQSK 1877.1
EKPDLIIVYSTDKDIK 1884.0 AIGQDATVSLFDEFDKK 2227.1 VDAGTYWYNDPYTLDFMR
2781.4 YAGDYIVSTSEGKPTPGYESTNMWK P30 33 834.5 QAIEFVK 864.5 YIAQLEK
946.5 QGTPEQMR 962.5 QAIEFVKK 976.5 DKFNDIPK 1054.5 AMITSEGAFK
1202.5 SNIETVHGSMK 1268.6 HLLVETSVDKK 1443.6 DIFGEVYTDSIGK 1450.7
TIQQTFIDNDKK 1454.7 VVTTNSILYDMAK 1571.7 KDIFGEVYTDSIGK 1593.7
QDPHAWLSLDNGIK 1818.9 DVKPIYLNGEEGNKDK 1836.9 DKQDPHAWLSLDNGIK
1911.9 QYGITPGYIWEINTEK 2582.3 LTDADVILYNGLNLETGNGWFEK 2710.2
KLTDADVILYNGLNLETGNGWFEK 3942.4 NVGGDNVDIHSIVFVGQDPHEYEVKPK
.sup.1Molecular weight as determined by SDS-PAGE. .sup.2The m/z
value of a polypeptide fragment can be converted to mass by
subtracting 1 from the m/z value. Each mass includes a range of
plus or minus 300 parts per million (ppm), or plus or minus 1
Da.
TABLE-US-00003 TABLE 3 Characteristics of polypeptides obatined
from S. aureus isolate SAVV1. Approximate m/z value of molecular
polypeptide weight in fragments polypeptide kilodaltons resulting
from designation (kDa).sup.1 trypsin digest.sup.2 Predicted amino
acid sequence of the polypeptide fragment P33A 55 783.4 LHSWLK
911.5 KLHSWLK 937.5 TYTFHLR 996.5 KFDGTGPFK 1025.5 QAIGHMVNR 1039.4
NDQYWGEK 1178.5 GTDSLDKDSLK 1185.5 IYNSIDDAFK 1222.6 DKYTVELNLK
1229.5 ISTLIDNVKVK 1346.6 AESLLDEAGWKK 1355.5 EQAEYLQAEFK 1381.6
VMPAGETAFLSMK 1400.5 KGETNFAFTDDR 1419.6 FHDGTPFDADAVK 1422.6
NVTDINFDMPTR 1483.6 EQAEYLQAEFKK 1547.7 FHDGTPFDADAVKK 1550.6
NVTDINFDMPTRK 1559.7 LNINGETSDKIAER 1787.9 EILDGQEKPATQLFAK 1945.8
DESADFNKNDQYWGEK 2239.0 VSFTQSQYELPFNEMQYK 2354.1
QIDDEGIFIPISHGSMTVVAPK 2868.1 DIGDMNPHVYGGSMSAESMIYEPLVR P33B 55
895.4 FPYAANGR 904.5 ALLHASNR 1045.5 EEGLAIKASK 1384.5 GEAYFVDNNSLR
1435.7 TIEADYVLVTVGR 1669.8 RPNTDELGLEELGVK 1841.0
NAIIATGSRFIEIPNFK 2179.2 TSISNIYAIGDIVPGLPLAHK 2546.2
FVEAQHSENLGVIAESVSLNFQK 2587.3 VVGDFPIETDTIVIGAGPGGYVAAIR P35 37
699.4 FEYIK 729.4 DAWPLK 792.4 ASVVNFR 852.4 VYDQLSK 1008.4
LIDDLYEK 1020.4 YKDAWPLK 1074.4 EKEAEDLLK 1083.5 LKPDLIVASK 1169.5
FEYIKNDLK 1182.4 KTESEWTSSK 1184.4 YDDKVAAFQK 1278.5 IAPTVSTDTVFK
1558.7 QVDNGKDIIQLTSK 1623.7 IVGQEPAPNLEEISK 1712.7 ESIPLMNADHIFVVK
1800.7 IYAGGYAGEILNDLGFK 1956.8 IYAGGYAGEILNDLGFKR 2251.9
NNQVSDDLDEITWNLAGGYK 3227.5 VVTLYQAGTDVAVSLGVKPVGAVESWTQKPK P38 33
864.5 YIAQLEK 946.4 QGTPEQMR 976.5 DKFNDIPK 1054.5 AMITSEGAFK
1146.5 FNDIPKEQR 1268.6 HLLVETSVDKK 1322.5 TIQQTFIDNDK 1443.6
DIFGEVYTDSIGK 1450.6 TIQQTFIDNDKK 1454.6 VVTTNSILYDMAK 1593.7
QDPHAWLSLDNGIK 1818.9 DVKPIYLNGEEGNKDK 1836.8 DKQDPHAWLSLDNGIK
1911.9 QYGITPGYIWEINTEK 2942.4 NVGGDNVDIHSIVPVGQDPHEYEVKPK
.sup.1Molecular weight as determined by SDS-PAGE. .sup.2The m/z
value of a polypeptide fragment can be converted to mass by
subtracting 1 from the m/z value. Each mass includes a range of
plus or minus 300 parts per million (ppm), or plus or minus 1
Da.
TABLE-US-00004 TABLE 4 Characteristics of polypeptides obatined
from S. aureus isolate 2176. Approximate m/z value of molecular
polypeptide weight in fragments Polypeptide kilodaltons resulting
from designation (kDa).sup.1 trypsin digest.sup.2 Predicted amino
acid sequence of the polypeptide fragment P478 88 736.35 IIGDYR
814.49 IFTDYR 942.42 IFTDYRK 945.36 TGNTPDGRK 974.40 YAQVKPIR
984.27 QMQFFGAR 992.41 SMQPFGGIR 1087.31 EQQLDVISR 1097.31
VSGYAVNFIK 1159.37 NHATAWQGFK 1261.37 LWEQVMQLSK 1289.46
AGVITGLPDAYGR 1315.42 TSTFLDIYAER 1322.39 LREELSEQYR 1394.37
THNQGVFDAYSR 1417.52 KAGVITGLPDAYGR 1426.36 IEMALHDTEIVR 1487.39
NHATAWQGFKNGR 1508.42 AGEPFAPGANPMHGR 1513.52 VALYGVDFLMEEK 1543.43
YGFDLSRPAENFK 1571.50 TSSIQYENDDIMR 1636.56 KAGEPFAPGANPMHGR
1859.80 DLETIVGVQTEKPFKR 1876.77 TMATGIAGLSVAADSLSAIK 2042.57
MHDFNTMSTEMSEDVIR 2077.68 YGNNDDRVDDIAVDLVER 2158.88
AGVITESEVQEIIDHFIMK 2284.90 ETLIDAMEHPEEYPQLTIR 2575.08
FLHSLDNLGPAPEPNLTVLWSVR 2628.01 SGAQVGPNFEGINSEVLEYDEVFK 2756.06
SGAQVGPNFEGINSEVLEYDEVFKK 3262.33 VASTITSHDAGYLDKDLETIVGVQTEKPFK
P479 80 625.27 HVDVR 736.26 IIGDYR 814.22 IFTDYR 942.27 IFTDYRK
974.26 YAQVKPIR 984.18 QMQFFGAR 992.23 SMQPFGGIR 1087.16 EQQLDVISR
1097.24 VSGYAVNFIK 1159.12 NHATAWQGFK 1243.14 VDDIAVDLVER 1261.22
LWEQVMQLSK 1272.24 SLGKEPEDQNR 1277.18 DGISNTFSIVPK 1289.21
AGVITGLPDAYGR 1315.19 TSTFLDIYAER 1322.21 LREELSEQYR 1394.16
THNQGVFDAYSR 1417.32 KAGVITGLPDAYGR 1426.23 IEMALHDTEIVR 1487.19
NHATAWQGFKNGR 1508.25 AGEFFAPGANPMHGR 1513.21 VALYGVDFLMEEK 1522.25
KTHNQGVFDAYSR 1543.26 YGFDLSRPAENFK 1571.23 TSSIQYENDDIMR 1636.29
KAGEPFAPGANPMHGR 1703.43 DLETIVGVQTEKPFK 1751.45 EAVQWLYAYLAAIK
1859.53 DLETIVGVQTEKPFKR 1876.50 TMATGIAGLSVAADSLSAIK 1936.37
NEEGLVVDFEIEGDFPK 2042.43 MHDFNTMTSTEMSEDVIR 2077.45
YGNNDDRVDDIAVDLVER 2158.57 AGVITESEVQEIIDHFIMK 2284.61
ETLIDAMEHPEEYPQLTIR 2574.77 FLHSLDNLGPAPEPNLTVLWSVR 2627.61
SGAQVGPNFEGINSEVLEYDEVFK 2755.70 SGAQVGPNFEGINSEVLEYDEVFKK 2907.65
EFIQLNYTLYEGNDSFLAGPTEATSK 3261.91 VASTITSHDAGYLDKDLETIVGVQTEKPFK
3421.02 TPDYNELFSGDPTWVTESIGGVGIDGRPLVTK P480 65 625.35 HVDVR
717.38 YSYER 733.42 LPDNFK 736.44 IIGDYR 814.33 IFTDYR 853.31
YGNNDDR 842.33 IFTDYRK 844.39 ELEKLGQK 974.52 YAQVKPIR 984.36
QMQFFGAR 992.44 SMQPFGGIR 1049.44 TLLYAINGGK 1087.43 EQQLDVISR
1097.51 VSGYAVNFIK 1159.52 NHATAWQGFK 1289.53 AGVITGLPDAYGR 1315.51
TSTFLDIYAER 1322.46 LREELSEQYR 1394.50 THNQGVFDAYSR 1417.65
KAGVITGLPDAYGR 1442.56 IEMALHDTEIVR + Oxidation (M) 1467.60
VSGYAVNFIKLTR 1522.61 KTHNQGVFDAYSR 1524.55 AGEPFAPGANPMHGR +
Oxidation (M) 1529.64 VALYGVDFLMEEK + Oxidation (M) 1543.62
YGFDLSRPAENFK 1652.68 KAGEPFAPGANPMHGR + Oxidation (M) 1671.76
TSTFLDIYAERDLK 1766.76 VDDIAVDLVERFMTK + Oxidation (M) 1876.86
TMATGIAGLSVAADSLSAIK 2077.93 YGNNDDRVDDIAVDLVER 2225.07
DSEHTMSVLTITSNVVYGKK + Oxidation (M) 2575.33
FLHSLDNLGPAPEPNLTVLWSVR 2628.25 SGAQVGPNFEGINSEVLEYDEVFK 2748.36
NLTSMLDGYAMQCGHHLNINVFNR 2756.63 SGAQYGPNFEGINSEVLEYDEVFKK 3001.02
DEKSGAQVGPNFEGINSEVLEYDEVFK 3420.75
TPDYNELFSGDPTWVTESIGGVGIDGRPLVTK P481 55 634.33 AKSNSK 883.24
TFYPEAR 1014.24 QFWGHLVK 1131.17 WIPLMMKGR 1207.21 VINEEFEISK
1324.10 NEDWQLYTAGK 1360.28 TLLFGPPANVGPK 1386.31 LDRFAIESSNER
1565.30 IDEGTDVNFGELTR 1584.34 EFINPLFHISYVR 1699.29 EIEPDWNIHVYER
1744.36 EPPGTPPMTVPHLDTR 2046.52 QVTDYVFIGAGGGAIPLLQK 2189.43
TFYPEARNEDWQLYTAGK 2806.58 HLGGFPISGQFLACTNPQVIEQHDAK P482 37
699.28 FEYIK 729.26 DAWPLK 792.33 ASVVNFR 852.28 VYDQLSK 1008.30
LIDDLYEK 1020.31 YKDAWFLK 1083.43 LKPDLIVASK 1278.36 IAFTVSTDTVFK
1623.44 IVGQEPAPNLEEISK 1712.62 ESIPLMNADHIFVVK 1800.61
IYAGGAGEILNDLGFP 1956.77 IYAGGYAGEILNDLGFKR 2251.77
NNQVSDDLDEITWNLAGGYK 3227.44 VVTLYQGATDVAVSLGVKPVGAVESWTQKPK P483
38 646.50 DVWAR 672.41 KLNAVK 716.41 VDIVDR 725.61 IIKPVR 842.50
IAPTLSLK 850.47 QNINSFK 1068.50 IGDYTSVGTR 1075.42 MIIMTDHAK +
Oxidation (M) 1185.53 KQPNLEEISK 1327.59 LKPDLIIADSSR 1343.58
VDIVDRDVWAR 1592.76 LKPDLIIADSSRHK 2081.00 GPYLQLDTEHLADLNPER
2438.24 AGLLAHPNYSYVGQGLNELGFK 2789.48 IVVLEYSFADALAALDVKPGIADDGK
2917.60 IVVLEYSFADALAALDVKPVGIADDGKK P484 35 857.38 AAAIDLAGR
1022.23 NIEADTGMR + Oxidation (M) 1056.32 VVDANIAAQR 1075.36
ADIDLPFER 1285.44 LVGGAGEETIIAR 1435.44 AMAVATEQEMKAR 1632.50
HHTEVLENPDNISK 1813.65 VVEAESEVPLAMAEALR 1887.67 VIETPFIAGVAMNGIEVK
2299.85 AGLALTTNQLESHYLAGGNVDR 2806.95 TVLSKGLDSGTAFEILSIDIADVDISK
3337.42 AGLATTNQLESHYLAGGNVDRVVDANIAAQR P485 33 625.28 ADYEK 864.28
YIAQLEK 946.23 QGTPEQMR 1045.26 ALEQAGKSLK 1268.35 JLLVETSVDKK
1443.34 DIFGEVYTDSIGK 1450.40 TIQQTFIDNDKK 1454.37 VVTTNSILYDMAK
1571.45 KDIFGEVYTDSIGK 1576.44 DVKPIYLNGEEGNK 1593.47
QDPHAWLSLDNGIK 1819.59 DVKPIYLNGEEGNKDK 1836.62 DKQDPHAWLSLDNGIK
1911.66 QYGITPGYIWEINTEK 2172.83 VIAVSKDVKPIYLNGEEGKN 2582.00
LTDADVILYNGLNETGNGWFEK 2942.26 NVGGDNVDIHSIVPVGQDPHEYEVKPK P486 32
625.42 ADYEK 864.41 YIAQLEK 1268.48 HLLVETSVDKK 1443.49
DIFGEVYTDSIGK 1450.53 TIQQTFIDNDKK 1454.61 VVTTNSILYDMAK 1576.64
DVKPIYLNGEEGNK 1593.57 QDPHAWLSLDNGIK 1818.77 DVKPIYLNGEEGNKDK
1836.78 DKQDPHAWLSLDNGIK 1911.81 QYGITPGYIWEINTEK 2582.18
LTDADVILYNGLNLETGNGWFEK 2942.32 NVGGDNVDIHSIVPVGQDPHEYEVKPK
.sup.1Molecular weight as determined by SDS-PAGE. .sup.2The m/z
value of a polypeptide fragment can be converted to mass by
subtracting 1 from the m/z value. Each mass includes a range of
plus or minus 300 parts per million (ppm), or plus or minus 1
Da.
TABLE-US-00005 TABLE 5 Characteristics of polypeptides obatined
from S. aureus isolate 1477. Approximate m/z value of molecular
polypeptide weight in fragments polypeptide kilodaltons resulting
from designation (kDa).sup.1 trypsin digest.sup.2 Predicted amino
acid sequence of the polypeptide fragment P487 88 717.39 YSYER
736.52 IIGDYR 814.46 IFTDYR 942.46 IFTDYRK 974.54 YAKVKPIR 984.41
QMQFFGAR 992.40 SMQPFGGIR 1087.49 EQQLDVISR 1097.50 VSGYAVNFIK
1159.39 NHATAWQGFK 1261.45 LWEQVMQLSK 1272.50 SLGKEPEDQNR 1277.50
DGISNTFSIVPK 1289.54 AGVITGLPDAYGR 1315.54 TSTFLDIYAER 1322.53
LREELSEQYR 1394.50 THNQGVFDAYSR 1417.62 KAGVITGLPDAYGR 1426.65
IEMALHDTEIVR 1509.59 AGEPFAPGANPMHGR 1522.61 KTHNQGVFDAYSR 1543.68
YGFDLSRPAENFK 1877.74 TMATGIAGLSVAADSLSAIK 2077.86
YGNNDDVRDDIAVDLVER 2159.08 AGVITESEVQEIIDHFIMK 2285.07
ETLIDAMEHPEEYPQLTIR 2575.32 FLHSLDNLGPAPEPNLTVLWSVR 2628.24
SGAQVGPNFEGINSEVLEYDEVFK 2756.41 SGAQVGPNFEGINSEVLEYDEVFKK 3262.68
VASTITSHDAGYLDKDLETIVGVQTEKPFK P488 80 625.49 HVDVR 814.54 IFTDYR
842.66 IFTDYRK 974.69 YAQVKPIR 984.59 QMQFFGAR 992.55 SMQPFGGIR
1159.64 NHATAWQGFK 1261.63 LWEQVMQLSK 1272.74 SLGKEPEDQNR 1277.69
DGISNTFSIVPK 1289.76 AGVITGLPDAYGR 1315.73 TSTFLDIYAER 1322.72
SMQPFGGIRMAK 1394.73 THNQGVFDAYSR 1417.86 KAGVITGLPDAYGR 1422.76
TLLYAINGGKDEK 1426.80 IEMALHDETEIVR 1508.82 AGEPFAPGANFMHGR 1513.80
VALYGVDFLMEEK 1543.82 YGFDLSRPAENFK 1571.82 TSSIQYENDDIMR 1703.99
DLETIVGVQTEKPFK 1860.23 DLETIVGVQTEKPFKR 1877.07
TMATGIAGLSVAADSLSAIK 1937.09 NEEGLVVDFEIEGDFPK 2078.13
YGNNDDRVDDIAVDLVER 2575.56 FLHSLDNLGPAPEPNLTVLWSVR 2628.30
SGAQVGPNFEGINSEVLEYDEVFK 2908.63 EFIQLNYTLYEGNDSFLAGPTEATSK P489 65
733.67 IVKFAR 944.71 ELKELGQK 974.79 YAQVKPIR 984.69 QMQFFGAR
1049.83 TLLYAINGGK 1087.78 EQQLDVISR 1097.79 VSGYAVNFIR 1243.80
VDDIAVDLVER 1272.82 SLGKEPEDQNR 1289.87 AGVITGLPDAYGR 1299.92
LPDNFKTYCAK 1315.83 TSTFLDIYAER 1322.84 SMQPFGGIRMAK 1390.93
DQKGALSSLSSVAK 1394.84 THNQGVFDAYSR 1577.94 VASTITSHDAGYLDK 1637.09
KAGEPFAPGANPMHGR 1704.16 DLETIVGVQTEKPFK 2030.42 MSIKTSSIQYENDDIMR
2078.34 YGNNDDRVDDIAVDLVER 2284.60 ETLIDAMEHPEEYPQLTIR 2575.77
FLHSLDNLGPAPEPNLTVLWSVR 2628.64 SGAQVGPNFEGINSEVLEYDEVFK P490 55
883.81 TFYPEAR 1014.87 QFWGHLVK 1131.97 WIPLMMKGR 1207.99
VINEEFEISK 1231.97 YSFDQVIMTK 1325.02 NEDWQLYTAGK 1361.17
TLLFGPFANVGPK 1362.14 GREDNPGIMAASK + Oxidation (M) 1387.14
LDRPAIESSNER 1481.24 NEDWQLYTAGKR 1566.28 IDEGTDVNFGELTR 1585.34
EFINPLPHISYVR 1700.36 EIEPDWNIHVYER 1761.49 EPPGTPPMTVPHLDTR +
Oxidation (M) 2047.67 QVTDYVFIGAGGGAIPLLQK 2208.82
VYGKEPPGTPPMTVPHLDTR + Oxidation (M) 2865.21
HLGGFPISGQFLACTNPQVIEQHDAD P492 36 857.57 AAAIDLAGR 1056.59
VVDANIAAQR 1075.61 ADIDLPFER 1285.74 LVGGAGEETIIAR 1632.95
HHTEVLENPDNISK 1814.09 VVEAESEVPLAMAEALR 2284.45
AAAIDLAGRDVLEAVQMSVNPK + Oxidation (M) 1300.40
AGLALTTNQLESHYLAGGNVDR 2807.80 TVLSKGLDSGTAFEILSIDIADVDISK P493 35
762.46 FVFHGR 964.39 DGFNNIER 1363.56 GHVYNGISGGQFK 1443.56
YTPTSILYFNPK 1450.64 QLAEDLQKHLGAK 1819.88 NHSEYVTDMRLIGIR +
Oxidation (M) 1875.84 DLPPMEQVFDTLDLDK 1941.00 IRPEDMHIMANIFLPK +
Oxidation (M) 2081.10 RIRPEDMHIMANIFLPK 2283.30
ISHLVLTRTGLYIIDSQLLK P495 32 .sup.1Molecular weight as determined
by SDS-PAGE. .sup.2The m/z value of a polypeptide fragment can be
converted to mass by subtracting 1 from the m/z value. Each mass
includes a range of plus or minus 300 parts per million (ppm), or
plus or minus 1 Da.
[0039] In yet archer aspect, the present invention further includes
polypeptides having similarity with an amino acid sequence. The
similarity is referred to as structural similarity and is generally
determined by aligning the residues of the two amino acid sequences
(i.e., a candidate amino acid sequence and a reference amino acid
sequence) to optimize the number of identical amino acids along the
lengths of their sequences; gaps in either or both sequences are
permitted in making the alignment in order to optimize the number
or identical amino acids, although the amino acids in each sequence
must nonetheless remain in their proper order. Reference amino acid
sequences are disclosed in Tables 6, 7, 8, and 9. Two amino acid
sequences can be compared using commercially available algorithms.
Preferably, two amino acid sequences are compared using the BLASTP
program of the BLAST 2 search algorithm, as described by Tatusova,
et al., (FEMS Microbiol Lett 1999, 174:247-250), and available
through the World Wide Web, for instance at the internet site
maintained by the National Center for Biotechnology Information,
National Institutes of Health. Preferably, the default values for
all BLAST 2 search parameters are used, including matrix=BLOSUM62;
open gap penalty=11, extension gap penalty=1, gap x_dropoff=50,
expect=10, wordsize=3, and optionally, filter on. In the comparison
of two amino acid sequences using the BLAST search algorithm,
structural similarity is referred to as "identities." Preferably, a
candidate amino acid sequence has at least 80% identity, at least
90% identity, at least 95% identity, at least 96% identity, at
least 97% identity, at least 98% identity, or at least 99% identity
to a reference amino acid sequence. Preferably, the molecular
weight of the candidate amino acid sequence and the reference amino
acid sequence are snbstantiaily the same value. Preferably, the
molecular weight of the candidate amino acid sequence and the
reference amino acid sequence is determined by SDS polyacrylamide
gel electrophoresis. A candidate polypeptide can be obtained by
growth of a microbe under low metal conditions and the subsequent
isolation of a polypepiide by the procedures disclosed herein.
[0040] Typically, a candidate amino acid sequence having structural
similarity to a inference amino acid sequence has immunogenic
activity, protective immunogenic activity, seroactive activity,
immunoregulatory activity, or a combination thereof.
