U.S. patent application number 14/842192 was filed with the patent office on 2016-02-18 for methods and compositions related to immunizing against staphylococcal lung diseases and conditions.
This patent application is currently assigned to THE UNIVERSITY OF CHICAGO. The applicant listed for this patent is THE UNIVERSITY OF CHICAGO. Invention is credited to Juliane Bubeck-Wardenburg, Olaf Schneewind.
Application Number | 20160046698 14/842192 |
Document ID | / |
Family ID | 48797387 |
Filed Date | 2016-02-18 |
United States Patent
Application |
20160046698 |
Kind Code |
A1 |
Bubeck-Wardenburg; Juliane ;
et al. |
February 18, 2016 |
Methods and Compositions Related to Immunizing Against
Staphylococcal Lung Diseases and Conditions
Abstract
Embodiments of the invention include methods and compositions
useful in a vaccination strategy capable of neutralizing Hla to
provide immunoprotection against S. aureus pneumonia. In certain
aspects the invention includes a Hla with reduced toxicity,
represented by a recombinant mutant form of Hla (HlaH35L) in which
histidine 35 is converted to leucine, which can be used to abrogate
the productive assembly of the toxin and protect a subject from
staphylococcal pneumonia.
Inventors: |
Bubeck-Wardenburg; Juliane;
(Frankfort, IL) ; Schneewind; Olaf; (Chicago,
IL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
THE UNIVERSITY OF CHICAGO |
Chicago |
IL |
US |
|
|
Assignee: |
THE UNIVERSITY OF CHICAGO
Chicago
IL
|
Family ID: |
48797387 |
Appl. No.: |
14/842192 |
Filed: |
September 1, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13742155 |
Jan 15, 2013 |
9181329 |
|
|
14842192 |
|
|
|
|
12675597 |
Sep 23, 2010 |
8840906 |
|
|
PCT/US2008/074849 |
Aug 29, 2008 |
|
|
|
13742155 |
|
|
|
|
60969514 |
Aug 31, 2007 |
|
|
|
Current U.S.
Class: |
530/387.3 |
Current CPC
Class: |
A61K 2039/505 20130101;
A61K 45/06 20130101; C07K 2317/31 20130101; A61K 39/40 20130101;
C07K 16/1271 20130101; C07K 2317/622 20130101; C07K 2317/24
20130101 |
International
Class: |
C07K 16/12 20060101
C07K016/12 |
Goverment Interests
[0002] This invention was made with government support under
AI38897 and AI52474 awarded by the National Institutes of Health;
and HD00850 awarded by the National Institute of Child Health and
Human Development. The government has certain rights in the
invention.
Claims
1.-76. (canceled)
77. An isolated antibody that specifically binds an epitope
contained within the first 50 amino acids of a mature Hla toxin,
wherein the isolated antibody does not detectably bind a L78-D127
Hla toxin fragment based on a Western blot assay, and wherein the
isolated antibody is a humanized antibody, a chimeric antibody, a
bispecific antibody, a recombinant antibody, a single chain
antibody, an scFv, or an engineered antibody.
78. The isolated antibody of claim 77, wherein the Hla toxin is
from Staphylococcus aureus.
79. The isolated antibody of claim 77, wherein the Hla toxin is an
H35L variant.
80. The isolated antibody of claim 77, wherein the isolated
antibody competes for binding to a mature Hla toxin with
supernatant from hybridoma 7B8.35 (ATCC Accession Number
PTA-121360).
81. The isolated antibody of claim 77, wherein the isolated
antibody competes for binding to a mature Hla toxin with
supernatant from hybridoma 1A9.4F9 (ATCC Accession Number
PTA-121613).
82. The isolated antibody of claim 77, wherein the isolated
antibody has increased binding to an A1-K50 Hla toxin fragment
compared to one of the following Hla toxin fragments: Y40-L88,
L78-D127, T117-G166, 1156-K205, L195-N244, or M234-N293.
83. The isolated antibody of claim 82, wherein the isolated
antibody has increased binding to an A1-K50 Hla toxin fragment
compared to the following Hla toxin fragments: Y40-L88, L78-D127,
T117-G166, 1156-K205, L195-N244, and M234-N293.
84. The isolated antibody of claim 77, wherein the isolated
antibody does not detectably bind a Y40-L88 Hla toxin fragment
based on a Western blot assay.
85. The isolated antibody of claim 77, wherein the isolated
antibody does not detectably bind a T117-G166 Hla toxin fragment
based on a Western blot assay.
86. The isolated antibody of claim 77, wherein the isolated
antibody does not detectably bind a 1156-K205 Hla toxin fragment
based on a Western blot assay.
87. The isolated antibody of claim 77, wherein the isolated
antibody does not detectably bind a L195-N244 Hla toxin fragment
based on a Western blot assay.
88. The isolated antibody of claim 77, wherein the isolated
antibody does not detectably bind a M234-N293 Hla toxin fragment
based on a Western blot assay.
89. The isolated antibody of claim 77, wherein the isolated
antibody comprises complementarity determining regions from a mouse
antibody.
90. The isolated antibody of claim 89, wherein the mouse antibody
is 7B8.35.
91. The isolated antibody of claim 89, wherein the mouse antibody
is 1A9.4F9.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 13/742,155 filed Jan. 15, 2013, which is a
divisional of U.S. patent application Ser. No. 12/675,597 filed
Sep. 23, 2010, which is a national phase application under 35
U.S.C. .sctn.371 of International Application No. PCT/US2008/074849
filed Aug. 29, 2008, which claims priority to U.S. Provisional
Application Ser. No. 60/969,514 filed Aug. 31, 2007. The entire
contents of each of the above-referenced disclosures are
specifically incorporated herein by reference without
disclaimer.
BACKGROUND OF THE INVENTION
[0003] I. Field of the Invention
[0004] The present invention relates generally to the fields of
immunology, microbiology, infectious diseases and medicine. In a
more particular embodiment, it concerns methods and compositions
including an exotoxin protein, such as .alpha.-hemolysin, for
producing an immune response to a bacterium.
[0005] II. Background
[0006] The current methods for treating S. aureus pneumonia rely on
antimicrobial drugs against which the organism has a remarkable
propensity to acquire resistance. The pathogenesis of
staphylococcal infections relies on many different virulence
factors such as secreted exotoxins. Previous studies have shown
that deletion of single genes encoding such factors causes either
no defect or results in only modest reduction of virulence.
However, studies of S. aureus pneumonia in a murine model system
conducted by the inventors unexpectedly defined .alpha.-hemolysin,
also known as alpha toxin, as a critical virulence factor in the
pathogenesis of the disease, as a mutant strain lacking this
exotoxin was avirulent. Alpha-hemolysin is a member of a family of
bacterial cytotoxins that is secreted by S. aureus and is capable
of inserting into the cell membrane of a multitude of eukaryotic
cells. The protein is secreted as a monomer, however it assembles
into a heptameric ring structure on the surface of eukaryotic
cells. The assembled toxin inserts into the host cell membrane,
forming a pore that contributes to cellular injury and death by
disrupting the integrity of the membrane. Several biochemical
studies have defined the amino acid residues within the
.beta.-hemolysin monomer that facilitate binding to the host cell,
heptamer formation and host cell lysis.
[0007] The development of staphylococcal vaccines is hindered by
the multifaceted nature of staphylococcal invasion strategies. It
is well established that live attenuated microorganisms are highly
effective vaccines, presenting a number of antigens to the
subject's immune system. Immune responses elicited by such vaccines
are often of greater magnitude and of longer duration than those
produced by non-replicating or multi-component immunogens. One
explanation for this may be that live attenuated strains establish
limited infections in the host and mimic the early stages of
natural infection as well as presenting a number of antigens to the
immune system.
[0008] A number of references describe the inclusion of a
.alpha.-hemolysin (Hla) component in a vaccine, some of which
describe a chemically or heat attenuated Hla toxoid. See U.S. Pat.
No. 4,327,082 for example. Other references have described
immunizing a human with a multi-component toxoid vaccine and
isolating Hla neutralizing antibodies for use in passive
immunization. See U.S. Pat. No. 4,027,010. Adlam et al., (1977)
have tested the effectiveness of purified Hla to protect against
mammary infections. Adlam et al. observed a reduction in the "blue
breast form" of mastitis, but did not see protection against the
local chronic abscess form of staphylococcal disease. Adlam et al.,
attribute this observation to the insufficiency of Hla alone to
protect against a multi-factorial disease state such as the local
chronic abscess form of staphylococcal infection.
[0009] Bhakdi et al. (1994) have described the reduced toxicity of
Hla having a mutation at residue 35 and describe administration of
such a mutant to a rabbit without killing the rabbit. Menzies and
Kernodle (1996) describe a similar H35L mutant of Hla and its use
to produce antibodies in rabbits that can later be purified and
used in passive immunity experiments. Menzies and Kernodle also
describe the difficulty and expected failure of producing
protection using a single component vaccine; they state "The great
diversity of S aureus as a pathogen and the multitude of virulence
factors which it produces make it unlikely that a single
immunologic target such as alpha toxin would be effective as a
vaccine candidate." The inventors note that none of these
references address the effectiveness of any composition to protect
against or treat staphylococcal pneumonia.
[0010] The state of the art is such that one of skill in the art
would not consider a recombinant Hla alone or substantially alone
as an effective antigen for protecting against staphylococcus
infection, particularly respiratory infections of staphylococcus or
the indirect effects of staphylococcal respiratory infection. Thus,
those of skill in the art would have no expectation of Hla,
administered as a primary vaccine component in the absence or
substantial absence of other Staphylococcal antigen(s), evoking an
immune response sufficient for protecting a subject from or
treating a subject with respiratory infection or staphylococcal
associated pneumonia.
[0011] There remains a need in the art for additional compositions
and methods for preventing and/or treating staphylococcal infection
of the lungs, as well as the attenuation or amelioration of the
secondary effects of such an infection.
SUMMARY OF THE INVENTION
[0012] The present invention is based on data showing that the
administration of attenuated .alpha.-hemolysin (Hla) toxin from
Staphylococcus aureus to an animal model of human staphylococcal
pneumonia protects the animal from mortality, reduces the number of
bacteria that can be recovered from the animal's lungs, and limits
pathological lesions to the focal site of the infection. Moreover,
the invention is based on data showing that antibodies generated
against .alpha.-hemolysin (also known as a toxin) in rabbits could
be administered to mice to confer a protective effect against
staphylococcal pneumonia. Therefore, the present invention concerns
methods and compositions for active immunization against
staphylococcal pneumonia in a subject using Hla toxin as a
monotherapy in which other staphylococcal proteins and antibodies
are specifically excluded, as well as methods and compositions for
passive immunization with antibodies specific for
.alpha.-hemolysin.
[0013] Certain embodiments include an immunogenic composition
comprising an isolated polypeptide comprising at least or at most
3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36. 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more amino
acids of SEQ ID NO:2, including all values and ranges there
between. In certain aspects an isolated polypeptide includes at
least, at most or about amino acids 1-50 of SEQ ID NO:2. In a
further aspect the isolated polypeptide is a fusion protein. The
composition can comprise an adjuvant. In certain aspects the
isolated polypeptide is a fusion protein and/or a lipopeptide.
[0014] In some embodiments of the invention, there are methods of
protecting a patient from a staphylococcal lung disease or
condition (e.g., a disease of condition associated with presence of
Staphylococcus bacteria including those diseases resulting from
staphylococcus infection or staphylococcus infection is sequela to
a first disease or condition) comprising administering to a patient
an effective amount of a composition comprising recombinant and
attenuated Staphylococcus .alpha.-hemolysin (Hla) toxin, wherein
the composition contains no more than contaminating amounts of any
other Staphylococcus protein. A contaminating amount refers to less
than 10, 5, 1, 0.1, 0.05 or less weight percent of a protein,
polypeptide or peptide other than the peptide comprising all or a
segment of Hla.
[0015] The phrase "protecting a patient" in the context of the
invention refers to preventing, treating, reducing the severity of,
and/or ameliorating a staphylococcal lung disease or condition in a
human patient. Unless otherwise indicated, it also refers to
preventing or delaying mortality attributable to the disease or
condition, decreasing the number of staphylococcus bacteria
recoverable from the lungs, limiting the pathological lesions to
focal sites, decreasing the extent of damage from the disease or
condition, decreasing the duration of the disease or condition,
and/or reducing the number, extent, or duration of symptoms related
to the disease or condition. Embodiments of the invention that are
implemented in the context of a human patient may also be
implemented with respect to any mammalian subject. In other
aspects, the methods can be directed to elliciting an immune
response to a staphylococcal bacteria. In a further aspect a
patient has or is at risk of developing a lung disease associated
with staphylococcal bacteria.
[0016] Other embodiments of the invention concern methods for
preventing a staphylococcal lung disease or condition in a patient
comprising administering to the patient an effective amount of a
composition comprising recombinant and attenuated Staphylococcus
.alpha.-hemolysin (Hla) toxin, wherein the composition does not
elicit a detectable immune response against any other
Staphylococcus protein.
[0017] The present invention also relates to methods for protecting
a patient from a staphyococcal lung disease or condition comprising
administering to a patient an effective amount of a composition
consisting essentially of recombinant and attenuated Staphylococcus
.alpha.-hemolysin (Hla) toxin. The term "consisting essentially of"
means the composition does not contain other ingredients that
materially affect the basic and novel properties of the invention,
i.e., the use of recombinant, attenuated Hla toxin as the
staphylococcus antigen in the composition for evoking an immune
response against staphylococcus in the patient.
[0018] In additional embodiments of the invention, there are
methods for protecting a patient from a staphylococcal lung disease
or condition comprising administering to the patient an effective
amount of a composition including humanized antibodies that are
immunologically reactive against Staphylococcus aureus
.alpha.-hemolysin (Hla).
[0019] The term "humanized antibodies" refers to an antibody that
has been genetically engineered to minimize the amount of a
non-human antibody that is transplanted into a human antibody. The
part of the antibody containing non-human sequence is typically the
variable part of the antibody while the nonvariable part is human
sequence. Generally, humanized antibodies are 90-95% human sequence
and 5-10% non-human sequence. The term "immunologically reactive"
means that the antibodies specifically recognize the specified
antigen and generate an immune response against the antigen.
[0020] The term "staphylococcal lung disease or condition" refers
to a disease or condition of the lungs that an infection from
staphylococcus bacteria causes, contributes to, exacerbates, and/or
helps to maintain. In particular embodiments, a staphylococcal lung
disease or condition is pneumonia.
[0021] Methods of the present invention include providing the
antigen, epitope(s), or antibodies in an amount effective to
achieve the intended purpose as indicated by the claimed invention.
More specifically, in some embodiments an effective amount means an
amount of active ingredients effective to stimulate or elicit an
immune response, or provide resistance to, or amelioration of
infection. In more specific aspects, an effective amount prevents,
alleviates or ameliorates symptoms of disease or infection, or
prolongs the survival of the subject being treated. Determination
of an effective amount is well within the capability of those
skilled in the art, especially in light of the detailed disclosure
provided herein. For any preparation used in the methods of the
invention, an effective amount or dose can be estimated initially
from in vitro, cell culture, and/or animal model assays. For
example, a dose can be formulated in animal models to achieve a
desired immune response or circulating antibody concentration or
titer. Such information can be used to more accurately determine
useful doses in humans.
[0022] In some embodiments, the patient involved in methods of the
invention is considered to be at risk for a staphylococcal lung
disease or condition. Such patients include, but are not limited
to, a patient who is hospitalized or will be hospitalized, a
patient who is or will be put in an intensive care unit, a patient
who will undergo surgery, a patient who will be anesthetized or
under general anesthesia, a patient over the age of 65, a patient
with a compromised immune system, a pediatric patient, a patient
who is or may be put on a respirator or other mechanical
ventilator, a patient in whom an endotracheal tube will or has been
placed, a patient who is or will be immobilized, a patient who will
undergo, is undergoing, or has undergone chemotherapy or
myeloablative therapy, and a patient who will take, is taking, or
has taken one or more immunosuppressants, particularly for a
significant period of time (longer than a month). Moreover, it is
contemplated that the patient may also appear to be a healthy
individual or no risk factors for pneumonia may be known or evident
with respect to a patient that may benefit from methods and
compositions of the invention.
[0023] In further embodiments of the invention, methods may also
involve identifying a patient at risk for a staphylococcal lung
disease or condition. Additionally, methods may include evaluating
a patient for risk factors for a staphylococcal lung disease or
condition, evaluating a patient for symptoms of a staphylococcal
lung disease or condition, or diagnosing the patient with a
staphylococcal lung disease or condition. In certain embodiments,
methods may involve implementing steps in which the staphylococcal
lung disease or condition is pneumonia.
[0024] In some aspects of the invention, an .alpha.-hemolysin (Hla)
toxin is attenuated, meaning that the toxin has been altered to be
functionally weaker or less toxic than an unaltered toxin. In
certain embodiments of the invention, the toxin is attenuated by
virtue of one or more amino acid changes to create a Hla variant.
The amino acid change may be a deletion, insertion, and/or
substitution of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32,
33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49,
50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66,
67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83,
84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99,
100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112,
113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125,
126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138,
139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151,
152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164,
165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177,
178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190,
191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 202, 203,
204, 205, 206, 207, 208, 209, 210, 211, 212, 213, 214, 215, 216,
217, 218, 219, 220, 221, 222, 223, 224, 225, 226, 227, 228, 229,
230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240, 241, 242,
243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253, 254, 255,
256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266, 267, 268,
269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281,
282, and 283 amino acids, or any range derivable therein. In some
embodiments the changes are with respect to SEQ ID NO:1 or SEQ ID
NO:2. In specific embodiments, the alteration is at position 24,
35, 66, 70, 110, and/or 152 of SEQ ID NO:2. In specific
embodiments, the change is D24C, H35C, H35K, R66C, E70C, or K110C,
or any combination thereof (amino acids referred to using single
letter code). Moreover, in particular embodiments, the attenuated
Hla toxin is H35L (name used in literature), which refers to a
toxin having a leucine at position 35 of the polypeptide instead of
a histidine. It is contemplated that position 35 may be substituted
with any other amino acid at that position, including any of the
other 19 naturally occurring amino acids. Consequently, in some
embodiments of the invention, an attenuated Hla toxin is
recombinant, meaning the toxin is created using DNA that has been
altered through recombinant engineering.
[0025] In certain embodiments, the Hla toxin has a sequence
identical or similar to SEQ ID NOs: 1 or 2. In certain aspects the
Hla toxin is a mature Hla toxin (SEQ ID NO:2) in which the initial
26 amino acids of SEQ ID NO:1 have been removed. In certain
embodiments the Hla toxin has the protein sequence from a
Staphylococcus aureus Hla toxin. Similarity or identity, with
identity being preferred, is known in the art, a number of
different programs can be used to identify whether a protein (or
nucleic acid) has sequence identity or similarity to a known
sequence. Sequence identity and/or similarity is determined using
standard techniques known in the art, including, but not limited
to, the local sequence identity algorithm of Smith & Waterman
(1981), by the sequence identity alignment algorithm of Needleman
& Wunsch (1970), by the search for similarity method of Pearson
& Lipman (1988), by computerized implementations of these
algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin
Genetics Software Package, Genetics Computer Group, 575 Science
Drive, Madison, Wis.), the Best Fit sequence program described by
Devereux et al. (1984), preferably using the default settings, or
by inspection. Preferably, percent identity is calculated by using
alignment tools known to and readily ascertainable to those of
skill in the art.
[0026] In certain embodiments of the invention, the activity of an
attenuated Hla toxin is diminished or eliminated with respect to
membrane binding, cell lysis (which may specifically be cell lysis
of red blood cells or hemolysis or lysis of antigen presenting
cells), and/or heptamer formation. Any or all of these activities
may be reduced by about, at least about, or at most about 10, 15,
20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95,
100% with respect to unattenuated Hla toxin in assays for these
activities, such as those described in Walker and Bailey, (1995),
which is hereby incorporated by reference, and herein. In certain
embodiments, the attenuated Hla toxin lacks detectable hemolytic
activity or lethal activity.
