Organic Compositions To Treat Hsf1-related Diseases

Abstract

The present disclosure relates to methods of treating heat shock factor 1 (HSF1)-related diseases such as cancer, autoimmune and viral diseases, using a therapeutically effective amount of a RNAi agent to HSF.

Description

BACKGROUND OF THE INVENTION

[0001] HSF1 is the master regulator of the heat shock response, in which multiple genes are induced in response to temperature increase and other stresses. At non-shock temperatures in humans and other vertebrates, HSF1 is produced constitutively, but is inactive and bound by protein HSP90. At an elevated temperature, HSF1 is released by HSP90, moves from the cytoplasm to the nucleus, and trimerizes. This active HSF1 binds to sequences called heat shock elements (HSE) in DNA and activates transcription of heat shock genes by RNA polymerase II. The HSE has a consensus sequence of three repeats of NGAAN and is present in the promoter regions of the HSP90, HSP70 and HSP27 genes. During cessation of the heat shock response, HSF1 is phosphorylated by mitogen-activated protein kinases (MAPKs) and glycogen synthase kinase 3 (GSK3) and returns to an inactive state. The biochemistry of HSF1 is described, inter alia, in Chu et al. 1996 J. Biol. Chem. 271:30847-30857; Huang et al. 1997 J. Biol. Chem. 272:26009-26016; and Morimoto et al. 1998 Nat. Biotech. 16: 833-838.

[0002] HSF1 interacts with additional factors. HSF1 binds to DNA-dependent protein kinase (DNA-PK), which is involved in DNA repair. HSF1 is a target of mitogen-activated protein kinases, and its activity is down-regulated when the RAS signaling cascade is active.

[0003] Additional heat shock factor proteins in humans include HSF2, HSF3, and HSF4. HSF1, HSF2, and HSF3 are positive regulators of heat shock gene expression, while HSF4 is a negative regulator. HSF1, HSF2 and HSF4 play a role in transcriptional control of other heat shock proteins. The various HSF proteins share about 40% sequence identity.

[0004] HSF1 has been implicated in several diseases, including cancer, and autoimmune, and viral diseases. HSF1 and other heat shock proteins (whose expression is increased by HSF1) are over-expressed in, or have otherwise been implicated in, breast, endometrial, fibrosarcoma, gastric, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, prostate, skin, squamous cell, and testicular cancers, leukemia (e.g., promyelocytic leukemia), and Hodgkin's disease.

[0005] Without wishing to be bound by any particular theory, the present disclosure contemplates that heat shock proteins (HSP) may block the pathways of apoptosis and permit malignant cells to arise despite the triggering of apoptotic signals during transformation. HSP expression may also afford protection to cancer cells from treatments such as chemotherapy and hyperthermia by thwarting the pro-apoptotic influence of these modalities.

[0006] Because HSF1 positively regulates HSPs, a need exists for therapeutics that modulate HSF1.

BRIEF SUMMARY OF THE INVENTION

[0007] The present disclosure provides RNAi (RNA interference) agents, for inhibition of HSF1. HSF1 is the master regulator of the heat shock response, in which multiple genes are induced in response to temperature increase and other stresses.

[0008] HSF1 has been implicated in several HSF1-related diseases, including cancer, and autoimmune, and viral diseases. HSF1 and other heat shock proteins (whose expression is increased by HSF1) are over-expressed in, or have otherwise been implicated in, breast, endometrial, fibrosarcoma, gastric, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, prostate, skin, squamous cell, and testicular cancers, leukemia (e.g., promyelocytic leukemia), and Hodgkin's disease. RNAi agents to HSF1 are useful in treating these diseases.

[0009] Because HSF1 positively regulates HSPs, a need exists for therapeutics that modulate HSF1. The RNAi agents of the present disclosure are specific to HSF1 and can reduce expression of HSF1. These RNAi agents are therefore useful in treating cancer, and autoimmune, and viral diseases.

[0010] The present disclosure provides specific RNAi agents and methods that are useful in reducing HSF1 levels in a subject, e.g., a mammal, such as a human. The present disclosure specifically provides double-stranded RNAi agents for RNA interference-mediated inhibition of the HSF1 gene, comprising at least 15 or more contiguous nucleotides of HSF1. In particular, the present disclosure provides agents comprising sequences of 15 or more contiguous nucleotides differing by 0, 1, 2 or 3 from those of the RNAi agents provided, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). The RNAi agents particularly can in one embodiment comprise less than 30 nucleotides per strand, e.g., such as 18-23 nucleotides, and/or 19-21 nucleotides, and/or such as those provided, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T).

[0011] The double-stranded RNAi agents can have one or two blunt end(s) and/or overhang(s) of 1, 2, 3 or 4 nucleotides (i.e., 1-4 nt [nucleotides]) from one or both 3' and/or 5' ends. The double-stranded RNAi agents can also optionally comprise one or two 3' caps and/or one or more modified nucleotides. Modified variants of sequences as provided herein include those that are otherwise identical but contain substitutions of a naturally occurring nucleotide for a corresponding modified nucleotide. Seven modifications of each of several duplex nucleotide sequences are provided. Any RNAi agent sequence(s) provided herein can be used in combination with any modification(s) or set of modification(s), 5' and/or 3' end caps, blunt end(s), and/or additional overhang(s) on one or both 5' and/or 3' end(s), ligand(s), pharmaceutical carrier(s) or additional treatment(s), provided that such combinations are not mutually exclusive (e.g., a RNAi agent comprising two strands cannot by definition simultaneously have two blunt ends and two overhangs).

[0012] The RNAi agent can either contain only naturally-occurring ribonucleotide subunits, or one or more modifications to the sugar, phosphate or base of one or more of the replacement nucleotide subunits, whether they comprise ribonucleotide subunits or deoxyribonucleotide subunits. In one embodiment, modified variants of the disclosed RNAi agents include RNAi agents with the same sequence (e.g., the same sequence of bases), but with one or more modifications to one or more of the sugar or phosphate of one or more of the nucleotide subunits. In one embodiment, the modifications improve efficacy, stability and/or reduce immunogenicity of the RNAi agent. One aspect of the present disclosure relates to a double-stranded oligonucleotide comprising at least one non-natural nucleobase. In certain embodiments, the non-natural nucleobase is difluorotolyl, nitroindolyl, nitropyrrolyl, or nitroimidazolyl. In a particular embodiment, the non-natural nucleobase is difluorotolyl. In certain embodiments, only one of the two oligonucleotide strands contains a non-natural nucleobase. In certain embodiments, both of the oligonucleotide strands contain a non-natural nucleobase.

[0013] The RNAi agent(s) can optionally be attached to a ligand selected to improve one or more characteristic, such as, e.g., stability, distribution and/or cellular uptake of the agent, e.g., cholesterol or a derivative thereof. The RNAi agent(s) can be isolated or be part of a pharmaceutical composition used for the methods described herein. Particularly, the pharmaceutical composition can be formulated for delivery to the lungs or nasal passage or formulated for parental administration. The pharmaceutical compositions can optionally comprise two or more RNAi agents, each one directed to the same, overlapping or a different segment of the HSF1 mRNA. If the composition comprises two or more RNAi agents targeting the same sequence, the two or more RNAi agents can, for example, differ in modifications. Optionally, the pharmaceutical compositions can further comprise or be used in conjunction with any known treatment for any HSF1-related disease.

[0014] The present disclosure further provides methods for reducing the level of HSF1 mRNA in a cell, particularly in the case of a disease characterized by over-expression or hyper-activity of HSF1. The present disclosure also encompasses a method of treating a human subject having a pathological state mediated at least in part by HSF1 expression, over-expression or hyper-activity (e.g., increased or excessive activity), the method comprising the step of administering to the subject a therapeutically effective amount of a RNAi agent HSF1. Such methods comprise the step of administering one of the RNAi agents of the present disclosure to a subject, as further described below. The present methods utilize the cellular mechanisms involved in RNA interference to selectively degrade the target RNA in a cell and are comprised of the step of contacting a cell with one of the RNAi agents of the present disclosure. Such methods can be performed directly on a cell or can be performed on a mammalian subject by administering to a subject one of the RNAi agents/pharmaceutical compositions of the present disclosure. Reduction of target HSF1 mRNA in a cell results in a reduction in the amount of encoded HSF1 protein produced.

[0015] The methods and compositions of the present disclosure, e.g., the methods and HSF1 RNAi agent compositions, can be used with any dosage and/or formulation described herein, as well as with any route of administration described herein.

[0016] The details of one or more embodiments of the present disclosure are set forth in the accompanying drawings and the description below. Elements of the various embodiments (e.g., modifications, end caps, ligands, sequences, combinations of RNAi agents, etc.) which are not mutually exclusive can be combined with each other. Thus, the disclosure complements any composition comprising one or more HSF1 RNAi agent comprising a first strand and a second strand, wherein (1) (a) the sequence of the first strand comprises 15 contiguous nt differing by 0, 1, 2, or 3 nt from the sequence of the first strand of any RNAi agent disclosed herein; or (b) the sequence of the first strand comprises 15 contiguous nt of the sequence of the first strand of any RNAi agent disclosed herein; or (c) the sequence of the first strand comprises the sequence of the first strand of any RNAi agent disclosed herein; or (d) the sequence of the first strand is the sequence of the first strand of any RNAi agent disclosed herein; wherein (2) the RNAi agent can have any modification(s), blunt end(s), overhang(s), 5' end cap(s), 3' end cap(s), ligand(s) or any other variation or modification disclosed herein, or any combinations thereof, provided that such combinations are not mutually exclusive (e.g., a RNAi comprising two strands cannot by definition comprise both two overhangs and two blunt ends). Other features, objects, and advantages of the present disclosure will be apparent from this description, the drawings, Tables, sequences, Examples, abstract, and claims. For example, any RNAi agent sequence disclosed herein can be combined with any set of modifications or endcaps disclosed herein. Any combination of modifications, 5' end caps, and/or 3' end caps can be used with any RNAi agent sequence disclosed herein. Any RNAi agent disclosed herein (with any combination of modifications or endcaps or without either modifications or endcaps) can be combined with any other RNAi agent or other treatment composition or method disclosed herein.

BRIEF DESCRIPTION OF THE FIGURES

[0017] FIG. 1 illustrates various modified nucleotides: U002, U003, U004, U005, C004, C005, A004, A005, G005, and G004, which can be used in the RNAi agents disclosed herein.

[0018] FIGS. 2A to 2G show the activity of various HSF1 RNAi agents in HeLa cells in vitro, as detailed in Example 2A.

DETAILED DESCRIPTION OF THE INVENTION

[0019] The present disclosure encompasses RNAi agents to HSF1, which are useful in treatment of HSF1-related diseases (e.g., diseases associated with mutations in and/or altered expression, level and/or activity of HSF1, and/or diseases treatable by modulating the expression, level and/or activity of HSF1), such as cancer, and autoimmune, and viral diseases. The present disclosure also provides methods of treating a human subject having a pathological state mediated at least in part by HSF1 expression, the method comprising the step of administering to the subject a therapeutically effective amount of a RNAi agent HSF1.

Various Embodiments of the Disclosure Include the Following

[0020] In one embodiment, the present disclosure relates to a composition comprising an RNAi agent for RNA interference-mediated inhibition of the HSF1 gene, comprising an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected of any sequence provided herein (e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7 [or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of]). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 of any sequence provided herein (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a sense strand and an antisense strand, wherein the sense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the sense strand and the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 of any sequence provided herein (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 of any sequence provided herein (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and a second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 of any sequence provided herein (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T).

[0021] HSF1 RNAi agents are presented in the following Tables:

Table A1. SEQ ID NOs and positions of various HSF1 RNAi agents. Table 1. HSF1 RNAi agent target sequences. Table 2. Unmodified HSF1 RNAi agent sequences. Table 3. Example modified HSF1 RNAi agent sequences. Table 4. Sets of HSF1 RNAi agents comprising overlapping sequences. Table 5. Activity of HSF1 RNAi agents in vitro on GTL-16 cells. Table 6. Activity of HSF1 RNAi agents in vitro on SK-BR-3 cells. Table 7. Activity of HSF1 RNAi agents in vitro on GTL-16 and SK-BR-3 cells.

Various Embodiments of the Present Disclosure

[0022] In one embodiment, the present disclosure relates to particular compositions comprising an RNAi agent comprising an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected from any one or more of the sequences in Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 listed in any one or more of Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). In another embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a sense strand and an antisense strand, wherein the sense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the sense strand and the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 listed in any one or more of Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). Particular duplexes include those specific duplexes provided above and as listed in any one or more of Tables A1, 1, 2, 3, 4, 5, 6, or 7 (or, if DNA sequences are provided, the RNA equivalent of or RNA corresponding to these sequences, e.g., with RNA nucleotides rather than DNA, and U instead of T). Additional modified variants (e.g., variants comprising one or more modified base) of each of the compositions above are also contemplated as part of the disclosure. RNAi agents comprising a first strand and a second strand, wherein the first strand and/or the second strand comprises the sequence of the first and/or second strand of any RNAi agent to HSF1 listed herein are also contemplated. In various embodiments, the RNAi agent is for inhibition of the HSF1 gene.

[0023] Table A1, below, provides the SEQ ID NOs for the target and unmodified and example modified variants of the sense and an anti-sense strands of various RNAi agents to HSF1. The positions for each RNAi agent within the HSF1 gene are also provided in Table A1; the position within the HSF1 gene corresponds to the prefix of the nickname of the HSF1 RNAi agent.

[0024] The target sequence for various RNAi agents is provided in Table 1; the unmodified variant for the various RNAi agents is provided in Table 2; example modified variants for each specific RNAi agent are provided in Table 3; and overlapping portions of these RNAi agents are provided in Table 4. Activity levels for various RNAi agents are provided in Tables 5 to 7.

[0025] Note that the RNAi agents listed in the Tables herein comprise sets of duplexes, wherein each duplex within the set has a particular set of modifications. For example, all RNAi agents with the prefix hs_HSF1.sub.--175 have the same sequence (e.g., nucleotide sequence or sequence of bases), though hs_HSF1.sub.--175_A22_S26, hs_HSF1.sub.--175_A25_S27, hs_HSF1.sub.--175_A81_S26, hs_HSF1.sub.--175_A48_S26, hs_HSF1.sub.--175_A82_S36, hs_HSF1.sub.--175_A83_S36, and hs_HSF1.sub.--175_A84_S36 may have different sets of modifications.

[0026] Similarly:

[0027] All the RNAi agents with the prefix hs_HSF1.sub.--517 have the same nucleotide sequence, though they may have different modifications.

[0028] All the RNAi agents with the prefix hs_HSF1.sub.--562 have the same nucleotide sequence, though they may have different modifications.

[0029] All the RNAi agents with the prefix hs_HSF1.sub.--751 have the same nucleotide sequence, though they may have different modifications.

[0030] All the RNAi agents with the prefix hs_HSF1.sub.--755 have the same nucleotide sequence, though they may have different modifications.

[0031] All the RNAi agents with the prefix hs_HSF1.sub.--846 have the same nucleotide sequence, though they may have different modifications.

[0032] All the RNAi agents with the prefix hs_HSF1.sub.--1360 have the same nucleotide sequence, though they may have different modifications.

[0033] All the RNAi agents with the prefix hs_HSF1.sub.--2030 have the same nucleotide sequence, though they may have different modifications.

[0034] All the RNAi agents with the prefix hs_HSF1.sub.--2034 have the same nucleotide sequence, though they may have different modifications.

[0035] All the RNAi agents with the prefix hs_HSF1.sub.--2138 have the same nucleotide sequence, though they may have different modifications.

[0036] All the RNAi agents with the prefix hs_HSF1.sub.--2153 have the same nucleotide sequence, though they may have different modifications.

[0037] All the RNAi agents with the prefix hs_HSF1.sub.--2154 have the same nucleotide sequence, though they may have different modifications.

[0038] Particular duplexes include the following, wherein each duplex targets a sequence comprising a set of SEQ ID NOs, wherein the first SEQ ID NO corresponds to the first strand of the target (e.g., an antisense) and the second SEQ ID NO corresponds to the second strand of the target (e.g., a sense strand): hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs. 12 and 96); hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs. 24 and 108); hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs. 36 and 120); hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs. 48 and 132); hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs. 60 and 144); hs_HSF1.sub.--175 A83_S36 (SEQ ID NOs. 72 and 156); hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs. 84 and 168); hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs. 4 and 88); hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs. 16 and 100); hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs. 28 and 112); hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs. 40 and 124); hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs. 52 and 136); hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs. 64 and 148); hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs. 76 and 160); hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs. 1 and 85); hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs. 13 and 97); hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs. 25 and 109); hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs. 37 and 121); hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs. 49 and 133); hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs. 61 and 145); hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs. 73 and 157); hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs. 2 and 86); hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs. 14 and 98); hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs. 26 and 110); hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs. 38 and 122); hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs. 50 and 134); hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs. 62 and 146); hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs. 74 and 158); hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs. 3 and 87); hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs. 15 and 99); hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs. 27 and 111); hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs. 39 and 123); hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs. 51 and 135); hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs. 63 and 147); hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs. 75 and 159); hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs. 5 and 89); hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs. 17 and 101); hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs. 29 and 113); hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs. 41 and 125); hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs. 53 and 137); hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs. 65 and 149); hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs. 77 and 161); hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs. 6 and 90); hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs. 18 and 102); hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs. 30 and 114); hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs. 42 and 126); hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs. 54 and 138); hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs. 66 and 150); hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs. 78 and 162); hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs. 7 and 91); hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs. 19 and 103); hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs. 31 and 115); hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs. 43 and 127); hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs. 55 and 139); hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs. 67 and 151); hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs. 79 and 163); hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs. 8 and 92); hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs. 20 and 104); hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs. 32 and 116); hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs. 44 and 128); hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs. 56 and 140); hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs. 68 and 152); hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs. 80 and 164); hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs. 9 and 93); hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs. 21 and 105); hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs. 33 and 117); hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs. 45 and 129); hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs. 57 and 141); hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs. 69 and 153); hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs. 81 and 165); hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs. 10 and 94); hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs. 22 and 106); hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs. 34 and 118); hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs. 46 and 130); hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs. 58 and 142); hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs. 70 and 154); hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs. 82 and 166); hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs. 11 and 95); hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs. 23 and 107); hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs. 35 and 119); hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs. 47 and 131); hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs. 59 and 143); hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs. 71 and 155); hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs. 83 and 167).

[0039] Particular duplexes include the following wherein each duplex (e.g., RNAi agent) comprises a set of SEQ ID NOs, wherein the first SEQ ID NO corresponds to a first strand and the second SEQ ID NO corresponds to a second strand, wherein the sequences are not necessarily modified: hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs. 180 and 264); hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs. 192 and 276); hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs. 204 and 288); hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs. 216 and 300); hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs. 228 and 312); hs_HSF1.sub.--175_A83_S36 (SEQ ID NOs. 240 and 324); hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs. 252 and 336); hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs. 172 and 256); hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs. 184 and 268); hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs. 196 and 280); hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs. 208 and 292); hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs. 220 and 304); hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs. 232 and 316); hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs. 244 and 328); hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs. 169 and 253); hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs. 181 and 265); hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs. 193 and 277); hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs. 205 and 289); hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs. 217 and 301); hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs. 229 and 313); hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs. 241 and 325); hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs. 170 and 254); hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs. 182 and 266); hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs. 194 and 278); hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs. 206 and 290); hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs. 218 and 302); hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs. 230 and 314); hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs. 242 and 326); hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs. 171 and 255); hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs. 183 and 267); hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs. 195 and 279); hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs. 207 and 291); hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs. 219 and 303); hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs. 231 and 315); hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs. 243 and 327); hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs. 173 and 257); hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs. 185 and 269); hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs. 197 and 281); hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs. 209 and 293); hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs. 221 and 305); hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs. 233 and 317); hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs. 245 and 329); hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs. 174 and 258); hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs. 186 and 270); hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs. 198 and 282); hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs. 210 and 294); hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs. 222 and 306); hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs. 234 and 318); hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs. 246 and 330); hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs. 175 and 259); hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs. 187 and 271); hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs. 199 and 283); hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs. 211 and 295); hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs. 223 and 307); hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs. 235 and 319); hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs. 247 and 331); hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs. 176 and 260); hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs. 188 and 272); hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs. 200 and 284); hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs. 212 and 296); hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs. 224 and 308); hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs. 236 and 320); hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs. 248 and 332); hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs. 177 and 261); hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs. 189 and 273); hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs. 201 and 285); hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs. 213 and 297); hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs. 225 and 309); hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs. 237 and 321); hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs. 249 and 333); hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs. 178 and 262); hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs. 190 and 274); hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs. 202 and 286); hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs. 214 and 298); hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs. 226 and 310); hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs. 238 and 322); hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs. 250 and 334); hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs. 179 and 263); hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs. 191 and 275); hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs. 203 and 287); hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs. 215 and 299); hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs. 227 and 311); hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs. 239 and 323); and hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs. 251 and 335). In these various embodiments, the first strand and the second strand are the antisense and sense strand, respectively, or the second and the first strand are the antisense and sense strand, respectively. The disclosure also encompasses modified variants of these duplexes (e.g., duplexes with one or more modifications).