TABLE-US-00006 TABLE 6 S. aureus ATCC isolate 19636. NCBI sequence
identifier of polypeptide identified by the Molecular weight of
computer algorithm as having reference polypeptide best match to
mass fingerprint (kDa).sup.1 of reference polypeptide 88 49243545
55 81762012 38 82750440 37 49243435 36 57286380 35 49245508 33
49243946 .sup.1Molecular weight as determined by SDS-PAGE.
TABLE-US-00007 TABLE 7 S. aureus SAAV1. NCBI sequence identifier of
polypeptide identified by the Molecular weight of computer
algorithm as having reference polypeptide best match to mass
fingerprint (kDa) .sup.1 of reference polypeptide 55 57286470 55
48874 37 49243435 33 49243946 .sup.1 Molecular weight as determined
by SDS-PAGE.
TABLE-US-00008 TABLE 8 S. aureus 2176. NCBI sequence identifier of
polypeptide identified by the Molecular weight of computer
algorithm as having reference polypeptide best match to mass
fingerprint (kDa).sup.1 of reference polypeptide 88 57285406 80
57285406 65 57285406 55 57286528 37 49482358 36 57286380 35
15927153 33 57285658 32 57285658 .sup.1Molecular weight as
determined by SDS-PAGE.
TABLE-US-00009 TABLE 9 S. aureus 1477. NCBI sequence identifier of
polypeptide identified by the Molecular weight of computer
algorithm as having reference polypeptide best match to mass
fingerprint (kDa).sup.1 of reference polypeptide 88 49482458 80
57285406 65 57285406 55 57286528 36 15927153 35 49484031
.sup.1Molecular weight as determined by SDS-PAGE.
[0041] The polypeptides expressed by a reference microbe and
referred to above by molecular weight can be obtained by growth of
the reference microbe under low metal conditions and the subsequent
isolation of a polypeptide by the processes disclosed herein. A
candidate polypeptide is isolatable from a microbe, preferably a
gram positive microbe, more preferably, a member of the family
Micrococcaceae, preferably, Staphylococcus spp., more preferably,
Staphylococcus aureus. Other gram positive microbes include
Corynebacterium spp., Erysipelothrix spp., Mycobacterium spp., and
Erysipelothrix spp. A candidate polypeptide may also be produced
using recombinant, enzymatic, or chemical techniques.
[0042] Also provided by the present invention are whole cell
preparations of a microbe, where the microbe expresses one or more
of the polypeptides of the present invention. The cells present in
a whole cell preparation are preferably, inactivated such that the
cells cannot replicate, but the immunogenic activity of the
polypeptides of the present invention expressed by the microbe is
maintained. Typically, the cells are killed by exposure to agents
such as glutaraldehyde, formalin, or formaldehyde.
Compositions
[0043] A composition of the present invention may include at least
one polypeptide described herein, or a number of polypeptides that
is an integer greater than 1 (e.g., at least 2, at least 3, at
least 4). For example, a composition can include 2, 3, 4, 5, or
more isolated metal regulated polypeptides having molecular weights
of 88 kDa, 55 kDa, 38 kDa, 37 kDa, 36 kDa, 35 kDa, 33 kDa, or any
subset or combination thereof. A composition, can include
polypeptides isolatable from 1 microbe, or can be isolatable from a
combination of 2 or more microbes. For instance, a composition can
include polypeptides isolatable from 2 or more Staphylocccocus
spp., or from a Staphyloccacus spp. and a different microbe that is
not a member of the genus Staphyloccocus. The present invention
also provides compositions including a whole cell preparation,
where the whole cell expresses one or more of the polypeptides of
the present invention. For instance, the whole cell can be a
Staphyloccocus spp. In some aspects, a composition can include
whole preparations from 2, 3, 4, 5, or 6 strains.
[0044] Optionally, a polypeptide of the present invention can be
covalently bound or conjugated to a carrier polypeptide to improve
the immunological properties of the polypeptide. Useful carrier
polypeptides are known in the art. The chemical coupling of
polypeptides of the present invention can be carried out using
known and routine methods. For instance, various homobifunctional
and/or heterobifunctional cross-linker reagents such as
bis(sulfosoccinimidyl) suberate, bis(diazobenzidinine), dimethyl
adipimidate, dimethyl pimelimidate, dimethyl superimidate,
disuccinimidyl suberate, glutaraldehyde,
m-maleimidobenzoyl-N-hydroxysuccinimide,
sulfosuccinimidyl-4-(N-maleimidomethyl) cycloheane-1-carboxylate,
sulfosuccinimidyl 4-(p-maleimido-phenyl) butyrate and
(1-ethyl-3-(dimethyl-aminopropyl) carbodiimide can be used (see,
for instance, Harlow and Lane, Antibodies, A Laboratory Manual,
generally and Chapter 5, Cold Spring Harbor Laboratory, Cold Spring
Harbor, New York, N.Y. (1988)).
[0045] The compositions of the present invention optionally further
include a pharmaceutically acceptable carrier. "Pharmaceutically
acceptable" refers to a diluent, carrier, excipient, salt, etc,
that is compatible with the other ingredients of the composition,
and not deleterious to the recipient thereof. Typically, the
composition inclodes a pharmaceutically acceptable carrier when the
composition is used as described herein. The compositions of the
present invention may be formulated in pharmaceutical preparations
in a variety of forms adapted to the chosen route of
administration, including routes suitable for stimulating an immune
response to an antigen. Thus, a composition of the present
invention can be administered via known routes including, for
example, oral; parental including intradermal, transcutaneous and
subcutaneous; intramuscular, intravenous, intraperitoneal, etc. and
topically, such as, intranasal, intrapolmonary, intramammary,
intravaginal, intrauterine, intradermal, transcutaneous and
rectally, etc. It is foreseen that a composition can be
administered to a mucosal surface, such as by administration to the
nasal or respiratory mucosa (e.g. spray or aerosol), in order to
stimulate mucosal immunity, such as production of secretory IgA
antibodies, throughout the animal's body.
[0046] A composition of the present invention can also be
administered via a sustained or delayed release implant. Implants
suitable for use according to the invention are know and include,
for example, those disclosed in Emery and Straub (WO 01/37810
(2001)), and Emery et al., (WO 96/01620 (1996)). Implants can be
produced at sizes small enough to be administered by aerosol or
spray. Implants also include nanospheres and microspheres.
[0047] A composition of the present invention may be administered
in an amount sufficient to treat certain conditions as described
herein. The amount of polypeptides or whole cells present in a
composition of the present invention can vary. For instance, the
dosage of polypeptides can be between 0.01 micrograms (.mu.g) and
300 mg, typically between 0.1 mg and 10 mg. When the composition is
a whole cell preparation, the cells can be present at a
concentration of, for instance, 10.sup.2 bacteria/ml, 10.sup.3
bacteria/ml, 10.sup.4 baceteria/ml, 10.sup.5 bacteria/ml, 10.sup.6
bacteria/ml, 10.sup.7 bacteria/ml, 10.sup.8 bacteria/ml, or
10.sup.9 bacteria/ml. For an injectable composition (e.g.
subcutaneous, intramuscular, etc.) the polypeptides may be present
in the composition in an amount such that the total volume of the
composition administered is 0.5 ml to 5.0 ml, typically 1.0-2.0 ml.
When the composition is a whole cell preparation, the cells are
preferably present in the composition in an amount that the total
volume of the composition administered is 0.5 ml to 5.0 ml,
typically 1.0-2.0 ml. The amount administered will vary depending
on various factors including, but not limited to, the specific
polypeptides chosen, the weight, physical condition and age of the
animal, and the route of administration. Thus, the absolute weight
of the polypeptide included in a given unit dosage form can vary
widely, and depends upon factors such as the species, age, weight
and physical condition of the animal, as well as the method of
administration. Such factors can be determined by one of skill in
the art. Other examples of dosages suitable for the invention are
disclosed in Emery et al., (U.S. Pat. No. 6,027,716).
[0048] The formulations may be conveniently presented in unit
dosage form and may be prepared by methods well known in the art of
pharmacy. Methods of preparing a composition with a
pharmaceutically acceptable carrier include the step of bringing
the active compound (e.g., a polypeptide or whole cell of the
present invention) into association with a carrier that constitutes
one or more accessory ingredients. In general, the formulations are
prepared by uniformly and intimately bringing the active compound
into association with a liquid carrier, a finely divided solid
carrier, or both, and then, if necessary, shaping the product into
the desired formulations.
[0049] A composition including a pharmaceutically acceptable
carrier can also include an adjuvant. An "adjuvant" refers to an
agent that can act in a nonspecific manner to enhance an immune
response to a particular antigen, thus potentially reducing the
quantity of antigen necessary in any given immunizing composition,
and/or the frequency of injection necessary in order to generate an
adequate immune response to the antigen of interest. Adjuvants may
include, for example, IL-1, IL-2, emulsifiers, muramyl dipeptides,
dimethyl dioctadecyl ammonium bromide (DDA), avridine, aluminum
hydroxide, oils, saponins, alpha-tocopherol, polysaccharides,
emuislfied paraffins (including, for instance, those available from
under the tradename EMULSIGEN from MVP Laboratories, Ralston,
Nebr.), ISA-70, RIBI and othes substances known in the art. It is
expected that polypeptides of the present invention will have
immunoregulatory activity and that such polypeptides may be used as
adjuvants that directly act as T and/or B cell activators or act on
specific cell types that enhance the synthesis of various cytokines
or activate intracellular signaling pathways. Such polypeptides are
expected to augment the immune response to increase the protective
index of the existing composition.
[0050] In another embodiment, a composition of the invention
including a pharmaceutically acceptable carrier can include a
biological response modifier, such as, for example, IL-2, IL-4
and/or IL-6, TNF, IFN-alpha, IFN-gamma, and other cytokines that
effect immune cells. An immunizing composition can also include
other components known in the art such as an antibiotic, a
preservative an antioxidant, or a chelating agent.
Methods of Making
[0051] The present invention also provides methods for obtaining
the polypeptide described herein. The polypeptides and whole cells
of the present invention are isolatable from a member of the family
Micrococcaceae, preferably, Staphylococcus spp., more preferably,
Staphylococcus aureus. Other gram positive microbes from which
polypeptides can be isolated include Corynebacterium spp.,
Erysipelothrix spp., Mycobacterium spp., and Erysipelothrix spp.
Microbes useful for obtaining polypeptides of the present invention
and making whole cell preparations are commercially available from
a depository such as American Type Culture Collection (ATCC). In
addition, such microbes are readily obtainable by techniques
routine and known to the art. The microbes may be derived from an
infected animal as a field isolate, and used to obtain polypeptides
and/or whole cell preparations of the present invention, or stored
for future use, for example, in a frozen repository at -20.degree.
C. to -95.degree. C., or -40.degree. C. to -50.degree. C., in
bacteriological media containing 20% glycerol, and other like
media.
[0052] When a polypeptide of the present invention is to be
obtained from a microbe, the microbe can be incubated under low
metal conditions. As used herein, the phrase "low metal conditions"
refers to an environment, typically bacteriological media, which
contains amounts of a free metal that cause a microbe to express
metal regulated polypeptides at a detectable level. As used herein,
the phrase "high metal conditions" refers to an environment that
contains amounts of a free metal that cause a microbe to either not
express one or more of the metal regulated polypeptides described
herein at a detectable level, or to decrease expression of such a
polypeptide. Metals are those present in the periodic table under
Groups 1 through 17 (IUPAC notation; also referred to as Groups
I-A, II-A, III-B, IV-B, V-B, VI-B, VII-B, VIII, I-B, II-B, III-A,
IV-A, V-A, VI-A, and VII-A, respectively, under CAS notation).
Preferably, metals are those in Groups 2 through 12, more
preferably, Groups 3-12. Even more preferably, the metal is iron,
zinc, copper, magnesium, nickel, cobalt, manganese, molybdenum, or
selenium, most preferably, iron.
[0053] Low metal conditions are generally the result of the
addition of a metal chelating compound to a bacteriological medium,
the use of a bacteriological medium that contains low amounts of a
metal, or the combination thereof. High metal conditions are
generally present when a chelator is not present in the medium, a
metal is added to the medium, or the computation thereof. Examples
of metal chelators include natural and synthetic compounds.
Examples of natural compounds include plant phenolic compounds,
such as flavenoids. Examples of flavenoids include the copper
chelators catechin and naringenin, and the iron chelators myricelin
and quercetin. Examples of synthetic copper chelators include, for
instance, tetrathiomolybdate, and examples of synthetic zinc
chelators include, for instance, N,N,N',N'-Tetrakis
(2-pyridylmethyl)-ethylene diamine. Examples of synthetic iron
chelators include 2,2'-dipyridyl (also referred to in the art as
.alpha.,.alpha.'-bipyridyl), 8-hydroxyquinoline,
ethylenediamine-di-O-hydroxyphenylacetic acid (EDDHA),
desferrioxamine methanesulphonate (desferol), transferrin,
lactoferrin, ovotransferrin, biological siderophores, such as, the
catecholates and hydroxamates, and citrate. An example of a general
divalent cation chelator is Chelex.RTM. resin. Preferably,
2,2'-dipyridyl is used for the chelation of iron. Typically,
2,2'-dipyridyl is added to the media at a concentration of at least
300 micrograms/milliliter (.mu.g/ml), at least 600 .mu.g/ml, or at
least 900 .mu.g/ml. High levels of 2,2'-dipyridyl can be 1200
.mu.g/ml, 1500 .mu.g/ml, or 1800 .mu.g/ml.
[0054] The S. aureus genome encodes three Fur homologs: Fur, PerR,
and Zur. While the Zur and PerR proteins appear to be primarily
involved in regulating zinc homeostasis and peroxide stress genes,
respectively, the Fur protein has been demonstrated to regulate
several iron-siderophore uptake systems in response to iron
limitation. The Fur protein also plays a role in oxidative stress
resistance and virulence. It is expected that a gram positive
organism, preferably, an S. aureus, with a mutation in a fur gene
will result in the constitutive expression of many, if not all, of
the metal regulated polypeptides of the present invention. The
production of fur mutation in a gram positive, preferably, an S.
aureus, can be produced using routine methods including, for
instance, transposon, chemical, or site-directed mutagenesis useful
for generating gene knock-out mutations in gram positive
bacteria.
[0055] The medium used to incubate the microbe and the volume of
media used to incubate the microbe can vary. When a microbe is
being evaluated for the ability to produce one or more of the
polypeptides described herein, the microbe can be grows in a
suitable volume, for instance, 10 milliliters to 1 liter of medium.
When a microbe is being grown to obtain polypeptides for use in,
for instance, administration to animals, the microbe may be grown
in a fermentor to allow the isolation of larger amounts of
polypeptides. Methods for growing microbes in a fermentor are
routine known to the art. The conditions used for growing a microbe
preferably include a metal chelator, more preferably an iron
chelator, for instance 2,2'-dipyridyl, a pH of between 6.5 and 7.5,
preferably between 6.9 and 7.1, and a teorperamre of 37.degree.
C.
[0056] In some aspects of the invention, a microbe may be harvested
after growth. Harvesting includes concentrating the microbe into a
smaller volume and suspending in a media different than the growth
media. Methods for concentrating a microbe are routine and known in
the art, and include, for example, filtration or centrifugation.
Typically, the concentrated microbe is suspended in an appropriate
buffer. An example of a buffer that can be used contains Tris-base
(7.3 grams/liter), at a pH of 8.5. Optionally, the final buffer
also minimizes proteolytic degradation. This can be accomplished by
having the final buffer at a pH of greater than 8.0, preferably, at
least 8.5, and/or including one or more proteinase inhibitors
(e.g., phenylmethanesulfonyl fluoride). Optionally and preferably,
the concentrated microbe is frozen at -20.degree. C. or below until
disrupted.
[0057] When the microbe is to be used as a whole cell preparation,
the harvested cells may be processed using routine and known
methods to inactivate the cells. Alternatively, when a microbe is
to be used to prepare polypeptides of the present invention, the
microbe may be disrupted using chemical, physical, or mechanical
methods routine and known to the art, including, for example,
boiling, french press, sonication, digestion of pepitdoglycan (for
instance, by digestion with lysozyme), or homogenization. An
example of a suitable device useful for homogenization is a model
C500-B Avestin Homegenizer, (A vestin Inc, Ottawa Canada). As used
herein, "disruption" refers to the breaking up of the cell.
Disruption of a microbe can be measured by methods that are routine
and known to the art, including, for instance, changes in optical
density. Typically, a microbe is subjected to disruption until the
percent transmittance is increased by 20% when a 1:100 dilution is
measured. When physical or mechanical methods are used, the
temperature during disruption is typically kept low, preferably at
4.degree. C., to further minimize proteolytic degradation. When
chemical methods are used the temperature may be increased to
optimize for the cell disruption. A combination of chemical,
physical, and mechanical methods may also be used to 10 solubilize
the cell wall of microbe. As used herein, the term "solubihze"
refers to dissolving cellular materials (e.g., polypeptides,
nucleic acids, carbohydrates) into the aqueous phase of the buffer
in which the microbe was disrupted, and the formation of aggregates
of insoluble cellular materials. Without intending to be limited by
theory, the conditions for solubilization are believed to result in
the aggregation of polypeptides of the present invention into
insoluble aggregates that are large enough to allow easy isolation
by, for instance, centrifugation.
[0058] The insoluble aggregates that include one or more of the
polypeptides of the present invention may be isolated by methods
that are routine and known to the art. Preferably, the insoluble
aggregates are isolated by centrifugation. Typically,
centrifugation of polypeptides, such as membrane polypeptides, can
be accomplished by centrifugal forces of 100,000.times.g. The use
of snch centrifugal forces requires the use of ultracentrifuges,
and scale-up to process large volumes of sample is often difficult
and not economical with these types of centrifuges. The methods
described herein provide for the production of insoluble aggregates
large enough, to allow the use of continuous flow centrifuges, for
instance T-1 Sharples (Alfa Laval Separations, Warminster, Pa.),
which can be used with a flow rate of 250 ml/minute as 17 psi at a
centrifugal force of 46,000.times.g to 60,000.times.g. Other large
scale centrifuges can be used, such as the tubular bowl, chamber,
and disc configurations. Such centrifuges are routinely used and
known in the art, and are commercially available from such
manufactures as Pennwalt, Westfalia and alpha-Laval.
[0059] The final harvested proteins are washed and/or dialyzed
against an appropriate buffer using methods known in the art, for
instance diafiltration, precipitation, hydrophobic chromatography,
ion-exchange chromatography, or affinity chromatography, or ultra
filtration and washing the polypeptides, for instance, in alcohol,
by diaflitration. After isolatron, the polypeptides suspended in
buffer and stored at low temperature, for instance, -20.degree. C.
or below.
[0060] In those aspects of the present invention where a whole cell
preparation is to be made, after growth a microbe can be killed
with the addition of an agent such as glutaraldehyde, formalin, or
formaldehyde, at a concentration sufficient to inactivate the cells
in the culture. For instance, formalin can be added at a
concentration of 0.3% (vol:vol). After a period of time sufficient
to inactivate the cells, the cells, can be harvested by, for
instance, diafiltration and/or centrifugation, and washed.
Methods of Use
[0061] An aspect of the present invention is further directed to
methods of using the compositions of the present invention. The
methods include administering to an animal an effective amount of a
composition of the present invention. The animal can be, for
instance, avian (including, for instance, chickens or turkeys),
bovine (including, for instance, cattle), caprine (including, for
instance, goats), ovine (including, for instance, sheep), porcine
(including, for instance, swine), bison (including, for instance,
buffalo), equine (including, for instance, horses), a companion
animal (including, for instance, dogs or cats), members of the
family Cervidae (including, for instance, deer, elk, moose, caribou
and reindeer), or human.
[0062] In some aspects, the methods may further include additional
administrations (e.g., one or more booster administrations) of the
composition to the animal to enhance or stimulate a secondary
immune response. A booster can be administered at a time after the
first, administration, for instance, 1 to 8 weeks, preferably 2 to
4 weeks, after the first administration of the composition.
Subsequent boosters can be administered one, two, three, four, or
more times annually. Without intending to be limited by theory, it
is expected that in some aspects of the present invention annual
boosters will not be necessary, as so animal will be challenged in
the field by exposure so microbes expressing polypeptides present
is the compositions having epitopes that are identical to or
structurally related to epitopes present on polypeptides of the
composition administered to the animal.
[0063] In one aspect, the invention is directed to methods for
making antibodies, for instance by inducing the production of
antibody in an animal, or by recombinant techniques. The antibody
produced includes antibody that specifically binds at least one
polypeptide present in the composition. In this aspect of the
invention, an "effective amount" is an amount effective to result
in the production of antibody in the animal. Methods for
determining whether an animal has produced antibodies that
specifically bind polypeptides present in a composition of the
present invention can be determined as described herein. The
present invention further includes antibody that specifically bind
to a polypeptide of the present invention, and compositions
including such antibodies. The method may be used to psoduce
antibody that specifically binds polypeptides expressed by a
microbe other than the microbe from which the polypeptides of the
composition were isolated. As used herein, an antibody that can
"specifically bind" a polypeptide is an antibody that interacts
with the epitope of the antigen that induced the synthesis of the
antibody, or interacts with a structurally related epitope. At
least some of the polypeptides present in the compositions of the
present invention typically include epitopes that are conserved in
the polypeptides of different species and different genera of
microbes. Accordingly, antibody produced using a composition
derived from one microbe is expected to bind to polypeptides
expressed by other microbes and provide breed spectrum protection
against gram positive organisms. Examples of gram positive microbes
to which the antibody may specifically bind are Micrococcaceae,
preferably, Staphylococcus spp., more preferably, Staphylococcus
aureus; members of the family Streptococcaceae, preferably,
Streptococcus pyogenes, Streptococcus pneumoniae, Streptotcoccus
agalactiae, Streptococcus uberis, Streptococcus bovis,
Streptococcus equi, or Streptococcus dysgalactiae; and Bacillus
spp., Clostridium spp., Corynebacterium spp., Enterococcus spp.,
Erysipelothrix spp., Listeria spp., Microoccus spp., and
Mycobacterium spp., Kytococcus spp., and Erysipelothrix spp.
[0064] The present invention is also directed to the use of such
antibody to target a microbe expressing a polypeptide of the
present invention or a polypeptide having an epitope structurally
related to an epitope present on a polypeptide of the present
invention. A compound can be covalently bound to an antibody, where
the compound can be, for instance, a toxin. Likewise, such
compounds can be covalently bound to a bacterial siderophore to
target the microbe. The chemical coupling or conjugation of an
antibody of the present invention, or a portion thereof (such as an
Fab fragment), can be carried out using known and routine methods.
In one aspect the invention is also directed to treating an
infection in an animal, including a human, caused by a gram
positive microbe, preferably by a member of the family
Micrococcaceae, preferably, Staphyhcoccus spp., more preferably, S.
aureus, members of the family Streptococcaceae, preferably,
Streptococcus pyogenes, Streptococcus pneumoniae, Streptococcus
agalactiae, Streptococcus uberis, Streptococcus bovis,
Streptococcus equi, or Streptococcus dysgalactiae, Bacillus spp.,
Clostridium spp., Corynebacterium spp., Enterococcus spp.,
Erysipelothrix spp., Kytococcus spp., Listeria spp., Micrococcus
spp., Mycobacterium spp., and Erysipelothrix spp. As used herein,
the term "infection" refers to the presence of a gram positive
microbe in an animal's body, which may or may not be clinically
apparent. An animal with an infection by a member of the genus
Staphylococcus that is not clinically apparent is often referred to
as an asymptomatic carrier. The method includes administering an
effective amount of the composition of the present invention to an
animal having an infection caused by a gram positive microbe, and
determining whether the number of microbes causing the infection
has decreased. Methods for determining whether an infection is
caused by a gram positive microbe are routine and known in the art,
as are methods for determining whether the infection has
decreased.