[0027] Moreover, it is contemplated that in some embodiments, the
Hla toxin is or is not denatured, such as through chemical
denaturation (such as with formamide and formalin) or thermal
denaturation. The term "not substantially denatured" refers to a
toxin in which some denaturation may be detectable but the
immunogenic activity or the ability to bind conformation specific
binding agents associated with the tertiary or secondary structure
of the polypeptide is detectable. In particular embodiments, the
Hla toxin is purified, which may be accomplished with or without
minimal denaturation. In some aspects of the invention, the Hla
toxin is active, meaning the toxin retains some detectable level of
function or activity, such as those described above, including
binding ability. It is contemplated that the Hla toxin may be
purified to about, at least about, or at most about 50, 55, 60, 65,
70, 75, 80, 85, 90, 95, 96, 97, 98, 99, 100% purity or homogeneity
(with respect to other proteinaceous molecules and/or cellular
macromolecules), or any range derivable therein. In additional
embodiments, the recombinant Hla toxin may be isolated. The term
"isolated" can refer to a nucleic acid or polypeptide that is
substantially free of cellular material, bacterial material, viral
material, or culture medium (when produced by recombinant DNA
techniques) of their source of origin, or chemical precursors or
other chemicals (when chemically synthesized). Moreover, an
isolated compound refers to one that can be administered to a
subject as an isolated compound; in other words, the compound may
not simply be considered "isolated" if it is adhered to a column or
embedded in an agarose gel. Moreover, an "isolated nucleic acid
fragment" or "isolated peptide" is a nucleic acid or protein
fragment that is not naturally occurring as a fragment and/or is
not typically in the functional state.
[0028] Methods of the invention involve administering Hla toxin to
a patient in order to stimulate an immune response in the patient
against Hla. In certain embodiments, methods involve testing the
patient for antibodies against Hla toxin. Such methods are well
known to skill in the art, and they include, but are not limited
to, the following assays: Western blotting, ELISA, dot blots,
sandwich assays, immunohistochemistry, and flow cytometry, such as
FACS.
[0029] It is contemplated that compositions of the invention may be
administered a single time or multiple times. In certain
embodiments of the invention, a composition is administered 1, 2,
3, 4, 5, 6 or more times, or any range derivable therein. It is
contemplated that a preventative or treatment regimen may involve
multiple administrations over 1, 2, 3, 4, 5, 6, and/or 7 days or 1,
2, 3, 4, or 5 weeks, and/or 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
and/or 12 months, or any range derivable therein. Moreover, any
such regimen may be repeated after a certain amount of time has
passed or when the subject again appears at risk for a
staphylococcal disease or condition or is afflicted with the
disease or condition.
[0030] Compositions of the invention may be administered to
patients via any route used to introduce vaccines or antibodies to
patients. Such routes include, but are not limited to, mucosal or
intramuscular delivery. In particular embodiments, a composition is
administered to a patient intranasally or by inhalation. In other
embodiments, a composition is administered intravenously or by
intravenous injection. In additional embodiments, the
administration of compositions includes, but is not limited to
oral, parenteral, subcutaneous, intramuscular, intravenous
administration, or various combinations thereof.
[0031] The compositions may be formulated in a pharmaceutically
acceptable composition. In certain aspects of the invention the
staphylococcus bacterium is an S. aureus bacterium.
[0032] Furthermore, in embodiments of the invention, methods may
involve compositions containing about, at least about, or at most
about 0.1, 0.2, 0.3, 0.4, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0,
4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0, 10.5,
11.0, 11.5, 12.0, 12.5, 13.0, 13.5, 14.0, 14.5, 15.0, 15.5, 16.0,
16.5, 17.0, 17.5, 18.0, 18.5, 19.0. 19.5, 20.0, 21, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58,
59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75,
76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92,
93, 94, 95, 96, 97, 98, 99, 100, 110, 120, 130, 140, 150, 160, 170,
180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300,
310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430,
440, 441, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550,
560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680,
690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810,
820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940,
950, 960, 970, 980, 990, or 1000 .mu.g or mg of protein (or any
range derivable therein). The protein may be in about, at least
about, or at most about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8,
0.9, 1.0, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.1,
2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3.0, 3.1, 3.2, 3.3, 3.4,
3.5, 3.6, 3.7. 3.8, 3.9, 4.0, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7,
4.8, 4.9, 5.0, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6.0,
6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7.0, 7.1, 7.2, 7.3,
7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8.0, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6,
8.7, 8.8, 8.9, 9.0, 10, 11, 12, 12, 13, 14, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37,
38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54,
55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71,
72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88,
89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 110, 120, 130,
140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260,
270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390,
400, 410, 420, 430, 440, 441, 450, 460, 470, 480, 490, 500, 510,
520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640,
650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770,
780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900,
910, 920, 930, 940, 950, 960, 970, 980, 990, or 1000 .mu.l or ml
(or any range derivable therein). In certain aspects, one or more
anti-Hla antibody can be administered as a dose of 0.1, 0.2, 0.3,
0.4, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0,
6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5, 12.0,
12.5, 13.0, 13.5, 14.0, 14.5, 15.0, 15.5, 16.0, 16.5, 17.0, 17.5,
18.0, 18.5, 19.0. 19.5, 20.0, 21, 21, 22, 23, 24, 25, 26, 27, 28,
29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,
46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62,
63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79,
80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96,
97, 98, 99, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200,
210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330,
340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 441, 450,
460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580,
590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710,
720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840,
850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970,
980, 990, or 1000 mg per kg of body weight.
[0033] In some embodiments a patient is also given one or more
antibiotics for treating a Staphylococcus aureus lung infection.
The antibiotic may or may not be included with a composition that
includes an Hla toxin or an antibody specific for Hla toxin.
[0034] In additional embodiments of the invention a composition
contains one or more adjuvants. An adjuvant may be covalently or
non-covalently coupled to a polypeptide or peptide of the
invention. In certain aspects, the adjuvant is chemically
conjugated to a protein, polypeptide, or peptide.
[0035] Moieties of the invention, such as antigens or immunogens,
may be conjugated or linked covalently or noncovalently to other
moieties such as adjuvants, proteins, peptides, supports,
fluorescence moieties, or labels. The term "conjugate" or
"immunoconjugate" is broadly used to define the operative
association of one moiety with another agent and is not intended to
refer solely to any type of operative association, and is
particularly not limited to chemical "conjugation." Recombinant
fusion proteins are particularly contemplated. A nucleic acid or
polypeptide composition can be at least of a purity of 60, 65, 70,
75, 80, 85, 90, 95, 98, or 100% based on the amount other
contaminating substances.
[0036] In further embodiments a composition comprises a recombinant
nucleic acid molecule encoding the Hla toxin. Typically a
recombinant nucleic acid molecule contains a heterologous promoter.
In certain aspects, a recombinant nucleic acid molecule of the
invention is a vector, in still other aspects the vector is a
plasmid. In certain embodiments the vector is a viral vector. A
composition is typically administered to human subjects, but
administration to other animals that are capable of eliciting an
immune response is contemplated, particularly cattle, horses,
goats, sheep and other domestic animals. In further aspects the
staphylococcus bacterium is a Staphylococcus aureus. In further
embodiments the immune response is a protective immune response. In
still further aspects, the methods and compositions of the
invention can be used to prevent, ameliorate, reduce, or treat
infection of the lungs, particularly pneumonia and other lung
infections. Other methods include, but are not limited to
prophylactic reduction of the bacterial burden in a subject not
exhibiting signs of infection, particularly those subjects
suspected of or at risk of being colonized by a target bacteria,
e.g., patients that are or will be at risk or susceptible to
infection during a hospital stay, treatment, and/or recovery.
[0037] As used herein, the term "antigen" is a molecule capable of
being bound by an antibody or T-cell receptor. An antigen is
additionally capable of inducing a humoral immune response and/or
cellular immune response leading to the production of B- and/or
T-lymphocytes. The structural aspect of an antigen that gives rise
to a biological response is referred to herein as an "antigenic
determinant." B-lymphocytes respond to foreign antigenic
determinants via antibody production, whereas T-lymphocytes are the
mediators of cellular immunity. In addition to being mediators of
cellular immunity, T-lymphocytes can facilitate antibody production
by further stimulating the response of B-lymphocytes to antigen.
Thus, antigenic determinants or epitopes are those parts of an
antigen that are recognized by antibodies, or in the context of an
MHC, by T-cell receptors. An antigenic determinant need not be a
contiguous sequence or segment of protein and may include various
sequences that are not immediately adjacent to one another.
[0038] Other embodiments of the invention are discussed throughout
this application. Any embodiment discussed with respect to one
aspect of the invention applies to other aspects of the invention
as well and vice versa. The embodiments in the Example section are
understood to be embodiments of the invention that are applicable
to all aspects of the invention.
[0039] It is specifically contemplated that an individual component
or element of a list may be specifically included or excluded from
the claimed invention.
[0040] The terms "inhibiting," "reducing," or "prevention," or any
variation of these terms, when used in the claims and/or the
specification includes any measurable decrease or complete
inhibition to achieve a desired result.
[0041] The use of the word "a" or "an" when used in conjunction
with the term "comprising" in the claims and/or the specification
may mean "one," but it is also consistent with the meaning of "one
or more," "at least one," and "one or more than one."
[0042] It is contemplated that any embodiment discussed herein can
be implemented with respect to any method or composition of the
invention, and vice versa. Furthermore, compositions and kits of
the invention can be used to achieve methods of the invention.
[0043] Throughout this application, the term "about" is used to
indicate that a value includes the standard deviation of error for
the device or method being employed to determine the value.
[0044] The use of the term "or" in the claims is used to mean
"and/or" unless explicitly indicated to refer to alternatives only
or the alternatives are mutually exclusive, although the disclosure
supports a definition that refers to only alternatives and
"and/or."
[0045] As used in this specification and claim(s), the words
"comprising" (and any form of comprising, such as "comprise" and
"comprises"), "having" (and any form of having, such as "have" and
"has"), "including" (and any form of including, such as "includes"
and "include") or "containing" (and any form of containing, such as
"contains" and "contain") are inclusive or open-ended and do not
exclude additional, unrecited elements or method steps.
[0046] Other objects, features and advantages of the present
invention will become apparent from the following detailed
description. It should be understood, however, that the detailed
description and the specific examples, while indicating specific
embodiments of the invention, are given by way of illustration
only, since various changes and modifications within the spirit and
scope of the invention will become apparent to those skilled in the
art from this detailed description.
DESCRIPTION OF THE DRAWINGS
[0047] The following drawings form part of the present
specification and are included to further demonstrate certain
aspects of the present invention. The invention may be better
understood by reference to one or more of these drawings in
combination with the detailed description of specific embodiments
presented herein.
[0048] FIGS. 1A-1C .alpha.-Hemolysin (Hla) is a virulence factor
for CA-MRSA (community associated-methicillin resistant S. aureus)
lung infection. (FIG. 1A) Comparison of CA-MRSA strain S. aureus
LAC (wt) with an isogenic hla::erm mutant for virulence in a murine
lung infection model by assessment of animal mortality at 24, 48
and 72 hours post-infection. Ten animals were infected per group
(p<0.0007). (FIG. 1B) Deletion of lukS-PV and lukF-PV, encoding
Panton-Valentine leukocidin (PVL) toxin, in CA-MRSA strains LAC or
MW2 does not affect virulence in the murine model of staphylococcal
pneumonia. Mice were infected with 2.times.10.sup.8 CFU S. aureus
LAC wild-type (wt) or isogenic lukS-PV and lukF-PV deletion mutant
(.DELTA.pvl) (p=0.22) as well as 3-4.times.10.sup.8 CFU S. aureus
MW2 (wt) and its isogenic pvl deletion mutant (.DELTA.pvl)
(p=0.41). Mortality was assessed at 24, 48 and 72 hours
post-infection in groups of 15 animals per strain. (FIG. 1C)
Histopathologic analysis of thin sectioned lung tissue via
hematoxylin-eosin staining revealed similar patterns of lung injury
irrespective of PVL expression in the LAC and MW2 isolates.
[0049] FIGS. 2A-2B .alpha.-Hemolysin (Hla) is a virulence factor
for CA-MRSA (community associated-methicillin resistant S. aureus)
lung infection. (FIG. 2A) Mice were infected with 2.times.10.sup.8
CFU S. aureus LAC wild-type (wt) or isogenic lukS-PV and lukF-PV
deletion mutant (.DELTA.pvl) as well as 3-4.times.10.sup.8 CFU S.
aureus MW2 (wt) and its isogenic pvl deletion mutant (.DELTA.pvl).
Bacterial recovery from the right lung of animals infected for 24
hours with staphylococci revealed that deletion of lukS-PV and
lukF-PV did not affect staphylococcal replication in lung tissue
(groups of 10 animals per strain). Statistical analysis with the
Student's t-test yielded p=0.46 for the comparison of LAC strains
and p=0.23 for MW2 strains. (FIG. 2B) Immunoblotting with
antibodies against LukS-PV and LukF-PV demonstrated loss of toxin
secretion in the pvl mutant strains, however secretion of
.alpha.-hemolysin (Hla) was not affected by isogenic pvl deletions.
A crossreactive species marked with asterisks (*) migrates slightly
faster than LukF-PV.
[0050] FIGS. 3A-3E Lysogeny with .phi.Sa2mw phage expressing
Panton-Valentine leukocidin (PVL) does not affect virulence of S.
aureus Newman in a murine model of staphylococcal pneumonia. (FIG.
3A) Diagram displays the genome of S. aureus Newman, its origin
(ori) and terminus (ter) of replication as well as insertion sites
of four prophages (.phi.NW1, .phi.NM2, .phi.NM3, .phi.NM4). The
insertion site of .phi.Sa2mw in S. aureus Newman is indicated.
(FIG. 3B) .phi.Sa2mw lysogeny of strain Newman results in
expression of lukS-PV and lukF-PV as both PVL toxin components
(LukS-PV and LukF-PV) can be detected by immunoblot analysis with
rabbit antisera in culture supernatant samples. A crossreactive
species marked with asterisks (*) migrates slightly faster than
LukF-PV. (FIG. 3C) Recovery of bacteria from the right lung of mice
24 hours following intranasal inoculation with 3-4.times.10.sup.8
colony forming units (CFU) of S. aureus Newman (wt) or an isogenic
variant lysogenized with .phi.Sa2mw (Newman .phi.Sa2mw) revealed no
significant differences in staphylococcal replication (p=0.74 with
the Student's t-test, fifteen animals per group). Means of
bacterial recovery are denoted by horizontal lines. (FIG. 3D)
Animals infected by intranasal inoculation with S. aureus Newman
(wt) or an isogenic variant lysogenized with .phi.Sa2mw (Newman
.phi.Sa2mw) display similar mortality following 24, 48 or 72 hours
of observation (p=0.58). (FIG. 3E) Transduction of the hla::erm
allele into S. aureus Newman .phi.Sa2mw abolishes virulence in the
murine lung infection model (p<0.00004).
[0051] FIGS. 4A-4B Lysogeny with .phi.Sa2mw phage expressing
Panton-Valentine leukocidin (PVL) does not affect virulence of S.
aureus Newman in a murine model of staphylococcal pneumonia. (FIG.
4A) Animals infected via intranasal route with 3-4.times.10.sup.8
CFU S. aureus Newman carrying either vector alone or ppvl revealed
that plasmid-mediated over-expression of PVL does not influence
animal mortality (p=0.27). An .alpha.-hemolysin deficient strain
(hla::erm) was avirulent during lung infection, and hla::erm
mutants transformed with vector alone, ppvl or phla were analyzed
for their virulence attributes in the murine lung infection model.
Ten to fifteen animals were examined per strain and mortality was
recorded at 24, 48 and 72 hours post-infection. The mortality of
animals infected with S. aureus hla mutants (phla) was
significantly increased over that of animals infected with S.
aureus hla mutants harboring either vector or ppvl (p=0.00004).
(FIG. 4B) Immunoblot analysis of 18 hour culture supernatants
derived from S. aureus Newman and its isogenic hla::erm variant
transformed with plasmids that promote expression of either PVL
(ppvl, lukS-PV and lukF-PV), .alpha.-hemolysin (phla) or vector
alone. Specific antibodies revealed the presence and/or absence of
LukS-PV, LukF-PV, .alpha.-hemolysin (Hla) and nuclease. A
crossreactive species marked with asterisks (*) migrates slightly
faster than LukF-PV.
[0052] FIGS. 5A-5E Immunization with a mutant .alpha.-hemolysin
protects against staphylococcal pneumonia. (FIG. 5A) C57BL/6J mice
were immunized with PBS or 20 .mu.g Hla.sub.H35L, a mutant
.alpha.-hemolysin with a single amino acid substitution that
abolishes toxin activity and pore formation, and then challenged
with S. aureus Newman. Mortality was recorded 24, 48 or 72 hours
following infection (p<0.001). (FIG. 5B) Immunization of mice
with Hla.sub.H35L reduces growth of S. aureus Newman in infected
murine lung tissue. (FIG. 5C) Gross pathology of S. aureus Newman
infected lung tissue from mice that were immunized with PBS or
Hla.sub.H35L. (FIG. 5D) Histopathology of S. aureus Newman infected
lung tissue from mice that were immunized with PBS or Hla.sub.H35L.
(FIG. 5E) C57BL/6J mice were immunized with PBS or 20 .mu.g
Hla.sub.H35L and then challenged with S. aureus CA-MRSA strains LAC
or MW2. Mortality was recorded 24, 48 or 72 hours following
infection. The mortality of Hla.sub.H35L immunized animals was
significantly reduced over that of mock (PBS) immunized animals
challenged with either S. aureus strains LAC (p=0.00001) or MW2
(p=0.018).
[0053] FIGS. 6A-6C .alpha.-Hemolysin mediates staphylococcal injury
of human alveolar cells. (FIG. 6A) Human A549 alveolar cells were
infected with S. aureus (strains LAC, MW2 or Newman). Following
four hours of co-culture at 37.degree. C., an assessment of lactate
dehydrogenase (LDH) release by lysed cells was performed on each
well. Infections were performed in triplicate to allow assessment
of statistical significance with the Student's t-test. (FIG. 6B)
Phase contrast microscopic images of A549 cells that were left
uninfected or infected with an .alpha.-hemolysin mutant S. aureus
strain (hla::erm) carrying either plasmid vector or phla. Images
were captured 3 hours post-infection. (FIG. 6C) .alpha.-Hemolysin
mediated injury of human lung cells by staphylococci was reduced by
treatment with anti-Hla rabbit serum or by pre-incubation with
purified Hla.sub.H35L, whereas non-reactive rabbit serum (NRS) had
no effect.
[0054] FIGS. 7A-7F Passive immunization of mice with anti-Hla serum
generates protection against staphylococcal lung infection. (FIG.
7A) Mice were passively immunized by intra-peritoneal injection
with rabbit serum that was either non-reactive (NRS), or harbored
anti-Hla antibodies, and then challenged with S. aureus Newman
(p<0.0007). Mortality was recorded 24, 48 and 72 hours following
infection. (FIG. 7B) Passive immunization of mice with anti-Hla
reduces the ability of S. aureus Newman to grow in murine lung
tissue (FIG. 7C) and also decreases the gross pathologic (FIG. 7D)
and histopathologic lesions evident following infection. (FIG. 7E)
Anti-Hla antisera also protects animals upon challenge by
intra-nasal inoculation with S. aureus strains LAC (p<0.025) or
MW2 (p<0.009). (FIG. 7F) Anti-PVL immunoglobulin fails to afford
protection against infection with S. aureus LAC as recorded 24, 48
and 72 hours post-infection (p=0.55).
[0055] FIG. 8 Cytokine responses during staphylococcal lung
infection are influenced by passive immunization with antibodies
against .alpha.-hemolysin. Mice were injected into the peritoneal
cavity with rabbit serum that was either non-reactive or harbored
anti-Hla antibodies. Serum cytokine levels were determined by a
multiplex bead-based cytokine assay, examining the concentration of
IL-1.beta. as well as IFN-.gamma.. Statistical significance of
differences in cytokine levels was calculated with the Student's
t-test (nine animals per group) and recorded.
[0056] FIG. 9 Mouse monoclonal antibodies against .alpha.-hemolysin
protect A549 cells from S. aureus-induced lysis. A549 cells were
cocultured with live S. aureus in the presence of rabbit serum that
was either non-reactive (NRS) or harbored anti-Hla. Additional
wells of A549 cells were cocultured with live S. aureus and two
independent anti-Hla monoclonal antibodies (7B8.35 (Accession
Number PTA-121360) and 1A9 (ATCC Accession Number PTA-121613)) or
their isotype-matched control antibodies (IgG2a and IgG2b,
respectively), demonstrating that both polyclonal rabbit antisera
and mouse monoclonal antibodies are capable of protecting A549
cells from Hla-induced injury.
[0057] FIG. 10 Titration of mouse monoclonal antibodies in A549
cell LDH release assay. Isotype control antibodies (IgG2a or IgG2b)
or anti-.alpha.-hemolysin monoclonal antibodies 7B8.35/1A9.4F9
(Accession Number PTA-121360; (ATCC Accession Number PTA-121613))
were added to cocultures of A549 cells in the presence of S. aureus
Newman. Monoclonal antibodies were titrated in the assay as
follows: 2.5 mg/ml, 2 mg/ml, 1.5 mg/ml, 1 mg/ml, 0.5 mg/ml, 0.1
mg/ml, 0.01 mg/ml, and 0.001 mg/ml from left to right. LDH release
was assessed following a four hour coculture.