[0040] Particular duplexes include the following wherein each duplex (e.g., RNAi agent) comprises a set of SEQ ID NOs, wherein the first SEQ ID NO corresponds to a first strand and the second SEQ ID NO corresponds to a second strand, wherein the sequences ARE modified: hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs. 348 and 432); hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs. 360 and 444); hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs. 372 and 456); hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs. 384 and 468); hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs. 396 and 480); hs_HSF1.sub.--175_A83_S36 (SEQ ID NOs. 408 and 492); hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs. 420 and 504); hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs. 340 and 424); hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs. 352 and 436); hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs. 364 and 448); hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs. 376 and 460); hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs. 388 and 472); hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs. 400 and 484); hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs. 412 and 496); hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs. 337 and 421); hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs. 349 and 433); hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs. 361 and 445); hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs. 373 and 457); hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs. 385 and 469); hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs. 397 and 481); hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs. 409 and 493); hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs. 338 and 422); hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs. 350 and 434); hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs. 362 and 446); hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs. 374 and 458); hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs. 386 and 470); hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs. 398 and 482); hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs. 410 and 494); hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs. 339 and 423); hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs. 351 and 435); hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs. 363 and 447); hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs. 375 and 459); hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs. 387 and 471); hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs. 399 and 483); hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs. 411 and 495); hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs. 341 and 425); hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs. 353 and 437); hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs. 365 and 449); hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs. 377 and 461); hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs. 389 and 473); hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs. 401 and 485); hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs. 413 and 497); hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs. 342 and 426); hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs. 354 and 438); hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs. 366 and 450); hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs. 378 and 462); hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs. 390 and 474); hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs. 402 and 486); hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs. 414 and 498); hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs. 343 and 427); hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs. 355 and 439); hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs. 367 and 451); hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs. 379 and 463); hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs. 391 and 475); hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs. 403 and 487); hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs. 415 and 499); hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs. 344 and 428); hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs. 356 and 440); hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs. 368 and 452); hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs. 380 and 464); hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs. 392 and 476); hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs. 404 and 488); hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs. 416 and 500); hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs. 345 and 429); hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs. 357 and 441); hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs. 369 and 453); hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs. 381 and 465); hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs. 393 and 477); hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs. 405 and 489); hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs. 417 and 501); hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs. 346 and 430); hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs. 358 and 442); hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs. 370 and 454); hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs. 382 and 466); hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs. 394 and 478); hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs. 406 and 490); hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs. 418 and 502); hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs. 347 and 431); hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs. 359 and 443); hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs. 371 and 455); hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs. 383 and 467); hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs. 395 and 479); hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs. 407 and 491); and hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs. 419 and 503). In these various embodiments, the first strand and the second strand are the antisense and sense strand, respectively, or the second and the first strand are the antisense and sense strand, respectively. The disclosure also encompasses different modifications of these duplexes (e.g., duplexes with the same nucleotide sequence, but with different modifications).

[0041] In addition to the described example modifications, other modified variants can be made using the nucleotide sequences provided.

[0042] Provided in Table A1 are: Nickname for the sequence (wherein each sequence nickname begins with hs_HSF1_*, where * is the nickname provided in each row; e.g., "175_A22_S26" is the same as "hs_HSF1.sub.--175_A22_S26", etc.); target sequence (AS, antisense; and Sense strand); RNAi agent sequence provided as a sequence which is not modified (antisense and sense); RNAi agent sequence provided as an example modified variant (antisense and sense); and Position within the HSF1 gene. Note that at time duplexes are referred to by their position; e.g., "hs_HSF1.sub.--175" is sometimes referred to as simply HSF1-175; "hs_HSF1.sub.--517" is sometimes referred to as simply "HSF1-517," etc.

TABLE-US-00001 TABLE A1 SEQ ID NOs. for RNAi Agents to HSF1. RNAI AGENT (NOT TARGET MODIFIED) RNAI AGENT AS SENSE AS SENSE (MODIFIED) SEQ ID SEQ ID SEQ ID SEQ ID AS SENSE Nickname NO: NO: NO: NO: SEQ ID NO: SEQ ID NO: Position 175_A22_S26 12 96 180 264 348 432 175 175_A25_S27 24 108 192 276 360 444 175 175_A81_S26 36 120 204 288 372 456 175 175_A48_S26 48 132 216 300 384 468 175 175_A82_S36 60 144 228 312 396 480 175 175_A83_S36 72 156 240 324 408 492 175 175_A84_S36 84 168 252 336 420 504 175 517_A22_S26 4 88 172 256 340 424 517 517_A25_S27 16 100 184 268 352 436 517 517_A81_S26 28 112 196 280 364 448 517 517_A48_S26 40 124 208 292 376 460 517 517_A82_S36 52 136 220 304 388 472 517 517_A83_S36 64 148 232 316 400 484 517 517_A84_S36 76 160 244 328 412 496 517 562_A22_S26 1 85 169 253 337 421 562 562_A25_S27 13 97 181 265 349 433 562 562_A81_S26 25 109 193 277 361 445 562 562_A48_S26 37 121 205 289 373 457 562 562_A82_S36 49 133 217 301 385 469 562 562_A83_S36 61 145 229 313 397 481 562 562_A84_S36 73 157 241 325 409 493 562 751_A22_S26 2 86 170 254 338 422 751 751_A25_S27 14 98 182 266 350 434 751 751_A81_S26 26 110 194 278 362 446 751 751_A48_S26 38 122 206 290 374 458 751 751_A82_S36 50 134 218 302 386 470 751 751_A83_S36 62 146 230 314 398 482 751 751_A84_S36 74 158 242 326 410 494 751 755_A22_S26 3 87 171 255 339 423 755 755_A25_S27 15 99 183 267 351 435 755 755_A81_S26 27 111 195 279 363 447 755 755_A48_S26 39 123 207 291 375 459 755 755_A82_S36 51 135 219 303 387 471 755 755_A83_S36 63 147 231 315 399 483 755 755_A84_S36 75 159 243 327 411 495 755 846_A22_S26 5 89 173 257 341 425 846 846_A25_S27 17 101 185 269 353 437 846 846_A81_S26 29 113 197 281 365 449 846 846_A48_S26 41 125 209 293 377 461 846 846_A82_S36 53 137 221 305 389 473 846 846_A83_S36 65 149 233 317 401 485 846 846_A84_S36 77 161 245 329 413 497 846 1360_A22_S26 6 90 174 258 342 426 1360 1360_A25_S27 18 102 186 270 354 438 1360 1360_A81_S26 30 114 198 282 366 450 1360 1360_A48_S26 42 126 210 294 378 462 1360 1360_A82_S36 54 138 222 306 390 474 1360 1360_A83_S36 66 150 234 318 402 486 1360 1360_A84_S36 78 162 246 330 414 498 1360 2030_A22_S26 7 91 175 259 343 427 2030 2030_A25_S27 19 103 187 271 355 439 2030 2030_A81_S26 31 115 199 283 367 451 2030 2030_A48_S26 43 127 211 295 379 463 2030 2030_A82_S36 55 139 223 307 391 475 2030 2030_A83_S36 67 151 235 319 403 487 2030 2030_A84_S36 79 163 247 331 415 499 2030 2034_A22_S26 8 92 176 260 344 428 2034 2034_A25_S27 20 104 188 272 356 440 2034 2034_A81_S26 32 116 200 284 368 452 2034 2034_A48_S26 44 128 212 296 380 464 2034 2034_A82_S36 56 140 224 308 392 476 2034 2034_A83_S36 68 152 236 320 404 488 2034 2034_A84_S36 80 164 248 332 416 500 2034 2138_A22_S26 9 93 177 261 345 429 2138 2138_A25_S27 21 105 189 273 357 441 2138 2138_A81_S26 33 117 201 285 369 453 2138 2138_A48_S26 45 129 213 297 381 465 2138 2138_A82_S36 57 141 225 309 393 477 2138 2138_A83_S36 69 153 237 321 405 489 2138 2138_A84_S36 81 165 249 333 417 501 2138 2153_A22_S26 10 94 178 262 346 430 2153 2153_A25_S27 22 106 190 274 358 442 2153 2153_A81_S26 34 118 202 286 370 454 2153 2153_A48_S26 46 130 214 298 382 466 2153 2153_A82_S36 58 142 226 310 394 478 2153 2153_A83_S36 70 154 238 322 406 490 2153 2153_A84_S36 82 166 250 334 418 502 2153 2154_A22_S26 11 95 179 263 347 431 2154 2154_A25_S27 23 107 191 275 359 443 2154 2154_A81_S26 35 119 203 287 371 455 2154 2154_A48_S26 47 131 215 299 383 467 2154 2154_A82_S36 59 143 227 311 395 479 2154 2154_A83_S36 71 155 239 323 407 491 2154 2154_A84_S36 83 167 251 335 419 503 2154

[0043] Note that in some texts the nickname may contain an underscore after "hs". This underscore is insignificant; e.g., "hs_HSF1.sub.--562_A22_S26" is identical to "hsHSF1.sub.--562_A22_S26". Sequence nicknames may also appear with internal spaces ( ) after the underscores (_); these too are not significant. In addition, some RNAi agents to HSF1 have multiple designations. hs_HSF1.sub.--2138_ is also known as HSF1.sub.--2138, HSF1.sub.--2138 NBC, and HSF1.sub.--2120 ALNY. Similarly, other RNAi agents may have the "hs_" portion of the prefix deleted or an additional suffix "NBC" appended. RNAi agent hs_HSF1.sub.--562 is also known as HSF-544 or HSF-544-1. hs_HSF1.sub.--562 is also known as AD-20487-b1 and AD-30071; hs_HSF1.sub.--751 is also known as AD-20560-b1 and AD-37739; hs_HSF1.sub.--755 is also known as AD-20564 and AD-36971; and hs_HSF1.sub.--517_is also known as AD-20397-b1. The suffix "b" followed by a number indicates batch number; thus, "b1" indicates batch 1. However, note that the batch number does not affect the nucleotide sequence; e.g., AD-20397-b1 has the same nucleotide sequence as AD-20397.

[0044] An RNAi Agent Comprising an Antisense Strand of an RNAi Agent Described Herein.

[0045] In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected from those antisense strands in the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7.

[0046] Various particular specific embodiments of this embodiment are described below.

[0047] In one embodiment, the composition further comprises a second RNAi agent to HSF1. In various embodiments, the second RNAi agent is physically separate from the first, or the two are physically connected (e.g., covalently linked or otherwise conjugated). In various embodiments, the first and second RNAi agents are co-administered, or administered simultaneously or sequentially.

[0048] In one embodiment, the antisense strand is about 30 or fewer nucleotides in length.

[0049] In one embodiment, the antisense strand forms a duplex region with a sense strand, wherein the duplex region is about 15 to 30 nucleotide pairs in length.

[0050] In one embodiment, the antisense strand is about 15 to about 30 nucleotides in length, including about 19 to about 49, about 19 to about 30, about 19 to about 23 nucleotides in length. In one embodiment, the antisense strand has at least the length selected from about 15 nucleotides, about 16 nucleotides, about 17 nucleotides, about 18 nucleotides, about 19 nucleotides, about 20 nucleotides, about 21 nucleotides, about 22 nucleotides, about 23 nucleotides, about 24 nucleotides, about 25 nucleotides, about 26 nucleotides, about 27 nucleotides, about 28 nucleotides, about 29 nucleotides and 30 nucleotides.

[0051] In one embodiment, the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment, e.g., blood serum or intestinal lavage fluid.

[0052] In one embodiment, the RNAi agent comprises at least one sugar backbone modification (e.g., phosphorothioate linkage) or at least one 2'-modified nucleotide. In various embodiments, one, more than one, or all the pyrimidines are 2' O-methyl-modified nucleotides.

[0053] In one embodiment, the RNAi agent comprises: at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide. These dinucleotide motifs are particularly prone to serum nuclease degradation (e.g. RNase A). Chemical modification at the 2'-position of the first pyrimidine nucleotide in the motif prevents or slows down such cleavage. This modification recipe is also known under the term `endo light`.

[0054] In one embodiment, the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA). In one embodiment, all pyrimidines (uridine and cytidine) are 2' O-methyl-modified nucleosides.

[0055] In one embodiment, the RNAi agent comprises at least one blunt end.

[0056] In one embodiment, the RNAi agent comprises an overhang having 1 nt to 4 nt unpaired.

[0057] In one embodiment, the RNAi agent comprises an overhang at the 3'-end of the antisense strand of the RNAi agent.

[0058] In one embodiment, the RNAi agent is ligated to one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[0059] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 60% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0060] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 70% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0061] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 75% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0062] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 80% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0063] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 90% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0064] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 95% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0065] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 99% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0066] In one embodiment, the RNAi has an EC50 of no more than about 0.1 nM. EC50 is effective concentration to reduce gene expression by 50%.

[0067] In one embodiment, the RNAi has an EC50 of no more than about 0.01 nM.

[0068] In one embodiment, the RNAi has an EC50 of no more than about 0.001 nM.

[0069] An RNAi Agent Comprising a First and Second Strand of an RNAi Described Herein.

[0070] In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand comprises the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first and/or second strand further comprises 1 to 20 nt.

[0071] Various particular specific embodiments of these embodiments are described below.

[0072] In one embodiment, the composition comprises a second RNAi agent to HSF1. In various embodiments, the second RNAi agent is physically separate from the first, or the two are physically connected (e.g., chemically linked or otherwise conjugated). In various embodiments, the first and second RNAi agents are co-administered, or administered simultaneously or sequentially.

[0073] In one embodiment, the second strand is about 30 or fewer nucleotides in length.

[0074] In one embodiment, the first strand and the second strand form a duplex region about 15 to about 30 nucleotide pairs in length.

[0075] In one embodiment, the antisense strand is about 15 to about 30 nucleotides in length, including about 19 to about 49, about 19 to about 30, about 19 to about 23 nucleotides in length. In one embodiment, the antisense strand has at least the length selected from about 15 nucleotides, about 16 nucleotides, about 17 nucleotides, about 18 nucleotides, about 19 nucleotides, about 20 nucleotides, about 21 nucleotides, about 22 nucleotides, about 23 nucleotides, about 24 nucleotides, about 25 nucleotides, about 26 nucleotides, about 27 nucleotides, about 28 nucleotides, about 29 nucleotides and 30 nucleotides.

[0076] In one embodiment, the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment, e.g., blood serum or intestinal lavage fluid.

[0077] In one embodiment, the RNAi agent comprises at least one sugar backbone modification (e.g., phosphorothioate linkage) or at least one 2'-modified nucleotide. In various embodiments, one, more than one, or all the pyrimidines are 2' O-methyl-modified nucleotides.

[0078] In one embodiment, the RNAi agent comprises: at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[0079] In one embodiment, the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA). In one embodiment, all pyrimidines (uridine and cytidine) are 2' O-methyl-modified nucleosides.

[0080] In one embodiment, the RNAi agent comprises at least one blunt end.

[0081] In one embodiment, the RNAi agent comprises an overhang having 1 to 4 nt unpaired.

[0082] In one embodiment, the RNAi agent comprises an overhang at the 3'-end of the second strand of the RNAi agent.

[0083] In one embodiment, the RNAi agent is ligated to one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[0084] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 60% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0085] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 70% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0086] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 80% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0087] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 90% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0088] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 95% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0089] In one embodiment, the RNAi agent is capable of inhibiting expression of HSF1 by at least about 99% in HeLa, GTL-16, or SK-BR-3 cells in vitro, or Hep3B tumor cells in vitro.

[0090] In one embodiment, the RNAi has an EC50 of no more than about 0.1 nM.

[0091] In one embodiment, the RNAi has an EC50 of no more than about 0.01 nM.

[0092] In one embodiment, the RNAi has an EC50 of no more than about 0.001 nM.

[0093] Treatment Using an RNAi Agent Comprising a RNAi Agent Described Herein.

[0094] In one particular specific embodiment, the present disclosure relates to a method of treating a HSF1-related disease in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising an RNAi agent comprising an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected from those specific duplexes provided herein and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one embodiment of this method, the RNAi agent to HSF1 comprises an antisense strand duplexed with a sense strand, wherein the sense and antisense strands are selected from one or more of the sequences provided in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand comprises the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first and/or second strand further comprises 1 to 20 nt.

[0095] Various particular specific embodiments of these embodiments are described below.

[0096] In one embodiment, the HSF1-related disease is proliferative disease such as, e.g., a cancer, or is an autoimmune disease, or is a viral disease.

[0097] In one embodiment, the HSF1-related disease is cancer selected from the list of bladder, bone, breast, cervical, colon, colorectal, endometrial, fibrosarcoma, gastric, haematopoietic, intestine, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, osteosarcoma, ovary, pancreas, pleura, prostate, skin, squamous cell, stomach, and testicular cancers, leukemia, promyelocytic leukemia, and Hodgkin's disease.

[0098] In one embodiment, the method further comprises the step of administering an additional cancer treatment.

[0099] In one embodiment, the method further comprises the step of administering an additional cancer treatment selected from the list of actinomycin D, an inhibitor of HSP90 (heat shock protein 90), AUY922 (NVP-AUY922) (a HSP90 inhibitor), 17-AAG (tanespimycin), 17-DMAG (alvespimycin), IPI-504 (retaspimycin), IPI-493, SNX-5422 mesylate, AUY922, BIB021 CNF-2024, BIIB028, STA-9090, KW-2478, ATI3387, XL888, HSP990, MPC-3100, ABI-010 (as reviewed in Kim et al. 2009 Curr. Topics in Med. Chem. 9: 1479-1492), or 2-chlorodeoxyadenosine, 5-azacitidine, 5-fluoro-29-deoxyuridine, 5-fluorouracil, 6-mercaptopurine, 6-thioguanine, 7-hydroxystaurosporine, 13-cis-retinoic acid, a goserlin implant, alemtuzumab, alitretinoin, all-trans retinoic acid, alpha interferon, altretamine, amifostine, aminoglutethimide, anagrelide, anastrozole, arabinosylcytosine, arsenic trioxide, asparaginase, bacillus calmette-guerin, bendamustine, bevacizumab, bexarotene, bicalutamide, bleomycin, bortezomib, busulfan, camptothecin, capecitabine, carboplatin, carmustine, cetuximab, chlorambucil, cisplatin, cladribine, colcemid, Cycloheximide, cyclophosphamide, cytarabine, cytosine arabinoside (Ara-C), dacarbazine, dactinomycin, dasatinib, daunorubicin liposomal, daunorubicin, decitabine, denileukin diftitox, dexamethazone, docetaxel, doxorubicin, edelfosine, ehlorambucil, epipodophyllotoxin, epirubicin, erlotinib, estramustine, etoposide, everolimus, exemestane, fenretinide, finasteride, flavopiridol, floxuridine, fludarabine, fluorouracil, fluoxymesterone, flutamide, fulvestrant, gefitinib, gemeitabine, gemtuzumab ozogamicin, goserelin, hexamethylmelamine, hydrocortisone, hydroxyurea, ibritumomab tiuxetan, ibtritumomab, idarubicin, ifosfamide, imatinib, imidazole carboxamide, interleukin-11, interleukin-2, irinotecan, ixabepilone, lapatinib, L-asparaginase, lenalidomide, letrozole, leukovorin, leuprolide, mechlorethamine, megestrol, melphalan, mercaptopurine, methotrexate, methylprednisolone, mitixantrone, mitomycin, mitoxantrone, nelarabine, nitrogen mustard, octreotide, oxaliplatin, paclitaxel, paclitaxel-albumin formulations, paclitaxel-protein formulations, pamidronate, panitumumab, pemetrexed, pentostatin, phenylalanine mustard, pirubicin, prednisolone, prednisone, procarbazine, Puromycin, raloxifene, rituxan, rubidomycin, sargramostim, sorafenib, staurosporine, steroids, streptozocin, sunitinib, tamoxifen, Taxol, tegafur, temozolomide, temsirolimus, teniposide, thalidomide, thiophosphoamide, thiotepa, topotecan, toremifene, tositumomab, trastuzumab, tretinoin, UFT, vinblastine, vincristine, vinorelbine, vorinostat, and/or zoledronic acid. A RNAi agent to HSF1 can be used in conjunction with any additional treatment disclosed herein, as appropriate for the disease, optionally, in further conjunction with one or more additional RNAi agents to HSF1.