[0065] In another aspect, the present invention is directed to
methods for treating one or more symptoms of certain conditions in
an animal that may be caused by infection by a gram positive
microbe, preferably by a member of the family Micrococcaceae,
preferably, Staphylococcus spp., more preferably, S. aureus;
members of the family Streptococcacae, preferably, Streptococcus
pyogenes, Streptococcus pneumoniae, Streptococcus agalactiae,
Streptococcus uberis, Streptococcus bovis, Streptococcus equi, or
Streptococcus dysgalactiae; Bacillus spp., Clostridium spp.,
Corynebacterium spp., Enterococcus spp., Erysipelothrix spp.,
Kytococcus spp., Listeria spp., Micrococcus spp., Mycobacterium
spp., and Erysipelothrix spp. The method includes administering an
effective amount of a composition of the present invention to an
animal having or at risk of having a condition, or symptoms of a
condition, and determining whether at least one symptom of the
condition is changed, preferably, reduced. Examples of conditions
caused by microbial infections include, for instance, mastitis,
septicemia, pneumonia, meningoencephalitis, lymphangitis,
dermatitis, genital tract infections, strangles, metritis,
perinatal disease, pituitary abscesses, arthritis, bursitis,
orchitis, cystitis and pyelonephritis, caseous lymphadenitis,
tuberculosis, ulcerative lymphangitis, listeriosis, erysipelas,
laminitis, anthrax, tyzzer's disease, tetanus, botulism, enteritis,
malignant edema, braxy, bacillary hemoglobinuria, enterotoxemia,
necrotic skin lesions, and nosocomial infections. Examples of
conditions caused by S. aureus also include, for instance,
botryomycosis in horses, purulent synovitis and osteomyelitis in
poultry, abortions in swine, and tick pyemia in lambs. Examples of
conditions caused by Streptococcus spp. also include, for instance,
sore throat, scarlet fever, impetigo, ulcerative endocarditis,
rheumatic fever and post streptococcal glomerulonephritis
cervicitis in humans, cervicitis in equine and swine, and
meningitis and jowl abscesses in swine.
[0066] Treatment of symptoms associated with these conditions can
be prophylactic or, alternatively, can be initiated after the
development of a condition described herein. As used herein, the
term "symptom" refers to objective evidence in a subject of a
condition caused by infection by a microbe. Symptoms associated
with conditions referred to herein and the evaluations of such
symptoms are routine and known to the art. Treatment that is
prophylactic, for instance, initiated before a subject manifests
symptoms of a condition caused by a microbe, is referred to herein
as treatment of a subject that is "at risk" of developing the
condition. Typically, an animal "at risk" of developing a condition
is an animal present in an area where animals having the condition
have been diagnosed and/or is likely to be exposed to a microbe
causing the condition. Accordingly, administration of a composition
can be performed before, during, or after the occurance of the
conditions described herein. Treatment initiated after the
development of a condition may result in decreasing the severity of
the symptoms of one of the conditions, or completely removing the
symptoms. In this aspect of the invention, an "effective amount" is
an amount effective to prevent the manifestation of symptoms of a
disease, decrease the severity of the symptoms of a disease, and/or
completely remove the symptoms. The successful treatment of a gram
positive microbial infection in an animal is disclosed in Example
5, which demonstrates the protection against disease caused by S.
aureus in mouse models by administering a composition of the
present invention. These mouse models are a commonly accepted model
for the study of human disease caused by these microbes. The
successful treatment of a gram positive microbial infection in an
animal is also disclosed in Examples 10-12, which demonstrates the
protection against disease caused by S. aureus in cows by
administering a composition of the present invention.
[0067] The present invention also provides methods for decreasing
colonization by gram positive microbes, for instance blocking the
attachment sites of gram positive microbe, including tissues of the
skeletal system (for instance, bones, cartilage, tendons and
ligaments), muscular system, (for instance, skeletal and smooth
muscles), circulatory system (for instance, heart, blood vessels,
capillaries and blood), nervous system (for instance, brain, spinal
cord, and peripheral nerves), respiratory system (for instance,
nose, trachea lungs, bronchi, bronchioceles, alveoli), digestive
system (for instance, mouth, salivary glands oesophagas liver
stomach large and small intestine), excretory system (for instance,
kidneys, ureters, bladder and urethra), endocrine system (for
instance, hypothalamus, pituitary, thyroid, pancreas and adrenal
glands), reproductive system (for instance, ovaries, oviduct,
oterus, vagina, mammary glands, testes, and seminal vesicles),
lymphatic/immune systems (for instance, lymph, lymph nodes and
vessels, mononuclear or white blood cells, such as macrophages,
neutrophils, monocytes, eosinophils, basophils, lymphocytes t-and
b-cells), and specific cell lineages (for instance, precursor
cells, epithelial cells, stem cells), and the like. Preferably, the
gram positive microbe is a member of the family Micrococcaceae,
preferably, Staphylococcus spp., more preferably, S. aureus; a
member of the family Streptooccaceae, preferably, Streptococcus
pyogenes, Streptococcus pneumoniae, Streptococcus agalactiae,
Streptococcus uberis, Streptococcus bovis, Streptococcus equi, or
Steptococcus dysgalactiae; Bacillus spp., Clostridium spp.,
Cornebacterium spp., Entercococus spp., Erysipelothrix spp.,
Kytococcus spp., Listeria spp., Micrococcus spp., Mycobacterium
spp., and Erysipelothrix spp. The method includes administering an
effective amonnt of a composition of the present invention to an
animal colonized by, or at risk of being colonized by, a gram
positive microbe. In this aspect of the invention, an "effective
amount" is an amount sufficient to decrease colonization of the
animal by the microbe. Methods for evaluating the colonization of
an animal by a microbe are routine and known in the art. For
instance, colonization of an animal's intestinal tract, by a
microbe can be determined by measuring the presence of the microbe
in the animal's feces. It is expected that decreasing the
colonization of an animal by a microbe will reduce transmission of
the microbe to humans.
[0068] A composition of the invention can be used to provide for
active or passive immunization against bacterial infection.
Generally, the composition can be administered to an animal to
provide active immunization. However, the composition can also be
used to induce production of immune products, such as antibodies,
which can be collected from the producing animal and administered
to another animal to provide passive immunity. Immune components,
such as antibodies, can be collected to prepare compositions
(preferably containing antibody) from serum, plasma, blood,
colostrum, etc. for passive immunization therapies. Antibody
compositions including monoclonal antibodies and/or anti-idioltypes
can also be prepared using known methods. Chimeric antibodies
include human-derived constant regions of both heavy and light
chains and murine-derived variable regions that are
antigen-specific (Morrison et al., Proc. Natl. Acad. Sci. USA,
1984, 81(21):6851-5; LoBuglio et al., Proc. Natl. Acad. Sci. USA,
1989, 86(11):4220-4; Boolianne et al. Nature, 1984,
312(5995):643-6), Humanized antibodies substitute the murine
constant and framework (FR) (of the variable region) with the human
counterparts (Jones et al., Nature, 1986, 321(6069):522-5;
Riechmann et al., Nature, 1988, 332(6162);323-7; Verboeyen et al.,
Science, 1988, 239(4847); 1534-6; Queen et al., Proc. Natl. Acad.
Sci. USA, 1989, 86(24): 10029-33; Daugerty et al., Nucleic Acids
Res., 1991, 19(9): 2471-6.). Alternatively, certain mouse strains
can be used that have been genetically engineered to produce
antibodies that are almost completely of human origin; following
immunization the B cells of these mice are harvested and
immortalized for the production of human monoclonal antibodies
(Bruggeman and Taussig, Curr. Opin. Biotechnol., 1997, 8(4);455-8;
Lonberg and Huszar, Int. Rev. Immunol., 1995; 13(1):65-93; Lonberg
et al., Nature, 1994, 368:856-9; Taylor et al., Nucleic Acids Res.,
1992, 20:6287-95). Passive antibody compositions and fragments
thereof, e.g., seFv, Fab, F(ab').sub.2 or Fv or other modified
forms thereof, may be administered to a recipient in the form of
serum, plasma, blood, colostrum, and the like. However, the
antibodies may also be isolated from serum plasma, blood,
colostrun, and the like, using known methods for later use in a
concentrated or reconstituted form such as, for instance, lavage
solutions, impregnated dressings and/or topical agents and the
like. Passive immunization preparations may be particularly
advantageous for the treatment of acute systemic illness, or
passive immunization of young animals that failed to receive
adequate levels of passive immunity through maternal colostrum.
Antibodies useful for passive immunization may also be useful to
conjugate to various drugs or antibiotics that could be directly
targeted to bacteria expressing during a systemic or localized
infection a polypeptide of the present invention or a polypeptide
having an epitope structurally related to art epitope present on a
polypeptide of the present invention.
[0069] Animal models, in particular mouse models, are available for
experimentally evaluating the compositions of the present
invention. These mouse models are commonly accepted models for the
study of human disease caused by members of the genus
Staphylococcus, and S. aureus in particular. In those cases where a
members of the genus Staphylococcus causes disease in an animal,
for instance a cow, the natural host can be used to experimentally
evaluate the compositions of the present invention.
[0070] Another aspect of the present invention provides methods for
detecting antibody that specifically binds polypeptides of the
present. invention. These methods are useful in, for instance,
detecting whether an animal has antibody that specifically binds
polypeptides of the present invention, and diagnosing whether an
animal may have a condition caused by a microbe expressing
polypeptides described herein, or expressing polypeptides that
share epitopes with the polypeptides described herein. Such
diagnostic systems may be in kit form. The methods include
contacting an antibody with a preparation that include a
polypeptide of the present invention to result in a mixture. The
antibody may be present in a biological sample, for instance,
blood, milk, or colostrum. The method leather includes incubating
the mixture under conditions to allow the antibody to specifically
bind the polypeptide to form a polypeptide:antibody complex. As
used herein, the term polypeptide:antibody complex refers to the
complex that results when an antibody specifically binds to a
polypeptide. The preparation that includes the polypeptides of the
present invention may also include reagents, for instance a buffer,
that provide conditions appropriate for the formation of the
polypeptide:antibody complex. The polypeptide-antibody complex is
then detected. The detection of antibodies is known in the art and
can include, for instance, immunofluorescence or peroxidase. The
methods for detecting the presence of antibodies that specifically
bind to polypeptides of the present invention can be used in
varions formats that have been used to detect antibody, including
radioimmunoassay and enzyme-linked immunosorbent assay.
[0071] The present invention also provides a kit for detecting
antibody that specifically binds polypeptides of the present
invention. The antibody detected may be obtained from as animal
suspected to have an infection caused by a gram positive microbe,
more preferably, a member of the family Micrococcaceae, preferably
Staphylococcus spp., more preferably, S. aureus; Streptococcus
spp., Bacillus spp., Clostridium spp., Corynebacterium spp.,
Enterococcus spp., Erysipelothrix spp., Kytococcus spp., Listeria
spp., Micrococcus spp., Mycobacterium spp., and Erysipelothrix
spp.
[0072] The kit includes at least one of the polypeptides of the
present invention, or a numbers of polypeptides that is an integer
greater than 1 (e.g., at least 2, at least 3, etc.), in a suitable
packaging material in an amount sufficient for at least one assay.
Optionally, other reagents such as buffers and solutions needed to
practice the invention are also included. For instance, a kit may
also include a reagent to permit defection of an antibody that
specifically binds to a polypeptide of the present invention, such
as a detectably labeled secondary antibody designed to specifically
bind to an antibody obtained from an animal. Instructions for use
of the packaged polypeptides are also typically included. As used
herein, the phrase "packaging material" refers to one or more
physical structures used to house the contents of the kit. The
packaging material is constructed by well known methods, generally
to provide a sterile, contaminant-free environment. The packaging
material may have a label which indicates that the polypeptides can
be used for detecting antibody that specifically binds polypeptides
of the present invention. In addition, the packaging material
contains instructions indicating how the materials within the kit
are employed to detect the antibody. As used herein, the term
"package" refers to a container such as glass, plastic, paper,
foil, and the like, capable of holding within fixed limits the
polypeptides, and other reagents, for instance a secondary
antibody. Thus, for example, a package can be a microtiter plate
well to which microgram quantities of polypeptides have been
affixed,. A package can also contain a secondary antibody,
"Instructions for use" typically include a tangible expression
describing the reagent concentration or at least one assay method
parameter, such as the relative amounts of reagent and sample to be
admixed, maintenance time periods for reagent/sample admixtures,
temperature, buffer conditions, and the like.
[0073] The present invention is illustrated by the following
examples. It is to be understood that the particular examples,
materials, amounts, and procedures are to be interpreted broadly in
accordance with the scope and spirit of the invention as set forth
herein.
EXAMPLES
Example 1
Preparation of Iron Regulated Proteins Laboratory Scale
[0074] Compositions derived from different strains of
Staphylococcus aureus including novel proteins expressed under
iron-restriction and/or other degrees of metal ion chelation were
evaluated for efficacy against a virulent challenge in mice. The
efficacy of the composition was evaluated by collecting data on the
following parameters (1) the efficacy of each composition to
provide homologous and heterologous protection against a live
virulent challenge in mice, (2) the efficacy of each composition to
reduce necrotic skin lesions, and (3) the efficacy of compositions
derived from Staphylococcus grown in replete and deplete iron
conditions to provide protection.
[0075] The Staphylococcus aureus strains evaluated in this study
originated from three animal species; avian, human and bovine. The
avian isolate SAAV1 was a field isolate originating from a flock of
diseased turkeys having a high degree of osteomyelitis and
synovitis. The bovine isolates (strain 1477 and strain 2176) were
isolated from two different commercial dairy herds having a high
incidence of clinical mastitis. The human isolate was obtained from
the ATCC (strain 19636), and originated from a patient having
clinical osteomyelitis.
[0076] Master seed stocks of each isolate were prepared by
inoculating the appropriate isolate into 200 ml of Tryptic Soy
Broth (TSB, Difco Laboratories, Detroit, Mich.) containing 300
.mu.M 2,2-dipyribyl (Sigma-Aidrich St. Louis, Mo.). The culture was
grown while stirring at 200 rpm for 6 hours at 3.degree. C., and
collected by centrifugation at 10,000.times.g. The bacterial pellet
was re-suspended into 100 ml TSB broth containing 20% glycerol, and
sterilely dispensed into 2 ml cryogenic vials (1 ml per vial) and
stored at -90.degree. C. until use.
[0077] Each master seed stock was expanded into a working seed. One
vial of each master seed isolate was inoculated into 200 ml of
Tryptic Soy Broth (TSB, Difco Laboratories, Detroit, Mich.)
containing 1000 .mu.M 2,2-dipyridyl (Sigma-Aldrich St, Louis, Mo.).
The culture was grown while stirring at 200 rpm for 6 hours at
37.degree. C., and collected by centrifugation at 10,000.times.g.
The bacterial pellet was resuspended into 100 ml TSB broth
containing 20% glycerol, and sterilely dispensed into 2 ml
cryogenic vials (1 ml per vial) and stored -90.degree. C. and use.
The working seed was used for the production of compositions
enriched with iron-regulated membrane proteins, including
iron-regulated membrane proteins.
[0078] All strains were adapted to grow in highly iron-depleted
media (i.e., media containing very low levels of free iron). This
was accomplished by sub-culturing the bacteria in TSB containing
increasing concentrations of 2,2-dipyridyl (from 300 to 1600
.mu.M).
[0079] Proteins were prepared from bacteria as follows. The
bacteria were grown from frozen working seed stocks by subculturing
into 25 ml of iron-deplete media (containing 1000 .mu.M
2,2'-dyipyridyl) and iron-replete media, then incubated at
37.degree. C. while shaking at 400 rpm. Following 12 hours of
incubation, 5 ml of each culture was transferred into 500 ml of
iron-deplete or iron-replete media pre-incubated at 37.degree. C.
Cultures were incubated for 8 hours at 37.degree. C. while shaking
at 100 rpm, then cells were pelleted by centrifugation at
10,000.times.g for 20 minutes. Bacterial pellets were resuspended
in 100 ml of sterile physiological saline and centrifuged at
10,000.times.g for 10 minutes. Pellets were then resuspended in 45
ml of Tris-buffered saline, pH 7.2 (TBS; 25 mM Tris, 150 mM NaCl)
and the resulting bacterial suspensions were dispensed as 9-ml
aliquots into 5 individual tubes. One milliliter of TBS containing
50 units of lysostaphin (Sigma, St. Louis, Mo.) was added to each
tube to give a final volnme of 5 units/ml. Following incubation at
37.degree. C. for 30 minutes while shaking at 200 rpm, 1 ml of TBS
containing 0.1 mg of lysoxyme (Sigma) was added to each tube. The
bacterial suspensions were then incubated for an additional 45
minutes while shaking at 200 rpm. Next, suspensions were
centrifuged at 3050.times.g for 12 minutes at 4.degree. C. to
pellet large cellular debris. The supernatants were collected by
aspiration without disturbing the pellet. The supernatant was then
cenrtrifuged at 39,000.times.g for 25 hours. The resulting pellets
containing the proteins were resupended into 200 .mu.L. Tris
buffer, pH 7.2, without saline. The protein solution for each
isolate were combined for a total volume of 1 ml and stored at
-90.degree. C.
[0080] The protein-enriched extracts derived from S. aureus were
size-fractionated on SDS-PAGE gels using a 4% stacking gel and 10%
resolving gel. Samples for electrophoresis were prepared by
combining 10 .mu.l of sample with 30 .mu.l of SDS reducing sample
buffer (62.5 mM Tris-HCL pH 6.8, 20% glycerol, 2% SDS, 5%
.beta.-mercaptoethanol) and boiled for 4 minutes. Samples were
electrophoresed at 18 mA constant current for 5 hours at 4.degree.
C. using a Protein U xi cell power supply (BioRad Laboratories,
Richmond, Calif., model 1000/300). The molecular weight of each
iindivldual protein as visually seen in the SDS-PAGE was estimated
using a GS-800 densitometer (BioRad) using a broad range molecular
weight marker as a reference standard (BioRad).
[0081] The SDS-PAGE patterns of the proteins from each isolate when
grown in the presence of 1000 .mu.M dipyridyl showed a very
different protein expression pattern compared to the same strain
when grown in the presence of 300 .mu.M dipyridyl. For instance,
when grown in 300 .mu.M dipyridyl isolate SAAV1 resulted in metal
regulated proteins of 90 kDa, 84 kDa, 72 kDa, 66 kDa, 36 kDa, 32
kDa, and 22 kDa, while growth in 1600 .mu.M dipyridyl resulted in
metal regulated proteins of 87.73 kDa, 54.53 kDa, 38.42 kDa, 37.37
kDa, 35.70 kDa, 34.91 kDa, and 33.0 kDa. Likewise, when grown in
300 .mu.M dipyrldyl isolate 19636 resulted in proteins of 42 kDa
and 36 kDa, while growth in 1600 .mu.M dipyridyl resulted in metal
regulated pmrteins of 87.73 kDa, 54.53 kDa, 38.42 kDa, 37.37 kDa,
35.70 kDa, 34.91 kDa, and 33.0 kDa. All conditions, including
growth in iron-replete media, resulted in the expression of the
following proteins that were presumably not metal regulated: 150
kDa, 132 kDa, 120 kDa, 75 kDa, 58 kDa, 50 kDa, 44 kDa 43 kDa 41
kDa, and 40 kDa.
[0082] Furthermore, growth of the different strains of S. aureus in
1600 .mu.M dipytidyl resulted in similar protein expression
pattens. The compositions enriched in iron-regulated membrane
proteins from the avian isolate (SAAV1) included proteins with
molecular weights of 87.73 kDa, 54.53 kDa, 38.42 kDa, 37.37 kDa,
35.70 kDa, 34.91 kDa, and 33.0 kDa. The molecular weights of the
proteins from the ATCC isolate 19636 were essentially identical to
those from the avian isolate. Both bovine isolates, when grown with
1600 .mu.M 2,2-dipyridyl, expressed similar banding profiles as the
avian and ATCC isolates for the majority of the proteins (87.73
kDa, 54.53 kDa, 37.7 kDa, 35.70 kDa, 34.91 kDa, and 33.0 kDa).
However, neither of the bovine isolates produced the 38.42 kDa
protein seen with the avian and ATCC isolates, and the bovine
isolates expressed three proteins (80.46 kDa, 65.08 kDa, and 31.83
kDa) not observed with the avian and ATCC strains (see FIG. 1 and
Table 10). All conditions resulted in the expression of the
following proteins that were not metal regulated: 150 kDa, 132 kDa,
120 KDa, 75 kDa, 58 kDa, 50 kDa, 44 kDa, 43 kDa, 41 kDa, and 40
kDa.
TABLE-US-00010 TABLE 10 Molecular weights of metal regulated
polypeptides obtained from Staphylococcus aureus isolates. Avian
Human Bovine Bovine SAAV1 19636 1477 2176 87.73 87.73 87.73 87.73
-- -- 80.46 80.46 -- -- 65.08 65.08 54.53 54.53 54.53 54.53 38.42
38.42 -- -- 37.37 37.37 37.37 37.37 35.70 35.70 35.70 35.70 34.91
34.91 34.91 34.91 33.0 33.0 33.0 33.0 31.83 31.83
[0083] Interestingly, there was no difference in the protein
profiles as examined by SDS-PAGE between the clarified supernatant
and the bacterial pellet after treating the bacteria with
lysostaphin/lysozyme. Both the extracted bacterial pellet and the
supernatant had exactly the same protein profiles as examined by
SDS-PAGE. This same observation was also seen when disrupting the
bacterial cells using an Avestin homogenizer at 30,000 psi. The
resultant bacterial pellet, after slow speed cenfrifugation was
identical in its protein profile as compared to the clarified
supernatant after high speed centrifugation at 30,000.times.g for
2.0 hours at 4.degree. C.
Example 2
Preparation of the Immunizing Compositions Derived from
Staphylococcus aureus
[0084] The proteins from the human isolate ATCC 19636 and the
bovine isolate 1477, grown in iron-deplete conditions and prepared
as described in Example 1, were used to formulate two vaccine
compositions. The proteins from the ATCC isolate had molecular
weights of 87.73 kDa, 54.53 kDa, 38.42 kDa, 37.37 kDa, 35.70 kDa,
34.91 kDa, and 33.0 kDa, while the bovine isolate expressed
proteins having molecular weights 87.73 kDa, 80.46 kDa, 65.08 kDa,
54.53 kDa, 37.37 kDa, 35.70 kDa, 34.91 kDa, 33.0 kDa, and 31.83.