[0058] FIGS. 11A-11B Anti-.alpha.-hemolysin monoclonal antibodies
7B8.35 (Accession Number PTA-121360) and 1A9.4F9 (ATCC Accession
Number PTA-121613) protect experimental animals from mortality
related to S. aureus pneumonia. Twenty-four hours prior to
infection with S. aureus Newman, groups of 15 mice received
intraperitoneal injections of either isotype control antibody
(IgG2a, panel A or IgG2b, panel B) or the corresponding anti-Hla
monoclonal antibody (7B8.35 (Accession Number PTA-121360), panel A
or 1A9.4F9 (ATCC Accession Number PTA-121613), panel B). Each
antibody was delivered in a 5 mg/kg dose. Following infection with
S. aureus via intranasal route, animals were observed for acute
lethal disease, revealing a marked protection afforded by treatment
with either monoclonal antibody.
[0059] FIG. 12 Anti-Hla monoclonal antibodies protect experimental
animals from pneumonia caused by USA300/LAC. Animals received
intraperitoneal doses of either isotype control antibody (IgG2a or
IgG2b) or the corresponding anti-Hla monoclonal antibody (7B8.35
(Accession Number PTA-121360) or 1A9.4F9 (ATCC Accession Number
PTA-121613)). Each antibody was delivered in a 5 mg/kg dose.
Following infection with S. aureus strain USA300/LAC via intranasal
route, animals were observed for acute lethal disease, revealing
protection afforded by treatment with either monoclonal
antibody.
[0060] FIG. 13 Schematic of HlaH35L truncation products. Full
length HlaH35L and seven truncation products diagrammed below the
full length protein.
[0061] FIG. 14 Anti-Hla monoclonal antibodies bind to a single
N-terminal region of the mature toxin. Dot blot analysis of HlaH35L
truncation products with monoclonal antibodies 7B8.35 (Accession
Number PTA-121360) and 1A9.4F9 (ATCC Accession Number PTA-121613)
demonstrates that the epitopes recognized by both monoclonals
reside within the first 50 amino acids of the protein.
DETAILED DESCRIPTION OF THE INVENTION
[0062] Studies of S. aureus pneumonia in a murine model system
defined .alpha.-hemolysin (Hla) as a critical virulence factor in
the pathogenesis of disease, as a mutant strain lacking this
exotoxin is avirulent. Hla is a member of a bacterial cytotoxin
family that is secreted by S. aureus and is capable of inserting
into the cell membrane of a multitude of eukaryotic cells. The
protein is secreted as a monomer and assembles into a heptameric
ring structure on the surface of eukaryotic cells. The assembled
toxin inserts into the host cell membrane, forming a pore that
contributes to cellular injury and death by disrupting the
integrity of the membrane. Several biochemical studies have defined
the amino acid residues within the Hla monomer that facilitate
binding to the host cell, heptamer formation and host cell lysis.
The histidine residue at position 35 in the mature toxin is known
to be required for efficient heptamer formation and cell lysis, but
is not essential for binding to the eukaryotic cell target. The
inventors contemplate that a vaccination strategy capable of
neutralizing Hla should provide immunoprotection against S. aureus
pneumonia. To this end, the inventors generated a recombinant
attenuated or reduced-toxicity Hla represented by a mutant or
variant form of Hla (HlaH35L) in which histidine 35 is converted to
leucine, thus abrogating the productive assembly of the toxin.
[0063] Immunization of experimental animals with this mutant toxin
conferred protection against pneumonia upon challenge with S.
aureus. This protection was manifest as reduced mortality, fewer
bacteria recovered from the lung, and a limitation of pathologic
lesions to focal sites. Similarly, passive immunization with sera
derived from rabbits immunized with the recombinant HlaH35L also
protected mice from S. aureus pneumonia, demonstrating the same
benefits as seen following active immunization.
[0064] Embodiments of the invention are directed to immunogenic
proteins, polypeptides, and peptides exemplified by Hla, HlaH35L
and fragments thereof for use in mitigating or immunizing against
infection and/or preventing or treating staphylococcal pneumonia.
Antigenic proteins, polypeptides, or peptides include, but are not
limited to all or part of Hla proteins from Staphylococcus, and in
particular S. aureus. Non-limiting examples of such strains include
those belonging to one of the 10 clonal clusters (CC1, CC5, CC8,
CC12, CC15, CC22, CC25, CC30, CC45 and CC51) identified by Lindsay
et al. (2006). More particularly, antigenic proteins, polypeptides,
or peptides include, but are not limited to, all or part of Hla
proteins from S. aureus MRSA strains and clades that have been
associated with hospital- and community-acquired infections
including, but not limited to S. aureus strains 8325, Barnum,
Berlin, Brazilian Iberian, COL, EMRSA-15, EMRSA-16, Hanover, LAC,
N315, MRSA 252, MW2, Mu50, Pediatric NY, Japan, as well as S.
aureus strains classified within the CDC clades USA 100, USA 200,
USA 300, USA 500, USA 600, and USA 800.
I. STAPHYLOCOCCAL HLA
[0065] Staphylocccal .alpha.-hemolysin (Hla or .alpha.-toxin) is
the founding member of a family of bacterial pore-forming
.beta.-barrel toxins (Bhakdi and Tranum-Jensen, 1991; Song et al.,
1996). Its structural gene, hla, is located on the chromosome of
all S. aureus strains examined that secrete the 293 residue
water-soluble monomer (O'Reilly et al., 1990; O'Reilly et al.,
1986). Hla is thought to engage surface receptors of sensitive host
cells, thereby promoting its oligomerization into a heptameric
prepore and insertion of a .beta.-barrel structure with 2 nm pore
diameter into the plasma membrane (Gouaux et al., 1997). Hla pores
form in lymphocytes, macrophages, alveolar epithelial cells,
pulmonary endothelium and erythrocytes; however granulocytes and
fibroblasts appear resistant to lysis (Bhakdi and Tranum-Jensen,
1991; McElroy et al., 1999). Instillation of purified Hla into
rabbit or rat lung tissue triggers vascular leakage and pulmonary
hypertension, which has been attributed to release of several
signaling molecules, e.g. phosphatidyl inositol, nitric oxide,
prostanoids (PGE2, PGI2) and thromboxane A2 (McElroy et al., 1999;
Seeger et al., 1984; Seeger et al., 1990; Rose et al., 2002;
Suttorp and Habben, 1988). In agreement with the biochemical
attributes of Hla, mutations that abrogate Hla expression in S.
aureus Newman severely attenuate virulence of the bacteria in the
murine pneumonia model (Bubeck-Wardenburg et al., 2007). Here the
inventor examined Hla as a target for the development of vaccines
or immunotherapeutic strategies that combat S. aureus lung
infections.
[0066] Certain aspects of the invention include methods and
compositions concerning proteinaceous compositions including
polypeptides, peptides, or nucleic acid encoding such, of a Hla
protein. These proteins may be modified by deletion, insertion,
and/or substitution. In particular embodiments, modifications of
these proteins are capable of eliciting an immune response in a
subject.
[0067] The Hla polypeptides include the amino acid sequence of Hla
proteins from bacteria in the Staphylococcus genus. The Hla
sequence may be from a particular staphylococcus species, such as
Staphylococcus aureus, and may be from a particular strain, such as
Newman. In certain embodiments, the Hla sequence can comprise a
sequence having a consensus S. aureus precursor sequence of:
TABLE-US-00001 (represented by SEQ ID NO: 1)
MKTRIVSSVTTTLLLGSILMNPVANAADSDINIKTGTTDIGSNTTVKTG
DLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEG
ANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFN
GNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVI
FNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAA(E/D)NFLDPNK
ASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTN
WKGTNTKDKW(I/T)DRSSERYKIDWEKEEMTN
[0068] and a mature S. aureus consensus sequence of:
TABLE-US-00002 (represented by SEQ ID NO: 2)
ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNK
KLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISD
YYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQ
PDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTR
NGSMKAA(E/D)NFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNID
VIYERVRDDYQLHWTSTNWKGTNTKDKW(I/T)DRSSERYKIDWEKEEMT N
[0069] In certain aspects, the Hla sequence is substantially set
forth in Genbank Accession Numbers AAA26498 (gi152953), Mu50
(NP.sub.--371687.1) (gi15924153), COL (YP.sub.--186036.1)
(gi57650272), N315 (NP.sub.--374279.1) (gi15926746), JH9
(YP.sub.--001246598.1) (gi148267655), JH1 (YP.sub.--001316387.1)
(gi150393712), USA300 (YP.sub.--493756.1) (gi87160380), NCTC8325
(YP.sub.--499665.1) (gi88194865), Newman (YP.sub.--001332107.1)
(gi151221285), MW2 (NP.sub.--645861.1) (gi21282773), and MSSA476
(YP.sub.--043222.1) (gi49486001), which are hereby incorporated by
reference as of the earliest priority date of this application, or
is a variant thereof.
[0070] In further embodiments, other Hla polypeptides may be used,
the sequences of which may be identified by one of skill in the art
using databases and internet accessible resources.
[0071] As used herein, a "protein" or "polypeptide" refers to a
molecule comprising at least ten amino acid residues. In some
embodiments, wild-type versions of a protein or polypeptide are
employed, however, in many embodiments of the invention, a modified
protein or polypeptide is employed to generate an immune response.
The terms described above may be used interchangeably herein. A
"modified protein" or "modified polypeptide" refers to a protein or
polypeptide whose chemical structure, particularly its amino acid
sequence, is altered with respect to the wild-type protein or
polypeptide. In some embodiments, a modified protein or polypeptide
has at least one modified activity or function (recognizing that
proteins or polypeptides may have multiple activities or
functions). It is specifically contemplated that a modified protein
or polypeptide may be altered with respect to one activity or
function, yet retain a wild-type activity or function in other
respects, such as immunogenicity.
[0072] In certain embodiments the size of a protein or polypeptide
(wild-type or modified) may comprise, but is not limited to, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44,
45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61,
62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78,
79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95,
96, 97, 98, 99, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145,
150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 205, 210,
215, 220, 225, 230, 235, 240, 245, 250, 255, 260, 265, 270, 275,
280, 285, 290, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525,
550, 575, 600, 625, 650, 675, 700, 725, 750, 775, 800, 825, 850,
875, 900, 925, 950, 975, 1000, 1100, 1200, 1300, 1400, 1500, 1750,
2000, 2250, 2500 amino molecules or greater, and any range
derivable therein, or derivative thereof. It is contemplated that
polypeptides may be mutated by truncation, rendering them shorter
than their corresponding wild-type form, but also they might be
altered by fusing or conjugating a heterologous protein sequence
with a particular function (e.g., for targeting or localization,
for enhanced immunogenicity, for purification purposes, etc.).
[0073] As used herein, an "amino molecule" refers to any amino
acid, amino acid derivative, or amino acid mimic known in the art.
In certain embodiments, the residues of the proteinaceous molecule
are sequential, without any non-amino molecule interrupting the
sequence of amino molecule residues. In other embodiments, the
sequence may comprise one or more non-amino molecule moieties. In
particular embodiments, the sequence of residues of the
proteinaceous molecule may be interrupted by one or more non-amino
molecule moieties.
[0074] Accordingly, the term "proteinaceous composition"
encompasses amino molecule sequences comprising at least one of the
20 common amino acids in naturally synthesized proteins, or at
least one modified or unusual amino acid.
[0075] Proteinaceous compositions may be made by any technique
known to those of skill in the art, including (i) the expression of
proteins, polypeptides, or peptides through standard molecular
biological techniques, (ii) the isolation of proteinaceous
compounds from natural or recombinant sources (e.g., E. coli,
insect cells, yeast or the like), or (iii) the chemical synthesis
of proteinaceous materials. The nucleotide as well as the protein,
polypeptide, and peptide sequences for various genes have been
previously disclosed, and may be found in the recognized
computerized databases. One such database is the National Center
for Biotechnology Information's Genbank and GenPept databases (on
the World Wide Web at ncbi.nlm.nih.gov/). The coding regions for
these genes may be amplified and/or expressed using the techniques
disclosed herein or as would be know to those of ordinary skill in
the art.
[0076] Amino acid sequence variants of Hla are contemplated and can
be substitutional, insertional, or deletion variants. A
modification in a polypeptide of the invention may affect 1, 2, 3,
4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38,
39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55,
56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72,
73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89,
90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 100, 101, 102, 103,
104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116,
117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129,
130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142,
143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155,
156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168,
169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181,
182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194,
195, 196, 197, 198, 199, 200, 201, 202, 203, 204, 205, 206, 207,
208, 209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 219, 220,
221, 222, 223, 224, 225, 226, 227, 228, 229, 230, 231, 232, 233,
234, 235, 236, 237, 238, 239, 240, 241, 242, 235, 236, 237, 238,
239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251,
252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264,
265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277,
278, 279, 280, 281, 282, 283, 284, 285, 286, 287, 288, 289, 290,
291, 292, 293, or more non-contiguous or contiguous amino acids of
the polypeptide, as compared to wild-type. A Hla polypeptide from
any staphylococcus species and strain are contemplated for use in
methods of the invention.
[0077] Variants typically lack one or more residues of the native
or wild-type protein. Individual residues can be deleted or a
number of contiguous amino acids can be deleted. A stop codon may
be introduced (by substitution or insertion) into an encoding
nucleic acid sequence to generate a truncated protein. Insertional
mutants typically involve the addition of material at a
non-terminal point in the polypeptide. This may include the
insertion of one or more residues. Terminal additions, called
fusion proteins, may also be generated.
[0078] Substitutional variants typically contain the exchange of
one amino acid for another at one or more sites within the protein,
and may be designed to modulate one or more properties of the
polypeptide, with or without the loss of other functions or
properties. Substitutions may be conservative, that is, one amino
acid is replaced with one of similar shape and charge. Conservative
substitutions are well known in the art and include, for example,
the changes of: alanine to serine; arginine to lysine; asparagine
to glutamine or histidine; aspartate to glutamate; cysteine to
serine; glutamine to asparagine; glutamate to aspartate; glycine to
proline; histidine to asparagine or glutamine; isoleucine to
leucine or valine; leucine to valine or isoleucine; lysine to
arginine; methionine to leucine or isoleucine; phenylalanine to
tyrosine, leucine or methionine; serine to threonine; threonine to
serine; tryptophan to tyrosine; tyrosine to tryptophan or
phenylalanine; and valine to isoleucine or leucine. Alternatively,
substitutions may be non-conservative such that a function or
activity of the polypeptide is affected. Non-conservative changes
typically involve substituting a residue with one that is
chemically dissimilar, such as a polar or charged amino acid for a
nonpolar or uncharged amino acid, and vice versa.
[0079] Proteins of the invention may be recombinant, or synthesized
in vitro. Alternatively, a non-recombinant or recombinant protein
may be isolated from bacteria. It is also contemplated that a
bacterium containing such a variant may be implemented in
compositions and methods of the invention. Consequently, a protein
need not be isolated.
[0080] The term "functionally equivalent codon" is used herein to
refer to codons that encode the same amino acid, such as the six
codons for arginine or serine, and also refers to codons that
encode biologically equivalent amino acids (see Table 1,
below).
TABLE-US-00003 TABLE 1 Codon Table Amino Acids Codons Alanine Ala A
GCA GCC GCG GCU Cysteine Cys C UGC UGU Aspartic acid Asp D GAC GAU
Glutamic acid Glu E GAA GAG Phenylalanine Phe F UUC UUU Glycine Gly
G GGA GGC GGG GGU Histidine His H CAC CAU Isoleucine Ile I AUA AUC
AUU Lysine Lys K AAA AAG Leucine Leu L UUA UUG CUA CUC CUG CUU
Methionine Met M AUG Asparagine Asn N AAC AAU Proline Pro P CCA CCC
CCG CCU Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG
CGU Serine Ser S AGC AGU UCA UCC UCG UCU Threonine Thr T ACA ACC
ACG ACU Valine Val V GUA GUC GUG GUU Tryptophan Trp W UGG Tyrosine
Tyr Y UAC UAU
[0081] It also will be understood that amino acid and nucleic acid
sequences may include additional residues, such as additional N- or
C-terminal amino acids, or 5' or 3' sequences, respectively, and
yet still be essentially as set forth in one of the sequences
disclosed herein, so long as the sequence meets the criteria set
forth above, including the maintenance of biological protein
activity where protein expression is concerned. The addition of
terminal sequences particularly applies to nucleic acid sequences
that may, for example, include various non-coding sequences
flanking either of the 5' or 3' portions of the coding region.
[0082] The following is a discussion based upon changing of the
amino acids of a protein to create an equivalent, or even an
improved, second-generation molecule. For example, certain amino
acids may be substituted for other amino acids in a protein
structure without appreciable loss of interactive binding capacity
with structures such as, for example, antigen-binding regions of
antibodies or binding sites on substrate molecules. Since it is the
interactive capacity and nature of a protein that defines that
protein's biological functional activity, certain amino acid
substitutions can be made in an amino acid sequence, and in its
underlying DNA coding sequence, and nevertheless produce a protein
with like properties. It is thus contemplated by the inventors that
various changes may be made in the DNA sequences of genes or
nucleic acids without appreciable loss of their biological utility
or activity.
[0083] In making such changes, the hydropathic index of amino acids
may be considered. The importance of the hydropathic amino acid
index in conferring interactive biologic function on a protein is
generally understood in the art (Kyte and Doolittle, 1982). It is
accepted that the relative hydropathic character of the amino acid
contributes to the secondary structure of the resultant protein,
which in turn defines the interaction of the protein with other
molecules, for example, enzymes, substrates, receptors, DNA,
antibodies, antigens, and the like.
[0084] It also is understood in the art that the substitution of
like amino acids can be made effectively on the basis of
hydrophilicity. U.S. Pat. No. 4,554,101, incorporated herein by
reference, states that the greatest local average hydrophilicity of
a protein, as governed by the hydrophilicity of its adjacent amino
acids, correlates with a biological property of the protein. It is
understood that an amino acid can be substituted for another having
a similar hydrophilicity value and still produce a biologically
equivalent and immunologically equivalent protein.
[0085] As outlined above, amino acid substitutions generally are
based on the relative similarity of the amino acid side-chain
substituents, for example, their hydrophobicity, hydrophilicity,
charge, size, and the like. Exemplary substitutions that take into
consideration the various foregoing characteristics are well known
and include: arginine and lysine; glutamate and aspartate; serine
and threonine; glutamine and asparagine; and valine, leucine and
isoleucine.
[0086] It is contemplated that in compositions of the invention,
there is between about 0.001 mg and about 10 mg of total protein
per ml. Thus, the concentration of protein in a composition can be
about, at least about or at most about 0.001, 0.010, 0.050, 0.1,
0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1.0, 1.5, 2.0, 2.5, 3.0,
3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5,
10.0 .mu.g/ml, mg/ml, or more (or any range derivable therein). Of
this, about, at least about, or at most about 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24,
25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41,
42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58,
59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75,
76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92,
93, 94, 95, 96, 97, 98, 99, 100% may be Hla protein.
[0087] The present invention contemplates the administration of a
Hla polypeptide or peptide to affect a preventative therapy against
the development of a disease or condition associated with infection
by a staphylococcus pathogen, in certain aspects pneumonia. The
present invention also contemplates the administration of
antibodies raised against a Hla polypeptide or peptide for use in
preventing or treating a disease or condition associated with
infection by a staphylococcus pathogen, in certain aspects
pneumonia.
[0088] In addition, U.S. Pat. No. 4,554,101 (Hopp), which is
incorporated herein by reference, teaches the identification and
preparation of epitopes from primary amino acid sequences on the
basis of hydrophilicity. Through the methods disclosed in Hopp, one
of skill in the art would be able to identify potential epitopes
from within an amino acid sequence and confirm their
immunogenicity. Numerous scientific publications have also been
devoted to the prediction of secondary structure and to the
identification of epitopes, from analyses of amino acid sequences
(Chou & Fasman, 1974a,b; 1978a,b, 1979). Any of these may be
used, if desired, to supplement the teachings of Hopp in U.S. Pat.
No. 4,554,101.
[0089] The present invention describes polypeptides, peptides, and
proteins for use in various embodiments of the present invention.