[0100] In one embodiment, the HSF1-related disease is a viral disease.

[0101] In one embodiment, the HSF1-related disease is a viral disease selected from the list of viral diseases mediated in whole or in part by adenovirus, herpes simplex virus, human cytomegalovirus, HTLV-1, SV40, polyoma virus, HIV, and/or Epstein-Barr virus.

[0102] In one embodiment, the method further comprises the step of administering an additional viral disease treatment.

[0103] In one embodiment, the method further comprises the step of administering an additional viral disease treatment selected from the list of Abacavir, Aciclovir, acyclovir (acycloguanosine), Adefovir, Amantadine, Ampligen, Amprenavir, Arbidol, Atazanavir, Atripla, bevirimat, Boceprevir, broad spectrum inhibitor, Cidofovir, Combivir, Darunavir, Delavirdine, Didanosine, Docosanol, Edoxudine, Efavirenz, Emtricitabine, Enfuvirtide, Entecavir, Entry inhibitors, Entry or fusion inhibitor, Famciclovir, Fomivirsen, Fosamprenavir, Foscarnet, Fosfonet, Fusion inhibitor, Ganciclovir, Ibacitabine, Idoxuridine, Imiquimod, Imunovir, Indinavir, Inosine, Integrase inhibitor, Integrase inhibitor, Interferon, Interferon type I, Interferon type II, Interferon type III, Lamivudine, Lopinavir, Loviride, Maraviroc, Maturation inhibitor, Moroxydine, Nelfinavir, Nevirapine, Nexavir, Non-nucleoside reverse transcriptase inhibitor, NOV-205, Nucleoside analogues, Nucleotide analog reverse transcriptase inhibitor, Oseltamivir (Tamiflu), Peginterferon alfa-2a, Penciclovir, Peramivir, Pleconaril, Podophyllotoxin, Protease inhibitor, Protease inhibitor, Raltegravir, Raltegravir, Reverse transcriptase inhibitor, Reverse transcriptase inhibitor, Ribavirin, Rimantadine, Ritonavir, Saquinavir, Saquinavir, Stavudine, Synergistic enhancer (antiretroviral), Tenofovir, Tenofovir disoproxil, Tipranavir, Trifluridine, Trizivir, Tromantadine, Truvada, Valaciclovir (Valtrex), Valganciclovir, Vicriviroc, Vidarabine, Viramidine, Zalcitabine, Zanamivir (Relenza), and Zidovudine. It will be understood that references to any additional treatment (e.g., viral disease treatment or cancer treatment or autoimmune disease treatment, etc.) are meant to also include the pharmaceutically acceptable salts of any of the active substances. If active substances comprised by components (a) and/or (b) have, for example, at least one basic center, they can form acid addition salts. Corresponding acid addition salts can also be formed having, if desired, an additionally present basic center. Active substances having an acid group, e.g., COOH, can form salts with bases. The active substances comprised in components (a) and/or (b) or a pharmaceutically acceptable salts thereof may also be used in form of a hydrate or include other solvents used for crystallization.

[0104] In one embodiment, the HSF1-related disease is an autoimmune disease.

[0105] In one embodiment, the HSF1-related disease is lupus or rheumatoid arthritis.

[0106] In one embodiment, the composition comprises a second RNAi agent to HSF1. In various embodiments, the second RNAi agent is physically distinct from the first, or the two are physically connected (e.g., linked or conjugated).

[0107] Inhibiting HSF1 Expression Using an RNAi Comprising an RNAi Agent.

[0108] In one particular specific embodiment, the present disclosure relates to a method of inhibiting the expression of HSF1 in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising an RNAi agent of the disclosure. In one embodiment of this method, the RNAi comprises a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected from those specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand comprises the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment of this method, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first and/or second strand further comprises 1 to 20 nt.

[0109] Various particular specific embodiments of these embodiments are described below.

[0110] In one embodiment, the individual is afflicted with or susceptible to an HSF1-related disease.

[0111] In one embodiment, the HSF1-related disease is proliferative disease, such as, e.g., a cancer.

[0112] In one embodiment, the HSF1-related disease is cancer selected from the list of bladder, bone, breast, cervical, colon, colorectal, endometrial, fibrosarcoma, gastric, haematopoietic, intestine, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, osteosarcoma, ovary, pancreas, pleura, prostate, skin, squamous cell, stomach, and testicular cancers, leukemia, promyelocytic leukemia, and Hodgkin's disease.

[0113] In one embodiment, the method further comprises the step of administering an additional cancer treatment.

[0114] In one embodiment, the method further comprises the step of administering an additional cancer treatment selected from the list of any cancer treatment listed herein, or known in the art.

[0115] In one embodiment, the HSF1-related disease is a viral disease.

[0116] In one embodiment, the HSF1-related disease is a viral disease selected from the list of viral diseases mediated in whole or in part by adenovirus, herpes simplex virus, human cytomegalovirus, HTLV-1, SV40, polyoma virus, HIV, and/or Epstein-Barr virus.

[0117] In one embodiment, the method further comprises the step of administering an additional viral disease treatment.

[0118] In one embodiment, the method further comprises the step of administering an additional viral disease treatment selected from the list of any viral disease treatment listed herein.

[0119] In one embodiment, the HSF1-related disease is an autoimmune disease.

[0120] In one embodiment, the HSF1-related disease is lupus or rheumatoid arthritis.

[0121] In one embodiment, the composition further comprises a second RNAi agent to HSF1. In various embodiments, the second RNAi agent is physically distinct from the first, or the two are physically connected (e.g., linked or conjugated).

[0122] Pharmaceutical Formulations of a RNAi Agent to HSF1.

[0123] In one particular specific embodiment, the present disclosure relates to a composition comprising a RNAi agent of the present disclosure. In one embodiment, the RNAi agent comprises at least an anti-sense strand, and/or comprises a sense and an anti-sense strand, wherein the anti-sense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the anti-sense strand of a RNAi agent to HSF1 selected from those specific duplex provided herein and as listed, e.g., in a Table herein, wherein the composition is in a pharmaceutically effective formulation. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand comprises the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first and/or second strand further comprises 1 to 20 nt.

[0124] In one embodiment, the present disclosure pertains to the use of a RNAi agent in the manufacture of a medicament for treatment of a HSF1-related disease, wherein the RNAi agent comprises a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent to HSF1 selected from those specific duplex provided herein and as listed, e.g., in a Table herein. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides from the first and second strand, respectively, of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand comprises the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first strand is the sequence of the first strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand comprises the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one particular specific embodiment, the present disclosure relates to a composition comprising an RNAi agent comprising a first strand and an second strand, wherein the sequence of the first and/or second strand is the sequence of the first and/or second strand of an RNAi agent to HSF1 selected from the specific duplexes provided above and as listed in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first and/or second strand further comprises 1 to 20 nt.

Other Embodiments

[0125] Various particular specific embodiments of this disclosure are described below.

[0126] In one embodiment, the disclosure pertains to a composition according to any of the above embodiments, for use in a method of treating a HSF1-related disease in an individual, the method comprising the step of administering to the individual a therapeutically effective amount of a composition according to any of the claims.

[0127] Various particular specific embodiments of this embodiment are described below.

[0128] In one embodiment, the disclosure pertains to the composition according to any of the above embodiments, for use in a method of inhibiting the expression of HSF1 in an individual, the method comprising the step of administering to the individual a therapeutically effective amount of a composition according to any of the above embodiments.

[0129] One embodiment of the disclosure is the use of a composition according to any of the above embodiments, in the manufacture of a medicament for treatment of an HSF1-related disease.

[0130] In one embodiment, the HSF1-related disease is selected from cancer, viral disease or autoimmune disease.

[0131] In one embodiment, the disclosure pertains to the composition of any of the above embodiments, for use in the treatment of an HSF1-related disease.

[0132] In one embodiment, the HSF1-related disease is selected from cancer, viral disease or autoimmune disease.

[0133] In one embodiment, the disclosure relates to a method of inhibiting the expression of HSF1 in an cell, comprising the step of introducing into the cell a composition comprising an RNAi agent comprising an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of an RNAi agent to HSF1 selected from the HSF1 siRNAs disclosed herein.

[0134] In one embodiment, the disclosure relates to a method of inhibiting the expression of HSF1 in an cell, comprising the step of introducing into the cell a composition comprising an RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand, and the sense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the sense strand of an RNAi agent to HSF1 selected from the HSF1 siRNAs disclosed herein.

DEFINITIONS

[0135] Heat Shock Factor 1 (HSF1).

[0136] By "HSF1" is meant the gene or mRNA or protein (or any nucleic acid encoding the protein) heat shock factor 1, or heat shock transcription factor 1 (HSTF1). HSF1 is the master regulator of the heat shock response, in which multiple genes are induced in response to temperature increase and other stresses. HSF1 has been designated HGNC ID HGNC:5224, on Chromosome 8q24.3. It (including homologues) is also identified as: GeneID: 3297; RefSeq IDs NM.sub.--005526; AccNo. M64673; Mouse Genome Database ID MGI:96238; Rat Genome Database ID RGD:620913; Entrez Gene ID 3297; CCDS IDs CCDS6419.1; Pubmed IDs 1871105; Ensembl ID ENSG00000185122; OMIM ID (NCBI) 140580; UCSC ID (UCSC) uc003zbt.2; and/or UniProt ID (mapped data supplied by UniProt) Q00613.

[0137] The amino acid sequence of human HSF1 is provided as SEQ ID NO: 505:

TABLE-US-00002 (SEQ ID NO: 505) MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVF DQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPER DDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLL TDVQLMKGKQECMDSKLLAMKHENEALWREVASLRQKHAQQQKVVNK LIQFLISLVQSNRILGVKRKIPLMLNDSGSAHSMPKYSRQFSLEHVH GSGPYSAPSPAYSSSSLYAPDAVASSGPIISDITELAPASPMASPGG SIDERPLSSSPLVRVKEEPPSPPQSPRVEEASPGRPSSVDTLLSPTA LIDSILRESEPAPASVTALTDARGHTDTEGRPPSPPPTSTPEKCLSV ACLDKNELSDHLDAMDSNLDNLQTMLSSHGFSVDTSALLDLFSPSVT VPDMSLPDLDSSLASIQELLSPQEPPRPPEAENSSPDSGKQLVHYTA QPLFLLDPGSVDTGSNDLPVLFELGEGSYFSEGDGFAEDPTISLLTG SEPPKAKDPTVS

[0138] The functional domains of HSF1 have been delineated by mutagenesis. A sequence near the N terminus forms the DNA binding domain (numbered approximately aa 13-121). Adjacent to this is a hydrophobic region comprising three "leucine zippers" that mediate monomerization and trimerization (numbered approximately aa 126-217). A fourth hydrophobic patch or leucine zipper lies at approximately aa 378-407; this region is involved in negative regulation under non-stress conditions. The central part of the molecule contains a region that regulates the activity of transcriptional activation domains in response to stress. Sequences within the regulatory domain undergo specific phosphorylation and dephosphorylation in response to stress. This regulatory domain, which is rich in serines and prolines, lies at approximately aa 221-310. The C-terminal portion of HSF1 contains the main transcriptional activation regions; this comprises the 100 most C-terminal amino acids, or aa 395-503, particularly aa 401-420. These domains are described in, inter alia, Green et al. 1995 Mol. Cell. Biol. 15: 3354-3362; and Shi et al. 1995 Mol. Cell. Biol. 15: 4309-4318, which references provide slightly different boundaries for the different regions. The HSF1 RNAi agent of the present disclosure can interact with a specific functional domain or domains of HSF1.

[0139] In various embodiments, the RNAi agents of the present disclosure specifically bind to HSF1 mRNA, in a sequence corresponding to a functional domain, e.g., in a sequence near the N terminus that forms the DNA binding domain; in the 4/3 hydrophobic repeat or "leucine zipper" that mediates trimerization; in the first, second, third or fourth leucine zipper; in the central part of the molecule that contains several elements that maintain HSF1 in its latent form, or that regulate the activity of transcriptional activation domains in response to stress; in sequences within the regulatory domain that undergo specific phosphorylation and dephosphorylation in response to stress; in the C-terminal portion of HSF1 that contains the main transcriptional activation regions; in the arrays of amphipathic alpha-helical residues in the amino-terminal domain of HSF family proteins that interact to form coiled coils; and/or in the fourth region of amphipathic alpha-helix in the carboxyl-terminal domain. In other embodiments, the RNAi agents of the present disclosure bind to the 5' or 3' UTR [untranslated region(s)].

[0140] In various embodiments, the RNAi agents of the present disclosure bind to HSF1 mRNA, but not in a sequence corresponding to a functional domain, e.g., not in a sequence near the N terminus that forms the DNA binding domain; not in the 4/3 hydrophobic repeat or "leucine zipper" that mediates trimerization; not in the first, second, third or fourth leucine zipper; not in the central part of the molecule that contains several elements that maintain HSF1 in its latent form, or that regulate the activity of transcriptional activation domains in response to stress; not in sequences within the regulatory domain that undergo specific phosphorylation and dephosphorylation in response to stress; not in the C-terminal portion of HSF1 that contains the main transcriptional activation regions; not in the arrays of amphipathic alpha-helical residues in the amino-terminal domain of HSF family proteins that interact to form coiled coils; not in the fourth region of amphipathic alpha-helix in the carboxyl-terminal domain; or not in the 5' or 3' UTRs. In another embodiment, the RNAi agents of the present disclosure bind to the HSF1 mRNA, but neither strand of the RNAi agent comprises the entirety of the sequence spanning nt 322 to 340 downstream of the gene transcription start site as described by Rossi et al. 2006 Cancer Res. 66:7678-7685.

[0141] HSF1-Related Diseases.

[0142] As used herein, the phrase a "HSF1-related disease" means one or more of the following: a proliferative disease, including, e.g., a cancer, wherein the cancer is selected from one or more of cancers of bladder, bone, breast, cervical, colon, colorectal, endometrial, fibrosarcoma, gastric, haematopoietic, intestine, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, osteosarcoma, ovary, pancreas, pleura, prostate, skin, squamous cell, stomach, and testicular cancers, leukemia, promyelocytic leukemia, and Hodgkin's disease; a viral disease, wherein the viral disease is selected from one or more of viral diseases mediated in whole or in part by adenovirus, herpes simplex virus, human cytomegalovirus, HTLV-1, SV40, polyoma virus, HIV, and/or Epstein-Barr virus; and an autoimmune disease, wherein the autoimmune disease is selected from one or more of lupus and a rheumatoid arthritis.

[0143] HSF1 has been implicated in several diseases, including cancer and viral diseases. HSF1 and other heat shock proteins (whose expression is increased by HSF1) are over-expressed in, or have otherwise been implicated in, bladder, bone, breast, cervical, colon, colorectal, endometrial, fibrosarcoma, gastric, haematopoietic, intestine, kidney, liver, lung, lymphoma, neuroectodermal, neuroblastoma, Ewing's sarcoma, osteosarcoma, ovary, pancreas, pleura, prostate, skin, squamous cell, stomach, and testicular cancers, leukemia (e.g., promyelocytic leukemia), and Hodgkin's disease. HSF1 is over-expressed in metastatic prostate carcinoma cell line PC-3M (as compared to the non-metastatic PC-3 line), and other prostate cancer cells.

[0144] The over-expression of HSF1 is correlated with an up-relation of heat shock protein HSP27. Hoang et al. 2000 Am. J. Pathol. 156: 857-864. HSP27 up-regulation is also associated with increased tumorigenicity and invasiveness of some cancers, including colon, breast, promyelocytic leukemia, testicular and prostate. HSF1 also plays a functional role in cancer cells under non-stress conditions; a dominant-negative HSF1 alters DNA content in PC-3 cell populations and inhibits aneuploidy. Wang et al. 2004 J. Biol. Chem. 279: 32651-32659. Many tumor types contain high concentrations of heat shock protein of the HSP27, HSP70, and HSP90 families, which are up-regulated by HSF1. Without wishing to be bound by any particular theory, applicants note that it has been suggested that heat shock proteins (HSP) may block the pathways of apoptosis and permit malignant cells to arise despite the triggering of apoptotic signals during transformation. HSP expression may also afford protection of cancer cells from treatments such as chemotherapy and hyperthermia by thwarting the pro-apoptotic influence of these modalities. Tang et al. 2005 Cell Stress Chaperones 10: 46-58 and references therein. Rossi et al. also showed that decreasing HSF1 levels increased the sensitivity of uterine cervix carcinoma cells to cisplatin associated with hyperthermia. Over-expression of heat shock proteins is also associated with protection of cancer cells against doxorubicin and hyperthermia and other anti-cancer treatments. Helmbrecht et al. 2000 Cell Prolif. 33: 341-365.

[0145] Over-expression of heat shock proteins is also associated with viral infections, including those mediated by adenovirus, herpes simplex virus, human cytomegalovirus, HTLV-1, SV40, polyoma virus, HIV, Epstein-Barr virus. High heat shock protein levels are also associated with autoimmune diseases, including lupus and rheumatoid arthritis. Inhibition of HSF1, e.g., via use of an anti-HSF1 RNAi agent, can thus be an effective treatment against cancer, and viral and other diseases. Few HSP inhibitors are known, but they include quercetin, a flavonoid that inhibits the HSF1. Zanini et al. 2007 J. Neurochem. 103:1344-354 and references therein. Quercetin can thus be used as a positive control for RNAi agents that inhibit HSF1 in treating a viral disease or cancer.

[0146] HSF1 Gene Sequences in Various Species.

[0147] The human HSF1 gene has been cloned. Rabindran et al. 1991 Proc. Natl. Acad. Sci USA 88: 6906-6910. Various sequences are available for human HSF1, including Genbank identifier NM.sub.--005526.2. The mouse (Mus musculus) HSF1 gene is, for example, Genbank id NM.sub.--008296.2. Another mouse HSF1 sequence is available as Acc. Number XM.sub.--128055 (as used in Yin et al. 2005 J. Mol. Cell. Card. 39: 681-689).