Each composition also contained the following proteins that were
not metal regulated: 150 kDa, 132 kDa, 120 kDa, 75 kDa, 58 kDa, 50
kDa, 44 kDa, 43 kDa, 41 kDa, and 40 kDa. Stock vaccines were
prepared from the two strains by emulsifying each aqueous protein
suspension (500 .mu.g total protein/ml) into a commercial adjuvant
(EMULSIGEN, MVP Laboratories, Ralston, Nebr.) using an IKA Ultra
Turrax T-50 homogenizing vessel (IKA, Cincinnati, Ohio) to give a
final dose of 50 .mu.g total protein in a 0.1 ml injectable volume
with an adjuvant concentration of 22.5% vol/vol. As a control
vaccination, a protein composition was prepared from the bovine
isolate 1477 grown under iron-replete conditions (TSB supplemented
with 300 .mu.M ferric chloride) as described is Example 1. A
placebo vaccine was prepared by substituting physiological saline
for the aqueous protein suspension in the above protocol.
Example 3
Moose Vaccination
[0085] Seventy (N=70) female CF-1 mice obtained from Harlan
Breeding Laboratories (Indianapolis, Ind.) weighing 16-22 grams
were equally distributed into 7 groups (10 mice/group). Mice were
housed in polycarbonate mouse cages (Ancore Corporation, Bellmore,
N.Y.). A single cage was used for each treatment gnaop and food and
water was supplied ad libitum to all mice. All mice were vaccinated
intraperitonally with 0.1 ml of the appropriate composition two
times at 14 day intervals as follows:
[0086] Group-1: Placebo-Vaccinated
[0087] Group-2: Vaccinated with ATCC 19636 proteins expressed under
iron-restriction.
[0088] Group-3: Placebo-Vaccinated
[0089] Group-4: Vaccinated with Bovine 1477 proteins expressed
under iron-restriction.
[0090] Group-5: Vaccinated with Bovine 1477 proteins expressed
under iron-restriction.
[0091] Group-6: Vaccinated with ATCC 19636 proteins expressed under
iron-restriction.
[0092] Group-7: Bovine 1477 FeCl.sub.3-Vaccinated, where "Bovine
1477 FeCl.sub.3" refers to proteins obtained from Bovine 1477 grown
in TSB supplemented with 300 .mu.M ferric chloride.
Example 4
Preparation of Challenge Organists
[0093] The previously described Staphylococcus aureus strains ATCC
19636 and strain 1477 were used as challenge organisms. Briefly,
the isolates from frozen stocks (previously described) were
streaked onto blood agar plates and incubated at 37.degree. C. for
18 hours. A single colony of each isolate was subcultured into 50
ml Tryptic Soy Broth (Difco) containing 1600 .mu.M 2,2' dipyridyl.
The cultures were incubated at 3.degree. C. for 6 hours while
rotating at 200 rpm, then centrifuged at 10,000.times.g for 10
minutes at 4.degree. C. to pellet the bacteria. The final pellets
were washed twice by centrifugation in TBS at 4.degree. C. The
final pellets were resuspended in TBS to an optical density of 42%
Transmittance (T) at 562 nm in a volume of approximately 25 ml of
TBS and used for challenge. Just prior to challenge, 1 ml of these
bacterial suspensions was serially diluted and plated on agar to
enumerate the number of colony-forming units (CFU) per mouse
dose.
Example 5
Challenge
[0094] Fourteen days after the second vaccination, mice in all
groups (1 -7) were subcutaneously challenged in the back of the
neck with 0.1 ml of the appropriate organism. The seven groups of
mice were challenged as follows:
[0095] Group-1 (Placabo-Vacinated): Challenged with ATCC 19636
[0096] Group-2 (Vaccinated with ATCC 19636 proteins expressed under
iron-restriction): Challenged with ATCC 19636
[0097] Group-3 (Placebo-Vaccinated): Challenged with Bovine
1477
[0098] Group-4 (Vaccinated Bovine 1477 proteins expressed under
iron-restriction): Challenged with Bovine 1477
[0099] Group-5 (Vaccinated Bovine 1477 proteins expressed under
iron-restriction): Challenged with ATCC 19636
[0100] Group-6 (Vaccinated ATCC 19636 proteins expressed under
iron-restriction); Challenged with Bovine 1477
[0101] Group-7 (Bovine 1477 FeCl.sub.3-Vaccinated): Challenged with
Bovine 1477
[0102] As determined by the enumeration protocol described in
Example 4, the concentration of S. aureus 19636 used for challenge
was 1.35.times.10.sup.8 CFU per mouse dose, and the concentration
of S. aureus 1477 used for challenge was 1.65.times.10.sup.8 colony
CFU per mouse dose. Morbidity, mortality and gross pathology were
recorded daily for 7 days after challenge.
[0103] When comparing the mice challenged with the ATCC 19636
isolate, 70% of the placebo-vaccinated Group 1 mice died within 7
days of challenge (Table 11 and FIG. 2). This demonstrated that
strain 19636 caused a high rate of mortality in mice at the dose
level administered. In contrast to the mice in Group 1, only 10% of
the mice in Group 2 died within 7 days post-challenge. These
results illustrated that the mice challenged with strain 19636 were
significantly protected by vaccination with the 19636 composition
(p=0.020, Fischer's Exact test). Furthermore, a Kaplan-Meier
analysis of the time-to-death data indicated that the vaccine
afforded significant (p=0.0042, logrank test) protection against
homologous challenge (FIG. 3). In addition, only 20% of the mice in
Group 5 died within 7 days of challenge, indicating that the bovine
1477 composition offered significant protection against challenge
with the ATCC 19636 strain (p=0.015 logrank test for mortality).
When the data was analyzed by a Kaplan-Meier survival curve and
logrank test (FIG. 4), the protection against mortality was
detennined to be significant (p=0.015 logrank test for mortality),
indicating that the vaccine composition derived from strain 1477
provided heterologous-protection against challenge with strain
19636.
TABLE-US-00011 TABLE 11 Mortality of Vaccinated and Non-Vaccinated
Mice Following Challenge with Staphylococcus aureus (human ATCC
isolate 19636 and bovine isolate 1477). Percent Groups # Mice #
Dead mortality (%) Group-1* (Placebo, ATCC 19636 10 7/10 70 Chlg)
Group-2* (ATCC 19636, 10 1/10 10 Homologous Chlg) Group-3*
(Placebo, Bovine 1477 10 2/10 20 Chlg) Group-4* (Bovine 1477, 10
1/10 10 Homologous Chlg) Group-5* (Bovine 1477, 10 2/10 20
Heterologous Chlg) Group-6* (ATCC 19636, 10 0/10 0 Heterologous
Chlg) Group-7* (Bovine 1477 FeCl.sub.3, 10 2/10 20 Bovine 1477
Chlg) *Group-1, (Placebo-Vaccinated/Challenged with ATCC 19636)
*Group-2 (Vaccinated with ATCC 19636 proteins expressed under
iron-restriction/Challenged with ATCC 19636) *Group-3
(Placebo-Vaccinated/Challenged with Bovine 1477) *Group-4
(Vaccinated with Bovine 1477 proteins expressed under
iron-restriction/Challenged with Bovine 1477) *Group-5 (Vaccinated
with Bovine 1477 proteins expressed under
iron-restriction/Challenged with ATCC 19636) *Group-6 (Vaccinated
with ATCC 19636 proteins expressed under
iron-restriction/Challenged with Bovine 1477) *Group-7 (Bovine 1477
FeCl.sub.3 -Vaccinated/Challenged with Bovine 1477)
[0104] When comparing the mice challenged with the bovine 1477
isolate, only 20% of the mice in the placebo-vaccinated group
(Group 3) died within 7 days of challenge. However, challenge with
the bovine 1477 isolate elicited the development of necrotic skin
lesions on 6 (75%) of the surviving mice of Group 3. These lesions
were measured and the average size of the lesions on the surviving
mice was 18.5 mm (Table 12). In contrast, 20% of the Group 4 mice
died within 7 days of challenge, but only three (38%) of the
surviving mice developed lesions (average diameter, 2.7 mm). These
results indicate that the bovine 1477 composition offered
significant homologous protection against development of lesions in
the mice challenged with the bovine strsra 1477 (p=0.009, Student's
t-test). In addition, vaccination, with the ATCC 19636 composition
protected against challenge with strain 1477, since no mice died in
Group 6 and only three (30%) of the mice developed skin lesions
(average diameter, 3.7 mm). Taken together, the reduced mortality
and/or lesion development in the mice in Groups 5 and 6 demonstrate
the significant cross-protective nature of the compositions derived
from strains 19636 and 1477 (p=0.012, Students t-test based on
lesion size). In demonstration of the efficacy of the composition
as compared to the non-iron regulated proteins, 20% of the mice in
Group 7 died and 4 of the survivors developed skin lesions (average
diameter, 15.8 mm). The mice of Group 7 demonstrated some degree of
protection by vaccination with the proteins of the 1477 isolate
since fewer mice developed lesions compared to the
placebo-vaccinated Group 3. However, the skin lesions observed on
the mice in group 7 were more frequent and of a larger diameter
than the lesions an the mice of Group 4, indicating that, relative
to proteins isolated from cells grown under iron-replete
conditions, the proteins isolated from bacteria grown under iron
restriction offered superior protection against so identical
challenge.
TABLE-US-00012 TABLE 12 The Induction of Necrotic Lesions in Mice
Seven Days Post-Challenge with Staphylococcus aureus (ATCC Isolate
19636 and/or Bovine Isolate 1477) Group-1 Group-2 Group-3 Group-4
Group-5 Group-6 Group-7 Lesion diameter (millimeter) per mouse No
No lesion 26 5 5 5 25 lesion No No lesion 25 2 No lesion 5 25
lesion No No lesion 24 1 No lesion 1 10 lesion Dead No lesion 24 No
lesion No lesion No 3 lesion Dead No lesion 7 No lesion No lesion
No No lesion lesion Dead No lesion 5 No lesion No lesion No No
lesion lesion Dead No lesion No No lesion No lesion No No lesion
lesion lesion Dead No lesion No No lesion No lesion No No lesion
lesion lesion Dead No lesion Dead No lesion Dead No Dead lesion
Dead Dead Dead Dead Dead No Dead lesion Average lesion diameter
(mm) among surviving mice 0 0 18.5 2.7 5 3.7 15.8 Group-1,
(Placebo-Vaccinated/Challenged ATCC 19636) Group-2 (Vaccinated with
ATCC 19636 proteins expressed under iron-restriction/Challenged
ATCC 19636) Group-3 (Placebo-Vaccinated/Challenged Bovine 1477)
Group-4 (Vaccinated with Bovine 1477 proteins expressed under
iron-restriction/Challenged Bovine 1477) Group-5 (Vaccinated with
Bovine 1477 proteins expressed under iron-restriction/Challenged
ATCC 19636) Group-6 (Vaccinated with ATCC 19636 proteins expressed
under iron-restriction/Challenged Bovine 1477) Group-7 (Bovine 1477
FeCl.sub.3 Vaccinated/Challenged Bovine 1477)
[0105] The cross-protective nature of the proteins observed in the
mouse challenge study is supported by the similar molecular weights
of the proteins from the S. aureus strains described in Example 1
(FIG. 1). Althongh there were noticeable differences in the
SDS-PAGE profile of the proteins from the bovine-derived isolates,
specifically the absence of a 38.4 kDa protein and the presence of
3 additional proteins, the proteins from both strains 1477 and ATCC
19636 elicited heterologous protection. These results indicate that
the similar proteins between strains 19636 and 1477 are likely
responsible for the cross-protection observed in Groups 5 and 6. By
contrast, the protein profiles from strain 1477 grown under
iron-deplete and iron-replete conditions are observably different.
Those proteins isolated under iron-depleted conditions are more
protective when compared to the proteins isolated under
iron-replete conditions, demonstrated by the seduction in lesion
development among the once of Croup 4 compared to the mice of Group
7.
Example 6
[0106] In mammals, it has been shown that the response to tissue
injury or bacterial infection results in as acute inflammatory
response. This response increases capillary permeability and
phagocytic infiltration resulting in the clinical signs recognized
as inflammation; swelling, fever, pain and redness; if left
uncontrolled, this may lead to death. The activation of humoral
factors and the release of cytokines mediate systemic events
collectively known as the acute phase protein response which
results in a cascade of physiological and biochemical events. The
duration of this response is directly related to the severity of
the injury and magnitude of the systemic infection. It has been
well-documented that during bacterial sepsis, major surgery, burns
and other bodily trauma there is an alteration in the concentration
of a number of metal ions in serum such as, iron, copper, and zinc.
For instance, dating the acute phase of an infection there is a
decrease in plasma levels of iron and zinc and an increase in
copper. The alteration of these trace metal ions in serum may
directly affect the severity or progression of any bacterial
infection.
[0107] In this study we examined the expression of proteins of
Staphylococcus aureus under various conditions of metal ion
restriction in order to mimic the expression of novel proteins that
may be expressed during systemic invasion. The Staphylococcus
aureus strains evaluated in this study originated from clinical
samples of three different species of animal; avian (strain SAAV1),
human (strain 19636), and bovine (strains 1477 and 2176). Briefly,
cultures of each isolate were prepared from master seed stocks in
200 ml of Tryptic Soy Broth (TSB). Each culture was grown while
stirring at 200 rpm for 6 hours at 37.degree. C. Ten ml of each
culture were transferred into 500 ml of deplete TSB containing one
of four metal ion chelators; 2,2-dipyridyl (Dp),
2-pyridylmethyl-ethylene diamine (TPEN), catechin, and naringenin
(all obtained from Sigma, St. Louis, Mo.). In addition each culture
was also grown in cation-replete media containing ferric chloride,
zinc chloride and/or copper chloride prepared 300 .mu.M
concentrations. The metal ion chelators were used at the following
concentration; 2,2-dipridyl (800 .mu.M), catechin and naringenin
were used at 300 .mu.M, and 2-pyridylmethyl-ethylene diamine was
used at a concentration of 100 .mu.M. Cultures were grown with each
chelator for 8 hours, at which point the culture was subcultured a
second time for an additional 12 hours. Each culture was
subcultured for three consecutive passes at 12-hour intervats. At
the end of the third pass, each culture was harvested by
centrifugation at 10,000.times.g for 20 minutes. Each culture was
washed twice by centrifugation at 10,000.times.g and resuspended in
20 ml Tris-buffered saline, pH 7.2 at 4.degree. C.
[0108] Each bacterial pellet was resuspended in 45 ml of
Tris-buffered saline, pH 7.2 (25 mM Tris and 150 mM NaCl) and the
resulting bacterial suspensions were dispensed as 9-ml aliquots
into 5 individual tubes, twenty tubes total. One milliliter of TBS
containing 50 units of lysostaphin (Sigma, St. Louis, Mo.) was
added to each tube to give a final concentration of 5 units/ml.
Following incubation at 37.degree. C. for 30 minutes while shaking
at 200 rpm, 1 ml of IBS containing 0.1 mg of lysosyme (Sigma) was
added to each tube. The bacterial suspensions were then incubated
for an additional 45 minutes while shaking at 200 rpm. Next,
suspensions were centrifuged at 3050.times.g for 12 minutes at
4.degree. C. to pellet large cellular debris. The supernatants were
collected by aspiration without disturbing the pellet. The
supernatant was then centrifuged at 39,000.times.g for 2.5 hours.
The resulting pellets, enriched for petal-regulated membrane
proteins, were resuspended in 200 .mu.L Tris buffer, pH 7.2. The
protein solutions for each isolate were combined for a total volume
of 1 ml and stored at -90.degree. C.
[0109] The proteins obtained from the SAAV1, 19636, 1477 and 2176
S. aureus isolates grown under iron, zinc and copper deplete
conditions included metal-regulated polypeptides.
[0110] Cell extracts, derived from each isolate were
size-fractionated on SDS-PAGE gels using a 4% stacking gel and 10
.mu.l resolving gel. Samples for electrophoresis were prepared by
combining 10 .mu.l of sample with 30 .mu.l of SDS reducing sample
buffer (62.5 mM Tris-HCL ph 6.8, 20% glycerol, 2% SDS, 5%
beta-mercaptoethanol) boiled for 4 minutes. Samples were
electrophoresed 18 mA of constant current for 5 hours at 4.degree.
C. using a Protein II xi cell power supply (BioRad Laboratoties,
Richmond, Calif., model 1000/500).
[0111] The SDS-PAGE patterns of the proteins grown under zinc
and/or copper chelation showed unique handing patterns in all
isolates that were different when compared to the same isolates
grown under iron-restriction in the presence of 2,2'-dyipvridyl.
For example, when the 19636 isolate was grown under
iron-restriction or in the presence of the chelator
2,2'-dyipyridyl, unique iron-regulated proteins were expressed at
the 87.73 kDa, 54.53 kDa, 38.42 kDa, 37.37 kDa, 35.70 kDa, 34.91
kDa and 33.0 kDa regions. These proteins were downregulated when
the isolate was grown in the presence of ferric chloride. However,
when the same isolate was grown in the presence of the zinc and or
copper chelator, a novel subsets of proteins was expressed relative
to the proteins expressed under iron-restriction; the new proteins
having molecular weights of approximately 115 kDa, 88 kDa, 80 kDa,
71 kDa, 69 kDa, 35 kDa, 30 kDa, 29 kDa and 27 kDa. In addition, an
87.73 kDa protein was expressed under conditions of iron
restriction or copper-restriction but not when cultures were
zinc-restricted. The proteins expressed under iron-restriction
appeared to be downregulated when growth was under either
zinc-restriction and/or copper-restriction but not completely shut
off as seen when the isolate was grown in ferric chloride.
[0112] It appears that there are novel proteins expressed when the
organism is grown under copper-restriction and/or zinc-restriction
that are not expressed when the same isolate is grown under
iron-restricted conditions. Since transitional metals are used by
organisms to build enzymes that catalyze various biochemical
reactions, the metal ions may play a vital role in microbial
survival during a systemic infection. It is perhaps for this reason
that during sepsis there is a transient decrease in the
availability of these transitional metals, making them unavailable
for growth of the organism. These novel proteins could very well
enhance the protective efficacy of the existing composition grown
under non-restriction because they may also be expressed by the
bacteria under the metal ion resiriction experienced during
systemic invasion.
Example 7
Compositions of the Present Invention can also be Produced Under
Large Scale Commercial Conditions
Fermentation
[0113] A cryogenic vial of the working seed (2 ml at 10.sup.9
CFU/ml) as described in Example 1 was used to inoculate 500 ml of
Tryptic Soy Broth (TSB) without dextrose (Difco) pre-warmed to
37.degree. C. containing 0.125 g/l 2,2-dipyridyl (Sigma), 2.7 grams
BiTek yeast extract (Difco) and glycerol (3% vol/vol). The culture
was incubated at 37.degree. C. for 12 hours while storing at 200
rpm at which time it was used to inoculate 2 liters of the above
media and allowed to grow for an additional 4 hours at 37.degree.
C. This culture was used to inoculate a 20-liter Virtis bench-top
fermentor, (Virtis, Gardiner, N.Y.) charged with 13 liters of the
above-described media. The pH was held constant between 6.9 and 7.1
by automatic titration with 50% NaOH and 10% HCl. The stirring
speed was adjusted at 400 rev/minute, and the culture aerated with
11 liters air/minute at 37.degree. C. Foaming was controlled
automatically by the addition of 11 ml defoamer (Mazu DF 204
Chem/Serv, Minneapolis, Minn.). The culture was allowed to grow
continuously at these conditions for 4 hours at which time was
sterilely pumped into a 150-liter fermentor (W. B. Moore, Eastern,
Pa.). The fermentor was charged with 120 liters tryptic soy broth
without dextrose (3,600.0 grams), BiTek yeast extract (600 grams),
glycerol (3,600 ml), 2,2-dypyrdyl (3.0 grams) and Mazu DF 204
defoamer (60 ml). The parameters of the fermentation were as
follows: dissolved oxygen (DO) was maintained at 30%+/-10% by
increasing agitation to 220 rev/minute sparged with 60 liters of
air/minute and 10 pounds per square inch (psi) back pressure. The
pH was held constant between 6.9 and 7.1 by automatic titration
with 50% NaOH and 10% HCL and the temperature maintained at
37.degree. C. At hour 4.5 (OD.sub.5408-9) of the fermentation the
culture was transferred to a 1,500 liter New Brunswick Scientific
fermentor IF-15000 charged with 1200 liters tryptic soy broth
without dextrose (36,000 grams), BiTek yeast extract (6,000 grams),
glycerol (36,000 ml), 2,2-dypyrdyl (30.0 grams) and Mazu DF 204
defoamer (600 ml). The parameters of the fermentation were as
follows: dissolved oxygen (DO) was maintained at 60%+/-10% with
supplemental oxygen by increasing agitation to 300 rev/minute
sparged with 300 to 1100 liters of air/minute and 5 pounds per
square inch (psi) back pressure. As fermentation progressed
supplemental oxygen was added from 0-90 liters/minute to assist in
the control of dissolved oxygen. The pH was held constant between
6.9 and 7.4 by automatic titration with 50% NaOH and 10% HCL and
the temperature was maintained at 37.degree. C.
[0114] At approximately 5 hours post inoculation of the large
fermentor the culture was supplemented with additional nutrients by
feeding 70 liters of media containing 18,000 grams TSB without
dextrose, 3,000 grams yeast extract 30.0 grams 2,2-dipyridyl and
18,000 ml of glycerol. The rate of feed was adjusted to
approximately 28 liters/hour while increasing agitation. At the end
of the feed the fermentation was allowed to continue for an
additional 4 hours at which point the fermentation was terminated
by lowing the temperature of the fermentor to 18.degree. C.
(OD.sub.540 35-40 at a 1:100 dilution).
Harvest
[0115] The bacterial fermentation was concentrated and washed using
a Pall Filtron Tangential Flow Maxisel-25 (Pall Filtron
Corporation, Nortboro, Mass.) equipped with three 30 ft.sup.2 Alpha
300-K open channel filters, catalog No. AS300C5, (Pall Filtron)
connected to a Waukesha Model U-60 feed pump (Waukesha
Chefry-Burrell, Delevan, Wis.) The original culture volume of 1250
liters was reduced to 50 liters (2.5 liters/minute) using a filter
inlet pressure of 30 psi and a retentate pressure of 5-6 psi. The
bacterial retentate was adjusted back up to 150 liters using
Tris-buffered Saline pH 8.5 and then concentrated again to 50
liters to help remove any contaminating exogenous proteins, such as
exoproteins to include secreted toxins and proteases. The elevated
pH of the tris-buffered saline helps prevent much of the
proteolytic degradation that can occur during storage of the whole
cell suspension. Protease inhibitors may be used instead of, or in
addition to, an elevated pH. The retentate was mixed thoroughly
while in the 200-liter tank asing a bottom mount magnetically
driven mixer. The retentate was sterilely dispensed (3.5 liters)
into sterile 4 liter Nalgene containers No. 2122 and placed into a
-20.degree. C. freezer for storage as a breaking point in the
manufacture, or could be further processed. The pellet mass was
calculated by centrifuging 30 ml samples of the fermented culture
and final harvest. Briefly, pre-weighted 50 ml Nalgene conical
tubes were centrifuged at 39,000.times.g for 90 minutes in a
Beckman J2-21 centrifuge using a JA-21 rotor (Beckman Instruments,
Palo Alto Calif.). At the end of the run, the supernate was poured
off and the tubes were weighed again. The pellet mass was
calculated for each stage. The fermentation process yielded a wet
pellet mass of approximately 60 kilograms.