For example, specific polypeptides are assayed for their abilities
to elicit an immune response. In specific embodiments, all or part
of the proteins of the invention can also be synthesized in
solution or on a solid support in accordance with conventional
techniques. Various automatic synthesizers are commercially
available and can be used in accordance with known protocols. See,
for example, Stewart and Young, (1984); Tam et al., (1983);
Merrifield, (1986); and Barany and Merrifield (1979), each
incorporated herein by reference. Alternatively, recombinant DNA
technology may be employed wherein a nucleotide sequence which
encodes a peptide of the invention is inserted into an expression
vector, transformed or transfected into an appropriate host cell
and cultivated under conditions suitable for expression.
[0090] One embodiment of the invention includes the use of gene
transfer to cells, including microorganisms, for the production
and/or presentation of proteins. The gene for the protein of
interest may be transferred into appropriate host cells followed by
culture of cells under the appropriate conditions. A nucleic acid
encoding virtually any polypeptide described herein may be
employed. The generation of recombinant expression vectors, and the
elements included therein, are discussed herein. Alternatively, the
protein to be produced may be an endogenous protein normally
synthesized by the cell used for protein production.
[0091] Another embodiment of the present invention uses autologous
B lymphocyte cell lines, which are transfected with a viral vector
that expresses an immunogen product, and more specifically, a
protein having immunogenic activity. Other examples of mammalian
host cell lines include, but are not limited to Vero and HeLa
cells, other B- and T-cell lines, such as CEM, 721.221, H9, Jurkat,
Raji, as well as cell lines of Chinese hamster ovary, W138, BHK,
COS-7, 293, HepG2, 3T3, RIN and MDCK cells. In addition, a host
cell strain may be chosen that modulates the expression of the
inserted sequences, or that modifies and processes the gene product
in the manner desired. Such modifications (e.g., glycosylation) and
processing (e.g., cleavage) of protein products may be important
for the function of the protein. Different host cells have
characteristic and specific mechanisms for the post-translational
processing and modification of proteins. Appropriate cell lines or
host systems can be chosen to ensure the correct modification and
processing of the foreign protein expressed.
[0092] A number of selection systems may be used including, but not
limited to HSV thymidine kinase, hypoxanthine-guanine
phosphoribosyltransferase, and adenine phosphoribosyltransferase
genes, in tk-, hgprt- or aprt-cells, respectively. Also,
anti-metabolite resistance can be used as the basis of selection:
dhfr, which confers resistance to trimethoprim and methotrexate;
gpt, which confers resistance to mycophenolic acid; neo, which
confers resistance to the aminoglycoside G418; and hygro, which
confers resistance to hygromycin.
[0093] Animal cells can be propagated in vitro in two modes: as
non-anchorage-dependent cells growing in suspension throughout the
bulk of the culture or as anchorage-dependent cells requiring
attachment to a solid substrate for their propagation (i.e., a
monolayer type of cell growth).
[0094] Non-anchorage dependent or suspension cultures from
continuous established cell lines are the most widely used means of
large scale production of cells and cell products. However,
suspension cultured cells have limitations, such as tumorigenic
potential and lower protein production than adherent cells.
[0095] A. Host Cells
[0096] As used herein, the terms "cell," "cell line," and "cell
culture" may be used interchangeably. All of these terms also
include their progeny, which is any and all subsequent generations.
It is understood that all progeny may not be identical due to
deliberate or inadvertent mutations. In the context of expressing a
heterologous nucleic acid sequence, "host cell" refers to a
prokaryotic or eukaryotic cell, and it includes any transformable
organism that is capable of replicating a vector or expressing a
heterologous gene encoded by a vector. A host cell can, and has
been, used as a recipient for vectors or viruses. A host cell may
be "transfected" or "transformed," which refers to a process by
which exogenous nucleic acid, such as a recombinant
protein-encoding sequence, is transferred or introduced into the
host cell. A transformed cell includes the primary subject cell and
its progeny.
[0097] Host cells may be derived from prokaryotes or eukaryotes,
including bacteria, yeast cells, insect cells, and mammalian cells
for replication of the vector or expression of part or all of the
nucleic acid sequence(s). Numerous cell lines and cultures are
available for use as a host cell, and they can be obtained through
the American Type Culture Collection (ATCC), which is an
organization that serves as an archive for living cultures and
genetic materials (www.atcc.org). An appropriate host can be
determined by one of skill in the art based on the vector backbone
and the desired result. A plasmid or cosmid, for example, can be
introduced into a prokaryote host cell for replication of many
vectors or expression of encoded proteins. Bacterial cells used as
host cells for vector replication and/or expression include
Staphylococcus strains, DH5.alpha., JM109, and KCB, as well as a
number of commercially available bacterial hosts such as SURE.RTM.
Competent Cells and SOLOPACK.TM. Gold Cells (STRATAGENE.RTM., La
Jolla, Calif.). Alternatively, bacterial cells such as E. coli
LE392 could be used as host cells for phage viruses. Appropriate
yeast cells include Saccharomyces cerevisiae, Saccharomyces pombe,
and Pichia pastoris.
[0098] Examples of eukaryotic host cells for replication and/or
expression of a vector or polypeptide include HeLa, NIH3T3, Jurkat,
293, Cos, CHO, Saos, and PC12. Many host cells from various cell
types and organisms are available and would be known to one of
skill in the art. Similarly, a viral vector may be used in
conjunction with either a eukaryotic or prokaryotic host cell,
particularly one that is permissive for replication or expression
of the vector.
[0099] Some vectors may employ control sequences that allow it to
be replicated and/or expressed in both prokaryotic and eukaryotic
cells. One of skill in the art would further understand the
conditions under which to incubate all of the above described host
cells to maintain them and to permit replication of a vector. Also
understood and known are techniques and conditions that would allow
large-scale production of vectors, as well as production of the
nucleic acids encoded by vectors and their cognate polypeptides,
proteins, or peptides.
[0100] B. Expression Systems
[0101] Numerous expression systems exist that comprise at least a
part or all of the compositions discussed above. Prokaryote- and/or
eukaryote-based systems can be employed for use with the present
invention to produce nucleic acid sequences, or their cognate
polypeptides, proteins and peptides. Many such systems are
commercially and widely available.
[0102] The insect cell/baculovirus system can produce a high level
of protein expression of a heterologous nucleic acid segment, such
as described in U.S. Pat. Nos. 5,871,986, 4,879,236, both herein
incorporated by reference, and which can be bought, for example,
under the name MAXBAC.RTM. 2.0 from INVITROGEN.RTM. and BACPACK.TM.
BACULOVIRUS EXPRESSION SYSTEM FROM CLONTECH.RTM..
[0103] In addition to the disclosed expression systems of the
invention, other examples of expression systems include
STRATAGENE.RTM.'s COMPLETE CONTROL.TM. Inducible Mammalian
Expression System, which involves a synthetic ecdysone-inducible
receptor, or its pET Expression System, an E. coli expression
system. Another example of an inducible expression system is
available from INVITROGEN.RTM., which carries the T-REX.TM.
(tetracycline-regulated expression) System, an inducible mammalian
expression system that uses the full-length CMV promoter.
INVITROGEN.RTM. also provides a yeast expression system called the
Pichia methanolica Expression System, which is designed for
high-level production of recombinant proteins in the methylotrophic
yeast Pichia methanolica. One of skill in the art would know how to
express a vector, such as an expression construct, to produce a
nucleic acid sequence or its cognate polypeptide, protein, or
peptide.
II. NUCLEIC ACIDS
[0104] The present invention concerns recombinant polynucleotides
encoding the proteins, polypeptides, peptides of the invention. The
nucleic acid sequences for wild-type Hla or any other polypeptide
variant thereof, are included, all of which are incorporated by
reference.
[0105] As used in this application, the term "polynucleotide"
refers to a nucleic acid molecule that either is recombinant or has
been isolated free of total genomic nucleic acid. Included within
the term "polynucleotide" are oligonucleotides (nucleic acids 100
residues or less in length), recombinant vectors, including, for
example, plasmids, cosmids, phage, viruses, and the like.
Polynucleotides include, in certain aspects, regulatory sequences,
isolated substantially away from their naturally occurring genes or
protein encoding sequences. Polynucleotides may be RNA, DNA,
analogs thereof, or a combination thereof.
[0106] In this respect, the term "gene," "polynucleotide" or
"nucleic acid" is used to refer to a nucleic acid that encodes a
protein, polypeptide, or peptide (including any sequences required
for proper transcription, post-translational modification, or
localization). As will be understood by those in the art, this term
encompasses genomic sequences, expression cassettes, cDNA
sequences, and smaller engineered nucleic acid segments that
express, or may be adapted to express, proteins, polypeptides,
domains, peptides, fusion proteins, and mutants. A nucleic acid
encoding all or part of a polypeptide may contain a contiguous
nucleic acid sequence encoding all or a portion of such a
polypeptide of the following lengths: 10, 20, 30, 40, 50, 60, 70,
80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210,
220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340,
350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 441, 450, 460,
470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590,
600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720,
730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850,
860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980,
990, 1000, 1010, 1020, 1030, 1040, 1050, 1060, 1070, 1080, 1090,
1095, 1100, 1500, 2000, 2500, 3000, 3500, 4000, 4500, 5000, 5500,
6000, 6500, 7000, 7500, 8000, 9000, 10000, or more nucleotides,
nucleosides, or base pairs. It also is contemplated that a
particular polypeptide from a given species may be encoded by
nucleic acids containing natural variations that having slightly
different nucleic acid sequences but, nonetheless, encode the same
or substantially similar protein (see Table 1 above).
[0107] In particular embodiments, the invention concerns isolated
nucleic acid segments and recombinant vectors incorporating nucleic
acid sequences that encode a Hla or any variant or fragment
thereof. Thus, an isolated nucleic acid segment or vector
containing a nucleic acid segment may encode, for example, a Hla or
Hla(H35L) protein that is immunogenic. The term "recombinant" may
be used in conjunction with a polypeptide or the name of a specific
polypeptide, and this generally refers to a polypeptide produced
from a nucleic acid molecule that has been manipulated in vitro or
that is a replication product of such a molecule.
[0108] In other embodiments, the invention concerns isolated
nucleic acid segments and recombinant vectors incorporating nucleic
acid sequences that encode a Hla or Hla variant polypeptide or
peptide that can be used to generate an immune response in a
subject. In various embodiments the nucleic acids of the invention
may be used in genetic vaccines.
[0109] The nucleic acid segments used in the present invention,
regardless of the length of the coding sequence itself, may be
combined with other nucleic acid sequences, such as promoters,
polyadenylation signals, additional restriction enzyme sites,
multiple cloning sites, other coding segments, and the like, such
that their overall length may vary considerably. It is therefore
contemplated that a nucleic acid fragment of almost any length may
be employed, with the total length preferably being limited by the
ease of preparation and use in the intended recombinant nucleic
acid protocol. In some cases, a nucleic acid sequence may encode a
polypeptide sequence with additional heterologous coding sequences,
for example to allow for purification of the polypeptide,
transport, secretion, post-translational modification, or for
therapeutic benefits such as targeting or efficacy. As discussed
above, a tag or other heterologous polypeptide may be added to the
modified polypeptide-encoding sequence, wherein "heterologous"
refers to a polypeptide that is not the same as the modified
polypeptide.
[0110] The nucleic acid used in the present invention encodes Hla
or any Hla variant or fragment. Such sequences may arise as a
consequence of codon redundancy and functional equivalency that are
known to occur naturally within nucleic acid sequences and the
proteins thus encoded. Alternatively, functionally equivalent
proteins or peptides may be created via the application of
recombinant DNA technology, in which changes in the protein
structure may be engineered, based on considerations of the
properties of the amino acids being exchanged. Changes designed by
human may be introduced through the application of site-directed
mutagenesis techniques, e.g., to introduce improvements to the
antigenicity of the protein.
[0111] In certain other embodiments, the invention concerns
isolated nucleic acid segments and recombinant vectors that include
within their sequence a contiguous nucleic acid sequence from SEQ
ID NO:1 or SEQ ID NO:2, or other amino acid sequence incorporated
by reference supra.
[0112] Suitable methods for nucleic acid delivery to effect
expression of compositions of the present invention are believed to
include virtually any method by which a nucleic acid (e.g., DNA,
including viral and nonviral vectors) can be introduced into a
cell, a tissue or an organism, as described herein or as would be
known to one of ordinary skill in the art. Such methods include,
but are not limited to, direct delivery of DNA such as by injection
(U.S. Pat. Nos. 5,994,624, 5,981,274, 5,945,100, 5,780,448,
5,736,524, 5,702,932, 5,656,610, 5,589,466 and 5,580,859, each
incorporated herein by reference), including microinjection
(Harland and Weintraub, 1985; U.S. Pat. No. 5,789,215, incorporated
herein by reference); by electroporation (U.S. Pat. No. 5,384,253,
incorporated herein by reference); by calcium phosphate
precipitation (Graham and Van Der Eb, 1973; Chen and Okayama, 1987;
Rippe et al., 1990); by using DEAE dextran followed by polyethylene
glycol (Gopal, 1985); by direct sonic loading (Fechheimer et al.,
1987); by liposome mediated transfection (Nicolau and Sene, 1982;
Fraley et al., 1979; Nicolau et al., 1987; Wong et al., 1980;
Kaneda et al., 1989; Kato et al., 1991); by microprojectile
bombardment (PCT Application Nos. WO 94/09699 and 95/06128; U.S.
Pat. Nos. 5,610,042; 5,322,783 5,563,055, 5,550,318, 5,538,877 and
5,538,880, and each incorporated herein by reference); by agitation
with silicon carbide fibers (Kaeppler et al., 1990; U.S. Pat. Nos.
5,302,523 and 5,464,765, each incorporated herein by reference); by
Agrobacterium mediated transformation (U.S. Pat. Nos. 5,591,616 and
5,563,055, each incorporated herein by reference); by PEG mediated
transformation of protoplasts (Omirulleh et al., 1993; U.S. Pat.
Nos. 4,684,611 and 4,952,500, each incorporated herein by
reference); or by desiccation/inhibition mediated DNA uptake
(Potrykus et al., 1985). Through the application of techniques such
as these, organelle(s), cell(s), tissue(s) or organism(s) may be
stably or transiently transformed.
III. IMMUNE RESPONSE AND THERAPY
[0113] As discussed above, the invention concerns evoking an immune
response in a subject against an Hla or a variant or fragment
thereof. In one embodiment, the immune response can protect against
or treat a subject having, suspected of having, or at risk of
developing an infection or related disease, particularly those
related to staphylococcal pneumonia.
[0114] A. Protective Immunity
[0115] In some embodiments of the invention, proteinaceous
compositions confer protective immunity on a subject. Protective
immunity refers to a body's ability to mount a specific immune
response that protects the subject from developing a particular
disease or condition that involves the agent against which there is
an immune response. An immunogenically effective amount is capable
of conferring protective immunity to the subject.
[0116] As used herein in the specification and in the claims
section that follows, the term polypeptide refers to a stretch of
amino acids covalently linked via peptide bonds or mimetic thereof.
Different polypeptides have different functionalities according to
the present invention. While according to one aspect a polypeptide
is derived from an immunogen designed to induce an active immune
response in a recipient, according to another aspect of the
invention, a polypeptide is derived from an antibody which results
following the elicitation of an active immune response, in, for
example, an animal, and which can serve to induce a passive immune
response in the recipient. In both cases, however, the polypeptide
can be encoded by a polynucleotide according to any possible codon
usage.
[0117] As used herein the phrase "immune response" or its
equivalent "immunological response" refers to the development of a
humoral (antibody mediated), cellular (mediated by antigen-specific
T cells or their secretion products) or both humoral and cellular
response directed against a protein, peptide, or polypeptide of the
invention in a recipient patient. Such a response can be an active
response induced by administration of immunogen or a passive
response induced by administration of antibody, antibody containing
material, or primed T-cells. A cellular immune response is elicited
by the presentation of polypeptide epitopes in association with
Class I or Class II MHC molecules, to activate antigen-specific CD4
(+) T helper cells and/or CD8 (+) cytotoxic T cells. The response
may also involve activation of monocytes, macrophages, NK cells,
basophils, dendritic cells, astrocytes, microglia cells,
eosinophils or other components of innate immunity.
[0118] As used herein "active immunity" refers to any immunity
conferred upon a subject by administration of an antigen.
[0119] As used herein "passive immunity" refers to any immunity
conferred upon a subject without administration of an antigen to
the subject. "Passive immunity" therefore includes, but is not
limited to, administration of activated immune effectors including
cellular mediators or protein mediators (e.g., monoclonal and/or
polyclonal antibodies) of an immune response. A monoclonal or
polyclonal antibody composition may be used in passive immunization
for the prevention or treatment of infection by organisms that
carry the antigen recognized by the antibody. An antibody
composition may include antibodies that bind to a variety of
antigens that may in turn be associated with various organisms. The
antibody component can be a polyclonal antiserum. In certain
aspects the antibody or antibodies are affinity purified from an
animal or second subject that has been challenged with an
antigen(s). Alternatively, an antibody mixture may be used, which
is a mixture of monoclonal and/or polyclonal antibodies to antigens
present in the same, related, or different microbes or organisms,
such as gram-positive bacteria, gram-negative bacteria, including
but not limited to staphylococcus bacteria.
[0120] Passive immunity may be imparted to a patient or subject by
administering to the patient immunoglobulins (Ig) and/or other
immune factors obtained from a donor or other non-patient source
having a known immunoreactivity. In other aspects, an antigenic
composition of the present invention can be administered to a
subject who then acts as a source or donor for globulin, produced
in response to challenge from the composition ("hyperimmune
globulin"), containing antibodies directed against an Hla or any
variant or fragment thereof. A subject thus treated would donate
plasma from which hyperimmune globulin would then be obtained, via
conventional plasma-fractionation methodology, and administered to
another subject in order to impart resistance against or to treat
staphylococcus infection. Hyperimmune globulins according to the
invention are particularly useful for immune-compromised
individuals, for individuals undergoing invasive procedures or
where time does not permit the individual to produce his own
antibodies in response to vaccination. See U.S. Pat. Nos.
6,936,258, 6,770,278, 6,756,361, 5,548,066, 5,512,282, 4,338,298,
and 4,748,018, each of which is incorporated herein by reference in
its entirety, for exemplary methods and compositions related to
passive immunity.
[0121] For purposes of this specification and the accompanying
claims the terms "epitope" and "antigenic determinant" are used
interchangeably to refer to a site on an antigen to which B and/or
T cells respond or recognize. B-cell epitopes can be formed both
from contiguous amino acids or noncontiguous amino acids juxtaposed
by tertiary folding of a protein. Epitopes formed from contiguous
amino acids are typically retained on exposure to denaturing
solvents whereas epitopes formed by tertiary folding are typically
lost on treatment with denaturing solvents. An epitope typically
includes at least 3, and more usually, at least 5 or 8-10 amino
acids in a unique spatial conformation. Methods of determining
spatial conformation of epitopes include, for example, x-ray
crystallography and 2-dimensional nuclear magnetic resonance. See,
e.g., Epitope Mapping Protocols (1996). Antibodies that recognize
the same epitope can be identified in a simple immunoassay showing
the ability of one antibody to block the binding of another
antibody to a target antigen. T cells recognize continuous epitopes
of about nine amino acids for CD8 cells or about 13-15 amino acids
for CD4 cells. T cells that recognize the epitope can be identified
by in vitro assays that measure antigen-dependent proliferation, as
determined by .sup.3H-thymidine incorporation by primed T cells in
response to an epitope (Burke et al., 1994), by antigen-dependent
killing (cytotoxic T lymphocyte assay, Tigges et al., 1996) or by
cytokine secretion.
[0122] The presence of a cell-mediated immunological response can
be determined by proliferation assays (CD4 (+) T cells) or CTL
(cytotoxic T lymphocyte) assays. The relative contributions of
humoral and cellular responses to the protective or therapeutic
effect of an immunogen can be distinguished by separately isolating
IgG and T-cells from an immunized syngeneic animal and measuring
protective or therapeutic effect in a second subject.
[0123] As used herein and in the claims, the terms "antibody" or
"immunoglobulin" are used interchangeably and refer to any of
several classes of structurally related proteins that function as
part of the immune response of an animal or recipient, which
proteins include IgG, IgD, IgE, IgA, IgM and related proteins.
[0124] "Humanized" antibodies are also contemplated, as are
chimeric antibodies from mouse, rat, or other species, bearing
human constant and/or variable region domains, bispecific
antibodies, recombinant and engineered antibodies and fragments
thereof. "Humanizing" techniques typically involve the use of
recombinant DNA technology to manipulate DNA sequences encoding the
polypeptide chains of the antibody molecule. Early methods for
humanizing monoclonal antibodies (MAbs) involved production of
chimeric antibodies in which an antigen binding site comprising the
complete variable domains of one antibody is linked to constant
domains derived from another antibody. Methods for carrying out
such chimerization procedures are described in EP0120694 (Celltech
Limited), EP0125023 (Genentech Inc. and City of Hope), EP-A-0
171496 (Rev. Dev. Corp. Japan), EP-A-0 173 494 (Stanford
University), and WO 86/01533 (Celltech Limited), each of which is
incorporated herein by reference in its entirety. Generally these
applications disclose processes for preparing an antibody molecule
having the variable domains from a mouse MAb and the constant
domains from a human immunoglobulin.