[0148] The Cynomolgus monkey ("Cyno", or Macaca fascicularis) HSF1 sequence (SEQ ID NO: 506), compared to the human sequence (SEQ ID NO: 513), is presented below:

TABLE-US-00003 human GCGGCGGGAGCGCGCCCGTTGCAAGATGGCGGCGGCCATGCTGGGCCCCGGGGCTGTGTG cyno ----------CGCGCCCGTTGCAAGATGGCGGCGGCAAAGCTGGGCCTTGGGGCTGGGGG ************************** * ******** ******* * * human TGCGCAGCGGGCGGCGGCGCGGCCCGGAAGGCTGGCGCGGCGACGGCGTTAGCCCGGCCC cyno GGCGCAGGGGGAGGCGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN ****** *** ***** Start-> human TCGGCCCCTCTTTGCGGCCGCTCCCTCCGCCTATTCCCTCCTTGCTCGAGATGGATCTGC cyno NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGAGATGGATCTGC ************** human CCGTGGGCCCCGGCGCGGCGGGGCCCAGCAAC-GTCCCGGCCTTCCTGACCAAGCTGTGG cyno CCGTGGGCCCCGGTGCGGCGGGGCCCAGCAANCGTCCCGGCCTTCCTGACCAAGCTGTGG ************* ***************** *************************** human ACCCTCGTGAGCGACCCGGACACCGACGCGCTCATCTGCTGGAGCCCGAGCGGGAACAGC cyno ACCCTCGTGAGCGACCCGGACACCGACGCGCTCATCTGCTGGAGCCCGAGTGGGAACAGC ************************************************** ********* human TTCCACGTGTTCGACCAGGGCCAGTTTGCCAAGGAGGTGCTGCCCAAGTACTTCAAGCAC cyno TTCCATGTGTTCGACCAGGGCCAGTTTGCCAAGGAGGTGCTGCCCAAGTATTTCAAGCAC ***** ******************************************** ********* human AACAACATGGCCAGCTTCGTGCGGCAGCTCAACATGTATGGCTTCCGGAAAGTGGTCCAC cyno AACAACATGGCCAGCTTCGTGCGGCAGCTCAACATGTATGGTTTCCGGAAAGTGGTCCAC ***************************************** ****************** human ATCGAGCAGGGCGGCCTGGTCAAGCCAGAGAGAGACGACACGGAGTTCCAGCACCCATGC cyno ATCGAGCAGGGTGGCCTGGTCAAGCCAGAGAGAGACGACACGGAGTTCCAGCACCCGTGC *********** ******************************************** *** human TTCCTGCGTGGCCAGGAGCAGCTCCTTGAGAACATCAA-GAGGAAAGTGACCAGTGTGTC cyno TTCCTGCGCGGCCAGGAGCAGCTCCTTGAGAACATCANAGAGGAAAGTGACCAGTGTGTC ******** **************************** ********************* human CACCCTGAAGAGTGAAGACATAAAGATCCGCCAGGACAGCGTCACCAAGCTGCTGACGGA cyno CACCCTGAAGAGTGAAGACATAAAGATCCGTCAGGACAGTGTCACCAAGCTGCTGACGGA ****************************** ******** ******************** human CGTGCAGCTGATGAAGGGGAAGCAGGAGTGCATGGACTCCAAGCTCCTGGCCATGAAGCA cyno CGTGCAGCTGATGAAGGGGAAGCAGGAGTGCATGGACTCCAAGCTCCTGGCCATGAAGCA ************************************************************ human TGAGAATGAGGCTCTGTGGCGGGAGGTGGCCAGCCTTCGGCAGAAGCATGCCCAGCAACA cyno TGAGAATGAGGCTCTGTGGCGGGAGGTGGCCAGCCTTCGGCAGAAGCATGCCCAGCAACA ************************************************************ human GAAAGTCGTCAACAAGCTCATTCAGTTCCTGATCTCACTGGTGCAGTCAAACCGGATCCT cyno GAAAGTCGTCAACAAGCTCATTCAGTTCCTGATCTCACTGGTGCAGTCAAACCGGATCCT ************************************************************ human GGGGGTGAAGAGAAAGATCCCCCTGATGCTGAACGACAGTGGCTCAGCACATTCCATGCC cyno GGGGGTGAAGAGAAAGATCCCCCTGATGCTGAACGACAGTGGCTCAGCACATTCCATGCC ************************************************************ human CAAGTATAGCCGGCAGTTCTCCCTGGAGCACGTCCACGGCTCGGGCCCCTACTCGGCCCC cyno CAAGTATGGCCGGCAGTTCTCCCTGGAGCACGTCCACGGCTCGGGCCCCTACTCGGCCCC ******* **************************************************** human CTCCCCAGCCTACAGCAGCTCCAGCCTCTACGCCCCTGATGCTGTGGCCAGCTCTGGACC cyno CTCCCCAGCCTACAGTAGCTCCAGCCTCTACGCCCCCGATTCTGTGGCCAACTCCGGACC *************** ******************** *** ********* *** ***** human CATCATCTCCGACATCACCGAGCTGGCTCCTGCCAGCCCCATGGCCTCCCCCGGCGGGAG cyno CATCATCTCCGACATCACCGAGCTGGCTCCTGCCAGCCCCGTGGCCTCCCCTGGCGGGAG **************************************** ********** ******** human CATAGACGAGAGGCCCCTATCCAGCAGCCCCCTGGTGCGTGTCAAGGAGGAGCCCCCCAG cyno CATAGACGAGAGGCCCCTGTCTAGCAGCCCCCTGGTGCGTGTCAAAGAGGAGCCCCCCAG ****************** ** *********************** ************** human CCCGCCTCAGAGCCCCCGGGTAGAGGAGGCGAGTCCCGGGCGCCCATCTTCCGTGGACAC cyno CCCGCCTCAGAGCCCCCGGGTAGAGGAGGCGAGTCCCGGGCGCCCATCTTCCGTGGACAC ************************************************************ human CCTCTTGTCCCCGACCGCCCTCATTGACTCCATCCTGCGGGAGAGTGAACCTGCCCCCGC cyno CCTCTTGTCCCCGACCGCCCTCATTGACTCCATCCTGCGGGAGAGTGAACCTACCCCCGC **************************************************** ******* human CTCCGTCACAGCCCTCACGGACGCCAGGGGCCACACGGACACCGAGGGCCGGCCTCCCTC cyno CTCCGCCACAGCCCTCACCGATGCCAGGGGCCACACGGACACCGAGGGCCGGCCTCCCTC ***** ************ ** ************************************** human CCCCCCGCCCACCTCCACCCCTGAAAAGTGCCTCAGCGTAGCCTGCCTGGACAAGAATGA cyno ACCCCCGCCCACCTCCACCCCTGAAAAGTGCCTCAGCGTAGCCTGCCTGGACAAGAATGA *********************************************************** human GCTCAGTGACCACTTGGATGCTATGGACTCCAACCTGGATAACCTGCAGACCATGCTGAG cyno GCTCAGTGATCACTTGGATGCTATGGACTCCAACCTGGACAACCTGCAGACCATGCTGAG ********* ***************************** ******************** human CAGCCACGGCTTCAGCGTGGACACCAGTGCCCTGCTGGACCTGTTCAGCCCCTCGGTGAC cyno CAGCCACGGCTTCAGCGTGGACACCAGCGCCCTGCTGGACCTGTTCAGCCCCTCGGTGAC *************************** ******************************** human CGTGCCCGACATGAGCCTGCCTGACCTTGACAGCAGCCTGGCCAGTATCCAAGAGCTCCT cyno CGTGCCCGACATGAGCCTGCCTGACCTTGACAGCAGCCTGGCTAGTATCCAAGAGCTCCT ****************************************** ***************** human GTCTCCCCAGGAGCCCCCCAGGCCTCCCGAGGCAGAGAACAGCAGCCCGGATTCAGGGAA cyno GTCTCCCCAGGAGCCCTCCAGGCCTCCCGAGGCAGAGAACAGCAGCCCGGATTCAGGGAA **************** ******************************************* human GCAGCTGGTGCACTACACAGCGCAGCCGCTGTTCCTGCTGGACCCCGGCTCCGTGGACAC cyno GCAGCTGGTGCACTACACAGCACAGCCACTGTTCCTGCTCGACCCCGGCTCCGTGGGCAC ********************* ***** *********** **************** *** human CGGGAGCAACGACCTGCCGGTGCTGTTTGAGCTGGGAGAGGGCTCCTACTTCTCCGAAGG cyno CGGGAGCAGCGACTTGCCGGTGCTGTTTGAGCTGGGGGAGGGCTCCTACTTCTCCGAAGG ******** **** ********************** *********************** human GGACGGCTTCGCCGAGGACCCCACCATCTCCCTGCTGACAGGCTCGGAGCCTCCCAAAGC cyno GGACGGCTTCGCAGAGGACCCCACCATCTCCCTGCTGACAGGCTCAGAGCCTCCCAAAGC ************ ******************************** ************** STOP human CAAGGACCCCACTGTCTCCTAGAGGCCCCGGAGGAGCTGGGCCAGCCGCCCACCCCCACC cyno CAAGGACCCCACTGTCTCCTAGGCGCCCGGGAGGAGCTGGGCCAGCCGCCCACCCCCACC ********************** **** ******************************* human CCCAGTGCAGGGCTGGTCTTGGGGAGGCAG-GGCAGCCTCGCGGTCTTGGGCACTGGTGG cyno CCCAGTGCAGGGCTGGCCTTGGGGAGGAAGAGGCAGCCTCGAGGTCCTGGGCACTGGTGG **************** ********** ** ********** **** ************* human GTCGGCCGCCATAGCCCCAGTAGGACAAAC--GGGCTCGGGTCTGGGCAGCACCTCTGGT cyno GTTGGCCACCACAGCCCCAGTAGGACAAACAGGGGCTCAGGTCTGGGCAGCACCTCTGGT ** **** *** ****************** ****** ********************* human CAGGAGGGTCACCCTGGCCTGCCAGTCTGCCTTCCCCCAACCCCGTGTCCTGTGGTTTGG cyno CAGGAGGGTCACCCCGGCCTCCCAGTCTGCCTTCCCCCAACCCCGTGTCCTGTGGTTTGG ************** ***** *************************************** human TTGGGGCTTCACAGCCACACCTGGACTGACCCTGCAGGTTGTTCATAGTCAGAATTGTAT cyno TTGGGGCTTCGTAGCCACACCTGGACTGACCCTGCAGGTTGTTCATAATCAGAATTGTAT ********** *********************************** ************ human TTTGGATTTTTACACAACTGTCCCGTTCCCCGCTCCACAGAGATACACAGATATATACAC cyno TTTGGATTTTTACACAACTGTCCCATTCCCTGTTCCATAGAGATATACAGATATATACAC ************************ ***** * **** ******* ************** human ACAG-TGGATGGACGGACAAGACAGGCAGAGATCTATAAACAGACAGGCTCTATGCTAAA cyno ACAGGTGGATGGACGGACAAGACAGGCAGAGATCTATAAACAGACAG------------- **** ****************************************** human AAAAAAAAAAAA (SEQ ID NO: 513) cyno ------------ (SEQ ID NO: 506)

[0149] The start (ATG) and stop (TAG) of the human HSF1 sequence and putative start and stop of the cyno HSF1 sequence are indicated in bold underlined. N indicates that the nucleotide was not determined at that position in the sequencing experiment. Nucleotides matching between the human and cyno sequences are marked with an asterisk (*).

[0150] In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence which is identical in the human, rat, mouse and cyno HSF1 gene. This sequence identity facilitates animal testing prior to human testing. In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence which is identical in the human, mouse and cyno HSF1 gene. In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence which is identical in the human and cyno HSF1 gene. In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence which is identical in the human and rat HSF1 gene. In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence which is identical in the human and mouse HSF1 gene.

Additional Embodiments of a RNAi Agent to HSF1

[0151] In one embodiment, the HSF1 RNAi agent comprises a sequence which does not match that of any other gene. In one embodiment, the HSF1 RNAi agent comprises a sequence which differs from all other known non-HSF1 genes by at least 0, 1, 2 or 3 nucleotides.

[0152] In one embodiment, the HSF1 RNAi agent comprises a sequence which is identical to that in HSF2, HSF3 or HSF4. In one embodiment, the HSF1 RNAi agent comprises a sequence which is not identical to any in HSF2, HSF3 or HSF4.

[0153] HSF1 RNAi Agent for Use in Treating Various HSF1-Related Diseases

[0154] In one embodiment, the HSF1 RNAi agent of the present disclosure comprises a sequence disclosed herein and is administered to a patient in need thereof (e.g., a patient suffering from cancer and/or a viral disease and/or autoimmune disease and/or HSF1-related disease). In one embodiment, the HSF1 RNAi agent of the present disclosure is administered to a patient in need thereof, along with one or more additional pharmaceutical agent appropriate for that disease. For example, a patient suffering from cancer can be administered a pharmacologically effective amount of one or more HSF1 RNAi agent along with a pharmacologically effective amount of one or more of any cancer treatment listed herein, and/or any other cancer treatment known in the art.

[0155] A patient suffering from a viral disease can be administered one or more RNAi agent to HSF1 and one or more additional viral disease treatment. This additional treatment can be selected from the list of any viral disease treatment listed herein, and/or any anti-viral known in the art.

[0156] The patient can also be administered more than one RNAi agent to HSF1.

[0157] In the case of cancer, and autoimmune and viral diseases, the RNAi agent(s) and additional disease treatment(s) can be administered in any order, simultaneously or sequentially, or in multiple doses over time. Administration of the RNAi agent and the additional treatment can be, for example, simultaneous, concurrent, separate or sequential.

[0158] In at least some cases, knockdown of HSF1 by itself may not have anti-tumor effects. However, knockdown of HSF1 may be able to sensitize cancer cells (e.g., liver cancer cells or melanoma cells) to HSP90 inhibitors. In other words, a HSF1 RNAi agent may not inhibit cell proliferation, but may synergize cancer cells to apoptosis with one or more HSP90 inhibitors. These HSP90 inhibitors include, as non-limiting examples, actinomycin D and AUY922 (also known as NVP-AUY922). See, for example, Jensen et al. 2008 Breast Cancer Res. 10(2): R33; Gaspar et al. 2010 Mol. Cancer Ther. 9: 1219-1233; Okui et al. 2011 Anticancer Res. 31: 1194-204; and Eccles et al. Cancer Res. 68: 2850-2860. In some embodiments, the disease treatment regimen includes both at least one RNAi agent to HSF1 and AUY922, wherein the administration of these agents in simultaneous, sequential, or separate.

[0159] Simultaneous administration may, e.g., take place in the form of one fixed combination with two or more active ingredients, or by simultaneously administering two or more active ingredients that are formulated independently. Sequential use (administration) preferably means administration of one (or more) components of a combination at one time point, other components at a different time point, that is, in a chronically staggered manner, preferably such that the combination shows more efficiency than the single compounds administered independently (especially showing synergism). Separate use (administration) preferably means administration of the components of the combination independently of each other at different time points, preferably meaning that the components (a) and (b) are administered such that no overlap of significant measurable blood levels of both compounds are present in an overlapping manner (at the same time).

[0160] Also combinations of two or more of sequential, separate and simultaneous administration are possible, preferably such that the combination component-drugs show a joint therapeutic effect that exceeds the effect found when the combination component-drugs are used independently at time intervals so large that no mutual effect on their therapeutic efficiency can be found, a synergistic effect being especially preferred.

[0161] The term "delay of progression" as used herein means administration of the combination to patients being in a pre-stage or in an early phase, of the first manifestation or a relapse of the disease to be treated, in which patients, e.g., a pre-form of the corresponding disease is diagnosed or which patients are in a condition, e.g., during a medical treatment or a condition resulting from an accident, under which it is likely that a corresponding disease will develop.

[0162] "Jointly therapeutically active" or "joint therapeutic effect" means that the compounds may be given separately (in a chronically staggered manner, especially a sequence-specific manner) in such time intervals that they preferably, in the warm-blooded animal, especially human, to be treated, still show a (preferably synergistic) interaction (joint therapeutic effect). Whether this is the case, can inter alia be determined by following the blood levels, showing that both compounds are present in the blood of the human to be treated at least during certain time intervals.

ADDITIONAL DEFINITIONS

[0163] For convenience, the meaning of certain terms and phrases used in the specification, examples, and appended claims, are provided below. If there is an apparent discrepancy between the usage of a term in other parts of this specification and its definition provided in this document, the definition in this document shall prevail.

[0164] As used throughout this disclosure, articles such as "a" and "an" refer to one or more than one (at least one) of the grammatical object of the article.

[0165] RNAi Agent

[0166] In one embodiment, the present disclosure pertains to a HSF1 RNAi agent or other composition comprising at least one nucleic acid sequence complementary to a HSF1 nucleic acid (or portion thereof), or pertains to a recombinant expression vector encoding at least one strand of the siRNA (RNAi agent) or a composition comprising the antisense nucleic acid that can function as an RNAi agent as defined below. As used herein, an "antisense" nucleic acid comprises a nucleotide sequence complementary to a "sense" nucleic acid encoding the HSF1 protein (e.g., complementary to the coding strand of a double-stranded DNA, complementary to an mRNA or complementary to the coding strand of a HSF1 gene or nucleic acid).

[0167] As used herein, the term "RNAi agent," "RNAi agent to HSF1", "RNAi agent specific to HSF1", "iRNA agent to HSF1", "siRNA to HSF1", "HSF1 siRNA" and the like refer to an siRNA (short inhibitory RNA), shRNA (short or small hairpin RNA), iRNA (interference RNA) agent, RNAi (RNA interference) agent, dsRNA (double-stranded RNA), microRNA, and the like, and/or refer to a composition which specifically targets, is specific to, and/or specifically binds to the HSF1 mRNA or a portion thereof. As used herein, the term "antisense nucleic acid" or "composition comprising an anti-sense nucleic acid" and the like is broadly meant to encompass any composition comprising at least one nucleic acid strand which is anti-sense to its target; this includes, but is not limited to, any siRNA, shRNA, iRNA, dsRNA, microRNA, antisense oligonucleotide, and any other composition comprising an anti-sense nucleic acid. As used herein, the terms "iRNA" and "RNAi" refers to an agent that contains RNA (or a derivative thereof), and which mediates the targeted cleavage of another RNA transcript via an RNA-induced silencing complex (RISC) pathway. In one embodiment, the RNAi agent is an oligonucleotide composition that activates the RISC complex/pathway. In another embodiment, the RNAi agent comprises an antisense strand sequence (antisense oligonucleotide). In one embodiment, the RNAi comprises a single strand. This single-stranded RNAi agent oligonucleotide or polynucleotide can comprise the sense or antisense strand, as described by Sioud 2005 J. Mol. Biol. 348:1079-1090, and references therein. Thus the disclosure encompasses RNAi agents with a single strand comprising either the sense or antisense strand of an RNAi agent described herein. It should also be clear that a single or double-stranded RNA molecule or strand (e.g., a siRNA, shRNA, dsRNA, microRNA, etc., or either or both strand thereof) can comprise one or more nucleotides which are not RNA. For example, a siRNA, shRNA, dsRNA, microRNA, etc., or either or both strand thereof, or the like, can comprise one or two or more terminal or internal nucleotides which are DNA. For example, a siRNA can comprise a terminal dinucleotide TT which is DNA. In no case does the present disclosure contemplate a molecule in which both strands are fully DNA (e.g., a double-stranded DNA molecule). In another non-limiting example, a siRNA can comprise one or two or a few other nucleotides which are DNA instead of RNA. In addition, the present disclosure contemplates a functional equivalent of a siRNA which is a molecule comprising any sequence disclosed herein, but wherein the components are not RNA and/or DNA nucleotides but rather PNA, LNA, TNA, GNA, FANA, or other nucleic acid substitutes.

[0168] RNA interference (RNAi) is a post-transcriptional, targeted gene-silencing technique that uses double-stranded RNA (dsRNA) to degrade messenger RNA (mRNA) containing the same sequence as the dsRNA. The process of RNAi occurs when ribonuclease III (Dicer) cleaves the longer dsRNA into shorter fragments called siRNAs. siRNAs (small interfering RNAs) are typically produced by Dicer to be about 21 to 23 nucleotides long and comprise about 19 base pair duplexes (though artificial RNAi agents can be shorter and/or blunt-ended). The smaller RNA segments then mediate the degradation of the target mRNA. Dicer has also been implicated in the excision of 21- and 22-nucleotide small temporal RNAs (stRNAs) from precursor RNA of conserved structure that are implicated in translational control. Hutvagner et al. 2001, Science, 293, 834. The RNAi response also features an endonuclease complex, commonly referred to as an RNA-induced silencing complex (RISC), which mediates cleavage of single-stranded mRNA complementary to the antisense strand of the siRNA. Cleavage of the target RNA takes place in the middle of the region complementary to the antisense strand of the siRNA duplex.

[0169] Kits for RNAi synthesis are commercially available, e.g., from New England Biolabs and Ambion.

[0170] The RNAi agent(s) of the present disclosure target (e.g., bind to, anneal to, etc.) the HSF1 mRNA. The use of the RNAi agent to HSF1 results in a decrease of HSF1 activity, level and/or expression, e.g., a "knock-down" or "knock-out" of the target gene or target sequence. Particularly, in one embodiment, in the case of a disease state characterized by over-expression or hyper-activity of HSF1, administration of a RNAi agent to HSF1 knocks down the HSF1 target enough to restore a normal level of HSF1 activity.