Disruption
[0116] Eighty kilograms of bacterial cell slurry in Tris-buffered
Saline pH 8.5 was aseptically transferred into a steam in place
1000 liter jacketed process tank (Lee, Model 259LU) with a top
mounted mixer (Eastern, Model TME-1/2, EMI Incorporated, Clinton,
Conn.) containing 900 liters TBS pH 8.5. The bulk bacterial
suspension was chilled to 4.degree..degree.C. with continuous
mixing for 18 hours at 200 rpm at which time was disrupted by
homogenization. Briefly, the 1000 liter tank containing the
bacterial suspension was connected to a model C-500-B Avestin
Homogenizer, (Avestin Inc., Ottawa Canada). A second 1000 liter
jacketed process tank (empty) was connected to the homogenizer such
that the fluid to the process tank could be passed through the
homogenizer, into the empty tank and back again, allowing for
multiple homogenizing passes while still maintaining a closed
system. The temperature during homogenization was kept at 4.degree.
C. At the start of the first pass, fluid was circulated at 70 psi
via a Waukesha model 10DO pump (Waukesha) through the uornogenieer
(500 gallons/hour), while the homogenizer pressure was adjusted to
30,000 psi. Prior to the first pass, two pre-homogenizing samples
were withdrawn from the homogenizer to establish a baseline for
determining the degree of disruption and monitoring of pH. The
degree of disruption was monitored by transmittance (% T at 540 nm
at 1:100 dilution) compared to the non-homogenized sample. The
number of passes through the homogenixer was standardized to give a
final percent transmittance between 78-91%T at a 1:100 dilution
preferably between 86-91%. After homogenization, the tank was
removed from the homogenizer and put onto a chiller loop at
4.degree. C. and mixed at 240 rpm.
Protein Harvest
[0117] The disrupted bacterial suspension containing the
iron-regulated proteins as illustrated in FIG. 1 were collected by
centrifugation using T-1 Sharples, (Alfa Laval Seperations,
Warminster, Pa.). Briefly, the 1000 liter jacketed process tank
containing the disrupted bacterial homogenate was fed into 12
Sharples with a feed rate of 250 ml/minute at 17 psi at a
centrifugal force of 60,000.times.g. The effluent was collected
into a second 1000 liter jacketed process tank through a closed
sterile loop allowing for multiple passes through the centrifuges
while maintaining a closed system. The temperature during
centrifugation was kept at 4.degree. C. The homogentae was passed 8
times across the centrifuges. Approximately 50% of the protein was
collected after the second pass, at which point, the homogenate
fluid was concentrated in 1/3 of its original volume, which
shortened the process time for the next 6 passes. The homogenate
tank was aseptically disconnected from the centrifuges and
connected to a Millipore Pellicon Tangential Flow Filter assembly
(Millipore Corporation, Bedford, Mass.), equipped with a 25
ft.sup.2 screen-channel series Alpha 30K Centraselle filter (Pall
Filtron) connected to a Waukesha Model U30 feed pump for
concentration. After concentration, centrifugation was continued
until the process was completed. Protein was collected after each
pass. The protein was collected, resuspended and dispensed in 50
liters Tris-buffered saline pH 8.5 containing 0.15% formulin
(Sigma) as preservative.
Diafiltration
[0118] The protein suspension was washed by diafiltration at
4.degree. C. to remove any exogenous proteins (proteases, toxins,
cytoplasmic and metabolic enzymes etc). Briefly, the 50 liters of
protein was sterilely transferred into a 200 liter process tank
containing 150 liters sterile Tris-buffer saline, pH 8.5 equipped
with a bottom mount Dayton mixer. Model 2Z846 (Dayton Electric,
Chicago, Ill.) rotating at 125 rev/minute. The process tank was
sterilely connected to a Millipore Pellicon Tangential Flow Filter
assembly (Millipore Corporation), equipped with a 25 ft.sup.2
screen-channel series Alpha 30K Centrasette filter (Pall Filtron)
connected to a Waukesha Model U30 feed pump. The 200 liter protein
solution was concentrated by filtration to a target volume 50
liters at which point 150 liters of sterile saline was added. The
protein suspension was then concentrated to approximately 50
liters. The protein concentrate was stored in a 50 liter jacketed
process tank equipped with a top mounted mixer and stored at
4.degree. C.
[0119] It is interesting to note that the composition derived from
the large scale process using homogenization as a means of
disruption generated identical handing profiles as examined by
SDS-PAGE as compared to the smaller scale process described in
Example 1. These results show that lysostaphin could be replaced as
the bacterial lysis agent using the Avestin homogenizer C500-B.
This discovery allows for the low cost generation of large volumes
of iron-regulated proteins from staphylococci.
Example 8
Hyper-Immunization of Mice and Preparation of Polyclonal
Antibody
[0120] Passive immunization with purified antibody isolated from
mice vaccinated with proteins derived from S. aureus strains 19636
grown under iron-limiting conditions was protective against a
homologous and heterologous S. aureus challenge. Fifteen adult CD1
mice were vaccinated as described in Example 3 wish the protein
composition derived from S. aureus strain ATCC 19636 grown under
iron-deplete conditions as described in Examples 1 and 2. Mice were
vaccinated intraperitoneally 3 times at 7 day intervals with 50
.mu.g of protein composition at each vaccination. Seven days after
the third immunization, mice were bled completely by cardiac
puncture. Serum was pooled and antibody purified using standard
ammonium sulfate precipitation. Exogenous serum proteins were
removed first prior to antibody precipitation by adding 0.5 volumes
of saturated ammonium sulfate pH 7.2. The solution was stirred at
100 rpm for 24 hours at 4.degree. C. The solution was again
centrifuged at 3000.times.g for 30 minutes. The supernatant was
collected and precipitated again by adding enough saturated
ammonium sulfate to bring the final concentration to 55%
saturation. The solution was stirred at 100 rpm for 24 hours at
4.degree. C. The precipitate was centrifuged at 3000.times.g for 30
minutes. The final pellet from each sample was resuspanded into 2
ml PBS pH 7.2. The precipitated antibodies were then dialyzed using
a 50,000 molecular cut off dialysis tubing (Pierce, Rockford Ill.)
for 30 hours against three 1 liter changes of phosphate-buffered
saline to remove ammonium sulfate. The first two liter changes were
preserved with 0.02% sodium axide. The final 1 liter buffer change
contained no preservative. The dialysate was collected and
centrifuged again to remove any remaining debris at 3000.times.g
for 30 minutes. The antibody solution was stored at 4.degree. C.
lor less then 48 hours prior to use. Each sample was plated on
blood agar to verily sterility prior to infusion.
Example 9
Passive Immunization and Challenge
[0121] In order to evaluate the protective effect of infused
antibody raised against S. aureus proteins expressed during
iron-limitation, two groups of 15 mice each were infused
intraperitoneally with either the purified antibody preparation
(Group 1) or physiological saline (Group 2) in a 200 .mu.L
infusion. An additional two groups of 15 mice each were infused
subcutaneously with either the purified antibody preparation (Group
3) or physiological saline (Group 4). After 60 minutes, the 2
groups of 15 mice receiving an intraperitoneal infusion were
challenged intraperitoneally with 13.times.10.sup.8 cfu of S.
aureus strain 19636. Similarly, the 2 groups of 15 mice receiving a
subcutaneous infusion were challenged subcutaneonsly with,
1.3.times.10.sup.8 cfu of S. aureus strain 1477 to test for
cross-protection against challenge by a different S. aureus strain.
Mortality and/or lesion size was recorded for 5 days and the livers
of all mice were removed post-mortem, homogenized and plated to
determine the number of S. aureus present as a measure of systemic
infection. The Kaplan-Meier survival curves (FIGS. 5 and 6) show
the protective effect afforded by the infusion of antibodies from
mice vaccinated with the S. aureus proteins expressed during iron
restriction. Although the difference between the infused and
control groups for the ATCC 19636-challenge groups was not
significant (p=0.076, log-rank test), the liver of the single mouse
that died within the antibody-infused group at Day 1 was cultured
on blood agar to determine the absence and/or presence of the
challenge organism (S. aureus). The culture derived from this mouse
was negative for Staphylococcus and showed no growth on the blood
agar plate or culture medium. In contrast, the livers of the mice
that died within the placebo group, were all positive for the
presence of Staphylococcus, in fact, pure cultures were obtained on
each blood agar plate derived from the livers of these mice. While
the liver data do not preclude the possibility that the mouse that
died within the antiody-infused group died of S. aureus infection,
the infection was not systemic, as it was in the placebo group, and
the mouse may have died for other reasons. Censoring of this
antibody-infused mouse death results in a significant difference
between antibody-infused and placebo treatments (p=0.015, log-rank
test). The data for the cross-challenge, where mice were infused
with antibody generated after vaccination with ATCC 19636-derived
proteins and challenged by S. aureus strain 1477, also showed a
protective trend. Between 7 and 14 days post challenge, all mice in
the infused and non-infused groups began to develop necrotic skin
lesions. However, gross examination of mice clearly revealed a
visible delay in the formation of an observable lesion as well as
the severity of the lesion between the groups. Infused mice
developed lesions more slowly as compared to non-infused control
mice which developed lesion faster then infused mice and at a
greater degree of severity. Thee infused mice healed faster then
non-infused mice. This was clearly evident between 21 and 35 days
post challenge. Gross examination of mice at 35 days post challenge
showed that non-infused mice were severely disfigured and revealed
a greater degree of scarring. In fact, many of these mice lost
normal posture, in that they appeared twisted in appearance, in
contrast to infused mice that did not develop nearly the extensive
scar tissue and/or disfigurement as illustrated by the twisted
appearance that the non-infused mice developed. Overall, these data
suggest that interperitoneal infusion of antibodies raised against
S. aureus induced proteins can both protect against and limit the
severity of S aureus infection.
Example 10
Evaluation of a Vaccine Composition Derived from Staphylococcus
aureus in a Chronically Infected Dairy Herd
[0122] A commercial Dairy herd having a history of chronically high
somatic cell counts attributable to Staphylococcus aureus was
chosen for the evaluation of a vaccine composition as described in
Example 1. The criterion for establishing vaccine efficacy of this
experimental study was: 1) decreased incidence of clinical mastitis
caused by Staphylococcus aureus among: vaccinates compared to
nom-vaccinated controls, 2) improvement (i.e., a decrease) in
somatic cell count among vaccinates compared to controls and 3)
decrease in culture positive isolation rates of S. aureus between
vaccinated and non-vaccinated controls. Blood will be taken at the
time of the first vaccination (day 0) and again at 3 and 6 weeks
post initial immunisation. Injection site reactions or systemic
reactions following vaccinations were monitored throughout the
study. In addition, bulk tank milk samples were cultured and
quantitatively enumerated to determine if them was a decrease in
the number of CFU of Staphylococcus aureus cultured after
vaccination.
[0123] Three of the Staphylococcus isolates derived from the
chronically infected lactating cows within the herd were grown
under conditions of iron-restriction and non-iron restricted
conditions as described in Eaxmple 1. The three isolates were
designated TTX101, TTX102, and TTX103. Extracted samples were
examined by SDS-PAGE to compare, banding profiles between isolates.
Identical banding profiles were observed among isolates examined;
the compositions made from each isolate included proteins having
molecular weights of 87.73 kDa, 80.46 kDa, 65.08 kDa, 54.53 kDa,
37.37 kDa, 35.70 kDa, 34.91 KDa, 33.0 kDa and 31.83 kDa. These
proteins are the same molecular weights as previously described in
Table 10. In addition, when comparing the isolates identical
banding profiles were seen with those proteins that were expressed
in all conditions that were not regulated by iron: 150 kDa, 132
kDa, 120 kDa, 75 kDa, 58 kDa, 50 kDa, 44 kDa, 43 kDa, 41 kDa, and
40 kDa. These results were consistent with previous observations.
One isolate designated as TTX101 was chosen as the isolate to
manufacture a composition to be used in this study.
Example 11
Vaccine Preparation of Staphylococcus aureus (TTX101)
[0124] A composition was prepared as described in Example 1 using
the isolate TTX101. The composition included proteins expressed
under iron deplete conditions having molecular weights of 87.73
kDa, 80.46 kDa, 65.08 kDa, 54.53 kDa, 37.37 kDa, 35.70 kDa, 34.91
kDa, 33.0 kDa, and 31.83 kDa as well as non-metal regulated
proteins having molecular weights of 150 kDa, 132 kDa, 120 kDa, 75
kDa, 58 kDa, 50 kDa, 44 kDa 43 kDa 41 kDa, and 40 kDa. The
immunizing composition derived from strain TTX101 was used to
prepare the experimental vaccine by emulsifying the extracted
protein suspension (400 .mu.g total protein per milliter) into a
commercial adjuvant (EMULSIGEN, MVP Laboratories, Ralston Nebr.)
using an IKA Ultra Turrax T-50 homogenizing vessel (IKA,
Cincinnati, Ohio) to give a final dose of 800 .mu.g total protein
in a 2.0 ml injectable volume with an adjuvant concentration of
22.5% vol/vol. The vaccine was administered subcutaneously 2 times
at 21 day intervals.
Example 12
Experimental Design and Herd Vaccination
[0125] Eighteen days before the first vaccination all lactating
cows enrolled in the study (N=80) were tested for S. aureus by
standardized aerobic bacteriological culture methods by culturing
individual milk samples derived from each lactating cow. In
addition, the Somatic Cell Counts (SCC) were enumerated by the
Dairy Herd Improvement Association using standard methods. Fourteen
of the 80 cows were clinically diagnosed with mastitis and were
culture positive for S. aureus. The remaining cows (N=66) tested
negative for S. aureus. The eighty cows were equally divided into
two groups designated as group-1, vacinnated (N=40) and group-2,
non-vaccinated (N=40). The fourteen clinically diagnosed
Staphylococcus positive cows were equally distributed between both
groups so that each study group contained 7 cows with clinical
mastitis. The average SCC between groups prior to the first
vaccination was 203,219 in the non-vacinated controls compared to
240,443 in vaccinates (not statistically different p=0.7).
[0126] Eighteen days after the first sampling all cows in group 1
were vaccinated subcutaneously in the upper right shoulder with 2
ml of vaccine as described in Example 11. Ten days after the first
vaccination milk samples were taken at this time period by the DHIA
for the enumeration of somatic cells from each individual cow. Milk
samples were not bacterioiogically tested at this time period for
determining the presence of Staphylococcus. The difference in the
SCC between groups at this time period was 125.741 (vaccinates)
compared to 196,297 (controls). This was a 36% difference in the
number of somatic cells between vaccinates as compared to
non-vaccinated controls. The difference in the SCC between the
controls and vaccinates at this sampling period was not
statistically different (p=0.5). The lack of statistical difference
in the SCC between groups at both sampling periods was due to the
large variation in individual SCC between cows. The injection site
of each vaccinated cow was also examined at this same time period.
None of the cows examined showed any adverse tissue reaction at the
site of injection by physical examination. In addition, there was
no measurable loss in milk production due to vaccination.
[0127] Twenty one days after the first vaccination all cows in
group-1 (vaccinates) were given their second vaccination or
booster. During the time period between first and second
vaccination, cows in both groups (vaccinates and controls)
developed tear damage due to a dramatic drop in the environmental
temperature resulting in the formation of lesions at the end of the
tear, resulting in the development of infected tears and
potentially increasing the isolation of Staphylococcus during
sampling, which was observed at the third sampling period. Twenty
three days after the second vaccination milk samples were taken by
the DHIA for the enumeration of Somatic Cells from each individual
cow. Milk samples were also bacterioiogically tested for the
presence of Staphylococcus aureus. There was a dramatic increase in
isolation rare of S. aureus at this time period in the cows that
tested negative at the first sampling period. In the non-vaccinated
controls 42.9% of these cows now tested positive for S. aureus, in
contest to the vaccinates, which only showed and increase of 35.5%.
This was a 7.4% difference between vaccinates as compared to the
non vaccinated controls. It's difficult to say that the improvement
in the isolation rate of S. aureus in the vaccinated group was due
to the effect of the vaccine alone. One cannot overlook the
difficulty in obtaining clean milk samples from cows that had tear
damage which could increase the potential contamination of the milk
by S. aureus when obtaining the sample. Nevertheless, there was a
significant difference in the average SCC between vaccinates
compared to controls. The average SCC of the vaccinated group was
222,679 compared to 404,278 somatic cells as measured in the
control group. This was a 44.9% difference between vaccinates when
compamd to the non vaccinated controls. It's interesting to
speculate that the difference seen in the SCC between these groups
also coincides with the difference in the isolation rate of S.
aureus between groups. However, due to the large variation in SCC
between individual animals and the small sample size of the
experimental trial in the number of animals the difference was not
statistically different (p=0.28).
[0128] At this same time period the injection site of each
vaccinated cow was examined for any adverse tissue reaction that
may have been caused by the vaccine composition. None of the cows
examined showed any adverse reaction at the site of injection by
physical examination. The vaccine compositions appeared to be
highly tissue compatible and caused no measurable loss in milk
production after each vaccination.
[0129] Monitoring of the cows is continued by measuring SCC and
milk samples for the presence or absence of Staphylococcus aureus.
Some of the cows of each group are vaccinated a third time at 42
days after the second vaccination. There appears to be a difference
favoring the use of the vaccine composition for decreasing somatic
cell counts and controlling infection caused by Staphylococcus
aureus. Further monitoring includes serology based on antibody
titers to the vaccine composition, changes in milk production in
vaccinated cows due the improvement in health, and decreased SCC of
vaccinated animals compared to non-vaccinated cohorts. In addition,
other experiments are conducted to investigate the protective index
of the vaccine based on dose response following challenge with a
virulent S. aureus.
Example 13
[0130] Since the molecular wights of the proteins among the
different S. aureus strains have been demonstrated to be similar
and since heterologous protection was observed in the mouse
challenge study, we sought to determine if the proteins sinning
similar molecular weights in FIG. 1 were similar proteins. The
technique chosen to characterize the proteins was matrix-assisted
laser desorption/ionization mass spectrometry (MALDI-MS). A portion
of the composition was resolved using SDS-PAGE as described in
Example 1, and the gel was stained with Coomassie Brilliant blue to
visualize the proteins.
Materials and Methods
[0131] Excision and washing. The gel was washed for 10 minutes with
water twice. Each protein band of interest was excised by cutting
as close to the protein band as possible to reduce the amount of
gel present in the sample.
[0132] Each gel slice was cut into 1.times.1 mm cubes and placed in
1.5 ml tube. The gel pieces were washed with water for 15 minutes.
All the solvent volumes used in the wash steps were approximately
equal to twice the volume of the gel slice. The gel slice was next
washed with water/acetonitrile (1:1) for 15 minutes. When the
proteins had been stained with silver, the water/acetonitrile
mixture was removed, the gel pieces dried in a Speed Vac
(ThermoSavant, Holbrook, N.Y.) and then reduced and alkylated as
described below. When the gel pieces were not silver-stained, the
water/acetonitrile mixture was removed, and acetonitrile was added
to cover and the gel pieces turned a sticky white, at which time
the acetonitrile was removed. The gel pieces were rehydrated in 100
mM NH.sub.4HCO.sub.3, and after 5 minutes, a volume of acetonitrile
equal to twice the volume of the gel pieces was added. This was
incubated for 15 minutes, the liquid removed, and the gel pieces
dried in a SpeedVac.
[0133] Reduction & alkylation. The dried gel pieces were
rehydrated in 10 mM DTT and 100 mM NH.sub.4HCO.sub.3, and incubated
for 45 minutes at 56.degree. C. After allowing the tubes to cool to
room temperature, the liquid was removed and the same volume of a
mixture of 55 mM iodoacetamide and 100 mM NH.sub.4HCO.sub.3 was
immediately added. This was incubated for 30 minutes at room
temperature in the dark. The liquid was removed, acetonitrile was
added to cover until the gel pieces turned a sticky white, at which
time the acetonitrile was removed. The gel pieces were rehydrated
in 100 mM NH.sub.4MCO.sub.3, and after 5 minutes, a volume of
acetonitrile equal to twice the volume of the gel pieces was added.
This was incubated for 15 minutes, the liquid removed, and the get
pieces dried in a Speed vac. If the gel was stained with coomasie
blue, and residual coomassie still remained, the wash with 100 mM
NH.sub.4HCO.sub.3/acetontrile was repeated.
[0134] In-gel digestion. Gel pieces were completely dried down in a
Speed Vac. The pieces were rehydrated in digestion buffer (50 mM
NH.sub.4HCO.sub.3, 5 mM CaCl.sub.2, 12.5 nanograms per microliter
(ng/.mu.l) trypsin) at 4.degree. C. Enough buffer was added to
cover the gel pieces, and more was added as needed. The gel pieces
were incubated on ice for 45 minutes, and the supernatant removed
and replaced with 5-2 .mu.l of same buffer without trypsin. This
was incubated at 37.degree. C. overnight in an air incubator.
[0135] Extraction of peptides. A sufficient volume of 25 mM
NH.sub.4HCO.sub.3 was added to cover gel pieces, and incubated for
15 minutes (typically in a bath sonicator). The same volume of
acetonitrile was added and incubated for 15 minutes (in a bath
sonicator if possible), and the supernatant was recovered. The
extraction was repeated twice, using 5% formic acid instead of
NH.sub.4HCO.sub.3. A sufficient volume of 5% formic acid was added
to cover gel pieces, and incubated for 15 minutes (typically in a
bath sonicator). The same volume of acetonitrile was added and
incubated for 15 minutes (typically in a bath sonicator), and the
supernatant was recovered. The extracts were pooled, and 10 mM DTT
was added to a final concentration of 1 mM DTT. The sample was
dried in a SpeedVac to a final volume of approximately 5 .mu.l.
[0136] Desalting of peptides. The samples were desalted using a
ZIPTIP pipette tips (C18, Millipose, Billenca, Mass.) as suggested
by the manufacturer. Briefly, a sample was reconstituted in
reconstitution solution (5:95 acetonitrile:H.sub.2O, 0.1%-0.5%
trifluoroacetic acid), centrifuged, and the pH checked to verify
that it was less than 3. A ZIPTIP was hydrated by aspirating 10
.mu.l of solution 1 (50:50 acetonitriled-H.sub.2O, 0.1%
trifluorooacetic acid) and discarding the aspirated ailquots. This
was followed by aspirating 10 .mu.l of solution 2 (0.1%
trifluoroacetic acid in deionized H.sub.2O) and discarding the
aspirated aliquots. The sample was loaded into the tip by
aspirating 10 .mu.l of the sample slowly into the tip, expelling it
into the sample tube, and repeating this 5 to 6 times. Ten
microliters of solution 2 was aspirated into the tip, the solution
discarded by expelling, and this process was repeated 5-7 times to
wash. The peptides were elated by aspirating 2.5 .mu.l of ice cold
solution 3 (60:40, acetonitrile:H.sub.2O, 0.1% trofluoroacetic
acid), expelling, and then re-aspirating the same aliquot in and
out of the tip 3 times. After the solution has been expelled from
the tip, the tube is capped and stored on ice.