[0125] Alternative approaches are described in EP-A-0239400
(Winter), in which the complementary determining regions (CDRs) of
a mouse MAb have been grafted onto the framework regions of the
variable domains of a human immunoglobulin by site directed
mutagenesis using long oligonucleotides. See U.S. Pat. No.
7,262,050, which is incorporated herein by reference in its
entirety, for an example of such methods.
[0126] Humanized antibodies can also be obtained from transgenic
animals. For example, transgenic, mutant mice that are capable of
producing a full repertoire of human antibodies, in response to
immunization, have been described (see, e.g., Jakobovits, et al.,
1993; Jakobovits et al., 1993; Bruggermann, et al., 1993, which are
incorporated by reference herein at least for their teaching of
human antibody preparation). Specifically, the homozygous deletion
of the antibody heavy chain joining region (J(H)) gene in these
chimeric and germ-line mutant mice results in complete inhibition
of endogenous antibody production, and the successful transfer of
the human germ-line antibody gene array into such germ-line mutant
mice results in the production of human antibodies upon antigen
challenge.
[0127] Under normal physiological conditions antibodies are found
in plasma and other body fluids and in the membrane of certain
cells and are produced by lymphocytes of the type denoted B cells
or their functional equivalent. Antibodies of the IgG class are
made up of four polypeptide chains linked together by disulfide
bonds. The four chains of intact IgG molecules are two identical
heavy chains referred to as H-chains and two identical light chains
referred to as L-chains.
[0128] In order to produce polyclonal antibodies, a host, such as a
rabbit or goat, is immunized with the antigen or antigen fragment,
generally with an adjuvant and, if necessary, coupled to a carrier.
Antibodies to the antigen are subsequently collected from the sera
of the host. The polyclonal antibody can be affinity purified
against the antigen rendering it monospecific.
[0129] In order to produce monoclonal antibodies, hyperimmunization
of an appropriate donor, generally a mouse, with the antigen is
undertaken. Isolation of splenic antibody producing cells is then
carried out. These cells are fused to a cell characterized by
immortality, such as a myeloma cell, to provide a fused cell hybrid
(hybridoma) which can be maintained in culture and which secretes
the required monoclonal antibody. The cells are then cultured, in
bulk, and the monoclonal antibodies harvested from the culture
media for use. By definition, monoclonal antibodies are specific to
a single epitope. Monoclonal antibodies often have lower affinity
constants than polyclonal antibodies raised against similar
antigens for this reason.
[0130] Monoclonal antibodies may also be produced ex-vivo by use of
primary cultures of splenic cells or cell lines derived from spleen
(Anavi, 1998). In order to produce a recombinant antibody (see
generally Huston et al., 1991; Johnson et al., 1991; Mernaugh et
al., 1995), messenger RNAs from antibody producing B-lymphocytes of
animals or hybridoma are reverse-transcribed to obtain
complementary DNAs (cDNAs). Antibody cDNA, which can be full length
or partial length, is amplified and cloned into a phage or a
plasmid. The cDNA can be a partial length of heavy and light chain
cDNA, separated or connected by a linker. The antibody, antibody
fragment, or immunological portion or segment of an antibody is
expressed using a suitable expression system to obtain a
recombinant antibody. Antibody cDNA can also be obtained by
screening pertinent expression libraries.
[0131] As discussed previously, antibodies for use in the methods
of the invention may be polyclonal or monoclonal antibodies or
fragments thereof. However, for certain therapeutic purposes the
antibodies are humanized such that they do not elicit a substantial
immune response to the administered antibodies. Such humanized
antibodies may also be used according to the current invention and
methods for generating such antibodies are well known to those of
skill in the art (Jones et al., 1986; Riechmann et al., 1988;
Verhoeyen et al., 1988).
[0132] The antibody can be bound to a solid support substrate or
conjugated with a detectable moiety or be both bound and conjugated
as is well known in the art. For a general discussion of
conjugation of fluorescent or enzymatic moieties see Johnstone et
al. (1982). The binding of antibodies to a solid support substrate
is also well known in the art (Harlow et al., 1988; Borrebaeck,
1992).
[0133] As used herein and in the claims, the phrase "an
immunological portion of an antibody" include a Fab fragment of an
antibody, a Fv fragment of an antibody, a heavy chain of an
antibody, a light chain of an antibody, an unassociated mixture of
a heavy chain and a light chain of an antibody, a heterodimer
consisting of a heavy chain and a light chain of an antibody, a
catalytic domain of a heavy chain of an antibody, a catalytic
domain of a light chain of an antibody, a variable fragment of a
light chain of an antibody, a variable fragment of a heavy chain of
an antibody, and a single chain variant of an antibody, which is
also known as scFv. In addition, the term includes chimeric
immunoglobulins which are the expression products of fused genes
derived from different species, one of the species can be a human,
in which case a chimeric immunoglobulin is said to be humanized.
Typically, an immunological portion of an antibody competes with
the intact antibody from which it was derived for specific binding
to an antigen.
[0134] Optionally, an antibody or preferably an immunological
portion of an antibody, can be chemically conjugated to, or
expressed as, a fusion protein with other proteins. For purposes of
this specification and the accompanying claims, all such fused
proteins are included in the definition of antibodies or an
immunological portion of an antibody.
[0135] As used herein the terms "immunogenic agent" or "immunogen"
or "antigen" are used interchangeably to describe a molecule
capable of inducing an immunological response against itself on
administration to a recipient, either alone, in conjunction with an
adjuvant, or presented on a display vehicle.
[0136] Single chain antibodies (SCAs) are genetically engineered
proteins designed to expand on the therapeutic and diagnostic
applications possible with monoclonal antibodies. SCAs have the
binding specificity and affinity of monoclonal antibodies and, in
their native form, are about one-fifth to one-sixth of the size of
a monoclonal antibody, typically giving them very short half-lives.
SCAs offer some benefits compared to most monoclonal antibodies,
including their ability to be directly fused with a polypeptide
that may be used for detection (e.g., luciferase or fluorescent
proteins). In addition to these benefits, fully-human SCAs can be
isolated directly from human SCA libraries without the need for
costly and time consuming "humanization" procedures.
[0137] Single-chain recombinant antibodies (scFvs) consist of the
antibody VL and VH domains linked by a designed flexible peptide
tether (Atwell et al., 1999). Compared to intact IgGs, scFvs have
the advantages of smaller size and structural simplicity with
comparable antigen-binding affinities, and they can be more stable
than the analogous 2-chain Fab fragments (Colcher et al., 1998;
Adams and Schier, 1999).
[0138] The variable regions from the heavy and light chains (VH and
VL) are both approximately 110 amino acids long. They can be linked
by a 15 amino acid linker or longer with a sequence, for example,
which has sufficient flexibility to allow the two domains to
assemble a functional antigen binding pocket. In specific
embodiments, addition of various signal sequences allows the scFv
to be targeted to different organelles within the cell, or to be
secreted. Addition of the light chain constant region (Ck) allows
dimerization via disulfide bonds, giving increased stability and
avidity. Thus, for a single chain Fv (scFv) SCA, although the two
domains of the Fv fragment are coded for by separate genes, it has
been proven possible to make a synthetic linker that enables them
to be made as a single protein chain scFv (Bird et al., 1988;
Huston et al., 1988) by recombinant methods. Furthermore, they are
frequently used due to their ease of isolation from phage display
libraries and their ability to recognize conserved antigens (for
review, see Adams and Schier, 1999). Thus, in some aspects of the
invention, an antibody may be an SCA that is isolated from a phage
display library rather that generated by the more traditional
antibody production techniques described above.
[0139] B. Treatment and Prevention Methods
[0140] A method of the present invention includes treatment for a
disease or condition caused by a staphylococcus pathogen, as well
as prevention of or reduction in infection so as to prevent or
minimize the extent of exposure to the pathogen. An immunogenic
polypeptide of the invention can be given to induce an immune
response in a person infected with staphylococcus, suspected of
having been exposed to staphylococcus, or at risk of exposure to
staphylococcus. Further, an antibody specific for an immunogenic
polypeptide or peptide of the invention can be administered for
passive immunization of a person infected with staphylococcus,
suspected of having been exposed to staphylococcus, or at risk of
exposure to staphylococcus. Methods may be employed with respect to
individuals who have tested positive for exposure to staphylococcus
or who are deemed to be at risk for infection based on possible
exposure.
[0141] It is contemplated that compositions of the invention may be
administered to a patient within about 1, 2, 3, 4, 5, 10, 15, 20,
25, 30, 35, 40, 45, 50, 55 minutes, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, 1, 2,
3, 4, 5, 6, 7 days, 1, 2, 3, 4, 5 weeks, and/or 1, 2, 3, 4, 5, 6,
7, 8, 9, 10, 11, 12 months of being diagnosed with a staphylococcal
disease or condition, diagnosed with a staphylococcal infection,
identified as having symptoms of a staphylococcal infection or a
staphylococcal disease or condition, placed at risk for a
staphylococcal infection, placed at risk for a staphylococcal
disease or condition, or placed in intensive care, and/or
hospitalized.
[0142] Compositions may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9,
10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more times, and/or
they may be administered every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11,
12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24 hours, or 1, 2,
3, 4, 5, 6, 7 days, or 1, 2, 3, 4, 5 weeks, or 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, 11, 12 months, or any range or combination derivable
therein.
[0143] In some embodiments, the treatment is administered in the
presence of adjuvants or carriers in the absence or substantial
absence of other staphylococcal antigens and/or proteins.
Furthermore, in some examples, treatment comprises administration
of other agents commonly used against bacterial infection, such as
one or more antibiotics.
[0144] The use of peptides for vaccination typically requires
conjugation of the peptide to an immunogenic carrier protein, such
as hepatitis B surface antigen, keyhole limpet hemocyanin, or
bovine serum albumin. Methods for performing this conjugation are
well known in the art.
IV. VACCINES AND PHARMACEUTICAL COMPOSITIONS
[0145] A. Vaccines
[0146] The present invention includes methods for preventing or
ameliorating staphylococcus infections. Embodiments of the
invention include preventing or ameliorating staphylococcal
pneumonia. As such, the invention contemplates vaccines for use in
both active and passive immunization embodiments. Immunogenic
compositions, proposed to be suitable for use as a vaccine, may be
prepared most readily directly from immunogenic Hla peptide or
protein prepared in a manner disclosed herein. Preferably the
antigenic material is extensively dialyzed to remove undesired
small molecular weight molecules and/or lyophilized for more ready
formulation into a desired vehicle. The invention includes
compositions that can be used to induce an immune response against
a polypeptide or peptide derived from a Hla peptide or protein so
as to protect against infection by a staphylococcus and against
developing a condition or disease caused by such. In certain
aspects a composition is formulated to be administered to a mucosal
surface, e.g., an aerosol formulation.
[0147] Alternatively, other viable and important options for a
protein/peptide-based vaccine involve introducing nucleic acids
encoding the antigen(s) as DNA vaccines. In this regard, recent
reports described construction of recombinant vaccinia viruses
expressing either 10 contiguous minimal CTL epitopes (Thomson,
1996) or a combination of B cell, CTL, and TH epitopes from several
microbes (An, 1997), and successful use of such constructs to
immunize mice for priming protective immune responses. Thus, there
is ample evidence in the literature for successful utilization of
peptides, peptide-pulsed APCs, and peptide-encoding constructs for
efficient in vivo priming of protective immune responses. The use
of nucleic acid sequences as vaccines is exemplified in U.S. Pat.
Nos. 5,958,895 and 5,620,896.
[0148] The preparation of vaccines that contain polypeptide or
peptide sequence(s) as active ingredients is generally well
understood in the art, as exemplified by U.S. Pat. Nos. 4,608,251;
4,601,903; 4,599,231; 4,599,230; 4,596,792; and 4,578,770, all of
which are incorporated herein by reference. Typically, such
vaccines are prepared as injectables either as liquid solutions or
suspensions: solid forms suitable for solution in or suspension in
liquid prior to injection may also be prepared. The preparation may
also be emulsified. The active immunogenic ingredient is often
mixed with excipients that are pharmaceutically acceptable and
compatible with the active ingredient. Suitable excipients are, for
example, water, saline, dextrose, glycerol, ethanol, or the like
and combinations thereof. In addition, if desired, the vaccine may
contain amounts of auxiliary substances such as wetting or
emulsifying agents, pH buffering agents, or adjuvants that enhance
the effectiveness of the vaccines. In specific embodiments,
vaccines are formulated with a combination of substances, as
described in U.S. Pat. Nos. 6,793,923 and 6,733,754, which are
incorporated herein by reference.
[0149] Vaccines may be conventionally administered parenterally,
mucosally, intranasally, by inhalation, and/or by injection, for
example, either subcutaneously or intramuscularly. Additional
formulations which are suitable for other modes of administration
include suppositories and, in some cases, oral formulations. For
suppositories, traditional binders and carriers may include, for
example, polyalkalene glycols or triglycerides; such suppositories
may be formed from mixtures containing the active ingredient in the
range of about 0.5% to about 10%, preferably about 1% to about 2%.
Oral formulations include such normally employed excipients as, for
example, pharmaceutical grades of mannitol, lactose, starch,
magnesium stearate, sodium saccharine, cellulose, magnesium
carbonate and the like. These compositions take the form of
solutions, suspensions, tablets, pills, capsules, sustained release
formulations or powders and contain about 10% to about 95% of
active ingredient, preferably about 25% to about 70%.
[0150] The polypeptides and polypeptide-encoding DNA constructs may
be formulated into a vaccine as neutral or salt forms.
Pharmaceutically-acceptable salts include the acid addition salts
(formed with the free amino groups of the peptide) and those that
are formed with inorganic acids such as, for example, hydrochloric
or phosphoric acids, or such organic acids as acetic, oxalic,
tartaric, mandelic, and the like. Salts formed with the free
carboxyl groups may also be derived from inorganic bases such as,
for example, sodium, potassium, ammonium, calcium, or ferric
hydroxides, and such organic bases as isopropylamine,
trimethylamine, 2-ethylamino ethanol, histidine, procaine, and the
like.
[0151] Typically, vaccines are administered in a manner compatible
with the dosage formulation, and in such amount as will be
therapeutically effective and immunogenic. The quantity to be
administered depends on the subject to be treated, including the
capacity of the individual's immune system to synthesize antibodies
and the degree of protection desired. Precise amounts of active
ingredient required to be administered depend on the judgment of
the practitioner. However, suitable dosage ranges are of the order
of several hundred micrograms active ingredient per vaccination.
Suitable regimes for initial administration and booster shots are
also variable, but are typified by an initial administration
followed by subsequent inoculations or other administrations.
[0152] The manner of application may be varied widely. Any of the
conventional methods for administration of a vaccine are
applicable. These are believed to include oral application on a
solid physiologically acceptable base or in a physiologically
acceptable dispersion, parenterally, mucosally, intranasally, by
inhalation, by injection and the like. The dosage of the vaccine
will depend on the route of administration and will vary according
to the size and health of the subject.
[0153] In many instances, it will be desirable to have multiple
administrations of the vaccine, usually not exceeding six
vaccinations, more usually not exceeding four vaccinations, and
preferably one or more, usually at least about three vaccinations.
The vaccinations will normally be at two to twelve week intervals,
more usually from three to five week intervals. Periodic boosters
at intervals of 1-5 years, usually three years, will be desirable
to maintain protective levels of the antibodies. The course of the
immunization may be followed by assays for antibodies against the
antigens, as described, for example in U.S. Pat. Nos. 3,791,932;
4,174,384 and 3,949,064, which are hereby incorporated by
reference.
[0154] 1. Carriers
[0155] A given composition may vary in its immunogenicity. It is
often necessary therefore to boost the host immune system, as may
be achieved by coupling a peptide or polypeptide to a carrier.
Exemplary and preferred carriers are keyhole limpet hemocyanin
(KLH) and bovine serum albumin (BSA). Other albumins such as
ovalbumin, mouse serum albumin, or rabbit serum albumin can also be
used as carriers. Means for conjugating a polypeptide to a carrier
protein are well known in the art and include glutaraldehyde,
m-maleimidobencoyl-N-hydroxysuccinimide ester, carbodiimyde, and
bis-biazotized benzidine.
[0156] 2. Adjuvants
[0157] The immunogenicity of polypeptide or peptide compositions
can be enhanced by the use of non-specific stimulators of the
immune response, known as adjuvants. Suitable adjuvants include all
acceptable immunostimulatory compounds, such as cytokines, toxins,
or synthetic compositions.
[0158] A number of adjuvants can be used to enhance an antibody
response against a Hla peptide or protein. Adjuvants can (1) trap
the antigen in the body to cause a slow release; (2) attract cells
involved in the immune response to the site of administration; (3)
induce proliferation or activation of immune system cells; or (4)
improve the spread of the antigen throughout the subject's
body.
[0159] Adjuvants include, but are not limited to, oil-in-water
emulsions, water-in-oil emulsions, mineral salts, polynucleotides,
and natural substances. Specific adjuvants that may be used include
IL-1, IL-2, IL-4, IL-7, IL-12, .gamma.-interferon, GMCSP, BCG,
aluminum hydroxide or other aluminum compound, MDP compounds, such
as thur-MDP and nor-MDP, CGP (MTP-PE), lipid A, and monophosphoryl
lipid A (MPL). Other adjuvants that may be used include RIBI, which
contains three components extracted from bacteria, MPL, trehalose
dimycolate (TDM), and cell wall skeleton (CWS) in a 2%
squalene/Tween 80 emulsion. MHC antigens may even be used. Others
adjuvants or methods are exemplified in U.S. Pat. Nos. 6,814,971,
5,084,269, 6,656,462, each of which is incorporated herein by
reference).
[0160] Various methods of achieving adjuvant affect for the vaccine
includes use of agents such as aluminum hydroxide or phosphate
(alum), commonly used as about 0.05 to about 0.1% solution in
phosphate buffered saline, admixture with synthetic polymers of
sugars (Carbopol.RTM.) used as an about 0.25% solution, aggregation
of the protein in the vaccine by heat treatment with temperatures
ranging between about 70.degree. to about 101.degree. C. for a
30-second to 2-minute period, respectively. Aggregation by
reactivating with pepsin-treated (Fab) antibodies to albumin;
mixture with bacterial cells (e.g., C. parvum), endotoxins or
lipopolysaccharide components of Gram-negative bacteria; emulsion
in physiologically acceptable oil vehicles (e.g., mannide
mono-oleate (Aracel A)); or emulsion with a 20% solution of a
perfluorocarbon (Fluosol-DA.RTM.) used as a block substitute may
also be employed to produce an adjuvant effect.
[0161] Exemplary, often preferred adjuvants include complete
Freund's adjuvant (a non-specific stimulator of the immune response
containing killed Mycobacterium tuberculosis), incomplete Freund's
adjuvants, and aluminum hydroxide.
[0162] In addition to adjuvants, it may be desirable to
co-administer biologic response modifiers (BRM) to enhance immune
responses. BRMs have been shown to upregulate T cell immunity or
downregulate suppresser cell activity. Such BRMs include, but are
not limited to, Cimetidine (CIM; 1200 mg/d) (Smith/Kline, PA);
low-dose Cyclophosphamide (CYP; 300 mg/m.sup.2) (Johnson/Mead, NJ)
and cytokines such as .gamma.-interferon, IL-2, or IL-12 or genes
encoding proteins involved in immune helper functions, such as
B-7.
[0163] B. Lipid Components and Moieties
[0164] In certain embodiments, the present invention concerns
compositions comprising one or more lipids associated with a
nucleic acid or a polypeptide/peptide. A lipid is a substance that
is insoluble in water and extractable with an organic solvent.
Compounds other than those specifically described herein are
understood by one of skill in the art as lipids, and are
encompassed by the compositions and methods of the present
invention. A lipid component and a non-lipid may be attached to one
another, either covalently or non-covalently.
[0165] A lipid may be a naturally occurring lipid or a synthetic
lipid. However, a lipid is usually a biological substance.
Biological lipids are well known in the art, and include for
example, neutral fats, phospholipids, phosphoglycerides, steroids,
terpenes, lysolipids, glycosphingolipids, glucolipids, sulphatides,
lipids with ether and ester-linked fatty acids and polymerizable
lipids, and combinations thereof.