[0171] A suitable RNAi agent can be selected by any process known in the art or conceivable by one of ordinary skill in the art. For example, the selection criteria can include one or more of the following steps: initial analysis of the HSF1 gene sequence and design of RNAi agents; this design can take into consideration sequence similarity across species (human, cynomolgus, mouse, etc.) and dissimilarity to other (non-HSF1) genes; screening of RNAi agents in vitro (e.g., at 10 nM in WI-38 cells); determination of EC50 in HeLa cells; determination of viability of WI-38, HeLa and GTL16 cells treated with RNAi agents, wherein it is desired that the RNAi agent to HSF1 not inhibit the viability of these cells; testing with human PBMC (peripheral blood mononuclear cells), e.g., to test levels of TNF-alpha to estimate immunogenicity, wherein immunostimulatory sequences are less desired; testing in human whole blood assay, wherein fresh human blood is treated with an RNAi agent and cytokine/chemokine levels are determined [e.g., TNF-alpha (tumor necrosis factor-alpha) and/or MCP1 (monocyte chemotactic protein 1)], wherein Immunostimulatory sequences are less desired; determination of gene knockdown in vivo using Hep3B subcutaneous tumors in test animals; HSF1 target gene modulation analysis, e.g., using a pharmacodynamic (PD) marker, for example, HSP70 or HSP27, wherein HSF1 knockdown leads to a dose-dependent reduction of HSP70 and HSP27 expression in A375 cells; and optimization of specific modifications of the RNAi agents.

[0172] Targets and Sequences.

[0173] As used herein, "target sequence" or "target gene" refer to a contiguous portion of the nucleotide sequence of an mRNA molecule formed during the transcription of a gene, e.g., a HSF1 gene, including mRNA that is a product of RNA processing of a primary transcription product. The target portion of the sequence will be at least long enough to serve as a substrate for iRNA-directed cleavage at or near that portion. For example, the target sequence will generally be from about 9-36 nucleotides ("nt") in length, e.g., about 15-30 nucleotides in length, including all sub-ranges therebetween. As non-limiting examples, the target sequence can be from about 15-30 nt, about 15-26 nt, about 15-23 nt, about 15-22 nt, about 15-21 nt, about 15-20 nt, about 15-19 nt, about 15-18 nt, about 15-17 nt, about 18-30 nt, about 18-26 nt, about 18-23 nt, about 18-22 nt, about 18-21 nt, about 18-20 nt, about 19-30 nt, about 19-26 nt, about 19-23 nt, about 19-22 nt, about 19-21 nt, about 19-20 nt, about 20-30 nt, about 20-26 nt, about 20-25 nt, about 20-24 nt, about 20-23 nt, about 20-22 nt, about 20-21 nt, about 21-30 nt, about 21-26 nt, about 21-25 nt, about 21-24 nt, about 21-23 nt, or about 21-22 nt.

[0174] As used herein, the term "strand comprising a sequence" refers to an oligonucleotide comprising a chain of nucleotides that is described by the sequence referred to using the standard nucleotide nomenclature.

[0175] As used herein, and unless otherwise indicated, the term "complementary" refers to the ability of an oligonucleotide or polynucleotide comprising a first nucleotide sequence to hybridize and form a duplex structure under certain conditions with an oligonucleotide or polynucleotide comprising a second nucleotide sequence. Such conditions can, for example, be stringent, e.g., 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 50.degree. C. or 70.degree. C. for 12-16 hours followed by washing. Other conditions, such as physiologically relevant conditions as may be encountered inside an organism, can apply. The skilled person will be able to determine the set of conditions most appropriate for a test of complementarity of two sequences in accordance with the ultimate application of the hybridized nucleotides. The present disclosure contemplates any RNAi agent comprising a first and a second strand wherein the first and/or second strand are complementary to any sequence disclosed herein (e.g., the first and/or second strand are anti-parallel to and have or comprise a sequence of bases which hydrogen bind to the sequence of bases of any sequence disclosed herein). It is also noted that RNA sequences are complementary to any DNA sequence disclosed herein.

[0176] Complementary sequences within an iRNA, e.g., within a dsRNA as described herein, include base-pairing of the oligonucleotide or polynucleotide comprising a first nucleotide sequence to an oligonucleotide or polynucleotide comprising a second nucleotide sequence over the entire length of one or both sequences. Such sequences can be referred to as "fully complementary" with respect to each other herein. However, where a first sequence is referred to herein as "substantially complementary" with respect to a second sequence, the two sequences can be fully complementary, or they may form one or more, but generally not more than 5, 4, 3 or 2 mismatched base pairs upon hybridization for a duplex up to 30 base pairs, while retaining the ability to hybridize under the conditions most relevant to their ultimate application, e g, inhibition of gene expression via a RISC pathway. However, where two oligonucleotides are designed to form, upon hybridization, one or more single stranded overhangs, such overhangs shall not be regarded as mismatches with regard to the determination of complementarity. For example, a dsRNA comprising one oligonucleotide 21 nt in length and another oligonucleotide 23 nt in length, wherein the longer oligonucleotide comprises a sequence of 21 nt that is fully complementary to the shorter oligonucleotide, may yet be referred to as "fully complementary" for the purposes herein.

[0177] "Complementary" sequences, as used herein, may also include, or be formed entirely from, non-Watson-Crick base pairs and/or base pairs formed from non-natural and modified nucleotides, in as far as the above requirements with respect to their ability to hybridize are fulfilled. Such non-Watson-Crick base pairs includes, but are not limited to, G:U Wobble or Hoogstein base pairing.

[0178] The terms "complementary," "fully complementary" and "substantially complementary" herein may be used with respect to the base matching between the sense strand and the antisense strand of a dsRNA, or between the antisense strand of an RNAi agent and a target sequence, as will be understood from the context of their use.

[0179] As used herein, a polynucleotide that is "substantially complementary to at least part of" a messenger RNA (mRNA) refers to a polynucleotide that is substantially complementary to a contiguous portion of the mRNA of interest (e.g., an mRNA encoding HSF1). For example, a polynucleotide is complementary to at least a part of a HSF1 mRNA if the sequence is substantially complementary to a non-interrupted portion of an mRNA encoding HSF1.

[0180] In various embodiments, one or both strands are nicked.

[0181] In one embodiment, the RNAi agent comprises a single strand (such as an shRNA, as described herein). In one embodiment, the RNAi agent comprises a single strand, the sequence of which comprises the sequences of both the sense and antisense strand (or first and second strand) of any RNAi agent disclosed herein.

[0182] In one embodiment, a single-stranded RNAi agent oligonucleotide or polynucleotide can comprise the sense and/or antisense strand. See, e.g., Sioud 2005 J. Mol. Biol. 348:1079-1090, and references cited therein. Thus the present disclosure encompasses RNAi agents with a single strand comprising either the sense or antisense strand of a RNAi agent described herein.

[0183] siRNAs that are particularly useful for this disclosure include those which can bind specifically to a region of the HSF1 mRNA, and have one or more of the following qualities: binding in the coding segment of HSF1; binding at or near the junction of the 5' untranslated region and the start of the coding segment; binding at or near the translational start site of the mRNA; binding at, across or near junctions of exons and introns; little or no binding to the mRNAs or transcripts of other genes (little or no "off-target effects"); binding to the HSF1 mRNA in or near a region or regions that is not double-stranded or a stem region, e.g., in a loop or single-stranded portion; eliciting little or no immunogenicity; binding in a segment of the HSF1 mRNA sequence which is conserved among various animal species (including human, mouse, rat, cyno, etc.), as the presence of a conserved sequence facilitates testing using various laboratory animals; binding to double-stranded region(s) of the mRNA; binding to an AT-rich region (e.g., at least about 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60% AT-rich); and/or lacking particular sequences known or suspected to decrease siRNA activity, e.g., the presence of a GG sequence at the 5' end, which may decrease separation of the double-stranded portion of the siRNA. In one embodiment, the RNAi agent specific to HSF1 can be a double-stranded RNA having any one or more of these qualities.

[0184] Double-Stranded RNA.

[0185] The term "double-stranded RNA" or "dsRNA," as used herein, refers to an RNAi agent comprising a first and a second strand; e.g., a composition that includes an RNA molecule or complex of molecules having a hybridized duplex region that comprises two anti-parallel and substantially complementary nucleic acid strands, which will be referred to as having "sense" and "antisense" orientations with respect to a target RNA. The antisense strand, with respect to the mRNA target, is also called the "guide" strand, and the sense strand is also called the "passenger" strand. The passenger strand can include at least one or more of the following: one or more extra nucleotides (e.g., a bulge or 1 nt loop) compared to the other strand, a nick, a gap, etc., compared to the other strand. In various embodiments, the first strand is the sense strand and the second strand is the anti-sense strand. In other embodiments, the first strand is the anti-sense strand, and the second strand is the sense strand.

[0186] The duplex region can be of any length that permits specific degradation of a desired target RNA through a RISC pathway, but will typically range from 9 to 36 base pairs ("bp") in length, e.g., 15-30 base pairs in length. Considering a duplex between 9 and 36 base pairs, the duplex can be any length in this range, for example, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, or 36 bp and any sub-range therebetween, including, but not limited to 15-30 base pairs, 15-26 bp, 15-23 bp, 15-22 bp, 15-21 bp, 15-20 bp, 15-19 bp, 15-18 bp, 15-17 bp, 18-30 bp, 18-26 bp, 18-23 bp, 18-22 bp, 18-21 bp, 18-20 bp, 19-30 bp, 19-26 bp, 19-23 bp, 19-22 bp, 19-21 bp, 19-20 bp, 19 bp, 20-30 bp, 20-26 bp, 20-25 bp, 20-24 bp, 20-23 bp, 20-22 bp, 20-21 bp, 20 bp, 21-30 bp, 21-26 bp, 21-25 bp, 21-24 bp, 21-23 bp, 21-22 bp, 21 bp, 22 bp, or 23 bp. The dsRNAs generated in the cell by processing with Dicer and similar enzymes are generally in the range of about 19 to about 22 base pairs in length (although artificial RNAi agents can be shorter or longer and/or blunt-ended or have modification(s), 5' and/or 3' endcap(s), and/or other variations). One strand of the duplex region of a dsRNA comprises a sequence that is substantially complementary to a region of a target RNA. The two strands forming the duplex structure can be from a single RNA molecule having at least one self-complementary duplex region, or can be formed from two or more separate RNA molecules that hybridize to form the duplex. Where the duplex region is formed from two self-complementary regions of a single molecule, the molecule can have a duplex region separated by a single stranded chain of nucleotides (herein referred to as a "hairpin loop", e.g., such as found in an shRNA construct) between the 3'-end of one strand and the 5'-end of the respective other strand forming the duplex structure. The hairpin loop can comprise at least one unpaired nucleotide; in some embodiments the hairpin loop can comprise at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 20, at least 23 or more unpaired nucleotides. Where the two substantially complementary strands of a dsRNA are comprised by separate RNA molecules, those molecules need not, but can be covalently connected. Where the two strands are connected covalently by a hairpin loop, the construct is generally referred to herein and in the art as a "shRNA". Where the two strands are connected covalently by means other than a hairpin loop, the connecting structure is referred to as a "linker." The term "siRNA" is also used herein to refer to a dsRNA as described above.

[0187] In one aspect, an RNA interference agent includes a single stranded RNA that interacts with a target RNA sequence to direct the cleavage of the target RNA. Without wishing to be bound by theory, the present disclosure contemplates that long double stranded RNA introduced into plants and invertebrate cells is broken down into siRNA by a Type III endonuclease known as Dicer (Sharp et al., Genes Dev. 2001, 15:485). Dicer, a ribonuclease-III-like enzyme, processes the dsRNA into 19-23 base pair short interfering RNAs with characteristic two base 3' overhangs (Bernstein, et al., (2001) Nature 409:363). The siRNAs are then incorporated into an RNA-induced silencing complex (RISC) where one or more helicases unwind the siRNA duplex, enabling the complementary antisense strand to guide target recognition (Nykanen, et al., (2001) Cell 107:309). Upon binding to the appropriate target mRNA, one or more endonucleases within the RISC cleaves the target to induce silencing (Elbashir, et al., (2001) Genes Dev. 15:188). Thus, in one aspect the disclosure relates to a single stranded RNA that promotes the formation of a RISC complex to effect silencing of the target gene.

[0188] Down-Regulation of HSF1.

[0189] As used herein, "down-regulates" refers to any statistically significant decrease in a biological activity and/or expression of HSF1, including full blocking of the activity (i.e., complete inhibition) and/or expression. For example, "down-regulation" can refer to a decrease of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100% in HSF1 activity and/or expression.

[0190] As used herein, the term "inhibit" or "inhibiting" HSF1 refers to any statistically significant decrease in biological activity and/or expression of HSF1, including full blocking of the activity and/or expression. For example, "inhibition" can refer to a decrease of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100% in HSF1 activity and/or expression. As used herein, the term "inhibit" similarly refers to a significant decrease in activity and/or expression, while referring to any other biological agent or composition.

[0191] By "level", it is meant that the HSF1 RNAi agent can interfere with the detectable level of HSF1, e.g., the level of HSF1 mRNA or the level of HSF1 protein.

[0192] By "activity," it is meant that the HSF1 RNAi agent can alter any known activity of HSF1, as described herein or as known in the literature.

[0193] By "heat shock" (HS) and "heat shock response" (HSR) is meant the biochemical response to environmental stress, such as elevated temperature. In the laboratory, experimental animals and cells can be maintained at a "non-shock" temperature (37.degree. C. or lower) and heat shock can be induced at an elevated temperature (e.g., 40, 41, 42, 43, 44, or 45 degrees C. or higher). Experimentally, heat shock is typically induced at 42, 43 or 44 degrees C.

[0194] Heat shock is characterized by misfolding, denaturation and aggregation of various proteins; the induced heat shock proteins (HSP or HSPs) include chaperone proteins (chaperonins) and others which repair and/or remove these proteins. Genes induced during the heat shock response include, inter alia, HSP90, HSP70 and HSP27. The heat shock response can also be induced (or mimicked) by additional environmental conditions, such as oxidative stress, chemical stress, free radicals, ATP depletion, acidosis, heavy metals, alcohols, presence of antibiotics, inhibitors of energy metabolism, pathological conditions such as ischemia and reperfusion, inflammation, tissue damage, infection and mutant proteins associated with genetic diseases. Jolly et al. 2000 J. Natl. Cancer Inst. 92: 1564-1572; Dai et al. 2007 Cell 130: 1005-1018. The RNAi agents of the present disclosure thus down-regulate heat shock or the heat shock response.

[0195] The RNAi Agent to HSF1.

[0196] In one embodiment, the disclosure pertains to a HSF1 RNAi agent or other antisense nucleic acid complementary to a HSF1 gene (or portion thereof), or a recombinant expression vector encoding the antisense nucleic acid. As used herein, an "antisense" nucleic acid comprises a nucleotide sequence complementary to a "sense" nucleic acid encoding the HSF1 protein (e.g., complementary to the coding strand of a double-stranded DNA, complementary to an mRNA or complementary to the coding strand of a HSF1 gene).

[0197] The use of antisense nucleic acids to down-modulate the expression of a particular protein in a cell is well known in the art. An antisense nucleic acid comprises a sequence complementary to, and is capable of hydrogen binding to, the coding strand of another nucleic acid (e.g., an mRNA). Antisense sequences complementary to an mRNA can be complementary to the coding region, the 5' or 3' untranslated region of the mRNA, and/or a region bridging the coding and untranslated regions, and/or portions thereof. Furthermore, an antisense nucleic acid can be complementary to a regulatory region of the gene encoding the mRNA, for instance a transcription or translation initiation sequence or regulatory element. Preferably, an antisense nucleic acid can be complementary to a region preceding or spanning the initiation codon on the coding strand or in the 3' untranslated region of an mRNA.

[0198] Antisense nucleic acids can be designed according to the rules of Watson and Crick base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of HSF1 mRNA, but in at least one embodiment is an oligonucleotide which is antisense to only a portion of the coding or non-coding region of HSF1 mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of HSF1 mRNA. An antisense oligonucleotide can be, for example, about 5, about 10, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 30, about 35, about 40, about 45 or about 50 nt in length, or 5, 10, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45 or 50 nt in length.

[0199] siRNA may have modifications internally, or at one or both ends. Example modifications at the 5' end are illustrated in FIG. 1. These include: C6-alkyl(5'-hexylphosphate), 5'-Methyoxy; 5'-inverted dT (idT), and 5'-beta-L-uridine. The modifications at the ends can help stabilize the siRNA, protecting it from degradation by nucleases in the blood. The siRNAs may optionally be directed to regions of the HSF1 mRNA known or predicted to be near or at splice sites of the gene; e.g., exon-intron junctions. The siRNAs can also optionally be designed to anneal to known or predicted exposed and/or single-stranded regions of the mRNA (e.g., loops).

[0200] An antisense nucleic acid can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally-occurring nucleotides or variously modified nucleotides designed to decrease off-target effects, and/or increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids. In at least one embodiment a modified sugar backbone, including a phosphorothioate linkage or its derivatives, and acridine substituted nucleotides can be used.

[0201] Each of "G," "C," "A," "T" and "U" generally stand for a nucleotide that contains guanine, cytosine, adenine, thymidine and uracil as a base, respectively. However, the term "ribonucleotide" or "nucleotide" can also refer to a modified nucleotide or a surrogate replacement moiety. The skilled person is well aware that guanine, cytosine, adenine, and uracil may be replaced by other moieties without substantially altering the base pairing properties of an oligonucleotide comprising a nucleotide bearing such replacement moiety. For example, without limitation, a nucleotide comprising inosine as its base may base pair with nucleotides containing adenine, cytosine, or uracil. Hence, nucleotides containing uracil, guanine, or adenine may be replaced in the nucleotide sequences of dsRNA featured in the disclosure by a nucleotide containing, for example, inosine. In another example, adenine and cytosine anywhere in the oligonucleotide can be replaced with guanine and uracil, respectively to form G-U Wobble base pairing with the target mRNA. Sequences containing such replacement moieties are suitable for the compositions and methods featured in the disclosure.

[0202] Modifications.

[0203] The skilled artisan will recognize that the term "RNA molecule" or "ribonucleic acid molecule" encompasses not only RNA molecules as expressed or found in nature, but also analogs and derivatives of RNA comprising one or more ribonucleotide/ribonucleoside analogs or derivatives as described herein or as known in the art. Strictly speaking, a "ribonucleoside" includes a nucleoside base and a ribose sugar, and a "ribonucleotide" is a ribonucleoside with one, two or three phosphate moieties. However, the terms "ribonucleoside" and "ribonucleotide" can be considered to be equivalent as used herein. The RNA can be modified in the nucleobase structure or in the ribose-phosphate backbone structure, e.g., as described herein below. However, the molecules comprising ribonucleoside analogs or derivatives must retain the ability to form a duplex. As non-limiting examples, an RNA molecule can also include at least one modified ribonucleoside, including but not limited to a 2'-O-methyl modified nucleotide, a nucleoside comprising a 5' phosphorothioate linkage group, a terminal nucleoside linked to a cholesteryl derivative or dodecanoic acid bisdecylamide group, a locked nucleoside, an abasic nucleoside, a 2'-deoxy-2'-fluoro modified nucleoside, a 2'-amino-modified nucleoside, 2'-alkyl-modified nucleoside, morpholino nucleoside, an unlocked ribonucleotide (e.g., an acyclic nucleotide monomer, as described in WO 2008/147824), a phosphoramidate or a non-natural base comprising nucleoside, or any combination thereof. Alternatively, an RNA molecule can comprise at least two modified ribonucleosides, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more, up to the entire length of the dsRNA molecule. The modifications need not be the same for each of such a plurality of modified ribonucleosides in an RNA molecule. In one embodiment, modified RNAs contemplated for use in methods and compositions described herein are peptide nucleic acids (PNAs) that have the ability to form the required duplex structure and that permit or mediate the specific degradation of a target RNA via a RISC pathway.

[0204] Examples of modified nucleotides which can be used to generate the antisense nucleic acid include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.

[0205] In one aspect, a modified ribonucleoside includes a deoxyribonucleoside. In such an instance, an RNAi agent can comprise one or more deoxynucleosides, including, for example, a deoxynucleoside overhang(s), or one or more deoxynucleosides within the double stranded portion of a dsRNA. A portion of the RNAi agent can be double-stranded DNA, while another portion is double-stranded RNA, forming a DNA-RNA chimera (See, for example, Yamato et al. 2011. Cancer Gene Ther. 18: 587-597). However, it is self-evident that under no circumstances is a double stranded DNA molecule encompassed by the term "iRNA."