[0137] Mass spectrometric peptide mapping. The peptides were
suspended in 10 .mu.l to 30 .mu.l of 5% formic acid, and analyzed
by MALDI-TOF MS (Bruker Daltonics Inc., Billerica, Mass.). The mass
spectrum of the peptide fragments was determined as suggested by
the manufacturer. Briefly, a sample containing the peptides
resulting from a tryptic digest were mixed wish matrix
cyano-4-hydroxycinnamic acid, transferred to a target, and allowed
to dry. The dried sample was placed in the mass spectrometer,
irradiated, and the time of flight of each ion detected and used to
determine a peptide mass fingerprint for each protein present in
the composition. Known polypeptides were used to standardize the
machine.
[0138] Data analysis. The experimentally observed masses for the
peptides in each mass spectrum were compared to the expected masses
of proteins using the Peptide Mass Fingerprint search method of the
Mascot search engine (Matrix Science Ltd., London, UK, and
www.matrixscience.com, see Perkins et al., Electrophoresis 20,
3551-3567 (1999)). The search parameters included: database, MSDB
or NCBInr, taxonomy, bacteria (eubacteria) or Firmicutes
(gram-positive bacteria); type of search, peptide mass fingerprint;
enzyme, trypsin; fixed modifications, carbamidomethyl (C) or none;
variable modifications, oxidation (M), carbamidonmethyl (C), the
combination, or none; mass values, monoisotopic; protein mass,
unrestricted; peptide mass tolerance, between .+-.150 ppm and
.+-.450 ppm, or .+-.1 Da; peptide charge state, Mr; max missed
cleavages, 0 or 1; number of queries, 20.
Results
[0139] The result of this search was a mass fingerprint for each
protein present in the composition is shown in Tables 2, 3, 4, and
5.
[0140] The complete disclosure of all patents, patent applications,
and publications, and electronically available material (including,
for instance, nucleotide sequence submissions in, e.g., GenBank and
RefSeq, and amino acid sequence submissions in, e.g., SwissProl,
PIR, PRF, PDB, and translations from annotated coding regions in
Gen-Bank and RefSeq) cited herein are incorporated by reference.
The foregoing detailed description and examples have been given for
clarity of understanding only. No unnecessary limitations are to be
understood therefrom. The invention is not limited to the exact
details shown and described, for variations obvious to one skilled
to the art will be included within the invention defined by the
claims.
[0141] Unless otherwise indicated, all numbers expressing
quantities of components, molecular weights, and so forth used in
the specification and claims are to be understood as being modified
in all instances by the term "about." Accordingly, unless otherwise
indicated to the contrary, the numerical parameters set forth is
the specification and claims are approximations that may vary
depending open the desired properties sought to be obtained by the
present invention. At the very least, and not as an attempt to
limit the doctrine of equivalents to the scope of the claims, each
numerical parameter should at least be construed in light of the
number of reported significant digits and by applying ordinary
rounding techniques.
[0142] Notwithstanding that the numerical ranges and parameters
setting forth the broad scope of the invention are approximations,
the numerical values set forth in the specific crumples am reported
as precisely as possible. All numerical values, however, inherently
contain a range necessarily resulting from the standard deviation
found in their respective testing measurements.
[0143] All headings are for the convenience of the reader and
should not be used to limit the meaning of the text that follows
the heading, unless so specified.
Sequence CWU 1
1
41715PRTStaphylococcus aureus 1His Val Asp Val Arg 1 5
25PRTStaphylococcus aureus 2Tyr Ser Tyr Glu Arg 1 5
37PRTStaphylococcus aureus 3Ile Ile Gly Asp Tyr Arg Arg 1 5
47PRTStaphylococcus aureus 4Ile Phe Thr Asp Tyr Arg Lys 1 5
58PRTStaphylococcus aureus 5Glu Leu Lys Glu Leu Gly Gln Lys 1 5
68PRTStaphylococcus aureus 6Tyr Ala Gln Val Lys Pro Ile Arg 1 5
78PRTStaphylococcus aureus 7Gln Met Gln Phe Phe Gly Ala Arg 1 5
89PRTStaphylococcus aureus 8Ser Met Gln Pro Phe Gly Gly Ile Arg 1 5
910PRTStaphylococcus aureus 9Val Ser Gly Tyr Ala Val Asn Phe Ile
Lys 1 5 10 1010PRTStaphylococcus aureus 10Asn His Ala Thr Ala Trp
Gln Gly Phe Lys 1 5 10 1110PRTStaphylococcus aureus 11Leu Trp Glu
Gln Val Met Gln Leu Ser Lys 1 5 10 1211PRTStaphylococcus aureus
12Ser Leu Gly Lys Glu Pro Glu Asp Gln Asn Arg 1 5 10
1312PRTStaphylococcus aureus 13Asp Gly Ile Ser Asn Thr Phe Ser Ile
Val Pro Lys 1 5 10 1413PRTStaphylococcus aureus 14Ala Gly Val Ile
Thr Gly Leu Pro Asp Ala Tyr Gly Arg 1 5 10 1511PRTStaphylococcus
aureus 15Thr Ser Thr Phe Leu Asp Ile Tyr Ala Glu Arg 1 5 10
1612PRTStaphylococcus aureus 16Ser Met Gln Pro Phe Gly Gly Ile Arg
Met Ala Lys 1 5 10 1712PRTStaphylococcus aureus 17Thr His Asn Gln
Gly Val Phe Asp Ala Tyr Ser Arg 1 5 10 1814PRTStaphylococcus aureus
18Lys Ala Gly Val Ile Thr Gly Leu Pro Asp Ala Tyr Gly Arg 1 5 10
1913PRTStaphylococcus aureus 19Thr Leu Leu Tyr Ala Ile Asn Gly Gly
Lys Asp Glu Lys 1 5 10 2012PRTStaphylococcus aureus 20Ile Glu Met
Ala Leu His Asp Thr Glu Ile Val Arg 1 5 10 2115PRTStaphylococcus
aureus 21Ala Gly Glu Pro Phe Ala Pro Gly Ala Asn Pro Met His Gly
Arg 1 5 10 15 2213PRTStaphylococcus aureus 22Val Ala Leu Tyr Gly
Val Asp Phe Leu Met Glu Glu Lys 1 5 10 2313PRTStaphylococcus aureus
23Lys Thr His Asn Gln Gly Val Phe Asp Ala Tyr Ser Arg 1 5 10
2413PRTStaphylococcus aureus 24Tyr Gly Phe Asp Leu Ser Arg Pro Ala
Glu Asn Phe Lys 1 5 10 2513PRTStaphylococcus aureus 25Thr Ser Ser
Ile Gln Tyr Glu Asn Asp Asp Ile Met Arg 1 5 10
2616PRTStaphylococcus aureus 26Lys Ala Gly Glu Pro Phe Ala Pro Gly
Ala Asn Pro Met His Gly Arg 1 5 10 15 2714PRTStaphylococcus aureus
27Arg Val Ala Leu Tyr Gly Val Asp Phe Leu Met Glu Glu Lys 1 5 10
2813PRTStaphylococcus aureus 28Leu Trp Glu Gln Val Met Gln Leu Ser
Lys Glu Glu Arg 1 5 10 2916PRTStaphylococcus aureus 29Met Leu Glu
Thr Asn Lys Asn His Ala Thr Ala Trp Gln Gly Phe Lys 1 5 10 15
3017PRTStaphylococcus aureus 30Met His Asp Phe Asn Thr Met Ser Thr
Glu Met Ser Glu Asp Val Ile 1 5 10 15 Arg 3118PRTStaphylococcus
aureus 31Tyr Gly Asn Asn Asp Asp Arg Val Asp Asp Ile Ala Val Asp
Leu Val 1 5 10 15 Glu Arg 3219PRTStaphylococcus aureus 32Glu Thr
Leu Ile Asp Ala Met Glu His Pro Glu Glu Tyr Pro Gln Leu 1 5 10 15
Thr Ile Arg 3325PRTStaphylococcus aureus 33Tyr Ala Gln Val Lys Pro
Ile Arg Asn Glu Glu Gly Leu Val Val Asp 1 5 10 15 Phe Glu Ile Glu
Gly Asp Phe Pro Lys 20 25 346PRTStaphylococcus aureus 34Leu His Ser
Trp Leu Lys 1 5 357PRTStaphylococcus aureus 35Lys Leu His Ser Trp
Leu Lys 1 5 367PRTStaphylococcus aureus 36Thr Tyr Thr Phe His Leu
Arg 1 5 379PRTStaphylococcus aureus 37Lys Phe Asp Gly Thr Gly Pro
Phe Lys 1 5 389PRTStaphylococcus aureus 38Gln Ala Ile Gly His Met
Val Asn Arg 1 5 399PRTStaphylococcus aureus 39Lys Trp Asp Val Ser
Glu Asp Gly Lys 1 5 4010PRTStaphylococcus aureus 40Ile Tyr Asn Ser
Ile Asp Asp Ala Phe Lys 1 5 10 4110PRTStaphylococcus aureus 41Asn
Leu Glu Met Ala Met Tyr Tyr Asp Lys 1 5 10 4211PRTStaphylococcus
aureus 42Glu Asn Lys Gln Leu Thr Tyr Thr Thr Val Lys 1 5 10
4312PRTStaphylococcus aureus 43Ala Glu Ser Leu Leu Asp Glu Ala Gly
Trp Lys Lys 1 5 10 4412PRTStaphylococcus aureus 44Thr Val Arg Gln
Ala Ile Gly His Met Val Asn Arg 1 5 10 4511PRTStaphylococcus aureus
45Thr Tyr Thr Phe His Leu Arg Asp Asp Val Lys 1 5 10
4612PRTStaphylococcus aureus 46Lys Gly Glu Thr Asn Phe Ala Phe Thr
Asp Asp Arg 1 5 10 4713PRTStaphylococcus aureus 47Phe His Asp Gly
Thr Pro Phe Asp Ala Asp Ala Val Lys 1 5 10 4812PRTStaphylococcus
aureus 48Asn Val Thr Asp Ile Asn Phe Asp Met Pro Thr Arg 1 5 10
4912PRTStaphylococcus aureus 49Asp Lys Ile Tyr Asn Ser Ile Asp Asp
Ala Phe Lys 1 5 10 5012PRTStaphylococcus aureus 50Glu Gln Ala Glu
Tyr Leu Gln Ala Glu Phe Lys Lys 1 5 10 5114PRTStaphylococcus aureus
51Val Met Pro Ala Gly Glu Thr Ala Phe Leu Ser Met Lys Lys 1 5 10
5214PRTStaphylococcus aureus 52Phe His Asp Gly Thr Pro Phe Asp Ala
Asp Ala Val Lys Lys 1 5 10 5313PRTStaphylococcus aureus 53Asn Val
Thr Asp Ile Asn Phe Asp Met Pro Thr Arg Lys 1 5 10
5414PRTStaphylococcus aureus 54Leu Asn Ile Asn Gly Glu Thr Ser Asp
Lys Ile Ala Glu Arg 1 5 10 5516PRTStaphylococcus aureus 55Glu Ile
Leu Asp Gly Gln Glu Lys Pro Ala Thr Gln Leu Phe Ala Lys 1 5 10 15
5617PRTStaphylococcus aureus 56Gly Ser Ser Ser Gln Lys Glu Gln Ala
Glu Tyr Leu Gln Ala Glu Phe 1 5 10 15 Lys 5716PRTStaphylococcus
aureus 57Asp Glu Ser Ala Asp Phe Asn Lys Asn Asp Gln Tyr Trp Gly
Glu Lys 1 5 10 15 5819PRTStaphylococcus aureus 58Ile Ala Lys Glu
Ile Leu Asp Gly Gln Glu Lys Pro Ala Thr Gln Leu 1 5 10 15 Phe Ala
Lys 5918PRTStaphylococcus aureus 59Val Ser Phe Thr Gln Ser Gln Tyr
Glu Leu Pro Phe Asn Glu Met Gln 1 5 10 15 Tyr Lys
6022PRTStaphylococcus aureusMOD_RES(12)..(12)Oxidized Met 60Glu Ala
Tyr Gln Pro Ala Leu Ala Glu Leu Ala Met Pro Arg Pro Tyr 1 5 10 15
Val Phe Val Ser Pro Lys 20 6126PRTStaphylococcus
aureusMISC_FEATUREAny two fo the three Mets in this sequence are
oxidized 61Asp Ile Gly Asp Met Asn Pro His Val Tyr Gly Gly Ser Met
Ser Ala 1 5 10 15 Glu Ser Met Ile Tyr Glu Pro Leu Val Arg 20 25
6226PRTStaphylococcus aureusMOD_RES(5)..(5)Oxidized Met 62Asp Ile
Gly Asp Met Asn Pro His Val Tyr Gly Gly Ser Met Ser Ala 1 5 10 15
Glu Ser Met Ile Tyr Glu Pro Leu Val Arg 20 25 639PRTStaphylococcus
aureus 63Ile Val Tyr Val Gly Ala Asp Glu Lys 1 5
649PRTStaphylococcus aureus 64Gln Ala Leu Asn Asn Pro Val Leu Lys 1
5 6510PRTStaphylococcus aureus 65Glu Thr Val Lys Ile Glu Asn Asn
Tyr Lys 1 5 10 6611PRTStaphylococcus aureus 66Glu Asn Pro Asp Val
Ile Leu Ala Met Asp Arg 1 5 10 6714PRTStaphylococcus aureus 67Ile
Ala Ala Thr Lys Pro Glu Val Ile Phe Ile Ser Gly Arg 1 5 10
6814PRTStaphylococcus aureus 68Asn Ala Val Val Leu Asp Tyr Gly Ala
Leu Asp Val Met Lys 1 5 10 6913PRTStaphylococcus aureus 69Ala Leu
Pro Asn Phe Leu Glu Ser Phe Lys Asp Asp Lys 1 5 10
7014PRTStaphylococcus aureus 70Leu Trp Tyr Phe Ala Ala Gly Ser Thr
Thr Thr Thr Ile Lys 1 5 10 7116PRTStaphylococcus aureus 71Phe Gly
Gly Leu Val Tyr Asp Thr Leu Gly Phe Asn Ala Val Asp Lys 1 5 10 15
7216PRTStaphylococcus aureus 72Ile Val Tyr Val Gly Ala Asp Glu Lys
Asn Leu Ile Gly Ser Met Lys 1 5 10 15 7317PRTStaphylococcus aureus
73Phe Gly Gly Leu Val Tyr Asp Thr Leu Gly Phe Asn Ala Val Asp Lys 1
5 10 15 Lys 7418PRTStaphylococcus aureus 74Gly Arg Phe Gly Gly Leu
Val Tyr Asp Thr Leu Gly Phe Asn Ala Val 1 5 10 15 Asp Lys
7518PRTStaphylococcus aureus 75Thr Val Met Tyr Leu Leu Val Asn Glu
Gly Glu Leu Ser Thr Phe Gly 1 5 10 15 Pro Lys 7620PRTStaphylococcus
aureus 76Glu Val Asn Phe Asp Lys Ile Ala Ala Thr Lys Pro Glu Val
Ile Phe 1 5 10 15 Ile Ser Gly Arg 20 7728PRTStaphylococcus aureus
77Val Ser Asn Ser Asn His Gly Gln Asn Val Ser Asn Glu Tyr Val Asn 1
5 10 15 Lys Glu Asn Pro Asp Val Ile Leu Ala Met Asp Arg 20 25
785PRTStaphylococcus aureus 78Phe Glu Tyr Ile Lys 1 5
796PRTStaphylococcus aureus 79Asp Ala Trp Pro Leu Lys 1 5
807PRTStaphylococcus aureus 80Ala Ser Val Val Asn Phe Arg 1 5
817PRTStaphylococcus aureus 81Val Tyr Asp Gln Leu Ser Lys 1 5
829PRTStaphylococcus aureus 82His Ala Met Gly Thr Thr Glu Ile Lys 1
5 838PRTStaphylococcus aureus 83Leu Ile Asp Asp Leu Tyr Glu Lys 1 5
848PRTStaphylococcus aureus 84Tyr Lys Asp Ala Trp Pro Leu Lys 1 5
859PRTStaphylococcus aureus 85Glu Lys Glu Ala Glu Asp Leu Leu Lys 1
5 8610PRTStaphylococcus aureus 86Leu Lys Pro Asp Leu Ile Val Ala
Ser Lys 1 5 10 879PRTStaphylococcus aureus 87Phe Glu Tyr Ile Lys
Asn Asp Leu Lys 1 5 8810PRTStaphylococcus aureus 88Lys Thr Glu Ser
Glu Trp Thr Ser Ser Lys 1 5 10 8910PRTStaphylococcus aureus 89Tyr
Asp Asp Lys Val Ala Ala Phe Gln Lys 1 5 10 9010PRTStaphylococcus
aureus 90Asn Glu Lys Val Tyr Asp Gln Leu Ser Lys 1 5 10
9112PRTStaphylococcus aureus 91Ile Ala Pro Thr Val Ser Thr Asp Thr
Val Phe Lys 1 5 10 9212PRTStaphylococcus aureus 92Thr Glu Ser Glu
Trp Thr Ser Ser Lys Glu Trp Lys 1 5 10 9313PRTStaphylococcus aureus
93Asp Ala Trp Pro Leu Lys Ala Ser Val Val Asn Phe Arg 1 5 10
9414PRTStaphylococcus aureus 94Gln Val Asp Asn Gly Lys Asp Ile Ile
Gln Leu Thr Ser Lys 1 5 10 9513PRTStaphylococcus aureus 95Leu Ile
Asp Asp Leu Tyr Glu Lys Leu Asn Ile Glu Lys 1 5 10
9615PRTStaphylococcus aureus 96Ile Val Gly Gln Glu Pro Ala Pro Asn
Leu Glu Glu Ile Ser Lys 1 5 10 15 9715PRTStaphylococcus aureus
97Glu Ser Ile Pro Leu Met Asn Ala Asp His Ile Phe Val Val Lys 1 5
10 15 9817PRTStaphylococcus aureus 98Ile Tyr Ala Gly Gly Tyr Ala
Gly Glu Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys
9918PRTStaphylococcus aureus 99Ile Tyr Ala Gly Gly Tyr Ala Gly Glu
Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys Arg
10020PRTStaphylococcus aureus 100Asn Asn Gln Val Ser Asp Asp Leu
Asp Glu Ile Thr Trp Asn Leu Ala 1 5 10 15 Gly Gly Tyr Lys 20
10132PRTStaphylococcus aureus 101Arg Val Val Thr Leu Tyr Gln Gly
Ala Thr Asp Val Ala Val Ser Leu 1 5 10 15 Gly Val Lys Pro Val Gly
Ala Val Glu Ser Trp Thr Gln Lys Pro Lys 20 25 30
1025PRTStaphylococcus aureus 102Asp Val Trp Ala Arg 1 5
1036PRTStaphylococcus aureus 103Ile Ile Lys Pro Val Arg 1 5
10410PRTStaphylococcus aureus 104Ile Gly Asp Tyr Thr Ser Val Gly
Thr Arg 1 5 10 10510PRTStaphylococcus aureus 105Lys Gln Pro Asn Leu
Glu Glu Ile Ser Lys 1 5 10 10612PRTStaphylococcus aureus 106Leu Lys
Pro Asp Leu Ile Ile Ala Asp Ser Ser Arg 1 5 10
10711PRTStaphylococcus aureus 107Val Asp Ile Val Asp Arg Asp Val
Trp Ala Arg 1 5 10 10818PRTStaphylococcus aureus 108Gly Pro Tyr Leu
Gln Leu Asp Thr Glu His Leu Ala Asp Leu Asn Pro 1 5 10 15 Glu Arg
10922PRTStaphylococcus aureus 109Ala Gly Leu Leu Ala His Pro Asn
Tyr Ser Tyr Val Gly Gln Phe Leu 1 5 10 15 Asn Glu Leu Gly Phe Lys
20 11027PRTStaphylococcus aureus 110Ile Val Val Leu Glu Tyr Ser Phe
Ala Asp Ala Leu Ala Ala Leu Asp 1 5 10 15 Val Lys Pro Val Gly Ile
Ala Asp Asp Gly Lys 20 25 1117PRTStaphylococcus aureus 111Ala Gly
Trp Ala Glu Val Lys 1 5 1129PRTStaphylococcus aureus 112Thr Val Asp
Ile Pro Lys Asp Pro Lys 1 5 1139PRTStaphylococcus aureus 113Lys Asp
Trp Glu Glu Thr Thr Ala Lys 1 5 11411PRTStaphylococcus aureus
114Val Ala Pro Thr Val Val Val Asp Tyr Asn Lys 1 5 10
11510PRTStaphylococcus aureus 115Tyr Leu Glu Gln Gln Glu Met Leu
Gly Lys 1 5 10 11610PRTStaphylococcus aureus 116Leu Tyr Thr Tyr Gly
Asp Asn Trp Gly Arg 1 5 10 11713PRTStaphylococcus aureus 117Ile Ala
Val Val Ala Pro Thr Tyr Ala Gly Gly Leu Lys 1 5 10
11812PRTStaphylococcus aureus 118Gly Gly Glu Val Leu Tyr Gln Ala
Phe Gly Leu Lys 1 5 10 11913PRTStaphylococcus aureus 119Ala Gly Trp
Ala Glu Val Lys Gln Glu Glu Ile Glu Lys 1 5 10
12016PRTStaphylococcus aureus 120Leu Gly Ala Asn Ile Val Ala Val
Asn Gln Gln Val Asp Gln Ser Lys 1 5 10 15 12116PRTStaphylococcus
aureus 121Glu Lys Pro Asp Leu Ile Ile Val Tyr Ser Thr Asp Lys Asp
Ile Lys 1 5 10 15 12217PRTStaphylococcus aureus 122Ala Ile Gly Gln
Asp Ala Thr Val Ser Leu Phe Asp Glu Phe Asp Lys 1 5 10 15 Lys
12318PRTStaphylococcus aureus 123Val Asp Ala Gly Thr Tyr Trp Tyr
Asn Asp Pro Tyr Thr Leu Asp Phe 1 5 10 15 Met Arg
12425PRTStaphylococcus aureus 124Tyr Ala Gly Asp Tyr Ile Val Ser
Thr Ser Glu Gly Lys Pro Thr Pro 1 5 10 15 Gly Tyr Glu Ser Thr Asn
Met Trp Lys 20 25 1257PRTStaphylococcus aureus 125Gln Ala Ile Glu
Phe Val Lys 1 5 1267PRTStaphylococcus aureus 126Tyr Ile Ala Gln Leu
Glu Lys 1 5 1278PRTStaphylococcus aureus 127Gln Gly Thr Pro Glu Gln
Met Arg 1 5 1288PRTStaphylococcus aureus 128Gln Ala Ile Glu Phe Val
Lys Lys 1 5 1298PRTStaphylococcus aureus 129Asp Lys Phe Asn Asp Ile
Pro Lys 1 5 13010PRTStaphylococcus aureus 130Ala Met Ile Thr Ser
Glu Gly Ala Phe Lys 1 5 10 13111PRTStaphylococcus aureus 131Ser Asn
Ile Glu Thr Val His Gly Ser Met Lys 1 5 10 13211PRTStaphylococcus
aureus 132His Leu Leu Val Glu Thr Ser Val Asp Lys Lys 1 5 10
13313PRTStaphylococcus aureus 133Asp Ile Phe Gly Glu Val Tyr Thr
Asp Ser Ile Gly Lys 1 5 10 13412PRTStaphylococcus aureus
134Thr Ile Gln Gln Thr Phe Ile Asp Asn Asp Lys Lys 1 5 10
13513PRTStaphylococcus aureus 135Val Val Thr Thr Asn Ser Ile Leu
Tyr Asp Met Ala Lys 1 5 10 13614PRTStaphylococcus aureus 136Lys Asp
Ile Phe Gly Glu Val Tyr Thr Asp Ser Ile Gly Lys 1 5 10
13714PRTStaphylococcus aureus 137Gln Asp Pro His Ala Trp Leu Ser
Leu Asp Asn Gly Ile Lys 1 5 10 13816PRTStaphylococcus aureus 138Asp