[0166] A nucleic acid molecule or a polypeptide/peptide, associated
with a lipid may be dispersed in a solution containing a lipid,
dissolved with a lipid, emulsified with a lipid, mixed with a
lipid, combined with a lipid, covalently bonded to a lipid,
contained as a suspension in a lipid or otherwise associated with a
lipid. A lipid or lipid-Hla-associated composition of the present
invention is not limited to any particular structure. For example,
they may also simply be interspersed in a solution, possibly
forming aggregates which are not uniform in either size or shape.
In another example, they may be present in a bilayer structure, as
micelles, or with a "collapsed" structure. In another non-limiting
example, a lipofectamine (Gibco BRL)-poxvirus or Superfect
(Qiagen)-poxvirus complex is also contemplated.
[0167] In certain embodiments, a composition may comprise about 1%,
about 2%, about 3%, about 4% about 5%, about 6%, about 7%, about
8%, about 9%, about 10%, about 11%, about 12%, about 13%, about
14%, about 15%, about 16%, about 17%, about 18%, about 19%, about
20%, about 21%, about 22%, about 23%, about 24%, about 25%, about
26%, about 27%, about 28%, about 29%, about 30%, about 31%, about
32%, about 33%, about 34%, about 35%, about 36%, about 37%, about
38%, about 39%, about 40%, about 41%, about 42%, about 43%, about
44%, about 45%, about 46%, about 47%, about 48%, about 49%, about
50%, about 51%, about 52%, about 53%, about 54%, about 55%, about
56%, about 57%, about 58%, about 59%, about 60%, about 61%, about
62%, about 63%, about 64%, about 65%, about 66%, about 67%, about
68%, about 69%, about 70%, about 71%, about 72%, about 73%, about
74%, about 75%, about 76%, about 77%, about 78%, about 79%, about
80%, about 81%, about 82%, about 83%, about 84%, about 85%, about
86%, about 87%, about 88%, about 89%, about 90%, about 91%, about
92%, about 93%, about 94%, about 95%, about 96%, about 97%, about
98%, about 99%, or any range therebetween, of a particular lipid,
lipid type, or non-lipid component such as an adjuvant, antigen,
peptide, polypeptide, sugar, nucleic acid or other material
disclosed herein or as would be known to one of skill in the art.
In a non-limiting example, a composition may comprise about 10% to
about 20% neutral lipids, and about 33% to about 34% of a
cerebroside, and about 1% cholesterol. In another non-limiting
example, a liposome may comprise about 4% to about 12% terpenes,
wherein about 1% of the micelle is specifically lycopene, leaving
about 3% to about 11% of the liposome as comprising other terpenes;
and about 10% to about 35% phosphatidyl choline, and about 1% of a
non-lipid component. Thus, it is contemplated that compositions of
the present invention may comprise any of the lipids, lipid types
or other components in any combination or percentage range.
[0168] C. Combination Therapy
[0169] The compositions and related methods of the present
invention, particularly administration of a Hla protein and/or
anti-Hla antibodies to a patient/subject, may also be used in
combination with the administration of traditional therapies. These
include, but are not limited to, the administration of antibiotics
such as streptomycin, ciprofloxacin, doxycycline, gentamycin,
chloramphenicol, trimethoprim, sulfamethoxazole, ampicillin,
tetracycline, oxacillin, vancomycin or various combinations of
antibiotics. In addition, administration of a Hla protein or
anti-Hla antibodies to a patient/subject may be used in combination
with the administration of antivirulence agents, such as RIP.
[0170] In one aspect, it is contemplated that a polypeptide vaccine
and/or therapy is used in conjunction with antibacterial and/or
antivirulence treatment. Alternatively, the therapy may precede or
follow the other agent treatment by intervals ranging from minutes
to weeks. In embodiments where the other agents and/or a proteins
or polynucleotides are administered separately, one would generally
ensure that a significant period of time did not expire between
each delivery, such that the agent and the composition of the
present invention would still be able to exert an advantageously
combined effect on the subject. In such instances, it is
contemplated that one may administer both modalities within about
12-24 h of each other and, more preferably, within about 6-12 h of
each other. In some situations, it may be desirable to extend the
time period for administration significantly, however, where
several days (2, 3, 4, 5, 6 or 7) to several weeks (1, 2, 3, 4, 5,
6, 7 or 8) lapse between the respective administrations.
[0171] Various combinations may be employed, for example antibiotic
therapy is "A" and the immunogenic molecule or antibody given as
part of an immune or passive immune therapy regime, respectively,
such as a Hla antigen, is "B":
TABLE-US-00004 A/B/A B/A/B B/B/A A/A/B A/B/B B/A/A A/B/B/B B/A/B/B
B/B/B/A B/B/A/B A/A/B/B A/B/A/B A/B/B/A B/B/A/A B/A/B/A B/A/A/B
A/A/A/B B/A/A/A A/B/A/A A/A/B/A
[0172] Administration of the compositions of the present invention
to a patient/subject will follow general protocols for the
administration of such compounds, taking into account the toxicity,
if any, of the Hla polypeptide or anti-Hla antibody composition. It
is expected that the treatment cycles would be repeated as
necessary. It also is contemplated that various standard therapies,
such as hydration, may be applied in combination with the described
therapy.
[0173] D. General Pharmaceutical Compositions
[0174] In some embodiments, pharmaceutical compositions are
administered to a subject. Different aspects of the present
invention involve administering an effective amount of a
composition to a subject. In some embodiments of the present
invention, a Hla polypeptide or peptide may be administered to the
patient to protect against infection by one or more staphylococcus
pathogens. In other embodiments of the present invention, an
antibody specific for a Hla polypeptide or peptide may be
administered to the patient to treat or prevent an infection by one
or more staphylococcus pathogens. Alternatively, an expression
vector encoding one or more such polypeptides or peptides may be
given to a patient as a preventative treatment. Additionally, such
compounds can be administered in combination with an antibiotic
and/or antivirulence agent. Such compositions will generally be
dissolved or dispersed in a pharmaceutically acceptable carrier or
aqueous medium.
[0175] The phrases "pharmaceutically acceptable" or
"pharmacologically acceptable" refer to molecular entities and
compositions that do not produce an adverse, allergic, or other
untoward reaction when administered to an animal, or human. As used
herein, "pharmaceutically acceptable carrier" includes any and all
solvents, dispersion media, coatings, antibacterial and antifungal
agents, isotonic and absorption delaying agents, and the like. The
use of such media and agents for pharmaceutical active substances
is well known in the art. Except insofar as any conventional media
or agent is incompatible with the active ingredients, its use in
immunogenic and therapeutic compositions is contemplated.
Supplementary active ingredients, such as other antivirulence or
anti-infection agents, can also be incorporated into the
compositions.
[0176] In addition to the compounds formulated for parenteral
administration, such as those for intravenous or intramuscular
injection, other pharmaceutically acceptable forms include, e.g.,
tablets or other solids for oral administration; time release
capsules; and any other form currently used, including inhalants
and the like.
[0177] The active compounds of the present invention can be
formulated for parenteral administration, e.g., formulated for
injection via the intravenous, intramuscular, sub-cutaneous, or
even intraperitoneal routes. The preparation of an aqueous
composition that contains a composition or compositions of the
present invention will be known to those of skill in the art in
light of the present disclosure. Typically, such compositions can
be prepared as injectables, either as liquid solutions or
suspensions; solid forms suitable for use to prepare solutions or
suspensions upon the addition of a liquid prior to injection can
also be prepared; and, the preparations can also be emulsified.
[0178] Solutions of the active compounds as free base or
pharmacologically acceptable salts can be prepared in water
suitably mixed with a surfactant, such as hydroxypropylcellulose.
Dispersions can also be prepared in glycerol, liquid polyethylene
glycols, and mixtures thereof and in oils. Under ordinary
conditions of storage and use, these preparations contain a
preservative to prevent the growth of microorganisms.
[0179] The pharmaceutical forms suitable for injectable use include
sterile aqueous solutions or dispersions; formulations including
sesame oil, peanut oil, or aqueous propylene glycol; and sterile
powders for the extemporaneous preparation of sterile injectable
solutions or dispersions. In all cases the form must be sterile and
must be fluid to the extent that it may be easily injected. It also
should be stable under the conditions of manufacture and storage
and must be preserved against the contaminating action of
microorganisms, such as bacteria and fungi.
[0180] The proteinaceous compositions may be formulated into a
neutral or salt form. Pharmaceutically acceptable salts, include
the acid addition salts (formed with the free amino groups of the
protein) and which are formed with inorganic acids such as, for
example, hydrochloric or phosphoric acids, or such organic acids as
acetic, oxalic, tartaric, mandelic, and the like. Salts formed with
the free carboxyl groups can also be derived from inorganic bases
such as, for example, sodium, potassium, ammonium, calcium, or
ferric hydroxides, and such organic bases as isopropylamine,
trimethylamine, histidine, procaine and the like.
[0181] The carrier also can be a solvent or dispersion medium
containing, for example, water, ethanol, polyol (for example,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), suitable mixtures thereof, and vegetable oils. The proper
fluidity can be maintained, for example, by the use of a coating,
such as lecithin, by the maintenance of the required particle size
in the case of dispersion, and by the use of surfactants. The
prevention of the action of microorganisms can be brought about by
various antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In
many cases, it will be preferable to include isotonic agents, for
example, sugars or sodium chloride. Prolonged absorption of the
injectable compositions can be brought about by the use in the
compositions of agents delaying absorption, for example, aluminum
monostearate and gelatin.
[0182] Sterile injectable solutions are prepared by incorporating
the active compounds in the required amount in the appropriate
solvent with various other ingredients enumerated above, as
required, followed by filtered sterilization. Generally,
dispersions are prepared by incorporating the various sterilized
active ingredients into a sterile vehicle which contains the basic
dispersion medium and the required other ingredients from those
enumerated above. In the case of sterile powders for the
preparation of sterile injectable solutions, the preferred methods
of preparation are vacuum-drying and freeze-drying techniques,
which yield a powder of the active ingredient, plus any additional
desired ingredient from a previously sterile-filtered solution
thereof.
[0183] Administration of the compositions according to the present
invention will typically be via any common route. This includes,
but is not limited to oral, nasal, or buccal administration.
Alternatively, administration may be by orthotopic, intradermal,
subcutaneous, intramuscular, intraperitoneal, intranasal, mucosal,
or intravenous injection. In certain embodiments, a vaccine
composition may be inhaled (e.g., U.S. Pat. No. 6,651,655, which is
specifically incorporated by reference). Such compositions would
normally be administered as pharmaceutically acceptable
compositions that include physiologically acceptable carriers,
buffers or other excipients. A pharmaceutically acceptable
material, composition or vehicle may include, but is not limited
to, a liquid or solid filler, diluent, excipient, solvent or
encapsulating material, involved in carrying or transporting a
chemical agent.
[0184] For parenteral administration in an aqueous solution, for
example, the solution should be suitably buffered, if necessary,
and the liquid diluent first rendered isotonic with sufficient
saline or glucose. These particular aqueous solutions are
especially suitable for intravenous, intramuscular, subcutaneous,
and intraperitoneal administration. In this connection, sterile
aqueous media which can be employed will be known to those of skill
in the art in light of the present disclosure. For example, one
dosage could be dissolved in isotonic NaCl solution and either
added to hypodermoclysis fluid or injected at the proposed site of
infusion, (see for example, Remington's Pharmaceutical Sciences,
1990). Some variation in dosage will necessarily occur depending on
the condition of the subject. The person responsible for
administration will, in any event, determine the appropriate dose
for the individual subject.
[0185] An effective amount of therapeutic or prophylactic
composition is determined based on the intended goal. The term
"unit dose" or "dosage" refers to physically discrete units
suitable for use in a subject, each unit containing a predetermined
quantity of the composition calculated to produce the desired
responses discussed above in association with its administration,
i.e., the appropriate route and regimen. The quantity to be
administered, both according to number of treatments and unit dose,
depends on the protection desired.
[0186] Precise amounts of the composition also depend on the
judgment of the practitioner and are peculiar to each individual.
Factors affecting dose include physical and clinical state of the
subject, route of administration, intended goal of treatment
(alleviation of symptoms versus cure), and potency, stability, and
toxicity of the particular composition.
[0187] Upon formulation, solutions will be administered in a manner
compatible with the dosage formulation and in such amount as is
therapeutically or prophylactically effective. The formulations are
easily administered in a variety of dosage forms, such as the type
of injectable solutions described above.
[0188] E. In Vitro, Ex Vivo, or In Vivo Administration
[0189] As used herein, the term in vitro administration refers to
manipulations performed on cells removed from or outside of an
animal, including, but not limited to cells in culture. The term ex
vivo administration refers to cells which have been manipulated in
vitro, and are subsequently administered to a living animal. The
term in vivo administration includes all manipulations performed
within an animal.
[0190] In certain aspects of the present invention, the
compositions may be administered either in vitro, ex vivo, or in
vivo. In certain in vitro embodiments, autologous B-lymphocyte cell
lines are incubated typically with a virus vector of the instant
invention for 24 to 48 hours or with a Hla polypeptide for two
hours. The transduced cells can then be used for in vitro analysis,
or alternatively for ex vivo administration.
[0191] U.S. Pat. Nos. 4,690,915 and 5,199,942, both incorporated
herein by reference, disclose methods for ex vivo manipulation of
blood mononuclear cells and bone marrow cells for use in
therapeutic applications.
V. EXAMPLES
[0192] The following examples are given for the purpose of
illustrating various embodiments of the invention and are not meant
to limit the present invention in any fashion. One skilled in the
art will appreciate readily that the present invention is well
adapted to carry out the objects and obtain the ends and advantages
mentioned, as well as those objects, ends and advantages inherent
herein. The present examples, along with the methods described
herein are presently representative of preferred embodiments, are
exemplary, and are not intended as limitations on the scope of the
invention. Changes therein and other uses which are encompassed
within the spirit of the invention as defined by the scope of the
claims will occur to those skilled in the art.
Example 1
Vaccine Mediated Protection Against Staphylococcus Aureus
[0193] A. Methods
[0194] Bacterial Strains and Culture.
[0195] S. aureus Newman, LAC, and MW2 were propagated in tryptic
soy broth (TSB) or on tryptic soy agar (TSA). To obtain
PVL-converting phage, .phi.Sa2mw lytic replication in S. aureus MW2
cultures was induced with 1 .mu.g/ml mitomycin C. Lysates were
filtered through 0.22 .mu.m membranes and filtrate subjected to
plaque formation on S. aureus RN4220 (Bae et al., 2006). Phage
suspensions were mixed with 1 ml mid-log culture of strain RN4220
grown in heart infusion broth supplemented with 5 mM CaCl.sub.2
(HIBCa5) and then amplified by incubation at 37.degree. C.
overnight. DNA was purified from the amplified phage particles by
phenol/chloroform extraction. .phi.Sa2mw was detected by
PCR-amplification of lukS-PV DNA with primers cctcctgttgatggaccact
(SEQ ID NO:3) and ggcgctgaggtagtcaaaag (SEQ ID NO:4). .phi.Sa2mw
phage solution was mixed with mid-log cultures of strain Newman
grown in HIBCa5, incubated overnight at 37.degree. C. with shaking
(150 rpm), and then plated on TSA. Colonies were propagated on TSA
to remove contaminating phage particles. .phi.Sa2mw lysogen was
grown overnight in 5 ml of TSB at 37.degree. C., chromosomal DNA
purified, and lukS-PV DNA amplified. Variants Newman 4 Sa2mw
hla::erm, Newman hla::erm and LAC hla::erm were generated by
transduction of bursa aurealis insertion mutations from strain
.PHI.N.XI.11568 and screened by PCR and DNA sequencing to confirm
disruption of the hla locus (Bae et al., 2004). Transductants were
maintained on TSA with 10 .mu.g/ml erythromycin, except for the LAC
hla::erm, which was propagated with 100 .mu.g/ml erythromycin. For
complementation studies, staphylococci were transformed with
plasmids pOS1 (vector), phla or ppvl and grown on TSA with 10
.mu.g/ml chloramphenicol. To establish murine lung infections,
overnight cultures of bacteria were diluted 1:100 into fresh TSB,
and grown with rotation at 37.degree. C. to OD.sub.660 0.5.
Staphylococci in 50 ml culture aliquots were sedimented by
centrifugation, washed in PBS, and suspended in 750 .mu.l PBS for
mortality studies (3-4.times.10.sup.8 CFU per 30 .mu.l volume), or
1250 .mu.l (2.times.10.sup.8 CFU per 30 .mu.l volume) for bacterial
load and histopathology experiments. For cytoxicity studies,
staphylococcal strains were grown to OD.sub.660 0.5. Staphylococci
in 5 ml culture aliquots were sedimented by centrifugation, washed
in PBS and suspended in 10 ml of F12 media (Gibco).
[0196] Plasmids.
[0197] The hla gene and promoter were PCR amplified with the
primers gcgggatcccccctttcttgaattaaca (SEQ ID N0:5) and
gcggaattcacattaatttgtcatttcttc (SEQ ID NO:6) using S. aureus Newman
DNA as template. The pvl locus and promoter were PCR amplified with
the primers gcgggatccgtatatgatgaatcttaggca (SEQ ID NO:7) and
gcggaattctgtttagctcataggatttttttc (SEQ ID NO:8). PCR products were
digested with BamHI and EcoRI and cloned into the corresponding
sites of pOS1.
[0198] Production of Rabbit Antisera.
[0199] PCR product encoding mature Hla.sub.H35L was generated using
pOS1-Hla.sub.H35L template DNA and primers
gccggatccgcagattctgatattaatattaaaacc (SEQ ID NO:9) and
gcggaattcacattaatttgtcatttcttc (SEQ ID NO:10). PCR products
encoding mature LukS-PV and LukF-PV were generated with USA300
genomic template DNA and primers
gccggatccgctcaacatatcacacctgtaagtgag (SEQ ID NO:11) and
gcggaattctgtttagctcataggatttttttc (SEQ ID NO:12) (LukF-PV) as well
as gccggatccgataacaatattgagaatattggtgat (SEQ ID NO:13) and
gccgaattctcaattatgtcctttcactttaatttc (SEQ ID NO:14) (LukS-PV). PCR
products were digested with BamHI and EcoRI, cloned into the
corresponding sites of pGEX-6P-1 (Amersham Biosciences) and
transformed into E. coli. GST-Hla.sub.H35L, GST-LukF-PV and
GST-LukS-PV fusion proteins were purified by affinity
chromatography. Purified protein (0.5 mg) was emulsified with
either Complete (CFA) or Incomplete Freund's Adjuvant (IFA) and
injected subscapularly in female New Zealand White rabbits for
primary immunization followed by two booster immunizations
separated by 21 day intervals.
[0200] Active and Passive Immunization Studies.
[0201] For active immunization, GST-Hla.sub.H35L fusion protein was
subjected to Precission protease cleavage according to the
manufacturer's instructions (Amersham Biosciences). Following
removal of contaminating endotoxin by Triton X-114 extraction,
Hla.sub.H35L protein was emulsified in either CFA or IFA. Four week
old C57Bl/6J mice (Jackson Laboratories) received 20 .mu.g of
Hla.sub.H35L protein in CFA on day 0, followed by a boost with 20
.mu.g Hla.sub.H35L protein in IFA on day 10. Animals were then
challenged with S. aureus on day 21. Sera were collected from
animals prior to immunization on day 0 and also on day 20 to assess
specific serum antibody production.
[0202] For passive immunization studies, 7 week old C57Bl/6J mice
received 100 .mu.l of either normal rabbit sera (NRS, Sigma) or
anti-Hla rabbit antisera via intraperitoneal (IP) injection 24
hours prior to challenge with S. aureus. Animals passively
immunized with LukF-PV and LukS-PV received 100 .mu.l of each
specific antisera in a 1:1 mixture for a total IP injection volume
of 200 .mu.l. Control animals for the LukF/S-PV immunization
studies received 200 .mu.l NRS. Sera were harvested at the time of
challenge to assess specific rabbit antibody titers.
[0203] Mouse Infection Model.
[0204] Six week old female C57Bl/6J mice (Jackson Laboratories)
were housed in the University of Chicago animal facility for 1 week
prior to infection. Animals were anesthetized with ketamine and
xylazine. When appropriate anesthesia was documented, 30 .mu.l
staphylococcal suspensions were inoculated into the left nare.
Animals were held upright for 1 minute post-inoculation and then
placed into the cage in supine position for recovery. All animals
were provided with food and water ad libitum and continually
observed over 72 hours. A small percentage of animals routinely
succumbed within the first six hours following inoculation, likely
from the combined effects of aspiration and anesthesia. These
animals were excluded from subsequent analyses.
[0205] Bacterial Load and Histopathology.