[0206] Other modifications and/or other changes can be made to the RNAi agent. The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (Inoue et al. 1987 Nucleic Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (Inoue et al. 1987 FEBS Lett. 215: 327-330).

[0207] In another embodiment, the RNAi agent has a single-stranded nick (e.g., a break or missing bond in the backbone). In various embodiments, a single-stranded nick can be in either the sense or anti-sense strand, or both.

[0208] This nick can be, for example, in the sense strand, producing a small internally segmented interfering RNA, or sisiRNA, which may have less off-target effects than the corresponding RNAi agent without a nick. See, for example, WO 2007/107162 to Wengels and Kjems.

[0209] The antisense nucleic acid or RNAi agent can also have an alternative backbone such as locked nucleic acids (LNA), Morpholinos, peptidic nucleic acids (PNA), threose nucleic acid (TNA), or glycol nucleic acid (GNA), or FANA and/or it can be labeled (e.g., radiolabeled or otherwise tagged). FANA are described in Dowler et al. 2006 Nucl. Acids Res. 34: 1669-1675.

[0210] One or both strands can comprise an alternative backbone.

[0211] Mismatches between the guide and passenger stand can also be introduced, though some positions may be better suited than others (See, for example, U.S. Patent App. No. 2009/0209626 to Khvorova). The passenger strand can also be shortened, to as short as 15 or 16 nt, while the guide strand remains 19 nt or longer (See, for example, Sun et al. 2008 Nature Biotech. 26: 1379-1382; and Chu and Rana 2008 RNA 14: 1714-1719). This can increase incorporation of the guide strand into the RNA-induced Silence Complex (RISC), and decrease incorporation of the passenger strand, than reducing off-target effects. In some cases, the passenger strand may be more amenable to modification (e.g., single-stranded nicking, nucleotide modifications, and shortening) than the guide strand. These and many other modifications can be made once a functional guide strand is identified.

[0212] Modified siRNAs or iRNA agents can be produced using any sequence provided herein with any one or more of these modifications (2' modifications, mismatches, nicks, RNA-DNA hybrid, LNA, PNA, GNA, TNA, or FANA, etc.), provided that the modifications are not mutually exclusive and produce a functional iRNA agent (e.g., an agent which mediates RNA interference activity against the target HSF1).

[0213] Replacing the 3'-terminal nucleotide overhanging segments of a 21-mer siRNA duplex having two-nucleotide 3'-overhangs with deoxyribonucleotides does not have an adverse effect on RNAi activity. Replacing up to four nucleotides on each end of the siRNA with deoxyribonucleotides has been well tolerated, whereas complete substitution with deoxyribonucleotides results in no RNAi activity. International PCT Publication No. WO 00/44914, and Beach et al. International PCT Publication No. WO 01/68836 preliminarily suggest that siRNA may include modifications to either the phosphate-sugar backbone or the nucleoside to include at least one of a nitrogen or sulfur heteroatom. Kreutzer et al. Canadian Patent Application No. 2,359,180, also describe certain chemical modifications for use in dsRNA constructs in order to counteract activation of double-stranded RNA-dependent protein kinase PKR, specifically 2'-amino or 2'-O-methyl nucleotides, and nucleotides containing a 2'-O or 4'-C methylene bridge. Additional 3'-terminal nucleotide overhangs include dT (deoxythimidine), 2'-O,4'-C-ethylene thymidine (eT), and 2-hydroxyethyl phosphate (hp).

[0214] Parrish et al. (2000 Molecular Cell 6: 1077-1087) tested certain chemical modifications targeting the unc-22 gene in C. elegans using long (>25 nt) siRNA transcripts. The authors describe the introduction of thiophosphate residues into these siRNA transcripts by incorporating thiophosphate nucleotide analogs with T7 and T3 RNA polymerase and observed that RNAs with two phosphorothioate modified bases also had substantial decreases in effectiveness as RNAi. Further, Parrish et al. reported that phosphorothioate modification of more than two residues greatly destabilized the RNAs in vitro such that interference activities could not be assayed. Id. at 1081. The authors also tested certain modifications at the 2'-position of the nucleotide sugar in the long siRNA transcripts and found that substituting deoxynucleotides for ribonucleotides produced a substantial decrease in interference activity, especially in the case of Uridine to Thymidine and/or Cytidine to deoxy-Cytidine substitutions. Id. In addition, the authors tested certain base modifications, including substituting, in sense and antisense strands of the siRNA, 4-thiouracil, 5-bromouracil, 5-iodouracil, and 3-(aminoallyl)uracil for uracil, and inosine for guanosine. Whereas 4-thiouracil and 5-bromouracil substitution appeared to be tolerated, Parrish reported that inosine produced a substantial decrease in interference activity when incorporated in either strand. Parrish also reported that incorporation of 5-iodouracil and 3-(aminoallyl)uracil in the antisense strand resulted in a substantial decrease in RNAi activity as well.

[0215] Those skilled in the art will appreciate that it is possible to synthesize and modify the siRNA as desired, using any conventional method known in the art (see Henschel et al. 2004 DEQOR: a web-based tool for the design and quality control of siRNAs. Nucleic Acids Research 32 (Web Server Issue): W113-W120). Further, it will be apparent to those skilled in the art that there are a variety of regulatory sequences (for example, constitutive or inducible promoters, tissue-specific promoters or functional fragments thereof, etc.) which are useful for the antisense oligonucleotide, siRNA, or shRNA expression construct/vector.

[0216] There are several examples in the art describing sugar, base, phosphate and backbone modifications that can be introduced into nucleic acid molecules with significant enhancement in their nuclease stability and efficacy. For example, oligonucleotides are modified to enhance stability and/or enhance biological activity by modification with nuclease resistant groups, for example, 2'-amino, 2'-C-allyl, 2'-flouro, 2'-O-methyl, 2'-O-allyl, 2'-H, nucleotide base modifications (for a review see Usman and Cedergren 1992 TIBS. 17: 34; Usman et al. 1994 Nucleic Acids Symp. Ser. 31: 163; Burgin et al. 1996 Biochemistry 35: 14090). Sugar modifications of nucleic acids have been extensively described in the art.

[0217] Additional modifications and conjugations of RNAi agents have been described. Soutschek et al. 2004 Nature 432: 173-178 presented conjugation of cholesterol to the 3'-end of the sense strand of a siRNA molecule by means of a pyrrolidine linker, thereby generating a covalent and irreversible conjugate. Chemical modifications (including conjugation with other molecules) of siRNA may also be made to improve the in vivo pharmacokinetic retention time and efficiency.

[0218] In various embodiments, the RNAi agent to HSF1 comprises at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[0219] In various embodiments, the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[0220] In another embodiment, the RNAi comprises a gap or missing base. For example, the phosphate-sugar backbone may be present, but the base missing.

[0221] In another embodiment, the RNAi agent has a single-stranded nick (e.g., a break or missing bond in the backbone). This nick can be, for example, in the sense strand, producing a small internally segmented interfering RNA, or sisiRNA, which may have less off-target effects than the corresponding RNAi agent without a nick.

[0222] The antisense nucleic acid or RNAi agent can also have an alternative backbone (or comprise mostly RNA with a small number of individual nucleotide substitutions) such as: locked nucleic acids (LNA), Morpholinos, peptidic nucleic acids (PNA), threose nucleic acid (TNA), boranophosphate-RNA, 2'-deoxy-2'-fluoro-.beta.-D-arabinonucleic acid (FANA), and/or glycol nucleic acid (GNA), and/or it can be labeled (e.g., radiolabeled or otherwise tagged). One or both strands can comprise an alternative backbone or have a small number (e.g., 1 to 10) of substitutions which are LNA, PNA, TNA, boranophosphate RNA, FANA, and/or GNA, etc.

[0223] In yet another embodiment, the antisense nucleic acid molecule employed by the methods of the present disclosure can include an .alpha.-anomeric nucleic acid molecule. An .alpha.-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual .beta.-units, the strands run parallel to each other. Gaultier et al. 1987 Nucleic Acids. Res. 15: 6625-6641. The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (Inoue et al. 1987 Nucleic Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (Inoue et al. 1987 FEBS Lett. 215: 327-330).

[0224] Alternatively, gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of HSF1 (e.g., the promoter and/or enhancers) to form triple helical structures that prevent transcription of the HSF1 gene. See generally, Helene 1991 Anticancer Drug Des. 6(6): 569-84; Helene et al. 1992 Ann. N.Y. Acad. Sci. 660: 27-36; and Maher 1992, Bioassays 14(12): 807-15.

[0225] Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be in an antisense orientation to a target nucleic acid of interest).

[0226] The antisense nucleic acid molecules of the present disclosure are typically administered to a subject or generated in situ such that they hybridize with cellular mRNA and/or genomic DNA encoding HSF1, and inhibit expression by inhibiting transcription and/or translation. An example of a route of administration of antisense nucleic acid molecules includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens. The antisense nucleic acid molecules can also be delivered to cells using vectors well known in the art and described in, for example, US20070111230, the entire contents of which are incorporated herein. To achieve sufficient intracellular concentrations of the antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter can be used.

[0227] RNA Interference.

[0228] RNA interference (RNAi) is a post-transcriptional, targeted gene-silencing technique that uses double-stranded RNA (dsRNA) to degrade messenger RNA (mRNA) containing the same sequence as the dsRNA. The process of RNAi occurs when ribonuclease III (Dicer) cleaves the longer dsRNA into shorter fragments called siRNAs. siRNAs (small interfering RNAs) produced in this way are typically about 21 to 23 nucleotides long and comprise about 19 base pair duplexes (although effective artificial siRNAs can be significantly longer or shorter). The smaller RNA segments then mediate the degradation of the target mRNA. Dicer has also been implicated in the excision of 21- and 22-nucleotide small temporal RNAs (stRNAs) from precursor RNA of conserved structure that are implicated in translational control. Hutvagner et al. 2001, Science, 293, 834. The RNAi response also features an endonuclease complex, commonly referred to as an RNA-induced silencing complex (RISC), which mediates cleavage of single-stranded mRNA complementary to the antisense strand of the siRNA. Cleavage of the target RNA takes place in the middle of the region complementary to the antisense strand of the siRNA duplex.

[0229] In one aspect, an RNA interference agent includes a single-stranded RNA that interacts with a target RNA sequence to direct the cleavage of the target RNA. Without wishing to be bound by theory, the present disclosure contemplates that long double-stranded RNA introduced into plants and invertebrate cells is broken down into siRNA by a Type III endonuclease known as Dicer (Sharp et al., Genes Dev. 2001, 15: 485). Dicer, a ribonuclease-III-like enzyme, processes the dsRNA into 19-23 base pair short interfering RNAs with characteristic two base 3' overhangs (Bernstein, et al., (2001) Nature 409:363) (although artificial RNAi agents can be shorter and/or blunt-ended). The siRNAs are then incorporated into an RNA-induced silencing complex (RISC) where one or more helicases unwind the siRNA duplex, enabling one of the now unpaired siRNA strands to act as a "guide" strand to guide target recognition (Nykanen, et al., (2001) Cell 107:309). Upon binding of the antisense guide strand to the appropriate target mRNA, one or more endonucleases within the RISC cleaves the target to induce silencing (Elbashir, et al., (2001) Genes Dev. 15:188). Thus, in one aspect the present disclosure relates to a single-stranded RNA that promotes the formation of a RISC complex to effect silencing of the target gene.

[0230] RNA interference has also been studied in a variety of systems. Work in Drosophila embryonic lysates (Elbashir et al. 2001 EMBO J. 20: 6877 and Tuschl et al. International PCT Publication No. WO 01/75164) has revealed certain requirements for siRNA length, structure, chemical composition, and sequence that are essential to mediate efficient RNAi activity in a variety of systems, including especially mammals. These studies have shown that 21-nucleotide siRNA duplexes are particularly active when containing 3'-terminal dinucleotide overhangs, though other studies have shown that blunt-ended siRNAs can also be effective.

[0231] The dsRNA molecules (RNAi agents) described herein are thus useful in RNA interference of HSF1.

[0232] The present disclosure also encompasses RNAi agents comprising any sequence disclosed herein, e.g., as part of a longer sequence. For example, the disclosure encompasses longer RNAi agents comprising two strands, wherein the sequence of either or both of the strands comprises the sequence of a strand provided herein. Several studies have shown that longer strands can be effective in RNA interference, even though they are half a dozen nt or by longer than a 19 nt RNAi agent, or even up to about 49, about 200, about 500, or even about 700 bp long or longer. See Elbashir et al. 2001 EMBO J. 23: 6877-6888; WO 00/44914; WO 01/36646; and WO 00/63364. Most importantly for therapeutic use, however, siRNA duplexes shorter than 50 bp or so are less likely to activate the interferon response in mammalian cells. See, e.g., Tuschl et al., WO 01/752164.

[0233] RNAi Agents to HSF1.

[0234] RNAi agents that are particularly useful for this disclosure include those which can bind specifically to a region of the HSF1 mRNA, and have one or more of the following qualities: binding in the coding segment of HSF1; binding at or near the junction of the 5' untranslated region and the start of the coding segment; binding at or near the translational start site of the mRNA; binding at or near junctions of exons and introns; little or no binding to the mRNAs of other genes (little or no "off-target effects"); binding to the HSF1 mRNA in or near a region or regions that is not double-stranded or a stem region, e.g., in a loop or single-stranded portion; eliciting little or no immunogenicity; binding in a segment of the HSF1 mRNA sequence which is conserved among various animal species (including human, mouse, rat, cynomolgus monkey, etc.), as the presence of a conserved sequence facilitates testing using various laboratory animals; binding to double-stranded region(s) of the mRNA; binding to an AT-rich region (e.g., at least about 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60% AT-rich); and lacking particular sequences known or suspected to decrease siRNA activity, e.g., the presence of a GG sequence at the 5' end, which may decrease separation of the double-stranded portion of the siRNA.

[0235] RNAi agents can be designed as HSF1 RNAi agents which bind to and assist in degradation of HSF1 mRNA. The anti-HSF1 RNAi agents can be designed to bind to the coding segment or non-coding segment (e.g., the 5' or 3' untranslated regions, or UTRs). Preferably, the RNAi agent binds to the coding segment of the mRNA. The RNAi agents can have double-stranded regions of, for example, about 17, 18, 19, 20, 21, 22, 23, or 24 bp. Preferably, the RNAi agent comprises about 19, 20 or 21 bp. The RNAi agents can be longer (e.g., up to 49 bp), as incorporated into a construct suitable for shortening by the Dicer complex. The RNAi can also be incorporated into a longer construct for expression prior to further shortening and processing.

[0236] RNAi Agents Lowering HSF1 Level, Expression and/or Activity.

[0237] RNAi agents for targeting HSF1 include those which bind to a HSF1 sequence provided herein and which work to reduce HSF1 through a RNAi mechanism. Example siRNAs to HSF1 are provided, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7.

[0238] The RNAi agents of the present disclosure silence, inhibit the expression of, down-regulate the expression of, and/or suppress the expression of the HSF1 gene, such that an approximately normal level of HSF1 activity, expression and/or level is achieved.

[0239] In addition, in various embodiments, depending on the disease condition and biological context, it is acceptable to use the RNAi agents of the present disclosure to establish a level of HSF1 expression, activity and/or level which is below the normal level, or above the normal level.

[0240] Features of a RNAi Agent: Sense Strand and Antisense Strand.

[0241] In various embodiments, the RNAi agents comprise a first strand and a second strand, e.g., a sense strand and an antisense strand and, optionally, one or both ends of the duplex containing unpaired nucleotides referred to herein as overhangs, and, optionally, 3' and/or 5' end caps.

[0242] The term "antisense strand" refers to the strand of a RNAi agent which includes a region that is substantially complementary to a target sequence. As used herein, the term "region of complementarity" refers to the region on the antisense strand that is substantially complementary to a sequence, for example a target sequence, as defined herein. Where the region of complementarity is not fully complementary to the target sequence, the mismatches may be in the internal or terminal regions of the molecule. Generally, the most tolerated mismatches are in the terminal regions, e.g., within 5, 4, 3, or 2 nucleotides of the 5' and/or 3' terminus.

[0243] The term "sense strand," as used herein, refers to the strand of a RNAi agent that includes a region that is substantially complementary to a region of the antisense strand as that term is defined herein.

[0244] The sequence of a gene may vary from individual to individual, especially at wobble positions within the coding segment, or in the untranslated region; individuals may also differ from each other in coding sequence, resulting in additional differences in mRNA. The sequence of the sense and antisense strands of the RNAi agent can thus be designed to correspond to that of an individual patient, if and where needed. RNAi agents can also be modified in sequence to reduce immunogenicity, binding to undesired mRNAs (e.g., "off-target effects") or to increase stability in the blood. These sequence variants are independent of chemical modification of the bases or 5' or 3' or other end-caps of the RNAi agents.

[0245] Overhangs, Blunt Ends and Caps.

[0246] The RNAi agents can also have 0, 1, or 2 overhangs; in the case of 0 overhangs, they are blunt-ended. A RNAi agent can have 0, 1 or 2 blunt ends. In a "blunt-ended RNAi agent" both strands terminate in a base-pair; thus a blunt-ended molecule lacks either 3' or 5' single-stranded nucleotide overhangs.

[0247] The terms "blunt" or "blunt-ended" as used herein in reference to a dsRNA mean that there are no unpaired nucleotides or nucleotide analogs at a given terminal end of a dsRNA, i.e., no nucleotide overhang. One or both ends of a dsRNA can be blunt. Where both ends of a dsRNA are blunt, the dsRNA is said to be blunt ended. To be clear, a "blunt ended" dsRNA is a dsRNA that is blunt at both ends, i.e., no nucleotide overhang at either end of the molecule. Most often such a molecule will be double-stranded over its entire length.

[0248] As used herein, the term "overhang" or "nucleotide overhang" refer to at least one unpaired nucleotide that protrudes from the end of at least one of the two strands of the duplex structure of a RNAi agent. For example, when a 3'-end of one strand of a dsRNA extends beyond the 5'-end of the other strand, or vice versa, the unpaired nucleotide(s) form the overhang. A dsRNA can comprise an overhang of at least one nucleotide; alternatively the overhang can comprise at least two nucleotides, at least three nucleotides, at least four nucleotides, at least five nucleotides or more. An overhang can comprise or consist of a nucleotide/nucleoside analog, including a deoxynucleotide/nucleoside. The overhang(s) may be on the sense strand, the antisense strand or any combination thereof. Furthermore, the nucleotide(s) of an overhang can be present on the 5' end, 3' end or both ends of either an antisense or sense strand of a dsRNA.

[0249] An example overhang is 3'-terminal dinucleotide such as dithymidine (TT), dTdT, sdTsdT, UU, etc. The 3'-terminal dinucleotide overhangs can be effective for increasing nuclease resistance, though they may not contribute to target recognition (Elbashir et al. 2001 Nature 411: 494-498). This is consistent with reports that the overhangs can be deleted in many cases, and can be replaced with a 3' endcap that increases nuclease resistance, WO 2005/021749 and WO 2007/128477. A suitable 3' endcap ideally performs at least two functions: (1) increasing stability, e.g., against nucleases, e.g., in blood serum or intestinal fluid; and (2) allowing RNA interference activity. Substitution of the 3'-terminal siRNA overhang nucleotides with 2'-deoxy nucleotides (2'-H) was also tolerated. In addition, a 5'-phosphate on the target-complementary strand of a siRNA duplex is usually required for siRNA activity.

[0250] The RNAi agent can thus optionally comprise a cap. The term "cap" and the like include a chemical moiety attached to the end of a double-stranded nucleotide duplex, but is used herein to exclude a chemical moiety that is a nucleotide or nucleoside. A "3' Cap" is attached at the 3' end of a nucleotide or oligonucleotide. A "5' Cap" is attached at the 5' end of a nucleotide or oligonucleotide. In one embodiment, 3' end caps are as disclosed in, for example, WO 2005/021749 and WO 2007/128477. A 3' and/or 5' end cap can be used in addition to an overhang or as a replacement to the overhang (e.g., on a blunt-end of a RNAi agent). In one embodiment, a blunt end of an RNAi duplex is chemically modified by the addition of a 3' cap, e.g., those described in WO 2005/021749 and WO 2007/128477. In such embodiments, the 3' caps are non-nucleotidic, and thus do not constitute an overhang.