Val Lys Pro Ile Tyr Leu Asn Gly Glu Glu Gly Asn Lys Asp Lys 1 5 10
15 13916PRTStaphylococcus aureus 139Asp Lys Gln Asp Pro His Ala Trp
Leu Ser Leu Asp Asn Gly Ile Lys 1 5 10 15 14016PRTStaphylococcus
aureus 140Gln Tyr Gly Ile Thr Pro Gly Tyr Ile Trp Glu Ile Asn Thr
Glu Lys 1 5 10 15 14123PRTStaphylococcus aureus 141Leu Thr Asp Ala
Asp Val Ile Leu Tyr Asn Gly Leu Asn Leu Glu Thr 1 5 10 15 Gly Asn
Gly Trp Phe Glu Lys 20 14224PRTStaphylococcus aureus 142Lys Leu Thr
Asp Ala Asp Val Ile Leu Tyr Asn Gly Leu Asn Leu Glu 1 5 10 15 Thr
Gly Asn Gly Trp Phe Glu Lys 20 14327PRTStaphylococcus aureus 143Asn
Val Gly Gly Asp Asn Val Asp Ile His Ser Ile Val Pro Val Gly 1 5 10
15 Gln Asp Pro His Glu Tyr Glu Val Lys Pro Lys 20 25
1446PRTStaphylococcus aureus 144Leu His Ser Trp Leu Lys 1 5
1457PRTStaphylococcus aureus 145Lys Leu His Ser Trp Leu Lys 1 5
1467PRTStaphylococcus aureus 146Thr Tyr Thr Phe His Leu Arg 1 5
1479PRTStaphylococcus aureus 147Lys Phe Asp Gly Thr Gly Pro Phe Lys
1 5 1489PRTStaphylococcus aureus 148Gln Ala Ile Gly His Met Val Asn
Arg 1 5 1498PRTStaphylococcus aureus 149Asn Asp Gln Tyr Trp Gly Glu
Lys 1 5 15011PRTStaphylococcus aureus 150Gly Thr Asp Ser Leu Asp
Lys Asp Ser Leu Lys 1 5 10 15110PRTStaphylococcus aureus 151Ile Tyr
Asn Ser Ile Asp Asp Ala Phe Lys 1 5 10 15210PRTStaphylococcus
aureus 152Asp Lys Tyr Thr Val Glu Leu Asn Leu Lys 1 5 10
15311PRTStaphylococcus aureus 153Ile Ser Thr Leu Ile Asp Asn Val
Lys Val Lys 1 5 10 15412PRTStaphylococcus aureus 154Ala Glu Ser Leu
Leu Asp Glu Ala Gly Trp Lys Lys 1 5 10 15511PRTStaphylococcus
aureus 155Glu Gln Ala Glu Tyr Leu Gln Ala Glu Phe Lys 1 5 10
15613PRTStaphylococcus aureus 156Val Met Pro Ala Gly Glu Thr Ala
Phe Leu Ser Met Lys 1 5 10 15712PRTStaphylococcus aureus 157Lys Gly
Glu Thr Asn Phe Ala Phe Thr Asp Asp Arg 1 5 10
15813PRTStaphylococcus aureus 158Phe His Asp Gly Thr Pro Phe Asp
Ala Asp Ala Val Lys 1 5 10 15912PRTStaphylococcus aureus 159Asn Val
Thr Asp Ile Asn Phe Asp Met Pro Thr Arg 1 5 10
16012PRTStaphylococcus aureus 160Glu Gln Ala Glu Tyr Leu Gln Ala
Glu Phe Lys Lys 1 5 10 16114PRTStaphylococcus aureus 161Phe His Asp
Gly Thr Pro Phe Asp Ala Asp Ala Val Lys Lys 1 5 10
16213PRTStaphylococcus aureus 162Asn Val Thr Asp Ile Asn Phe Asp
Met Pro Thr Arg Lys 1 5 10 16314PRTStaphylococcus aureus 163Leu Asn
Ile Asn Gly Glu Thr Ser Asp Lys Ile Ala Glu Arg 1 5 10
16416PRTStaphylococcus aureus 164Glu Ile Leu Asp Gly Gln Glu Lys
Pro Ala Thr Gln Leu Phe Ala Lys 1 5 10 15 16516PRTStaphylococcus
aureus 165Asp Glu Ser Ala Asp Phe Asn Lys Asn Asp Gln Tyr Trp Gly
Glu Lys 1 5 10 15 16618PRTStaphylococcus aureus 166Val Ser Phe Thr
Gln Ser Gln Tyr Glu Leu Pro Phe Asn Glu Met Gln 1 5 10 15 Tyr Lys
16722PRTStaphylococcus aureus 167Gln Ile Asp Asp Glu Gly Ile Phe
Ile Pro Ile Ser His Gly Ser Met 1 5 10 15 Thr Val Val Ala Pro Lys
20 16826PRTStaphylococcus aureus 168Asp Ile Gly Asp Met Asn Pro His
Val Tyr Gly Gly Ser Met Ser Ala 1 5 10 15 Glu Ser Met Ile Tyr Glu
Pro Leu Val Arg 20 25 1698PRTStaphylococcus aureus 169Phe Pro Tyr
Ala Ala Asn Gly Arg 1 5 1708PRTStaphylococcus aureus 170Ala Leu Leu
His Ala Ser His Arg 1 5 17110PRTStaphylococcus aureus 171Glu Glu
Gly Leu Ala Ile Lys Ala Ser Lys 1 5 10 17212PRTStaphylococcus
aureus 172Gly Glu Ala Tyr Phe Val Asp Asn Asn Ser Leu Arg 1 5 10
17313PRTStaphylococcus aureus 173Thr Ile Glu Ala Asp Tyr Val Leu
Val Thr Val Gly Arg 1 5 10 17415PRTStaphylococcus aureus 174Arg Pro
Asn Thr Asp Glu Leu Gly Leu Glu Glu Leu Gly Val Lys 1 5 10 15
17517PRTStaphylococcus aureus 175Asn Ala Ile Ile Ala Thr Gly Ser
Arg Pro Ile Glu Ile Pro Asn Phe 1 5 10 15 Lys
17621PRTStaphylococcus aureus 176Thr Ser Ile Ser Asn Ile Tyr Ala
Ile Gly Asp Ile Val Pro Gly Leu 1 5 10 15 Pro Leu Ala His Lys 20
17723PRTStaphylococcus aureus 177Phe Val Glu Ala Gln His Ser Glu
Asn Leu Gly Val Ile Ala Glu Ser 1 5 10 15 Val Ser Leu Asn Phe Gln
Lys 20 17826PRTStaphylococcus aureus 178Val Val Gly Asp Phe Pro Ile
Glu Thr Asp Thr Ile Val Ile Gly Ala 1 5 10 15 Gly Pro Gly Gly Tyr
Val Ala Ala Ile Arg 20 25 1795PRTStaphylococcus aureus 179Phe Glu
Tyr Ile Lys 1 5 1806PRTStaphylococcus aureus 180Asp Ala Trp Pro Leu
Lys 1 5 1817PRTStaphylococcus aureus 181Ala Ser Val Val Asn Phe Arg
1 5 1827PRTStaphylococcus aureus 182Val Tyr Asp Gln Leu Ser Lys 1 5
1838PRTStaphylococcus aureus 183Leu Ile Asp Asp Leu Tyr Glu Lys 1 5
1848PRTStaphylococcus aureus 184Tyr Lys Asp Ala Trp Pro Leu Lys 1 5
1859PRTStaphylococcus aureus 185Glu Lys Glu Ala Glu Asp Leu Leu Lys
1 5 18610PRTStaphylococcus aureus 186Leu Lys Pro Asp Leu Ile Val
Ala Ser Lys 1 5 10 1879PRTStaphylococcus aureus 187Phe Glu Tyr Ile
Lys Asn Asp Leu Lys 1 5 18810PRTStaphylococcus aureus 188Lys Thr
Glu Ser Glu Trp Thr Ser Ser Lys 1 5 10 18910PRTStaphylococcus
aureus 189Tyr Asp Asp Lys Val Ala Ala Phe Gln Lys 1 5 10
19012PRTStaphylococcus aureus 190Ile Ala Pro Thr Val Ser Thr Asp
Thr Val Phe Lys 1 5 10 19114PRTStaphylococcus aureus 191Gln Val Asp
Asn Gly Lys Asp Ile Ile Gln Leu Thr Ser Lys 1 5 10
19215PRTStaphylococcus aureus 192Ile Val Gly Gln Glu Pro Ala Pro
Asn Leu Glu Glu Ile Ser Lys 1 5 10 15 19315PRTStaphylococcus aureus
193Glu Ser Ile Pro Leu Met Asn Ala Asp His Ile Phe Val Val Lys 1 5
10 15 19417PRTStaphylococcus aureus 194Ile Tyr Ala Gly Gly Tyr Ala
Gly Glu Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys
19518PRTStaphylococcus aureus 195Ile Tyr Ala Gly Gly Tyr Ala Gly
Glu Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys Arg
19620PRTStaphylococcus aureus 196Asn Asn Gln Val Ser Asp Asp Leu
Asp Glu Ile Thr Trp Asn Leu Ala 1 5 10 15 Gly Gly Tyr Lys 20
19731PRTStaphylococcus aureus 197Val Val Thr Leu Tyr Gln Gly Ala
Thr Asp Val Ala Val Ser Leu Gly 1 5 10 15 Val Lys Pro Val Gly Ala
Val Glu Ser Trp Thr Gln Lys Pro Lys 20 25 30 1987PRTStaphylococcus
aureus 198Tyr Ile Ala Gln Leu Glu Lys 1 5 1998PRTStaphylococcus
aureus 199Gln Gly Thr Pro Glu Gln Met Arg 1 5 2008PRTStaphylococcus
aureus 200Asp Lys Phe Asn Asp Ile Pro Lys 1 5
20110PRTStaphylococcus aureus 201Ala Met Ile Thr Ser Glu Gly Ala
Phe Lys 1 5 10 2029PRTStaphylococcus aureus 202Phe Asn Asp Ile Pro
Lys Glu Gln Arg 1 5 20311PRTStaphylococcus aureus 203His Leu Leu
Val Glu Thr Ser Val Asp Lys Lys 1 5 10 20411PRTStaphylococcus
aureus 204Thr Ile Gln Gln Thr Phe Ile Asp Asn Asp Lys 1 5 10
20513PRTStaphylococcus aureus 205Asp Ile Phe Gly Glu Val Tyr Thr
Asp Ser Ile Gly Lys 1 5 10 20612PRTStaphylococcus aureus 206Thr Ile
Gln Gln Thr Phe Ile Asp Asn Asp Lys Lys 1 5 10
20713PRTStaphylococcus aureus 207Val Val Thr Thr Asn Ser Ile Leu
Tyr Asp Met Ala Lys 1 5 10 20814PRTStaphylococcus aureus 208Gln Asp
Pro His Ala Trp Leu Ser Leu Asp Asn Gly Ile Lys 1 5 10
20916PRTStaphylococcus aureus 209Asp Val Lys Pro Ile Tyr Leu Asn
Gly Glu Glu Gly Asn Lys Asp Lys 1 5 10 15 21016PRTStaphylococcus
aureus 210Asp Lys Gln Asp Pro His Ala Trp Leu Ser Leu Asp Asn Gly
Ile Lys 1 5 10 15 21116PRTStaphylococcus aureus 211Gln Tyr Gly Ile
Thr Pro Gly Tyr Ile Trp Glu Ile Asn Thr Glu Lys 1 5 10 15
21227PRTStaphylococcus aureus 212Asn Val Gly Gly Asp Asn Val Asp
Ile His Ser Ile Val Pro Val Gly 1 5 10 15 Gln Asp Pro His Glu Tyr
Glu Val Lys Pro Lys 20 25 2136PRTStaphylococcus aureus 213Ile Ile
Gly Asp Tyr Arg 1 5 2146PRTStaphylococcus aureus 214Ile Phe Thr Asp
Tyr Arg 1 5 2159PRTStaphylococcus aureus 215Thr Gly Asn Thr Pro Asp
Gly Arg Lys 1 5 2169PRTStaphylococcus aureus 216Glu Gln Gln Leu Asp
Val Ile Ser Arg 1 5 21710PRTStaphylococcus aureus 217Leu Arg Glu
Glu Leu Ser Glu Gln Tyr Arg 1 5 10 21813PRTStaphylococcus aureus
218Asn His Ala Thr Ala Trp Gln Gly Phe Lys Asn Gly Arg 1 5 10
21916PRTStaphylococcus aureus 219Asp Leu Glu Thr Ile Val Gly Val
Gln Thr Glu Lys Pro Phe Lys Arg 1 5 10 15 22020PRTStaphylococcus
aureus 220Thr Met Ala Thr Gly Ile Ala Gly Leu Ser Val Ala Ala Asp
Ser Leu 1 5 10 15 Ser Ala Ile Lys 20 22119PRTStaphylococcus aureus
221Ala Gly Val Ile Thr Glu Ser Glu Val Gln Glu Ile Ile Asp His Phe
1 5 10 15 Ile Met Lys 22223PRTStaphylococcus aureus 222Phe Leu His
Ser Leu Asp Asn Leu Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr
Val Leu Trp Ser Val Arg 20 22324PRTStaphylococcus aureus 223Ser Gly
Ala Gln Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15
Leu Glu Tyr Asp Glu Val Phe Lys 20 22425PRTStaphylococcus aureus
224Ser Gly Ala Gln Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val
1 5 10 15 Leu Glu Tyr Asp Glu Val Phe Lys Lys 20 25
22530PRTStaphylococcus aureus 225Val Ala Ser Thr Ile Thr Ser His
Asp Ala Gly Tyr Leu Asp Lys Asp 1 5 10 15 Leu Glu Thr Ile Val Gly
Val Gln Thr Glu Lys Pro Phe Lys 20 25 30 2266PRTStaphylococcus
aureus 226Ile Ile Gly Asp Tyr Arg 1 5 2276PRTStaphylococcus aureus
227Ile Phe Thr Asp Tyr Arg 1 5 2289PRTStaphylococcus aureus 228Glu
Gln Gln Leu Asp Val Ile Ser Arg 1 5 22911PRTStaphylococcus aureus
229Val Asp Asp Ile Ala Val Asp Leu Val Glu Arg 1 5 10
23010PRTStaphylococcus aureus 230Leu Arg Glu Glu Leu Ser Glu Gln
Tyr Arg 1 5 10 23113PRTStaphylococcus aureus 231Asn His Ala Thr Ala
Trp Gln Gly Phe Lys Asn Gly Arg 1 5 10 23215PRTStaphylococcus
aureus 232Asp Leu Glu Thr Ile Val Gly Val Gln Thr Glu Lys Pro Phe
Lys 1 5 10 15 23315PRTStaphylococcus aureus 233Glu Ala Val Gln Trp
Leu Tyr Leu Ala Tyr Leu Ala Ala Ile Lys 1 5 10 15
23416PRTStaphylococcus aureus 234Asp Leu Glu Thr Ile Val Gly Val
Gln Thr Glu Lys Pro Phe Lys Arg 1 5 10 15 23520PRTStaphylococcus
aureus 235Thr Met Ala Thr Gly Ile Ala Gly Leu Ser Val Ala Ala Asp
Ser Leu 1 5 10 15 Ser Ala Ile Lys 20 23617PRTStaphylococcus aureus
236Asn Glu Glu Gly Leu Val Val Asp Phe Glu Ile Glu Gly Asp Phe Pro
1 5 10 15 Lys 23719PRTStaphylococcus aureus 237Ala Gly Val Ile Thr
Glu Ser Glu Val Gln Glu Ile Ile Asp His Phe 1 5 10 15 Ile Met Lys
23823PRTStaphylococcus aureus 238Phe Leu His Ser Leu Asp Asn Leu
Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr Val Leu Trp Ser Val
Arg 20 23924PRTStaphylococcus aureus 239Ser Gly Ala Gln Val Gly Pro
Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu Glu Tyr Asp Glu
Val Phe Lys 20 24025PRTStaphylococcus aureus 240Ser Gly Ala Gln Val
Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu Glu Tyr
Asp Glu Val Phe Lys Lys 20 25 24126PRTStaphylococcus aureus 241Glu
Phe Ile Gln Leu Asn Tyr Thr Leu Tyr Glu Gly Asn Asp Ser Phe 1 5 10
15 Leu Ala Gly Pro Thr Glu Ala Thr Ser Lys 20 25
24230PRTStaphylococcus aureus 242Val Ala Ser Thr Ile Thr Ser His
Asp Ala Gly Tyr Leu Asp Lys Asp 1 5 10 15 Leu Glu Thr Ile Val Gly
Val Gln Thr Glu Lys Pro Phe Lys 20 25 30 24332PRTStaphylococcus
aureus 243Thr Pro Asp Tyr Asn Glu Leu Phe Ser Gly Asp Pro Thr Trp
Val Thr 1 5 10 15 Glu Ser Ile Gly Gly Val Gly Ile Asp Gly Arg Pro
Leu Val Thr Lys 20 25 30 2446PRTStaphylococcus aureus 244Leu Pro
Asp Asn Phe Lys 1 5 2456PRTStaphylococcus aureus 245Ile Ile Gly Asp
Tyr Arg 1 5 2466PRTStaphylococcus aureus 246Ile Phe Thr Asp Tyr Arg
1 5 2477PRTStaphylococcus aureus 247Tyr Gly Asn Asn Asp Asp Arg 1 5
24810PRTStaphylococcus aureus 248Thr Leu Leu Tyr Ala Ile Asn Gly
Gly Lys 1 5 10 2499PRTStaphylococcus aureus 249Glu Gln Gln Leu Asp
Val Ile Ser Arg 1 5 25010PRTStaphylococcus aureus 250Leu Arg Glu
Glu Leu Ser Glu Gln Tyr Arg 1 5 10 25112PRTStaphylococcus
aureusMOD_RES(3)..(3)Oxidized Met 251Ile Glu Met Ala Leu His Asp
Thr Glu Ile Val Arg 1 5 10 25213PRTStaphylococcus aureus 252Val Ser
Gly Tyr Ala Val Asn Phe Ile Lys Leu Thr Arg 1 5 10
25315PRTStaphylococcus aureusMOD_RES(12)..(12)Oxidized Met 253Ala
Gly Glu Pro Phe Ala Pro Gly Ala Asn Pro Met His Gly Arg 1 5 10 15
25413PRTStaphylococcus aureusMOD_RES(10)..(10)Oxidized Met 254Val
Ala Leu Tyr Gly Val Asp Phe Leu Met Glu Glu Lys 1 5 10
25516PRTStaphylococcus aureusMOD_RES(13)..(13)Oxidized Met 255Lys
Ala Gly Glu Pro Phe Ala Pro Gly Ala Asn Pro Met His Gly Arg 1 5 10
15 25614PRTStaphylococcus aureus 256Thr Ser Thr Phe Leu Asp Ile Tyr
Ala Glu Arg Asp Leu Lys 1 5 10 25715PRTStaphylococcus
aureusMOD_RES(13)..(13)Oxidized Met 257Val Asp Asp Ile Ala Val Asp
Leu Val Glu Arg Phe Met Thr Lys 1 5
10 15 25820PRTStaphylococcus aureus 258Thr Met Ala Thr Gly Ile Ala
Gly Leu Ser Val Ala Ala Asp Ser Leu 1 5 10 15 Ser Ala Ile Lys 20
25920PRTStaphylococcus aureusMOD_RES(6)..(6)Oxidized Met 259Asp Ser
Glu His Thr Met Ser Val Leu Thr Ile Thr Ser Asn Val Val 1 5 10 15
Tyr Gly Lys Lys 20 26023PRTStaphylococcus aureus 260Phe Leu His Ser
Leu Asp Asn Leu Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr Val
Leu Trp Ser Val Arg 20 26124PRTStaphylococcus aureus 261Ser Gly Ala
Gln Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu
Glu Tyr Asp Glu Val Phe Lys 20 26224PRTStaphylococcus aureus 262Asn
Leu Thr Ser Met Leu Asp Gly Tyr Ala Met Gln Cys Gly His His 1 5 10
15 Leu Asn Ile Asn Val Phe Asn Arg 20 26325PRTStaphylococcus aureus
263Ser Gly Ala Gln Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val
1 5 10 15 Leu Glu Tyr Asp Glu Val Phe Lys Lys 20 25
26427PRTStaphylococcus aureus 264Asp Glu Lys Ser Gly Ala Gln Val
Gly Pro Asn Phe Glu Gly Ile Asn 1 5 10 15 Ser Glu Val Leu Glu Tyr
Asp Glu Val Phe Lys 20 25 26532PRTStaphylococcus aureus 265Thr Pro
Asp Tyr Asn Glu Leu Phe Ser Gly Asp Pro Thr Trp Val Thr 1 5 10 15
Glu Ser Ile Gly Gly Val Gly Ile Asp Gly Arg Pro Leu Val Thr Lys 20
25 30 2666PRTStaphylococcus aureus 266Ala Lys Ser Asn Ser Lys 1 5
2677PRTStaphylococcus aureus 267Thr Phe Tyr Pro Glu Ala Arg 1 5
2688PRTStaphylococcus aureus 268Gln Phe Trp Gly His Leu Val Lys 1 5
2699PRTStaphylococcus aureus 269Trp Ile Pro Leu Met Met Lys Gly Arg
1 5 27010PRTStaphylococcus aureus 270Val Ile Asn Glu Glu Phe Glu
Ile Ser Lys 1 5 10 27111PRTStaphylococcus aureus 271Asn Glu Asp Trp
Gln Leu Tyr Thr Ala Gly Lys 1 5 10 27213PRTStaphylococcus aureus
272Thr Leu Leu Phe Gly Pro Phe Ala Asn Val Gly Pro Lys 1 5 10
27312PRTStaphylococcus aureus 273Leu Asp Arg Pro Ala Ile Glu Ser
Ser Asn Glu Arg 1 5 10 27414PRTStaphylococcus aureus 274Ile Asp Glu
Gly Thr Asp Val Asn Phe Gly Glu Leu Thr Arg 1 5 10
27513PRTStaphylococcus aureus 275Glu Phe Ile Asn Pro Leu Pro His
Ile Ser Tyr Val Arg 1 5 10 27613PRTStaphylococcus aureus 276Glu Ile
Glu Pro Asp Trp Asn Ile His Val Tyr Glu Arg 1 5 10
27716PRTStaphylococcus aureus 277Glu Pro Pro Gly Thr Pro Pro Met
Thr Val Pro His Leu Asp Thr Arg 1 5 10 15 27820PRTStaphylococcus
aureus 278Gln Val Thr Asp Tyr Val Phe Ile Gly Ala Gly Gly Gly Ala
Ile Pro 1 5 10 15 Leu Leu Gln Lys 20 27918PRTStaphylococcus aureus
279Thr Phe Tyr Pro Glu Ala Arg Asn Glu Asp Trp Gln Leu Tyr Thr Ala
1 5 10 15 Gly Lys 28026PRTStaphylococcus aureus 280His Leu Gly Gly
Phe Pro Ile Ser Gly Gln Phe Leu Ala Cys Thr Asn 1 5 10 15 Pro Gln
Val Ile Glu Gln His Asp Ala Lys 20 25 2815PRTStaphylococcus aureus
281Phe Glu Tyr Ile Lys 1 5 2826PRTStaphylococcus aureus 282Asp Ala
Trp Pro Leu Lys 1 5 2837PRTStaphylococcus aureus 283Ala Ser Val Val
Asn Phe Arg 1 5 2847PRTStaphylococcus aureus 284Val Tyr Asp Gln Leu
Ser Lys 1 5 2858PRTStaphylococcus aureus 285Leu Ile Asp Asp Leu Tyr
Glu Lys 1 5 2868PRTStaphylococcus aureus 286Tyr Lys Asp Ala Trp Pro
Leu Lys 1 5 28710PRTStaphylococcus aureus 287Leu Lys Pro Asp Leu
Ile Val Ala Ser Lys 1 5 10 28812PRTStaphylococcus aureus 288Ile Ala
Pro Thr Val Ser Thr Asp Thr Val Phe Lys 1 5 10
28915PRTStaphylococcus aureus 289Ile Val Gly Gln Glu Pro Ala Pro
Asn Leu Glu Glu Ile Ser Lys 1 5 10 15 29015PRTStaphylococcus aureus
290Glu Ser Ile Pro Leu Met Asn Ala Asp His Ile Phe Val Val Lys 1 5
10 15 29117PRTStaphylococcus aureus 291Ile Tyr Ala Gly Gly Tyr Ala
Gly Glu Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys
29218PRTStaphylococcus aureus 292Ile Tyr Ala Gly Gly Tyr Ala Gly
Glu Ile Leu Asn Asp Leu Gly Phe 1 5 10 15 Lys Arg
29320PRTStaphylococcus aureus 293Asn Asn Gln Val Ser Asp Asp Leu
Asp Glu Ile Thr Trp Asn Leu Ala 1 5 10 15 Gly Gly Tyr Lys 20
29431PRTStaphylococcus aureus 294Val Val Thr Leu Tyr Gln Gly Ala
Thr Asp Val Ala Val Ser Leu Gly 1 5 10 15 Val Lys Pro Val Gly Ala
Val Glu Ser Trp Thr Gln Lys Pro Lys 20 25 30 2955PRTStaphylococcus
aureus 295Asp Val Trp Ala Arg 1 5 2966PRTStaphylococcus aureus
296Lys Leu Asn Ala Val Lys 1 5 2976PRTStaphylococcus aureus 297Val
Asp Ile Val Asp Arg 1 5 2986PRTStaphylococcus aureus 298Ile Ile Lys
Pro Val Arg 1 5 2998PRTStaphylococcus aureus 299Ile Ala Pro Thr Leu
Ser Leu Lys 1 5 3007PRTStaphylococcus aureus 300Gln Asn Ile Asn Ser
Phe Lys 1 5 30110PRTStaphylococcus aureus 301Ile Gly Asp Tyr Thr
Ser Val Gly Thr Arg 1 5 10 3029PRTStaphylococcus
aureusMISC_FEATUREOne of the two Mets in this sequence is oxidized.