[0206] Infected animals were killed via forced CO.sub.2 inhalation
in compliance with the University of Chicago Institute of Animal
Care and Use Committee guidelines prior to removal of both lungs.
The right lung was placed in 1 ml sterile PBS and homogenized prior
to serial dilution and colony formation on agar plates. For
histopathology studies, the left lung was dissected and placed in
1% formalin. Formalin-fixed tissues were embedded and thin
sectioned prior to staining with hematoxylin and eosin and
inspection by light microscopy.
[0207] ELISA.
[0208] Analysis of mouse serum antibody titers was performed
utilizing Nunc MaxiSorp Immuno plates coated with 1 .mu.g/ml of
recombinant Hla.sub.H35L, LukF-PV, or LukS-PV. Dilutions of sera
were incubated in appropriate plates and developed with HRP
conjugated secondary antibodies and Opti-EIA (BD Biosciences) on a
Tecan GENios spectrophotometer.
[0209] Protein Analysis.
[0210] Staphylococcal cultures grown in TSB were adjusted to equal
optical density and proteins in the culture supernatant
precipitated with trichloroacetic acid, washed in acetone and
solubilized in sample buffer. Proteins separated on 15% SDS-PAGE
were analyzed by immunoblotting with specific antisera
(.alpha.-LukS-PV, .alpha.-LukF-PV or .alpha.-nuclease) and HRP
conjugated goat anti-rabbit secondary antibody with enhanced
chemiluminescence detection. Horseradish peroxidase conjugated
anti-Hla antibodies were purchased from Toxin Technology, Inc.
(Sarasota, Fla.).
[0211] Cytotoxcity Assay.
[0212] A549 cells were maintained in culture in F12 media
supplemented with 10% fetal bovine serum and normocin (100
.mu.g/ml, InvivoGen, SanDiego, Calif.). A549 cells were washed and
plated in complete F12 media at a density of 1.5.times.10.sup.4
cells per well in 96-well plates. A549 cells were washed once with
F12 media without supplements prior to the addition of 100 .mu.l
staphylococcal suspension per well. After 4 hours of incubation in
a humidified 37.degree. C. incubator, LDH activity was determined
in triplicate (Roche Applied Science, Mannheim, Germany). For
microscopic evaluation of cellular injury, images of cells were
obtained 3 hours following infection using a Nikon Eclipse TE2000U
microscope.
[0213] Cytokine Assay.
[0214] Sera harvested 24 hours post-infection from experimental
animals was diluted 1:4 ratio and assayed for cytokine content
using the Bioplex Mouse 8-Plex A assay (Bio-Rad). Cytokine
concentrations were quantified on a Bio-Plex Workstation with the
Bio-Plex Manager software.
[0215] Statistical Analysis.
[0216] Analysis of the statistical significance of mortality
studies was performed using the Fisher's exact test. Statistical
significance of bacterial recovery studies and A549 LDH release was
calculated using the two-tailed Student's t-test.
[0217] B. Results
[0218] Staphylocccal .alpha.-hemolysin (Hla or .alpha.-toxin) is
the founding member of bacterial pore-forming .beta.-barrel toxins
(Bhakdi and Tranum-Jensen, 1991; Song et al., 1996). Its structural
gene, hla, is located on the chromosome of all S. aureus strains
examined that secrete the 293 residue water-soluble monomer
(O'Reilly et al., 1990; O'Reilly et al., 1986). Hla is thought to
engage surface receptors of sensitive host cells, thereby promoting
its oligomerization into a heptameric prepore and insertion of a
.beta.-barrel structure with 2 nm pore diameter into the plasma
membrane (Gouaux et al., 1997). Hla pores form in lymphocytes,
macrophages, alveolar epithelial cells, pulmonary endothelium and
erythrocytes, however granulocytes and fibroblasts appear resistant
to lysis (Bhakdi and Tranum-Jensen, 1991; McElroy et al., 1999).
Instillation of purified Hla into rabbit or rat lung tissue
triggers vascular leakage and pulmonary hypertension, which has
been attributed to release of several signaling molecules, e.g.
phosphatidyl inositol, nitric oxide, prostanoids (PGE2, PGI2) and
thromboxane A2 (McElroy et al., 1999; Seeger et al., 1984; Seeger
et al., 1990; Rose et al., 2002; Suttorp and Habben, 1988). In
agreement with the biochemical attributes of Hla, mutations that
abrogate hla expression in S. aureus Newman severely attenuate
virulence in the murine pneumonia model (Bubeck-Wardenburg et al.,
2007). Here the inventors examined .alpha.-hemolysin as a target
for the development of vaccines or immunotherapeutic strategies
that combat S. aureus lung infections.
[0219] To test whether hla functions as a virulence factor in a
recent clinical S. aureus isolate, the inventors chose the
community-associated MRSA strain LAC (Los Angeles Clone, CDC clade
USA300) (Voyich et al., 2006; Miller et al., 2005). Replacement of
hla with the hla::erm allele completely abolished the ability of S.
aureus LAC to cause lung infections (FIG. 1A). Recent reports
described the emergence of S. aureus isolates that secrete
bacteriophage encoded Panton-Valentine leukocidin (PVL) (Miller et
al., 2005; Chambers, 2005; Vandenesch et al., 2003; Fridkin et al.,
2005). PVL is another heptameric .beta.-barrel toxin formed from
two subunits (LukS-PV and LukF-PV) that insert into membranes of
select target cells (Panton and Valentine, 1932; Menestrina et al.,
2001). Using the laboratory strain S. aureus RN6390 and its
PVL+derivatives, Labandeira-Rey and colleagues suggested that PVL
may function as an essential virulence factor for the pathogenesis
of murine pneumonia (Labandeira-Rey et al., 2007). Significant
animal mortality and histopathologic evidence for pneumonia was
observed when PVL was expressed from a multi-copy-plasmid in strain
RN6390 (Labandeira-Rey et al., 2007). In contrast, Voyich et al.
found no direct role for PVL in staphylococcal virulence using
murine models of sepsis and skin infection (Voyich et al., 2006).
Isogenic lukS-PV and lukF-PV mutant derivatives of the predominant
American CA-MRSA isolates, strains LAC (USA300) and MW2 (USA400),
also failed to reveal a role for PVL in neutrophil lysis, abscess
formation, dermonecrosis, or sepsis-induced mortality (Voyich et
al., 2006).
[0220] PVL and its Contribution to Pathogenesis of Lung
Infections.
[0221] To test whether PVL as expressed by current clinical
isolates is a contributor to the pathogenesis of lung infections,
S. aureus strains LAC and MW2 as well as their isogenic variants
lacking PVL genes were analyzed in the murine pneumonia model. No
significant difference in the overall mortality of animals with
staphylococcal pneumonia was observed following paired analysis of
infections caused by wild-type and isogenic .DELTA. pvl mutant
strains (FIG. 1B). Deletion of lukS/F-PV (.DELTA. pvl) in either of
the two CA-MRSA strains did not affect bacterial growth in the
murine lung. Hematoxylin-eosin stained thin-sectioned lung samples
from infected animals revealed pathologic evidence of pneumonia, as
manifested by immune cell infiltration, loss of alveolar
architecture with consolidation of lung parenchyma and bacterial
infiltrates; these features were indistinguishable in animals
infected with strains that did or did not secrete PVL (FIG.
1C).
[0222] The inventors contemplated whether any contribution of PVL
to staphylococcal pneumonia may be masked by .alpha.-hemolysin,
which appears to play a dominant role in the pathogenesis of lung
infections. A lukS/F-PV lysogen of S. aureus Newman was generated
with bacteriophage .phi.Sa2mw (isolated from S. aureus MW2) (Baba
et al., 2002) (FIG. 3A). Insertion of .phi.Sa2mw into the
chromosome at nucleotide 1565379 of S. aureus Newman led to LukS-PV
and LukF-PV secretion (Kaneko et al., 1998) (FIG. 3B). Following
challenge of C57Bl/6J mice, the .phi.Sa2mw lysogen replicated with
equal efficiency in lung tissues, determined as colony forming
units (CFUs) within homogenized tissues of the right lung (FIG.
3C). No significant differences were observed for the overall
mortality of mice that suffered from S. aureus Newman wild-type or
Newman .phi.Sa2mw induced pneumonia (FIG. 3D), indicating that PVL
secretion via phage lysogeny does not increase staphylococcal
virulence during murine lung infection. Despite the presence of PVL
bacteriophage, insertional disruption of hla rendered S. aureus
Newman .phi.Sa2mw (hla::erm) avirulent for murine lung infection
(FIG. 3E).
[0223] S. aureus Newman was transformed with a plasmid encoding
lukS/F-PV (ppvl), promoting high levels of PVL expression (FIG.
4B). Nevertheless, no alteration in pneumonia-related mortality of
experimental animals was observed in infections with S. aureus
Newman harboring either vector alone or ppvl (FIG. 4A). Similarly,
recovery of staphylococci from the lungs of infected animals or
histopathologic evidence of disease was unaltered by expression of
PVL (data not shown). As previously reported, loss of hla
expression in S. aureus Newman (hla::erm) completely abrogated
staphylococcal virulence and mortality in the lung infection model
(Bubeck-Wardenburg et al., 2007), a defect that could not be
reversed by transformation with ppvl. In contrast, transformation
with phla, a plasmid that promotes expression of Hla, resulted in
complete and exaggerated restoration of the virulence phenotype
with 100% of animals succumbing to pneumonia by the 24 hour time
point (FIG. 4A). Immunoblot analysis provided an indication of the
levels of LukS-PV, LukF-PV, and .alpha.-hemolysin present in each
of these strains, simultaneously confirming that the indicated
genetic defects resulted in a corresponding absence of proteins of
interest (FIG. 4B). Thus, Hla, but not PVL, is an essential
virulence factor for the establishment of staphylococcal lung
disease in mice.
[0224] Hla-Specific Immune Responses.
[0225] To test whether Hla-specific immune responses impact the
pathogenesis of staphylococcal pneumonia, mice were immunized by
intra-muscular injection with either phosphate buffered saline
(PBS) or 20 .mu.g purified Hla.sub.H35L, a variant of
.alpha.-hemolysin with a single amino acid substitution that
prevents pore formation without affecting the binding of toxin to
host target cells (Gouaux et al., 1997). An average Hla.sub.H35L
specific antibody titer of 1:5,601 (.+-.2,789) was raised by
immunization. Upon challenge with S. aureus Newman, a significant
decrease in animal mortality was observed in Hla.sub.H35L immunized
animals (FIG. 5A). This decrease correlated with a reduction in S.
aureus colony forming units recovered from the lung at 24 hours
post-infection (FIG. 5B). Gross pathologic analysis of infected
lung tissues revealed only focal areas of consolidation in
Hla.sub.H35L-immunized animals, in contrast to the diffuse
consolidation observed in mock immunized animals (FIG. 5C). The
focal nature of disease in .alpha.-hemolysin immunized animals was
also evident in histopathologic sections of infected lung tissue.
Lesions in Hla.sub.H35L-immunized animals were discrete and,
importantly, surrounded by unaffected areas of lung (FIG. 5D).
Conversely, the majority of alveolar space in mock immunized
animals was obliterated. To examine the effect of .alpha.-hemolysin
vaccination on the pathogenesis of lung infections caused by
clinically relevant S. aureus isolates, Hla.sub.H35L-immunized
animals were infected with S. aureus LAC or S. aureus MW2. While
the absolute mortality caused by these strains differed from each
other, significant protection from mortality was achieved in all
groups of animals that were immunized with Hla.sub.H35L (FIG.
5E).
[0226] The inventors recognize the possibility that staphylococcal
infection of murine lungs may differ from that of humans. Indeed,
two S. aureus phage-encoded proteins, CHIPS and SCIN, appear to
modulate the human immune system in a species-specific manner
(Rooijakkers et al., 2005; Rooijakkers et al., 2006). To address a
possible contribution of PVL to injury of human lung tissue, the
inventors analyzed the cytotoxic effects of S. aureus clinical
isolates on human A549 alveolar epithelial cells, which were
previously utilized to examine the effect of purified
staphylococcal .alpha.-hemolysin or Group B streptococcal
.beta.-hemolysin on human pulmonary epithelia (Rooijakkers et al.,
2005; Rooijakkers et al., 2006) (FIG. 6). When infected with S.
aureus LAC and MW2, A549 injury was readily detected by the release
of lactate dehydrogenase (FIG. 6A). Disruption of the pvl locus did
not diminish the cytotoxic effects of S. aureus in either of these
isolates, a finding that is in agreement with the reported
specificity of PVL for granulocytes and mononuclear phagocytes
(Woodin, 1970; Meunier et al., 1995). In contrast, S. aureus Newman
variants lacking .alpha.-hemolysin were unable to destroy A549
cells, a defect that was complemented by phla and readily
visualized by microscopy of infected cells (FIG. 6B). The prominent
role of .alpha.-hemolysin in direct alveolar cell injury suggests
that neutralization of this toxin prevents cellular damage.
Addition of Hla antisera to A549 cells simultaneously infected with
S. aureus afforded protection from toxin injury (FIG. 6C), whereas
control serum had no effect (FIG. 6C). Treatment with purified
Hla.sub.H35L also protected A549 cells, in agreement with the
hypothesis that Hla.sub.H35L occupies .alpha.-hemolysin binding
sites on the surface of lung cells (FIG. 6C). Live/dead imaging of
human A549 cells was captured by fluorescence microscopy 4 hours
post-infection assessing A549 cells left uninfected or cocultured
with S. aureus Newman in media treated with phosphate buffered
saline (PBS, 1:1000), normal rabbit sera (NRS, 1:1000, anti-Hla
rabbit sera (.alpha.-Hla, 1:1000), or purified HlaH35L (10
.mu.g/ml). Infections were also carried out with the Newman
isogenic hla insertion mutant, hla::erm, transformed with vector or
plasmid containing the hla gene (phla). Results demonstrated that
S. aureus injury of human alveolar epithelial cells is reduced by
antagonism of .alpha.-hemolysin.
[0227] .alpha.-hemolysin specific antibodies can protect against
staphylococcal lung disease. To test whether .alpha.-hemolysin
specific antibodies can protect against staphylococcal lung
disease, experimental animals were passively immunized with either
normal rabbit sera or anti-Hla sera via intra-peritoneal injection
24 hours prior to challenge with S. aureus Newman [average
Hla.sub.H35L, specific antibody titer 1:480(.+-.179)](FIG. 7).
Examination of pneumonia-induced mortality revealed protection via
passive immunization with anti-Hla serum, but not with control
serum (FIG. 7A). This protection correlated with improvements in
gross (FIG. 7C) and histopathologic (FIG. 7D) features of disease.
Furthermore, significant decreases in colony forming units
recovered from the lungs of anti-Hla immunized animals were
observed (FIG. 7B). Passive immunoprotection was effective not only
in animals challenged with S. aureus Newman, but also in animals
infected with S. aureus LAC or MW2 (FIG. 7E). In contrast, passive
immunization with anti-PVL serum [average specific antibody titers
LukS-PV=1:894(.+-.80) and LukF-PV=1:3,689(.+-.186)] had no effect
on the outcome of staphylococcal pneumonia (FIG. 7F).
[0228] Pulmonary inflammation induced by a variety of infectious or
non-infectious stimuli results in enhanced IL-1.beta. secretion,
which not only facilitates the recruitment of immune cells to the
site of infection but also precipitates systemic inflammatory
responses and acute lung injury (Goodman et al., 2003). When
occurring in excess, IL-1.beta. secretion is certainly deleterious
to the host (Goodman et al., 2003). Cytokine profiles in the serum
of animals with staphylococcal lung infection revealed that passive
immunization with anti-Hla led to a significant reduction of serum
IL-1.beta. (FIG. 8). Furthermore, anti-Hla immunized animals
displayed a release of IFN-.gamma. (FIG. 8), a cytokine that
promotes phagocytic uptake and killing of staphylococci by innate
immune cells such as macrophages and neutrophils (Zhao et al.,
1998).
[0229] The ability of antibodies generated against S. aureus
.alpha.-hemolysin to protect against both cytolytic injury to
cultured human alveolar epithelial cells as well as invasive
disease in a murine model system suggested that monoclonal
antibodies against this toxin may be a useful therapeutic. To
facilitate this line of investigation, the inventors immunized mice
with recombinant Hla.sub.H35L protein and generated a battery of
anti-Hla secreting myeloma cells. Six hybridomas generated in
response to Hla.sub.H35L immunization tested positive in an
ELISA-based screen; two of these were expanded and demonstrated to
provide functional blockade of the activity of Hla (FIG. 9).
Consistent with previous observations, co-culture of S. aureus with
A549 cells in the presence of non-immune rabbit sera (NRS) did not
lead to cell protection; in contrast, treatment of the co-cultures
with rabbit anti-Hla afforded protection from lysis. Similarly,
purified monoclonal antibody from clones 7B8.35 (Accession Number
PTA-121360) and 1A9.4F9 (ATCC Accession Number PTA-121613)
conferred a statistically significant degree of protection against
Hla-induced A549 injury. In contrast, isotype control mouse
antibodies did not confer protection. These results were also
visualized by LIVE-DEAD staining of A549 cells that were either
uninfected or treated with each of the anti-Hla monoclonal
antibodies or their isotype-matched controls. To examine the
relative protection afforded by these two monoclonal antibodies, a
range of antibody concentrations from 2.5 mg/ml to 0.001 mg/ml were
evaluated for their ability to protect A549 cells upon coculture
with S. aureus Newman in a LDH release assay (FIG. 10). While
monoclonal 1A9.4F9 (ATCC Accession Number PTA-121613) clearly
affords protection against cellular injury, the protection derived
from this antibody is not as robust as that afforded by the 7B8.35
(Accession Number PTA-121360) monoclonal, perhaps suggesting that
the epitopes recognized by these monoclonal antibodies or their
affinity for .alpha.-hemolysin are distinct. The results of these
in vitro protection studies demonstrate that monoclonal antibodies
specific for Hla may afford protection from the cytolytic effects
of Hla in vivo during the course of S. aureus pneumonia.
[0230] To investigate this, the inventors examined these purified
mouse monoclonal antibodies for their ability to protect mice from
S. aureus pneumonia. Groups of 15 mice each received a 5 mg/kg dose
of either purified monoclonal antibody 7B8.35 (Accession Number
PTA-121360) (FIG. 11A) or 1A9.4F9 (ATCC Accession Number
PTA-121613) (FIG. 11B) in a 100 .mu.l total volume via
intraperitoneal route 24 hours prior to infection. Sham treated
mice received 100 .mu.l of PBS. Animals were infected with S.
aureus Newman according to protocols utilized in the above
described experiments, and mortality scored over 72 hours
post-infection. Passive immunization with each monoclonal antibody
conferred a statistically significant degree of protection from
mortality in this assay, which correlated with an improved overall
clinical appearance of the animals following infection. Similarly,
both 7B8.35 (Accession Number PTA-121360) and 1A9.4F9 (ATCC
Accession Number PTA-121613) were able to protect animals from
pneumonia-related mortality caused by USA300/LAC, the most
prevalent methicillin-resistant S. aureus isolate in the US at
present (FIG. 12). Consistent with the results the inventors
observed in the A549 assay, monoclonal 7B8.35 (Accession Number
PTA-121360) is more effective at protecting experimental animals
than 1A9.4F9 (ATCC Accession Number PTA-121613), as the latter only
conferred a statistically significant degree of protection at the
24 hour time point following infection. Previous studies have
demonstrated that the USA300/LAC isolate is highly virulent in this
animal model, secreting much more Hla than the Newman isolate
thereby causing a higher degree of mortality in experimental
animals than that seen upon infection with S. aureus Newman.
Coupling the above in vitro and in vivo data, these two mouse
monoclonal antibodies target Hla function to antagonize the toxin
and thereby protect from disease.
[0231] As the monoclonal antibodies demonstrate protection in vitro
in a cell culture model of lung injury and also protect animals
against S. aureus pneumonia, the inventors were interested in
determining the regions of the Hla molecule that the antibodies
target. The inventors contemplate that the knowledge of these
epitopes may prove instructive both in understanding how inhibition
of the toxin may occur from a structural standpoint, and
furthermore may be of benefit to the future design of therapeutic
compounds, other monoclonal antibodies, or perhaps also shed light
on isolated regions of the toxin that may be incorporated into
vaccine preparations for administration in active immunization
approaches. There may be a number of mechanisms by which a
monoclonal antibody may block the activity of Hla in vivo. First,
the antibody may bind to a region of the protein that obscures the
eukaryotic receptor binding site (which is presently unknown), thus
preventing a functional interaction of the monomer with the host
cell. Second, an antibody may prevent the assembly of the bound
monomers into the heptameric form on the cell surface by impairing
intermolecular interactions from taking place. Third, the antibody
may render the assembled heptamer unable to undergo the
conformational changes necessary to insert the stem into the
eukaryotic lipid bilayer and form a stable pore. The elegant
biochemical and structural analyses of Hla have provided insight
into the amino acid residues that contribute to host cell binding,
heptamer formation, and cellular lysis. Thus, defining the precise
antibody binding sites of each monoclonal antibody will very likely
yield insight into the mechanism by which it antagonizes the toxin.