[0251] The present disclosure thus contemplates a RNAi agent specific to HSF1 comprising an antisense strand (which may be contiguous or connected via a linker or loop) in a RNAi agent. In a more specific embodiment, an RNAi agent comprises an antisense strand and a sense strand which together comprise a double-stranded or complementary region. In one embodiment, it can also optionally comprise one or two overhangs and/or one or two caps.

[0252] Target and Complementary Sequences.

[0253] The RNAi agents of the present disclosure target (e.g., specifically bind to, anneal to, etc.) the mRNA encoding the gene HSF1. The use of the RNAi agent specific to HSF1 results in a decrease of HSF1 activity, level and/or expression, e.g., a "knock-down" or "knock-out" of the target gene or target sequence. Particularly in one embodiment, in the case of a disease state characterized by over-expression or hyper-activity of HSF1, administration of a RNAi agent to HSF1 knocks down the HSF1 gene enough to restore a normal level of HSF1 activity and/or a normal level of Na.sup.+ reabsorption.

[0254] As used herein, "target sequence" or "target gene" refer to a contiguous portion of the nucleotide sequence of an mRNA molecule formed during the transcription of a gene, e.g., a HSF1gene, including mRNA that is a product of RNA processing of a primary transcription product. The target portion of the sequence will be at least long enough to serve as a substrate for iRNA-directed cleavage at or near that portion. For example, the target sequence will generally be from 9-36 nucleotides ("nt") in length, e.g., 15-30 nt in length, including all sub-ranges therebetween. As non-limiting examples, the target sequence can be from 15-30 nt, 15-26 nt, 15-23 nt, 15-22 nt, 15-21 nt, 15-20 nt, 15-19 nt, 15-18 nt, 15-17 nt, 18-30 nt, 18-26 nt, 18-23 nt, 18-22 nt, 18-21 nt, 18-20 nt, 19-30 nt, 19-26 nt, 19-23 nt, 19-22 nt, 19-21 nt, 19-20 nt, 19 nt, 20-30 nt, 20-26 nt, 20-25 nt, 20- 24 nt, 20-23 nt, 20-22 nt, 20-21 nt, 20 nt, 21-30 nt, 21-26 nt, 21-25 nt, 21-24 nt, 21-23 nt, or 21-22 nt, 21 nt, 22 nt, or 23 nt. The sense and antisense strands of the RNAi comprise a sequence complementary to that of the target nucleic acid, HSF1. In considering the "sequence" of a target, a strand or an RNAi agent, neither the end-caps nor modifications of the RNAi agent, as described herein, are considered a part of the sequence.

[0255] As used herein, and unless otherwise indicated, the term "complementary" refers to the ability of an oligonucleotide or polynucleotide comprising a first nucleotide sequence to hybridize and form a duplex structure under certain conditions with an oligonucleotide or polynucleotide comprising a second nucleotide sequence. Such conditions can, for example, be stringent, e.g., 400 mM NaCl, 40 mM PIPES pH 6.4, 1 mM EDTA, 50.degree. C. or 70.degree. C. for 12-16 hours followed by washing. Other conditions, such as physiologically relevant conditions as may be encountered inside an organism, can apply. The skilled person will be able to determine the set of conditions most appropriate for a test of complementarity of two sequences in accordance with the ultimate application of the hybridized nucleotides.

[0256] "Complementary" sequences, as used herein, may also include, or be formed entirely from, non-Watson-Crick base pairs and/or base pairs formed from non-natural and modified nucleotides, in as far as the above requirements with respect to their ability to hybridize are fulfilled. Such non-Watson-Crick base pairs includes, but are not limited to, G:U Wobble or Hoogstein base pairing.

[0257] The terms "complementary," "fully complementary" and "substantially complementary" herein may furthermore be used with respect to the base matching between the sense strand and the antisense strand of a dsRNA, or between the antisense strand of a RNAi agent and a target sequence, as will be understood from the context of their use.

[0258] As used herein, a polynucleotide that is "substantially complementary to at least part of" a messenger RNA (mRNA) refers to a polynucleotide that is substantially complementary to a contiguous portion of the mRNA of interest (e.g., an mRNA encoding HSF1). For example, a polynucleotide is complementary to at least a part of a HSF1mRNA if the sequence is substantially complementary to a non-interrupted portion of an mRNA encoding HSF1.

[0259] Complementary sequences within a RNAi agent, e.g., within a dsRNA as described herein, include base-paired oligonucleotides or polynucleotides comprising a first nucleotide sequence to an oligonucleotide or polynucleotide comprising a second nucleotide sequence over the entire length of one or both nucleotide sequences. Such sequences can be referred to as "fully complementary" with respect to each other herein. However, where a first sequence is referred to as "substantially complementary" with respect to a second sequence herein, the two sequences can be fully complementary, or they may form one or more, but generally not more than 5, 4, 3 or 2 mismatched base pairs upon hybridization for a duplex up to 30 base pairs, while retaining the ability to hybridize under the conditions most relevant to their ultimate application, e.g., inhibition of gene expression via a RISC pathway. However, where two oligonucleotides are designed to form, upon hybridization, one or more single-stranded overhangs, such overhangs shall not be regarded as mismatches with regard to the determination of complementarity.

[0260] For example, a duplex comprising one oligonucleotide 21 nucleotides in length and another oligonucleotide 23 nucleotides in length, wherein the longer oligonucleotide comprises a sequence of 21 nucleotides that is fully complementary to the shorter oligonucleotide, may yet be referred to as "fully complementary" for the purposes described herein. The term overhang describes an unpaired nucleotide at the 3' or 5' end of a double-stranded nucleotide duplex, as described above. In one embodiment, the overhang is 0 to 4 nt long and is on the 3' end.

[0261] Thus, the RNAi agent of the present disclosure is complimentary or substantially complimentary to a target sequence in the target HSF1 and is double-stranded, comprising a sense and an antisense strand (which can be contiguous, linked via a loop, or otherwise joined), where the double-stranded region an be 9 to 36 bp long (particularly for example, 19-22 bp or 19-23 bp long), and can furthermore optionally comprise a 3' or 5' overhang, and the RNAi agent can furthermore comprise a 3' cap. The RNAi agent mediates RNA interference, down-regulating or inhibiting the level, expression and/or activity of HSF1, and/or establishing or re-establishing an approximately normal level of HSF1 and/or HSF1 activity, or other biological function related to HSF1.

[0262] Types of RNAi Agents and Modification Thereof.

[0263] The use of RNAi agents or compositions comprising an antisense nucleic acid to down-modulate the expression of a particular protein in a cell is well known in the art. A RNAi agent comprises a sequence complementary to, and is capable of hydrogen binding to, the coding strand of another nucleic acid (e.g., an mRNA). Thus, in various embodiments, the RNAi agents of the present disclosure encompass any RNAi agents which target (e.g., are complementary, capable of hydrogen binding to, etc.) any sequence presented, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7.

[0264] Antisense sequences complementary to an mRNA can be complementary to the coding region, the 5' or 3' untranslated region of the mRNA, and/or a region bridging the coding and untranslated regions, and/or portions thereof. Furthermore, a RNAi agent or a portion thereof can be complementary to a regulatory region of the gene encoding the mRNA, for instance a transcription or translation initiation sequence or regulatory element. Particularly, a RNAi agent or a portion thereof can be complementary to a region preceding or spanning the initiation codon on the coding strand or in the 3' untranslated region of an mRNA.

[0265] RNAi agent molecules can be designed according to the rules of Watson and Crick base pairing. The RNAi agent can be complementary to the entire coding region of HSF1 mRNA, but more particularly is an oligonucleotide which is antisense to only a portion of the coding or non-coding region of HSF1 mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of HSF1 mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45 or 50 nucleotides in length.

[0266] The RNAi agent may have modifications internally, or at one or both ends. The modifications at the ends can help stabilize the RNAi agent, protecting it from degradation by nucleases in the blood. The RNAi agents may optionally be directed to regions of the HSF1 mRNA known or predicted to be near or at splice sites of the gene; e.g., exon-intron junctions (as described in, for example, Saxena et al. 1998).

[0267] The RNAi agents can also optionally be designed to anneal to known or predicted exposed and/or single-stranded regions of the mRNA (e.g., loops).

[0268] A RNAi agent can be constructed using chemical synthesis and enzymatic ligation reactions using procedures known in the art. For example, RNAi agent can be chemically synthesized using naturally-occurring nucleotides or variously modified nucleotides designed to decrease off-target effects, and/or increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used.

[0269] "G," "C," "A," "T" and "U" each generally stand for a nucleotide that contains guanine, cytosine, adenine, thymidine and uracil as a base, respectively. However, the term "ribonucleotide" or "nucleotide" can also refer to a modified nucleotide or a surrogate replacement moiety. The skilled person is well aware that guanine, cytosine, adenine, and uracil may be replaced by other moieties without substantially altering the base pairing properties of an oligonucleotide comprising a nucleotide bearing such replacement moiety. For example, without limitation, a nucleotide comprising inosine as its base may base pair with nucleotides containing adenine, cytosine, or uracil. Hence, nucleotides containing uracil, guanine, or adenine may be replaced in the nucleotide sequences of dsRNA featured in the present disclosure by a nucleotide containing, for example, inosine. In another example, adenine and cytosine anywhere in the oligonucleotide can be replaced with guanine and uracil, respectively to form G-U Wobble base pairing with the target mRNA. Sequences containing such replacement moieties are suitable for the compositions and methods featured in the present disclosure.

[0270] The skilled artisan will recognize that the term "RNA molecule" or "ribonucleic acid molecule" encompasses not only RNA molecules as expressed or found in nature (i.e., are naturally occurring), but also non-naturally occurring analogs and derivatives of RNA comprising one or more ribonucleotide/ribonucleoside analogs or derivatives as described herein or as known in the art. Strictly speaking, a "ribonucleoside" includes a nucleoside base and a ribose sugar, and a "ribonucleotide" is a ribonucleoside with one, two or three phosphate moieties. However, the terms "ribonucleoside" and "ribonucleotide" can be considered to be equivalent as used herein. The RNA can be modified in the nucleobase structure or in the ribose-phosphate backbone structure, e.g., as described herein below. However, the molecules comprising ribonucleoside analogs or derivatives must retain the ability to form a duplex. As non-limiting examples, an RNA molecule can also include at least one modified ribonucleoside, including but not limited to a 2'-O-methyl modified nucleotide, a nucleoside comprising a 5' phosphorothioate group, a terminal nucleoside linked to a cholesteryl derivative or dodecanoic acid bisdecylamide group, a locked nucleoside, an abasic nucleoside, a 2'-deoxy-2'-fluoro modified nucleoside, a 2'-amino-modified nucleoside, 2'-alkyl-modified nucleoside, morpholino nucleoside, an unlocked ribonucleotide (e.g., an acyclic nucleotide monomer, as described in WO 2008/147824), a phosphoramidate or a non-natural base comprising nucleoside, or any combination thereof. Alternatively, an RNA molecule can comprise at least two modified ribonucleosides, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20 or more, up to the entire length of the dsRNA molecule. The modifications need not be the same for each of such a plurality of modified ribonucleosides in an RNA molecule. In one embodiment, modified RNAs contemplated for use in methods and compositions described herein are peptide nucleic acids (PNAs) that have the ability to form the required duplex structure and that permit or mediate the specific degradation of a target RNA via a RISC pathway.

[0271] Examples of modified nucleotides which can be used to generate the RNAi agent include 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xantine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5'-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.

[0272] In one embodiment, the present disclosure encompasses modified any modified variant of any RNAi agent disclosed herein. The modified variant contains the same sequence, but can be modified to contain modifications in the phosphate, sugar, base, nucleotide, etc. For example, the modified variant can contain one or more of the modified nucleotides listed herein, for example a C replaced by a 2'-modified C.

[0273] In one aspect, a modified ribonucleoside includes a deoxyribonucleoside. In such an instance, a RNAi agent can comprise one or more deoxynucleosides, including, for example, a deoxynucleoside overhang(s), or one or more deoxynucleosides within the double-stranded portion of a dsRNA. However, it is self-evident that under no circumstances is a double-stranded DNA molecule encompassed by the term "RNAi agent."

[0274] Replacing the 3'-terminal nucleotide overhanging segments of a 21-mer siRNA duplex having two-nucleotide 3'-overhangs with deoxyribonucleotides does not have an adverse effect on RNAi activity. Replacing up to four nucleotides on each end of the siRNA with deoxyribonucleotides has been well tolerated, whereas complete substitution with deoxyribonucleotides results in no RNAi activity. International PCT Publication No. WO 00/44914, and Beach et al. International PCT Publication No. WO 01/68836 preliminarily suggest that siRNA may include modifications to either the phosphate-sugar backbone or the nucleoside to include at least one of a nitrogen or sulfur heteroatom. Kreutzer et al. Canadian Patent Application No. 2,359,180, also describe certain chemical modifications for use in dsRNA constructs in order to counteract activation of double-stranded RNA-dependent protein kinase PKR, specifically 2'-amino or 2'-O-methyl nucleotides, and nucleotides containing a 2'-O or 4'-C methylene bridge. Additional 3'-terminal nucleotide overhangs include dT (deoxythimidine), 2'-O,4'-C-ethylene thymidine (eT), and 2-hydroxyethyl phosphate (hp).

[0275] Parrish et al. 2000 Molecular Cell 6: 1077-1087 tested certain chemical modifications targeting the unc-22 gene in C. elegans using long (>25 nt) siRNA transcripts. The authors describe the introduction of thiophosphate residues into these siRNA transcripts by incorporating thiophosphate nucleotide analogs with T7 and T3 RNA polymerase and observed that RNAs with two phosphorothioate modified bases also had substantial decreases in effectiveness as RNAi. Further, Parrish et al. reported that phosphorothioate modification of more than two residues greatly destabilized the RNAs in vitro such that interference activities could not be assayed. Id. at 1081. The authors also tested certain modifications at the 2'-position of the nucleotide sugar in the long siRNA transcripts and found that substituting deoxynucleotides for ribonucleotides produced a substantial decrease in interference activity, especially in the case of Uridine to Thymidine and/or Cytidine to deoxy-Cytidine substitutions. Id. In addition, the authors tested certain base modifications, including substituting, in sense and antisense strands of the siRNA, 4-thiouracil, 5-bromouracil, 5-iodouracil, and 3-(aminoallyl) uracil for uracil, and inosine for guanosine. Whereas 4-thiouracil and 5-bromouracil substitution appeared to be tolerated, Parrish reported that inosine produced a substantial decrease in interference activity when incorporated in either strand. Parrish also reported that incorporation of 5-iodouracil and 3-(aminoallyl)uracil in the antisense strand resulted in a substantial decrease in RNAi activity as well.

[0276] Those skilled in the art will appreciate that it is possible to synthesize and modify the siRNA as desired, using any conventional method known in the art (see Henschel et al. 2004 DEQOR: a web-based tool for the design and quality control of siRNAs. Nucleic Acids Research 32 (Web Server Issue): W113-W120). Further, it will be apparent to those skilled in the art that there are a variety of regulatory sequences (for example, constitutive or inducible promoters, tissue-specific promoters or functional fragments thereof, etc.) which are useful for the antisense oligonucleotide, siRNA, or shRNA expression construct/vector.

[0277] There are several examples in the art describing sugar, base, phosphate and backbone modifications that can be introduced into nucleic acid molecules with significant enhancement in their nuclease stability and efficacy. For example, oligonucleotides are modified to enhance stability and/or enhance biological activity by modification with nuclease resistant groups, for example, 2'-amino, 2'-C-allyl, 2'-flouro, 2'-O-methyl, 2'-O-allyl, 2'-H, nucleotide base modifications (for a review see Usman and Cedergren 1992 TIBS. 17: 34; Usman et al. 1994 Nucleic Acids Symp. Ser. 31: 163; Burgin et al. 1996 Biochemistry 35: 14090). Sugar modification of nucleic acid molecules are extensively described in the art.

[0278] Additional modifications and conjugations of RNAi agents have been described. Soutschek et al. 2004 Nature 432: 173-178 presented conjugation of cholesterol to the 3'-end of the sense strand of a siRNA molecule by means of a pyrrolidine linker, thereby generating a covalent and irreversible conjugate. Chemical modifications (including conjugation with other molecules) of RNAi agents may also be made to improve the in vivo pharmacokinetic retention time and efficiency.

[0279] In various embodiments, the RNAi agent to HSF1 is ligated to one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[0280] Various modifications of the RNAi agent can be produced. In various embodiments, the RNAi agent to HSF1 comprises at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; and/or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[0281] In various embodiments, the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[0282] In another embodiment, the RNAi comprises a gap or missing base. For example, the phosphate-sugar backbone may be present, but the base missing.

[0283] In another embodiment, the RNAi agent has a single-stranded nick (e.g., a break or missing bond in the backbone). In various embodiments, a single-stranded nick can be in either the sense or anti-sense strand, or both.

[0284] This nick can be, for example, in the sense strand, producing a small internally segmented interfering RNA, or sisiRNA, which may have less off-target effects than the corresponding RNAi agent without a nick.

[0285] The antisense nucleic acid or RNAi agent can also have an alternative backbone (or comprise mostly RNA with a small number of individual nucleotide substitutions) such as: locked nucleic acids (LNA), Morpholinos, peptidic nucleic acids (PNA), threose nucleic acid (TNA), boranophosphate-RNA, 2'-deoxy-2'-fluoro-.beta.-D-arabinonucleic acid (FANA), and/or glycol nucleic acid (GNA), and/or it can be labeled (e.g., radiolabeled or otherwise tagged).

[0286] One or both strands can comprise an alternative backbone.

[0287] In yet another embodiment, the RNAi agent employed by the methods of the present disclosure can include an .alpha.-anomeric nucleic acid molecule. An .alpha.-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual .beta.-units, the strands run parallel to each other. Gaultier et al. 1987 Nucleic Acids. Res. 15: 6625-6641.

[0288] The antisense nucleic acid molecule can also comprise a 2'-o-methylribonucleotide (Inoue et al. 1987 Nucleic Acids Res. 15: 6131-6148) or a chimeric RNA-DNA analogue (Inoue et al. 1987 FEBS Lett. 215: 327-330).

[0289] Alternatively, gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of HSF1 (e.g., the promoter and/or enhancers) to form triple helical structures that prevent transcription of the HSF1 gene.

[0290] Production of RNAi Agents.

[0291] The RNAi agent can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be in an antisense orientation to a target nucleic acid of interest). The RNAi agent can also be produced biologically using an expression vector into which a nucleic acid has been subcloned as an shRNA construct (i.e., RNA transcribed from the inserted nucleic acid will have a first region in an antisense orientation to a target nucleic acid of interest, a second region that comprises a loop or hinge, and a third region in a sense orientation to the target nucleic acid of interest, wherein the first and third regions of the transcript preferably hybridizes with itself, thereby forming a stem-and-loop structure).

[0292] Methods of producing RNAi agents are well-known in the art and available to persons of ordinary skill in the art.

[0293] Kits for synthesis of RNAi are commercially available from, e.g., New England Biolabs and Ambion.

[0294] Delivery Vehicles for RNAi Agents.

[0295] RNAi agents of the present disclosure can be delivered or introduced (e.g., to a cell in vitro, to a test animal, or to a human) by any means known in the art.

[0296] The RNAi agents of the present disclosure are typically administered to a subject or generated in situ such that they can hybridize with cellular mRNA and/or genomic DNA encoding HSF1, and inhibit expression by inhibiting transcription and/or translation. An example of a route of administration of the RNAi agent includes direct injection at a tissue site. Alternatively, RNAi agents can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies which bind to cell surface receptors or antigens. The antisense nucleic acid molecules can also be delivered to cells using vectors well known in the art and described in, for example, US20070111230, the entire contents of which are incorporated herein. To achieve sufficient intracellular concentrations of the antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.

[0297] "Introducing into a cell," when referring to a RNAi agent, means facilitating or effecting uptake or absorption into the cell, as is understood by those skilled in the art. Absorption or uptake of a RNAi agent can occur through unaided diffusive or active cellular processes, or by auxiliary agents or devices. The meaning of this term is not limited to cells in vitro; a RNAi agent may also be "introduced into a cell," wherein the cell is part of a living organism. In such an instance, introduction into the cell will include the delivery to the organism. For example, for in vivo delivery, a RNAi agent can be injected into a tissue site or administered systemically. In vivo delivery can also be by a beta-glucan delivery system, such as those described in U.S. Pat. Nos. 5,032,401 and 5,607,677, and U.S. Publication No. 2005/0281781. In vitro introduction into a cell includes methods known in the art such as electroporation and lipofection. Further approaches are described herein or known in the art.