302Met Ile Ile Met Thr Asp His Ala Lys 1 5 30310PRTStaphylococcus
aureus 303Lys Gln Pro Asn Leu Glu Glu Ile Ser Lys 1 5 10
30412PRTStaphylococcus aureus 304Leu Lys Pro Asp Leu Ile Ile Ala
Asp Ser Ser Arg 1 5 10 30511PRTStaphylococcus aureus 305Val Asp Ile
Val Asp Arg Asp Val Trp Ala Arg 1 5 10 30614PRTStaphylococcus
aureus 306Leu Lys Pro Asp Leu Ile Ile Ala Asp Ser Ser Arg His Lys 1
5 10 30718PRTStaphylococcus aureus 307Gly Pro Tyr Leu Gln Leu Asp
Thr Glu His Leu Ala Asp Leu Asn Pro 1 5 10 15 Glu Arg
30822PRTStaphylococcus aureus 308Ala Gly Leu Leu Ala His Pro Asn
Tyr Ser Tyr Val Gly Gln Phe Leu 1 5 10 15 Asn Glu Leu Gly Phe Lys
20 30927PRTStaphylococcus aureus 309Ile Val Val Leu Glu Tyr Ser Phe
Ala Asp Ala Leu Ala Ala Leu Asp 1 5 10 15 Val Lys Pro Val Gly Ile
Ala Asp Asp Gly Lys 20 25 31028PRTStaphylococcus aureus 310Ile Val
Val Leu Glu Tyr Ser Phe Ala Asp Ala Leu Ala Ala Leu Asp 1 5 10 15
Val Lys Pro Val Gly Ile Ala Asp Asp Gly Lys Lys 20 25
3119PRTStaphylococcus aureus 311Ala Ala Ala Ile Asp Leu Ala Gly Arg
1 5 3129PRTStaphylococcus aureusMOD_RES(8)..(8)Oxidized Met 312Asn
Ile Glu Ala Asp Thr Gly Met Arg 1 5 31310PRTStaphylococcus aureus
313Val Val Asp Ala Asn Ile Ala Ala Gln Arg 1 5 10
3149PRTStaphylococcus aureus 314Ala Asp Ile Asp Leu Pro Phe Glu Arg
1 5 31513PRTStaphylococcus aureus 315Leu Val Gly Gly Ala Gly Glu
Glu Thr Ile Ile Ala Arg 1 5 10 31613PRTStaphylococcus aureus 316Ala
Met Ala Val Ala Thr Glu Gln Glu Met Lys Ala Arg 1 5 10
31714PRTStaphylococcus aureus 317His His Thr Glu Val Leu Glu Asn
Pro Asp Asn Ile Ser Lys 1 5 10 31817PRTStaphylococcus aureus 318Val
Val Glu Ala Glu Ser Glu Val Pro Leu Ala Met Ala Glu Ala Leu 1 5 10
15 Arg 31918PRTStaphylococcus aureus 319Val Ile Glu Thr Pro Phe Ile
Ala Gly Val Ala Met Asn Gly Ile Glu 1 5 10 15 Val Lys
32022PRTStaphylococcus aureus 320Ala Gly Leu Ala Leu Thr Thr Asn
Gln Leu Glu Ser His Tyr Leu Ala 1 5 10 15 Gly Gly Asn Val Asp Arg
20 32127PRTStaphylococcus aureus 321Thr Val Leu Ser Lys Gly Leu Asp
Ser Gly Thr Ala Phe Glu Ile Leu 1 5 10 15 Ser Ile Asp Ile Ala Asp
Val Asp Ile Ser Lys 20 25 32232PRTStaphylococcus aureus 322Ala Gly
Leu Ala Leu Thr Thr Asn Gln Leu Glu Ser His Tyr Leu Ala 1 5 10 15
Gly Gly Asn Val Asp Arg Val Val Asp Ala Asn Ile Ala Ala Gln Arg 20
25 30 3235PRTStaphylococcus aureus 323Ala Asp Tyr Glu Lys 1 5
3247PRTStaphylococcus aureus 324Tyr Ile Ala Gln Leu Glu Lys 1 5
3258PRTStaphylococcus aureus 325Gln Gly Thr Pro Glu Gln Met Arg 1 5
32610PRTStaphylococcus aureus 326Ala Leu Glu Gln Ala Gly Lys Ser
Leu Lys 1 5 10 32711PRTStaphylococcus aureus 327His Leu Leu Val Glu
Thr Ser Val Asp Lys Lys 1 5 10 32813PRTStaphylococcus aureus 328Asp
Ile Phe Gly Glu Val Tyr Thr Asp Ser Ile Gly Lys 1 5 10
32912PRTStaphylococcus aureus 329Thr Ile Gln Gln Thr Phe Ile Asp
Asn Asp Lys Lys 1 5 10 33013PRTStaphylococcus aureus 330Val Val Thr
Thr Asn Ser Ile Leu Tyr Asp Met Ala Lys 1 5 10
33114PRTStaphylococcus aureus 331Lys Asp Ile Phe Gly Glu Val Tyr
Thr Asp Ser Ile Gly Lys 1 5 10 33214PRTStaphylococcus aureus 332Asp
Val Lys Pro Ile Tyr Leu Asn Gly Glu Glu Gly Asn Lys 1 5 10
33314PRTStaphylococcus aureus 333Gln Asp Pro His Ala Trp Leu Ser
Leu Asp Asn Gly Ile Lys 1 5 10 33416PRTStaphylococcus aureus 334Asp
Val Lys Pro Ile Tyr Leu Asn Gly Glu Glu Gly Asn Lys Asp Lys 1 5 10
15 33516PRTStaphylococcus aureus 335Asp Lys Gln Asp Pro His Ala Trp
Leu Ser Leu Asp Asn Gly Ile Lys 1 5 10 15 33616PRTStaphylococcus
aureus 336Gln Tyr Gly Ile Thr Pro Gly Tyr Ile Trp Glu Ile Asn Thr
Glu Lys 1 5 10 15 33720PRTStaphylococcus aureus 337Val Ile Ala Val
Ser Lys Asp Val Lys Pro Ile Tyr Leu Asn Gly Glu 1 5 10 15 Glu Gly
Asn Lys 20 33823PRTStaphylococcus aureus 338Leu Thr Asp Ala Asp Val
Ile Leu Tyr Asn Gly Leu Asn Leu Glu Thr 1 5 10 15 Gly Asn Gly Trp
Phe Glu Lys 20 33927PRTStaphylococcus aureus 339Asn Val Gly Gly Asp
Asn Val Asp Ile His Ser Ile Val Pro Val Gly 1 5 10 15 Gln Asp Pro
His Glu Tyr Glu Val Lys Pro Lys 20 25 3405PRTStaphylococcus aureus
340Ala Asp Tyr Glu Lys 1 5 3417PRTStaphylococcus aureus 341Tyr Ile
Ala Gln Leu Glu Lys 1 5 34211PRTStaphylococcus aureus 342His Leu
Leu Val Glu Thr Ser Val Asp Lys Lys 1 5 10 34313PRTStaphylococcus
aureus 343Asp Ile Phe Gly Glu Val Tyr Thr Asp Ser Ile Gly Lys 1 5
10 34412PRTStaphylococcus aureus 344Thr Ile Gln Gln Thr Phe Ile Asp
Asn Asp Lys Lys 1 5 10 34513PRTStaphylococcus aureus 345Val Val Thr
Thr Asn Ser Ile Leu Tyr Asp Met Ala Lys 1 5 10
34614PRTStaphylococcus aureus 346Asp Val Lys Pro Ile Tyr Leu Asn
Gly Glu Glu Gly Asn Lys 1 5 10 34714PRTStaphylococcus aureus 347Gln
Asp Pro His Ala Trp Leu Ser Leu Asp Asn Gly Ile Lys 1 5 10
34816PRTStaphylococcus aureus 348Asp Val Lys Pro Ile Tyr Leu Asn
Gly Glu Glu Gly Asn Lys Asp Lys 1 5 10 15 34916PRTStaphylococcus
aureus 349Asp Lys Gln Asp Pro His Ala Trp Leu Ser Leu Asp Asn Gly
Ile Lys 1 5 10 15 35016PRTStaphylococcus aureus 350Gln Tyr Gly Ile
Thr Pro Gly Tyr Ile Trp Glu Ile Asn Thr Glu Lys 1 5 10 15
35123PRTStaphylococcus aureus 351Leu Thr Asp Ala Asp Val Ile Leu
Tyr Asn Gly Leu Asn Leu Glu Thr 1 5 10 15 Gly Asn Gly Trp Phe Glu
Lys 20 35227PRTStaphylococcus aureus 352Asn Val Gly Gly Asp Asn Val
Asp Ile His Ser Ile Val Pro Val Gly 1 5 10 15 Gln Asp Pro His Glu
Tyr Glu Val Lys Pro Lys 20 25 3536PRTStaphylococcus aureus 353Ile
Ile Gly Asp Tyr Arg 1 5 3546PRTStaphylococcus aureus 354Ile Phe Thr
Asp Tyr Arg 1 5 3559PRTStaphylococcus aureus 355Glu Gln Gln Leu Asp
Val Ile Ser Arg 1 5 35610PRTStaphylococcus aureus 356Leu Arg Glu
Glu Leu Ser Glu Gln Tyr Arg 1 5 10 35720PRTStaphylococcus aureus
357Thr Met Ala Thr Gly Ile Ala Gly Leu Ser Val Ala Ala Asp Ser Leu
1 5 10 15 Ser Ala Ile Lys 20 35819PRTStaphylococcus aureus 358Ala
Gly Val Ile Thr Glu Ser Glu Val Gln Glu Ile Ile Asp His Phe 1 5 10
15 Ile Met Lys 35923PRTStaphylococcus aureus 359Phe Leu His Ser Leu
Asp Asn Leu Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr Val Leu
Trp Ser Val Arg 20 36024PRTStaphylococcus aureus 360Ser Gly Ala Gln
Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu Glu
Tyr Asp Glu Val Phe Lys 20 36125PRTStaphylococcus aureus 361Ser Gly
Ala Gln Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15
Leu Glu Tyr Asp Glu Val Phe Lys Lys 20 25 36230PRTStaphylococcus
aureus 362Val Ala Ser Thr Ile Thr Ser His Asp Ala Gly Tyr Leu Asp
Lys Asp 1 5 10 15 Leu Glu Thr Ile Val Gly Val Gln Thr Glu Lys Pro
Phe Lys 20 25 30 3636PRTStaphylococcus aureus 363Ile Phe Thr Asp
Tyr Arg 1 5 36415PRTStaphylococcus aureus 364Asp Leu Glu Thr Ile
Val Gly Val Gln Thr Glu Lys Pro Phe Lys 1 5 10 15
36516PRTStaphylococcus aureus 365Asp Leu Glu Thr Ile Val Gly Val
Gln Thr Glu Lys Pro Phe Lys Arg 1 5 10 15 36620PRTStaphylococcus
aureus 366Thr Met Ala Thr Gly Ile Ala Gly Leu Ser Val Ala Ala Asp
Ser Leu 1 5 10 15 Ser Ala Ile Lys 20 36717PRTStaphylococcus aureus
367Asn Glu Glu Gly Leu Val Val Asp Phe Glu Ile Glu Gly Asp Phe Pro
1 5 10 15 Lys 36823PRTStaphylococcus aureus 368Phe Leu His Ser Leu
Asp Asn Leu Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr Val Leu
Trp Ser Val Arg 20 36924PRTStaphylococcus aureus 369Ser Gly Ala Gln
Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu Glu
Tyr Asp Glu Val Phe Lys 20 37026PRTStaphylococcus aureus 370Glu Phe
Ile Gln Leu Asn Tyr Thr Leu Tyr Glu Gly Asn Asp Ser Phe 1 5 10 15
Leu Ala Gly Pro Thr Glu Ala Thr Ser Lys 20 25 3716PRTStaphylococcus
aureus 371Ile Val Lys Phe Ala Arg 1 5 37210PRTStaphylococcus aureus
372Thr Leu Leu Tyr Ala Ile Asn Gly Gly Lys 1 5 10
3739PRTStaphylococcus aureus 373Glu Gln Gln Leu Asp Val Ile Ser Arg
1 5 37411PRTStaphylococcus aureus 374Val Asp Asp Ile Ala Val Asp
Leu Val Glu Arg 1 5 10 37511PRTStaphylococcus aureus 375Leu Pro Asp
Asn Phe Lys Thr Tyr Cys Ala Lys 1 5 10 37614PRTStaphylococcus
aureus 376Asp Gln Lys Gly Ala Leu Ser Ser Leu Ser
Ser Val Ala Lys 1 5 10 37715PRTStaphylococcus aureus 377Val Ala Ser
Thr Ile Thr Ser His Asp Ala Gly Tyr Leu Asp Lys 1 5 10 15
37815PRTStaphylococcus aureus 378Asp Leu Glu Thr Ile Val Gly Val
Gln Thr Glu Lys Pro Phe Lys 1 5 10 15 37917PRTStaphylococcus aureus
379Met Ser Ile Lys Thr Ser Ser Ile Gln Tyr Glu Asn Asp Asp Ile Met
1 5 10 15 Arg 38023PRTStaphylococcus aureus 380Phe Leu His Ser Leu
Asp Asn Leu Gly Pro Ala Pro Glu Pro Asn Leu 1 5 10 15 Thr Val Leu
Trp Ser Val Arg 20 38124PRTStaphylococcus aureus 381Ser Gly Ala Gln
Val Gly Pro Asn Phe Glu Gly Ile Asn Ser Glu Val 1 5 10 15 Leu Glu
Tyr Asp Glu Val Phe Lys 20 3827PRTStaphylococcus aureus 382Thr Phe
Tyr Pro Glu Ala Arg 1 5 3838PRTStaphylococcus aureus 383Gln Phe Trp
Gly His Leu Val Lys 1 5 3849PRTStaphylococcus aureus 384Trp Ile Pro
Leu Met Met Lys Gly Arg 1 5 38510PRTStaphylococcus aureus 385Val
Ile Asn Glu Glu Phe Glu Ile Ser Lys 1 5 10 38610PRTStaphylococcus
aureus 386Tyr Ser Phe Asp Gln Val Ile Met Thr Lys 1 5 10
38711PRTStaphylococcus aureus 387Asn Glu Asp Trp Gln Leu Tyr Thr
Ala Gly Lys 1 5 10 38813PRTStaphylococcus aureus 388Thr Leu Leu Phe
Gly Pro Phe Ala Asn Val Gly Pro Lys 1 5 10 38913PRTStaphylococcus
aureusMOD_RES(9)..(9)Oxidized Met 389Gly Arg Glu Asp Asn Pro Gly
Ile Met Ala Ala Ser Lys 1 5 10 39012PRTStaphylococcus aureus 390Leu
Asp Arg Pro Ala Ile Glu Ser Ser Asn Glu Arg 1 5 10
39112PRTStaphylococcus aureus 391Asn Glu Asp Trp Gln Leu Tyr Thr
Ala Gly Lys Arg 1 5 10 39214PRTStaphylococcus aureus 392Ile Asp Glu
Gly Thr Asp Val Asn Phe Gly Glu Leu Thr Arg 1 5 10
39313PRTStaphylococcus aureus 393Glu Phe Ile Asn Pro Leu Pro His
Ile Ser Tyr Val Arg 1 5 10 39413PRTStaphylococcus aureus 394Glu Ile
Glu Pro Asp Trp Asn Ile His Val Tyr Glu Arg 1 5 10
39516PRTStaphylococcus aureusMOD_RES(8)..(8)Oxidized Met 395Glu Pro
Pro Gly Thr Pro Pro Met Thr Val Pro His Leu Asp Thr Arg 1 5 10 15
39620PRTStaphylococcus aureus 396Gln Val Thr Asp Tyr Val Phe Ile
Gly Ala Gly Gly Gly Ala Ile Pro 1 5 10 15 Leu Leu Gln Lys 20
39720PRTStaphylococcus aureusMOD_RES(12)..(12)Oxidized Met 397Val
Tyr Gly Lys Glu Pro Pro Gly Thr Pro Pro Met Thr Val Pro His 1 5 10
15 Leu Asp Thr Arg 20 39826PRTStaphylococcus aureus 398His Leu Gly
Gly Phe Pro Ile Ser Gly Gln Phe Leu Ala Cys Thr Asn 1 5 10 15 Pro
Gln Val Ile Glu Gln His Asp Ala Lys 20 25 3999PRTStaphylococcus
aureus 399Ala Ala Ala Ile Asp Leu Ala Gly Arg 1 5
40010PRTStaphylococcus aureus 400Val Val Asp Ala Asn Ile Ala Ala
Gln Arg 1 5 10 4019PRTStaphylococcus aureus 401Ala Asp Ile Asp Leu
Pro Phe Glu Arg 1 5 40213PRTStaphylococcus aureus 402Leu Val Gly
Gly Ala Gly Glu Glu Thr Ile Ile Ala Arg 1 5 10
40314PRTStaphylococcus aureus 403His His Thr Glu Val Leu Glu Asn
Pro Asp Asn Ile Ser Lys 1 5 10 40417PRTStaphylococcus aureus 404Val
Val Glu Ala Glu Ser Glu Val Pro Leu Ala Met Ala Glu Ala Leu 1 5 10
15 Arg 40522PRTStaphylococcus aureusMOD_RES(17)..(17)Oxidized Met
405Ala Ala Ala Ile Asp Leu Ala Gly Arg Asp Val Leu Glu Ala Val Gln
1 5 10 15 Met Ser Val Asn Pro Lys 20 40622PRTStaphylococcus aureus
406Ala Gly Leu Ala Leu Thr Thr Asn Gln Leu Glu Ser His Tyr Leu Ala
1 5 10 15 Gly Gly Asn Val Asp Arg 20 40727PRTStaphylococcus aureus
407Thr Val Leu Ser Lys Gly Leu Asp Ser Gly Thr Ala Phe Glu Ile Leu
1 5 10 15 Ser Ile Asp Ile Ala Asp Val Asp Ile Ser Lys 20 25
4086PRTStaphylococcus aureus 408Phe Val Phe His Gly Arg 1 5
4098PRTStaphylococcus aureus 409Asp Gly Phe Asn Asn Ile Glu Arg 1 5
41013PRTStaphylococcus aureus 410Gly His Val Tyr Asn Gly Ile Ser
Gly Gly Gln Phe Lys 1 5 10 41112PRTStaphylococcus aureus 411Tyr Thr
Pro Thr Ser Ile Leu Tyr Phe Asn Pro Lys 1 5 10
41213PRTStaphylococcus aureus 412Gln Leu Ala Glu Asp Leu Gln Lys
His Leu Gly Ala Lys 1 5 10 41315PRTStaphylococcus
aureusMOD_RES(9)..(9)Oxidized Met 413Asn His Ser Glu Tyr Val Thr
Asp Met Arg Leu Ile Gly Ile Arg 1 5 10 15 41416PRTStaphylococcus
aureus 414Asp Leu Pro Pro Met Glu Gln Val Phe Asp Thr Leu Asp Leu
Asp Lys 1 5 10 15 41516PRTStaphylococcus aureusMISC_FEATUREOne of
the two Mets in this sequence is oxidized. 415Ile Arg Pro Glu Asp
Met His Ile Met Ala Asn Ile Phe Leu Pro Lys 1 5 10 15
41617PRTStaphylococcus aureus 416Arg Ile Arg Pro Glu Asp Met His
Ile Met Ala Asn Ile Phe Leu Pro 1 5 10 15 Lys
41720PRTStaphylococcus aureus 417Ile Ser His Leu Val Leu Thr Arg
Thr Gly Leu Tyr Ile Ile Asp Ser 1 5 10 15 Gln Leu Leu Lys 20
* * * * *
References