In addition, such mapping may ultimately direct the assembly of an
effective combination of monoclonal antibodies, each of which binds
to a distinct epitope, into a passive immunotherapeutic. To permit
a rapid focusing of the epitope specificity of each humanized
monoclonal antibody to a segment of Hla, a series of seven
glutathione S-transferase (GST) fusion proteins were generated,
each of which represents overlapping segments of the toxin
approximately 50 amino acids in length.
[0232] Each truncated protein shares a 10 amino acid overlap with
both the previous and subsequent protein fragment (FIG. 13). These
fusion proteins were examined for reactivity with the 7B8 and 1A9
(ATCC Accession Number PTA-121613) monoclonal antibodies in a
dot-blot analysis technique. Briefly, 1 .mu.g of each fusion
protein was dotted onto a nitrocellulose membrane and allowed to
dry. One membrane panel was prepared for each of the two monoclonal
antibodies. The membranes were then blocked and a Western blot was
performed according to standard protocols using each monoclonal
antibody at a concentration of 0.2 .mu.g/ml. The blots were washed,
incubated with a secondary antibody, and monoclonal binding to the
fusion proteins was assessed by chemiluminescent development
techniques. Interestingly, both 7B8 and 1A9 (ATCC Accession Number
PTA-121613) bind to not only the full length fusion protein
(HlaH35L), but also bind exclusively to a fusion protein containing
amino acids 1-50 of the fully processed toxin (HlaA1-K50) (FIG.
14). Isotype matched control antibodies for 7B8 and 1A9 (IgG2a and
IgG2b, respectively) (ATCC Accession Number PTA-121613) did not
demonstrate binding to any of the fusion proteins, while polyclonal
rabbit sera generated against the toxin (.alpha.-Hla) recognizes
each segment of the protein as well as GST alone (the rabbit
antisera was raised against the full length GST-HlaH35L fusion).
The observation that two independently generated, protective
anti-Hla monoclonal antibodies recognize epitopes contained within
the first 50 amino acids of the mature, processed toxin strongly
suggest that these antibodies may have the capacity to disrupt
toxin function by prohibiting the assembly of a stable heptameric
pore.
[0233] In sum, active immunization with the Hla.sub.H35L vaccine as
well as passive immunization with Hla-specific antibodies generated
significant protection against staphylococcal lung infection in
relevant animal model. Thus, antibodies against .alpha.-hemolysin,
a virulence factor that is secreted by all S. aureus strains,
should also afford protection against staphylococcal lung disease
in humans.
REFERENCES
[0234] The following references, to the extent that they provide
exemplary procedural or other details supplementary to those set
forth herein, are specifically incorporated herein by reference.
[0235] U.S. Pat. No. 3,791,932 [0236] U.S. Pat. No. 3,949,064
[0237] U.S. Pat. No. 4,027,010 [0238] U.S. Pat. No. 4,174,384
[0239] U.S. Pat. No. 4,327,082 [0240] U.S. Pat. No. 4,338,298
[0241] U.S. Pat. No. 4,554,101 [0242] U.S. Pat. No. 4,578,770
[0243] U.S. Pat. No. 4,596,792 [0244] U.S. Pat. No. 4,599,230
[0245] U.S. Pat. No. 4,599,231 [0246] U.S. Pat. No. 4,601,903
[0247] U.S. Pat. No. 4,608,251 [0248] U.S. Pat. No. 4,684,611
[0249] U.S. Pat. No. 4,690,915 [0250] U.S. Pat. No. 4,748,018
[0251] U.S. Pat. No. 4,879,236 [0252] U.S. Pat. No. 4,952,500
[0253] U.S. Pat. No. 5,084,269 [0254] U.S. Pat. No. 5,199,942
[0255] U.S. Pat. No. 5,302,523 [0256] U.S. Pat. No. 5,322,783
[0257] U.S. Pat. No. 5,384,253 [0258] U.S. Pat. No. 5,464,765
[0259] U.S. Pat. No. 5,512,282 [0260] U.S. Pat. No. 5,538,877
[0261] U.S. Pat. No. 5,538,880 [0262] U.S. Pat. No. 5,548,066
[0263] U.S. Pat. No. 5,550,318 [0264] U.S. Pat. No. 5,563,055
[0265] U.S. Pat. No. 5,580,859 [0266] U.S. Pat. No. 5,589,466
[0267] U.S. Pat. No. 5,591,616 [0268] U.S. Pat. No. 5,610,042
[0269] U.S. Pat. No. 5,620,896 [0270] U.S. Pat. No. 5,656,610
[0271] U.S. Pat. No. 5,702,932 [0272] U.S. Pat. No. 5,736,524
[0273] U.S. Pat. No. 5,780,448 [0274] U.S. Pat. No. 5,789,215
[0275] U.S. Pat. No. 5,871,986 [0276] U.S. Pat. No. 5,945,100
[0277] U.S. Pat. No. 5,958,895 [0278] U.S. Pat. No. 5,981,274
[0279] U.S. Pat. No. 5,994,624 [0280] U.S. Pat. No. 6,651,655
[0281] U.S. Pat. No. 6,656,462 [0282] U.S. Pat. No. 6,733,754
[0283] U.S. Pat. No. 6,756,361 [0284] U.S. Pat. No. 6,770,278
[0285] U.S. Pat. No. 6,793,923 [0286] U.S. Pat. No. 6,814,971
[0287] U.S. Pat. No. 6,936,258 [0288] U.S. Pat. No. 7,262,050
[0289] Adams and Schier, J. Immunol. Methods, 231:249-260, 1999.
[0290] Adlam et al., Infect. Immun., 17(2):250-6, 1977. [0291] An,
J. Virol., 71(3) 2292-2302, 1997. [0292] Anavi, M. Sc. thesis from
the Department of Molecular Microbiology and Biotechnology of the
Tel-Aviv University 1998. [0293] Atwell et al., Protein Eng.,
12:597-604, 1999. [0294] Baba et al., Lancet., 359:1819-1827, 2002.
[0295] Bae et al., Mol. Microbiol., 62:1035-47, 2006. [0296] Bae et
al., Proc. Natl. Acad. Sci. USA, 101:12312-12317, 2004. [0297]
Barany and Merrifield, In: The Peptides, Gross and Meienhofer
(Eds.), Academic Press, NY, 1-284, 1979. [0298] Bhakdi and
Tranum-Jensen, Microbiol. Rev., 55:733-751, 1991. [0299] Bhakdi et
al. Behring Inst. Mitt., 95):80-4, 1994. [0300] Bird et al.,
Science, 242:423-426, 1988. [0301] Borrebaeck, In: Antibody
Engineering--A Practical Guide, W. H. Freeman and Co., 1992. [0302]
Bruggermann, et al., Immunol., 7:33, 1993. [0303] Bubeck-Wardenburg
and Schneewind, J Exp Med; 205(2); 287-294, 2008. [0304]
Bubeck-Wardenburg et al., Nature Medicine, 13(12):1405-1406, 2007.
[0305] Bubeck-Wardenburg et al., Infect. Immun., 74:1040-1044,
2007. [0306] Burke et al., J. Inf. Dis., 170:1110-1119, 1994.
[0307] Chambers, N. Engl. J. Med., 352:1485-1487, 2005. [0308] Chen
and Okayama, Mol. Cell Biol., 7(8):2745-2752, 1987. [0309] Chou and
Fasman, Adv. Enzymol., 47:45-148, 1978a. [0310] Chou and Fasman,
Annu. Rev. Biochem., 47:251-276, 1978b. [0311] Chou and Fasman,
Biochemistry, 13(2):211-222, 1974a. [0312] Chou and Fasman,
Biochemistry, 13(2):222-245, 1974b. [0313] Chou and Fasman,
Biophys. J., 26(3):385-399, 1979. [0314] Colcher et al., J. Nucl.
Med., 42:225-241, 1998. [0315] Devereux et al., Nucl. Acid Res.,
12(1):387-395, 1984. [0316] EP 0120694 [0317] EP 0125023 [0318]
EP-A-0 171496 [0319] EP-A-0 173494 [0320] EP-A-0239400 [0321]
Epitope Mapping Protocols, 1996 [0322] Fechheimer, et al., Proc
Natl. Acad. Sci. USA, 84:8463-8467, 1987. [0323] Fraley et al.,
Proc. Natl. Acad. Sci. USA, 76:3348-3352, 1979. [0324] Fridkin et
al., N. Engl. J. Med., 352:1436-1444, 2005. [0325] Goodman et al.,
Cytokine Growth Factor Rev., 14:523-535, 2003. [0326] Gopal, Mol.
Cell Biol., 5:1188-1190, 1985. [0327] Gouaux et al., Protein Sci.,
6:2631-2635, 1997. [0328] Graham and Van Der Eb, Virology,
52:456-467, 1973. [0329] Harland and Weintraub, J. Cell Biol.,
101(3):1094-1099, 1985. [0330] Harlow and Lane, In: Antibodies: A
Laboratory Manual, Cold Spring Harbor Laboratory, 1988. [0331]
Huston et al., Biochemistry, 27(25):8945-8952, 1988. [0332] Huston
et al., In: Methods in Enzymology, Langone (Ed.), Academic Press,
NY, 203:46-88, 1991. [0333] Jakobovits et al., Nature, 362:255-8,
1993. [0334] Jakobovits, et al., Proc. Natl. Acad. Sci. USA,
90:2551-5, 1993. [0335] Johnson et al., Methods in Enzymol.,
203:88-99, 1991. [0336] Johnstone et al., In: Immunochemistry in
Practice, Blackwell Scientific Publications, Oxford, 1982. [0337]
Jones et al., Nature, 321:522-525, 1986. [0338] Kaeppler et al.,
Plant Cell Reports, 9:415-418, 1990. [0339] Kaneda et al., Science,
243:375-378, 1989. [0340] Kaneko et al., Gene, 215:57-67, 1998.
[0341] Kato et al, J. Biol. Chem., 266:3361-3364, 1991. [0342] Kyte
and Doolittle, J. Mol. Biol., 157(1):105-132, 1982. [0343]
Labandeira-Rey et al., Science, 315:1130-1133, 2007. [0344] Lindsay
et al., J. Bacteriol., 188:669-676, 2006. [0345] McElroy et al.,
Infect. Immun., 67:5541-5544, 1999. [0346] Menestrina et al.,
Toxicon., 39:1661-1672, 2001. [0347] Menzies and Kemodle, Infect.
Immun., 64(5):1839-41, 1996. [0348] Memaugh et al., In: Molecular
Methods in Plant Pathology, Singh et al. (Eds.), CRC Press Inc.,
Boca Raton, Fla., 359-365, 1995. [0349] Merrifield, Science,
232(4748):341-347, 1986. [0350] Meunier et al., Cytometry,
21:241-247, 1995. [0351] Miller et al., N. Engl. J. Med.,
352:1445-53, 2005. [0352] Needleman & Wunsch, J. Mol. Biol.,
48:443, 1970. [0353] Nicolau and Sene, Biochim. Biophys. Acta,
721:185-190, 1982. [0354] Nicolau et al., Methods Enzymol.,
149:157-176, 1987. [0355] Omirulleh et al., Plant Mol. Biol.,
21(3):415-428, 1993. [0356] O'Reilly et al., Microb. Pathog.,
1:125-138, 1986. [0357] O'Reilly et al., Mol. Microbiol.,
4:1947-1955, 1990. [0358] Panton and Valentine, Lancet,
222:506-508, 1932. [0359] PCT Appln. WO 86/01533 [0360] PCT Appln.
WO 94/09699 [0361] PCT Appln. WO 95/06128 [0362] Pearson and
Lipman, Proc. Natl. Acad. Sci. USA, 85(8):2444-2448, 1988. [0363]
Potrykus et al., Mol. Gen. Genet., 199:183-188, 1985. [0364]
Remington's Pharmaceutical Sciences, 18th Ed. Mack Printing
Company, pp. 1289-1329, 1990. [0365] Riechmann et al., Nature,
332(6162):323-327, 1988. [0366] Rippe, et al., Mol. Cell Biol.,
10:689-695, 1990. [0367] Rooijakkers et al., Cell. Microbiol.,
8:1282-1293, 2006. [0368] Rooijakkers et al., Nat. Immunol., 6,
920-927, 2005. [0369] Rose et al., Am. J. Physiol. Lung Cell Mol.
Physiol., 282:L207-L214, 2002. [0370] Seeger et al., J. Clin.
Invest., 74, 849-858, 1984. [0371] Seeger et al., Lab. Invest.,
63:341-349, 1990. [0372] Smith & Waterman, Adv. Appl. Math.,
2:482, 1981. [0373] Song et al., Science, 274:1859-1866, 1996.
[0374] Stewart and Young, In: Solid Phase Peptide Synthesis, 2d.
ed., Pierce Chemical Co., 1984. [0375] Suttorp and Habben, Infect.
Immun., 56:2228-34, 1988. [0376] Tam et al., J. Am. Chem. Soc.,
105:6442, 1983. [0377] Thomson, J. Immunol. 157822-6 1996) [0378]
Tigges et al., J. Immunol., 156(10):3901-3910, 1996. [0379]
Vandenesch et al., Emerg. Infect. Dis., 9:978-984, 2003. [0380]
Verhoeyen et al., Science, 239(4847):1534-1536, 1988. [0381] Voyich
et al., J. Infect. Dis., 194:1761-1770, 2006. [0382] Walker and
Bailey, JBC, 270:23065-23071, 1995. [0383] Wong et al., Gene,
10:87-94, 1980. [0384] Woodin In: Microbial Toxins, Montje et al.
(Eds.), 327, Academic Press Inc., NY, 1970. [0385] Zhao et al.,
Immunology, 93:80-85, 1998.
Sequence CWU 1
1
141319PRTStaphylococcus aureusmisc_feature(234)..(234)Xaa can be
Glu or Asp 1Met Lys Thr Arg Ile Val Ser Ser Val Thr Thr Thr Leu Leu
Leu Gly 1 5 10 15 Ser Ile Leu Met Asn Pro Val Ala Asn Ala Ala Asp
Ser Asp Ile Asn 20 25 30 Ile Lys Thr Gly Thr Thr Asp Ile Gly Ser
Asn Thr Thr Val Lys Thr 35 40 45 Gly Asp Leu Val Thr Tyr Asp Lys
Glu Asn Gly Met His Lys Lys Val 50 55 60 Phe Tyr Ser Phe Ile Asp
Asp Lys Asn His Asn Lys Lys Leu Leu Val 65 70 75 80 Ile Arg Thr Lys
Gly Thr Ile Ala Gly Gln Tyr Arg Val Tyr Ser Glu 85 90 95 Glu Gly
Ala Asn Lys Ser Gly Leu Ala Trp Pro Ser Ala Phe Lys Val 100 105 110
Gln Leu Gln Leu Pro Asp Asn Glu Val Ala Gln Ile Ser Asp Tyr Tyr 115
120 125 Pro Arg Asn Ser Ile Asp Thr Lys Glu Tyr Met Ser Thr Leu Thr
Tyr 130 135 140 Gly Phe Asn Gly Asn Val Thr Gly Asp Asp Thr Gly Lys
Ile Gly Gly 145 150 155 160 Leu Ile Gly Ala Asn Val Ser Ile Gly His
Thr Leu Lys Tyr Val Gln 165 170 175 Pro Asp Phe Lys Thr Ile Leu Glu
Ser Pro Thr Asp Lys Lys Val Gly 180 185 190 Trp Lys Val Ile Phe Asn
Asn Met Val Asn Gln Asn Trp Gly Pro Tyr 195 200 205 Asp Arg Asp Ser
Trp Asn Pro Val Tyr Gly Asn Gln Leu Phe Met Lys 210 215 220 Thr Arg
Asn Gly Ser Met Lys Ala Ala Xaa Asn Phe Leu Asp Pro Asn 225 230 235
240 Lys Ala Ser Ser Leu Leu Ser Ser Gly Phe Ser Pro Asp Phe Ala Thr
245 250 255 Val Ile Thr Met Asp Arg Lys Ala Ser Lys Gln Gln Thr Asn
Ile Asp 260 265 270 Val Ile Tyr Glu Arg Val Arg Asp Asp Tyr Gln Leu
His Trp Thr Ser 275 280 285 Thr Asn Trp Lys Gly Thr Asn Thr Lys Asp
Lys Trp Xaa Asp Arg Ser 290 295 300 Ser Glu Arg Tyr Lys Ile Asp Trp
Glu Lys Glu Glu Met Thr Asn 305 310 315 2293PRTStaphylococcus
aureusmisc_feature(208)..(208)Xaa can be Glu or Asp 2Ala Asp Ser
Asp Ile Asn Ile Lys Thr Gly Thr Thr Asp Ile Gly Ser 1 5 10 15 Asn
Thr Thr Val Lys Thr Gly Asp Leu Val Thr Tyr Asp Lys Glu Asn 20 25
30 Gly Met His Lys Lys Val Phe Tyr Ser Phe Ile Asp Asp Lys Asn His
35 40 45 Asn Lys Lys Leu Leu Val Ile Arg Thr Lys Gly Thr Ile Ala
Gly Gln 50 55 60 Tyr Arg Val Tyr Ser Glu Glu Gly Ala Asn Lys Ser
Gly Leu Ala Trp 65 70 75 80 Pro Ser Ala Phe Lys Val Gln Leu Gln Leu
Pro Asp Asn Glu Val Ala 85 90 95 Gln Ile Ser Asp Tyr Tyr Pro Arg
Asn Ser Ile Asp Thr Lys Glu Tyr 100 105 110 Met Ser Thr Leu Thr Tyr
Gly Phe Asn Gly Asn Val Thr Gly Asp Asp 115 120 125 Thr Gly Lys Ile
Gly Gly Leu Ile Gly Ala Asn Val Ser Ile Gly His 130 135 140 Thr Leu
Lys Tyr Val Gln Pro Asp Phe Lys Thr Ile Leu Glu Ser Pro 145 150 155
160 Thr Asp Lys Lys Val Gly Trp Lys Val Ile Phe Asn Asn Met Val Asn
165 170 175 Gln Asn Trp Gly Pro Tyr Asp Arg Asp Ser Trp Asn Pro Val
Tyr Gly 180 185 190 Asn Gln Leu Phe Met Lys Thr Arg Asn Gly Ser Met
Lys Ala Ala Xaa 195 200 205 Asn Phe Leu Asp Pro Asn Lys Ala Ser Ser
Leu Leu Ser Ser Gly Phe 210 215 220 Ser Pro Asp Phe Ala Thr Val Ile
Thr Met Asp Arg Lys Ala Ser Lys 225 230 235 240 Gln Gln Thr Asn Ile
Asp Val Ile Tyr Glu Arg Val Arg Asp Asp Tyr 245 250 255 Gln Leu His
Trp Thr Ser Thr Asn Trp Lys Gly Thr Asn Thr Lys Asp 260 265 270 Lys
Trp Xaa Asp Arg Ser Ser Glu Arg Tyr Lys Ile Asp Trp Glu Lys 275 280
285 Glu Glu Met Thr Asn 290 320DNAArtificialSynthetic primer
3cctcctgttg atggaccact 20420DNAArtificialSynthetic primer
4ggcgctgagg tagtcaaaag 20528DNAArtificialSynthetic primer
5gcgggatccc ccctttcttg aattaaca 28630DNAArtificialSynthetic primer
6gcggaattca cattaatttg tcatttcttc 30730DNAArtificialSynthetic
primer 7gcgggatccg tatatgatga atcttaggca
30833DNAArtificialSynthetic primer 8gcggaattct gtttagctca
taggattttt ttc 33936DNAArtificialSynthetic primer 9gccggatccg
cagattctga tattaatatt aaaacc 361030DNAArtificialSynthetic primer
10gcggaattca cattaatttg tcatttcttc 301136DNAArtificialSynthetic
primer 11gccggatccg ctcaacatat cacacctgta agtgag
361233DNAArtificialSynthetic primer 12gcggaattct gtttagctca
taggattttt ttc 331336DNAArtificialSynthetic primer 13gccggatccg
ataacaatat tgagaatatt ggtgat 361436DNAArtificialSynthetic primer
14gccgaattct caattatgtc ctttcacttt aatttc 36
* * * * *