[0298] Delivery of RNAi agent to tissue is a problem both because the material must reach the target organ and must also enter the cytoplasm of target cells. RNA cannot penetrate cellular membranes, so systemic delivery of naked RNAi agent is unlikely to be successful. RNA is degraded by RNAse activity in serum (although the use of particular 3' end caps on siRNAs may reduce or limit this degradation; see, for example, WO 2005/021749 and WO 2007/128477). For these reasons, other mechanisms to deliver RNAi agent to target cells has been devised. Methods known in the art include but are not limited to: viral delivery (retrovirus, adenovirus, lentivirus, baculovirus, AAV); liposomes (Lipofectamine, cationic DOTAP, neutral DOPC) or nanoparticles (cationic polymer, PEI), bacterial delivery (tkRNAi), and also chemical modification (LNA) of siRNA to improve stability. Xia et al. 2002 Nat. Biotechnol. 20 and Devroe et al. 2002. BMC Biotechnol. 21: 15, disclose incorporation of siRNA into a viral vector. Porphysomes can also be used to deliver RNAi agents. Lovell et al. 2001 Nature Mater. 10: 324-32; and WO 2011/044671. Other systems for delivery of RNAi agents are contemplated and the RNAi agents of the present disclosure can be delivered by various methods yet to be found and/or approved by the FDA or other regulatory authorities.

[0299] RNAi agents of the present disclosure can delivered in a suitable pharmaceutical composition. Several of these are described in greater detail, below.

[0300] Pharmaceutical Compositions of RNAi Agents.

[0301] As used here, a "pharmaceutical composition" comprises a pharmaceutically effective amount of one or more HSF1 RNAi agent, a pharmaceutically acceptable carrier, and, optionally, an additional disease treatment which works synergistically with the RNAi agent. As used herein, "pharmacologically effective amount," "therapeutically effective amount" or simply "effective amount" refers to that amount of a RNAi agent effective to produce the intended pharmacological, therapeutic or preventive result. For example, if a given clinical treatment is considered effective where there is at least a 10% reduction in a measurable parameter associated with a disease or disorder, a therapeutically effective amount of a drug for the treatment of that disease or disorder is the amount necessary to effect at least a 10% reduction in that parameter. In this embodiment, a therapeutically effective amount of a RNAi agent targeting HSF1 can reduce HSF1 protein levels by at least 10%. In additional embodiments, a given clinical treatment is considered effective where there is at least a 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90 or 95% reduction in a measurable parameter associated with a disease or disorder, and the therapeutically effective amount of a drug for the treatment of that disease or disorder is the amount necessary to effect at least a 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90 or 95% reduction, respectively, in that parameter.

[0302] The term "pharmaceutically acceptable carrier" refers to a carrier for administration of a therapeutic agent. Such carriers include, but are not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. The term specifically excludes cell culture medium. For drugs administered orally, pharmaceutically acceptable carriers include, but are not limited to pharmaceutically acceptable excipients such as inert diluents, disintegrating agents, binding agents, lubricating agents, sweetening agents, flavoring agents, coloring agents and preservatives. Suitable inert diluents include sodium and calcium carbonate, sodium and calcium phosphate, and lactose, while corn starch and alginic acid are suitable disintegrating agents. Binding agents may include starch and gelatin, while the lubricating agent, if present, will generally be magnesium stearate, stearic acid or talc. If desired, the tablets may be coated with a material such as glyceryl monostearate or glyceryl distearate, to delay absorption in the gastrointestinal tract. Agents included in drug formulations are described further herein.

[0303] The pharmaceutical compositions comprising a HSF1 RNAi agent can be in solid form, for example, powders, granules, tablets, pills, gelcaps, gelatin capsules, liposomes, suppositories, chewable forms, or patches. The pharmaceutical compositions comprising a HSF1 RNAi agent can also be presented in liquid form, for example, solutions, emulsions, suspensions, elixirs, or syrups. Appropriate liquid supports can be, for example, water, organic solvents such as polyol, such as glycerol or glycols, including propylene glycol and polyethylene glycol, or ethanol, Cremophor EL, or mixtures thereof, in varying proportions, in water. The compositions can comprise nano-sized amorphous or crystalline granules coated with albumin or a surfactant.

[0304] Appropriate supports can include, for example, antibacterial and antifungal agents, buffering agents, calcium phosphate, cellulose, methyl cellulose, chlorobutanol, cocoa butter, colorings, dextrin, emulsifiers, enteric coatings, flavorings, gelatin, isotonic agents, lecithin, magnesium stearate, perfuming agents, polyalcohols such as mannitol, injectable organic esters such as ethyl oleate, paraben, phenol sorbic acid, polyethylene glycol, polyvinylpyrrolidine, phosphate buffered saline (PBS), preserving agents, propylene glycol, sodium carboxymethylcellulose, sodium chloride, sorbitol, various sugars (including, but not limited to, sucrose, fructose, galactose, lactose and trehalose), starch, suppository wax, talc, vegetable oils, such as olive oil and corn oil, vitamins, wax, and/or wetting agents. For HSF1 RNAi agents, a preferred support comprises dextran and water, e.g. 5% dextrose in water (D5W).

[0305] The biologically inert portion of the pharmaceutical composition can optionally be erodible, allowing timed release of the RNAi agent.

[0306] The pharmaceutical composition can comprise additional components which aid in delivery, stability, efficacy, or reduction of immunogenicity.

[0307] Additional Components of a Pharmaceutical Composition Comprising a RNAi Agent to HSF1.

[0308] Additional components of a pharmaceutical composition comprising a RNAi Agent to HSF1 can be added to aid in delivery, stability, efficacy, or reduction of immunogenicity.

[0309] Liposomes have been used previously for drug delivery (e.g., delivery of a chemotherapeutic). Liposomes (e.g., cationic liposomes) are described in PCT publications WO02/100435A1, WO03/015757A1, and WO04029213A2; U.S. Pat. Nos. 5,962,016; 5,030,453; and 6,680,068; and U.S. Patent Application 2004/0208921. A process of making liposomes is also described in WO04/002453A1. Furthermore, neutral lipids have been incorporated into cationic liposomes (e.g., Farhood et al. 1995).

[0310] Cationic liposomes have been used to deliver RNAi agent to various cell types (Sioud and Sorensen 2003; U.S. Patent Application 2004/0204377; Duxbury et al., 2004; Donze and Picard, 2002).

[0311] Use of neutral liposomes disclosed in Miller et al. 1998, and U.S. Patent Application 2003/0012812.

[0312] As used herein, the term "SNALP" refers to a stable nucleic acid-lipid particle. A SNALP represents a vesicle of lipids coating a reduced aqueous interior comprising a nucleic acid such as an iRNA or a plasmid from which an iRNA is transcribed. SNALPs are described, e.g., in U.S. Patent Application Publication Nos. 20060240093, 20070135372, and in International Application No. WO 2009082817.

[0313] Chemical transfection using lipid-based, amine-based and polymer-based techniques, is disclosed in products from Ambion Inc., Austin, Tex.; and Novagen, EMD Biosciences, Inc, an Affiliate of Merck KGaA, Darmstadt, Germany); Ovcharenko D (2003) "Efficient delivery of siRNAs to human primary cells." Ambion TechNotes 10 (5): 15-16). Additionally, Song et al. (Nat Med. published online (Fete 10, 2003) doi: 10.1038/nm828) and others [Caplen et al. 2001 Proc. Natl. Acad. Sci. (USA), 98: 9742-9747; and McCaffrey et al. Nature 414: 34-39] disclose that liver cells can be efficiently transfected by injection of the siRNA into a mammal's circulatory system.

[0314] A variety of molecules have been used for cell-specific RNAi agent delivery. For example, the nucleic acid-condensing property of protamine has been combined with specific antibodies to deliver siRNAs. Song et al. 2005 Nat Biotech. 23: 709-717. The self-assembly PEGylated polycation polyethylenimine (PEI) has also been used to condense and protect siRNAs. Schiffelers et al. 2004 Nucl. Acids Res. 32: e149, 141-110.

[0315] The siRNA-containing nanoparticles were then successfully delivered to integrin-overexpressing tumor neovasculature. Hu-Lieskovan et al. 2005 Cancer Res. 65: 8984-8992.

[0316] The RNAi agents of the present disclosure can be delivered via, for example, Lipid nanoparticles (LNP); neutral liposomes (NL); polymer nanoparticles; double-stranded RNA binding motifs (dsRBMs); or via modification of the RNAi agent (e.g., covalent attachment to the dsRNA).

[0317] Lipid nanoparticles (LNP) are self-assembling cationic lipid based systems. These can comprise, for example, a neutral lipid (the liposome base); a cationic lipid (for siRNA loading); cholesterol (for stabilizing the liposomes); and PEG-lipid (for stabilizing the formulation, charge shielding and extended circulation in the bloodstream).

[0318] The cationic lipid can comprise, for example, a headgroup, a linker, a tail and a cholesterol tail. The LNP can have, for example, good tumor delivery, extended circulation in the blood, small particles (e.g., less than 100 nm), and stability in the tumor microenvironment (which has low pH and is hypoxic).

[0319] Neutral Liposomes (NL) are Non-Cationic Lipid Based Particles.

[0320] Polymer nanoparticles are self-assembling polymer-based particles.

[0321] Double-stranded RNA binding motifs (dsRBMs) are self-assembling RNA binding proteins, which will need modifications.

[0322] The RNAi agents of the present disclosure can be prepared in a pharmaceutical composition comprising various components appropriate for the particular method of administration of the RNAi agent.

[0323] Any of the pharmaceutically acceptable carriers or pharmaceutical compositions described herein can be used with an iRNA agent of any sequence described herein. These carriers and compositions can also be used with an iRNA agent having any modification, 3' end cap, 5' end cap, or other alteration described herein. For example, any liposome described herein can be used in combination with an iRNA agent of any sequence described herein.

[0324] Administration of a RNAi Agent.

[0325] The pharmaceutical composition comprising a HSF1 can be administered by buccal, inhalation (including insufflation and deep inhalation), nasal, oral, parenteral, implant, injection or infusion via epidural, intra-arterial, intra-articular, intra-capsular, intra-cardiac, intra-cerebroventricular, intracranial, intradermal, intramuscular, intra-orbital, ocular, intraperitoneal, intra-spinal, intrasternal, intrathecal, intravenous, subarachnoid, sub-capsular, subcutaneous, sub-cuticular, transendothelial, transtracheal, transvascular, rectal, sublingual, topical, and/or vaginal routes. This may be by injection, infusion, dermal patch, or any other method known in the art. The formulation can be powdered, nebulized, aerosolized, granulized or otherwise appropriately prepared for delivery. The administration, if liquid, may be slow or via bolus, though, under some circumstances known in the art, bolus injections may lead to loss of material through the kidneys.

[0326] The pharmaceutical compositions comprising a HSF1 RNAi agent can be administered with medical devices known in the art. For example, in a particular embodiment, a RNAi agent can be administered with a needle-less hypodermic injection device, such as the devices disclosed in U.S. Pat. Nos. 5,399,163, 5,383,851, 5,312,335, 5,064,413, 4,941,880, 4,790,824, or 4,596,556. Examples of well-known implants and modules useful in the present disclosure include: U.S. Pat. No. 4,487,603, which discloses an implantable micro-infusion pump for dispensing medication at a controlled rate; U.S. Pat. No. 4,486,194, which discloses a therapeutic device for administering medications through the skin; U.S. Pat. No. 4,447,233, which discloses a medication infusion pump for delivering medication at a precise infusion rate; U.S. Pat. No. 4,447,224, which discloses a variable flow implantable infusion apparatus for continuous drug delivery; U.S. Pat. No. 4,439,196, which discloses an osmotic drug delivery system having multi-chamber compartments; and U.S. Pat. No. 4,475,196, which discloses an osmotic drug delivery system. Many other such implants, delivery systems, and modules are known to those skilled in the art.

[0327] In certain embodiments, the pharmaceutical compositions comprising a RNAi agent can be formulated to ensure proper distribution in vivo. Administration of a RNAi agent to HSF1 can be systemic (whole-body) or, particularly, targeted to tissues or organs that express (or over-express or demonstrate a hyper-activity of) HSF1. Methods for targeting these particular tissues or organs are described herein, and/or are known in the art. For example, they can be formulated in liposomes. For methods of manufacturing liposomes, see, e.g., U.S. Pat. Nos. 4,522,811; 5,374,548; and 5,399,331. The liposomes may comprise one or more moieties which are selectively transported into specific cells or organs, thus enhance targeted drug delivery (see, e.g., V. V. Ranade (1989) J. Clin. Pharmacol. 29: 685).

[0328] Example targeting moieties include folate or biotin (see, e.g., U.S. Pat. No. 5,416,016 to Low et al.); mannosides (Umezawa et al., (1988) Biochem. Biophys. Res. Commun 153: 1038); antibodies (P. G. Bloeman et al. (1995) FEBS Lett. 357: 140; M. Owais et al. (1995) Antimicrob. Agents Chemother. 39: 180); surfactant protein A receptor (Briscoe et al. (1995) Am. J. Physiol. 1233: 134), different species of which may comprise the formulations of the present disclosures, as well as components of the invented molecules; p120 (Schreier et al. (1994) J. Biol. Chem. 269: 9090); see also K. Keinanen; M. L. Laukkanen (1994) FEBS Left. 346: 123; J. J. Killion; I. J. Fidler (1994) Immunomethods 4: 273.

[0329] The present disclosure thus encompasses pharmaceutical compositions comprising one or more RNAi agents to HSF1, which can optionally comprise various modifications and/or additional components, for use in treatment of HSF1-related diseases.

[0330] Measuring the Effect of an RNAi Agent on HSF1 Activity, Level and/or Expression

[0331] Any method known in the art can be use to measure changes in HSF1 activity, level and/or expression induced by a HSF1siRNA. Measurements can be performed at multiple timepoints, prior to, during and after administration of the siRNA, to determine the effect of the siRNA.

[0332] The terms "silence," "inhibit the expression of," "down-regulate the expression of," "suppress the expression of," and the like, in so far as they refer to a HSF1gene, herein refer to the at least partial suppression of the expression of a HSF1 gene, as manifested by a reduction of the amount of HSF1 mRNA which may be isolated from or detected in a first cell or group of cells in which a HSF1 gene is transcribed and which has or have been treated such that the expression of a HSF1 gene is inhibited, as compared to a second cell or group of cells substantially identical to the first cell or group of cells but which has or have not been so treated (control cells). The degree of inhibition is usually expressed in terms of

( mRNA in control cells ) - ( mRNA in treated cells ) ( mRNA in control cells ) 100 % Equation 1 ##EQU00001##

[0333] Alternatively, the degree of inhibition may be given in terms of a reduction of a parameter that is functionally linked to HSF1 gene expression, e.g., the amount of protein encoded by a HSF1 gene, etc. In principle, HSF1 gene silencing may be determined in any cell expressing HSF1, either constitutively or by genomic engineering, and by any appropriate assay. However, when a reference or control is needed in order to determine whether a given RNAi agent inhibits the expression of the HSF1 gene by a certain degree and therefore is encompassed by the instant disclosure, the assays provided in the Examples below shall serve as such reference.

[0334] For example, in certain instances, expression of a HSF1 gene is suppressed by at least about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, or 50% by administration of a RNAi agent featured in the present disclosure. In some embodiments, a HSF1 gene is suppressed by at least about 60%, 70%, or 80% by administration of a RNAi agent featured in the present disclosure. In some embodiments, a HSF1 gene is suppressed by at least about 85%, 90%, or 95% or more by administration of a RNAi agent, as described herein.

[0335] The ability of a RNAi agent to suppress HSF1 can be first tested in vitro (e.g., using test cells such as H441).

[0336] RNAi agents which can suppress HSF1 in vitro can then be tested for immunostimulation using, for example, a PBMC (peripheral blood mononuclear cell) assay. RNAi agents can also be tested in animal tests. Test and control animals include those which over-express or under-express HSF1. RNAi agents which suppress or alter the level, activity and/or expression of HSF1 can be used in medicaments to treat various HSF1-related diseases.

[0337] By "lower" in the context of HSF1 or a symptom of a HSF1-related disease is meant a statistically significant decrease in such level. The decrease can be, for example, at least 10%, at least 20%, at least 30%, at least 40% or more. If, for a particular disease, or for an individual suffering from a particular disease, the levels or expression of HSF1 are elevated, treatment with a HSF1 RNAi agent of the present disclosure can particularly reduce the level or expression of HSF1 to a level considered in the literature as within the range of normal for an individual without such disorder. The level or expression of HSF1 can be measured by evaluation of mRNA (e.g., via Northern blots or PCR), or protein (e.g., Western blots). The effect of a RNAi agent on HSF1 expression can be determined by measuring HSF1 gene transcription rates (e.g., via Northern blots; or reverse transcriptase polymerase chain reaction or real-time polymerase chain reaction). Direct measurements can be made of levels of HSF1, e.g. by Western blots of tissues in which HSF1 is expressed.

[0338] As used herein, "down-regulates" refers to any statistically significant decrease in a biological activity and/or expression of HSF1, including full blocking of the activity (i.e., complete inhibition) and/or expression. For example, "down-regulation" can refer to a decrease of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100% in HSF1 level, activity and/or expression.

[0339] As used herein, the term "inhibit" or "inhibiting" HSF1 refers to any statistically significant decrease in biological level, activity and/or expression of HSF1, including full blocking of the activity and/or expression. For example, "inhibition" can refer to a decrease of at least about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100% in HSF1 level, activity and/or expression. As used herein, the term "inhibit" similarly refers to a significant decrease in level, activity and/or expression, while referring to any other biological agent or composition.

[0340] By "level", it is meant that the HSF1 RNAi agent can alter the level of HSF1, e.g., the level of HSF1 mRNA or the level of HSF1 protein, or the level of activity of HSF1.

[0341] Some diseases, such as some viral diseases and cancers, are characterized by excessive HSF1 activity or levels. Particularly in one embodiment, in the case of a disease characterized by over-expression and/or hyper-activity of HSF1, administration of a RNAi agent to HSF1 reduces the level, expression and/or activity of HSF1. Thus, in various embodiments, administration of a RNAi agent to HSF1 particularly establishes or re-establishes a normal or approximately normal level of HSF1 activity, expression and/or level.

[0342] By "normal" or "approximately normal" in terms of level, expression and/or activity, is meant at least: about 50%, about 60%, about 70%, about 80%, about 90%, and/or about 100%; and/or no more than: about 100%, about 120%, about 130%, about 140%, or about 150% of the level, expression or activity of HSF1 in a healthy cell, tissue, or organ. Particularly in one embodiment, administration of the appropriate amount of the appropriate HSF1 RNAi agent restores HSF1 level, activity and/or expression to about 50% to about 150%, more particularly about 60% to about 140%, more particularly to about 70% to about 130%, more particularly to about 80% to about 120%, more particularly to about 90% to about 110%, and most particularly to about 100% of that of a healthy cell, tissue or organ.

[0343] In addition, in various embodiments, depending on the disease condition and biological context, it is acceptable to use the RNAi agents of the present disclosure to establish a level of HSF1 expression, activity and/or level which is below the normal level, or above the normal level.

[0344] Treatments Involving HSF1 RNAi Agents.

[0345] As used herein in the context of HSF1 expression, the terms "treat," "treatment," and the like, refer to relief from or alleviation of pathological processes mediated by HSF1 expression. In the context of the present disclosure insofar as it relates to any of the other conditions recited herein below (other than pathological processes mediated by HSF1 expression), the terms "treat," "treatment," and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression or anticipated progression of such condition, such as slowing the progression of a lipid disorder, such as atherosclerosis.

[0346] By "lower" in the context of a disease marker or symptom is meant a statistically significant decrease in such level. The decrease can be, for example, at least 10%, at least 20%, at least 30%, at least 40% or more. If, for a particular disease, or for an individual suffering from a particular disease, the levels or expression of HSF1 are elevated, treatment with an HSF1 RNAi agent of the present disclosure can preferably reduce the level or expression of HSF1 to a level considered in the literature as within the range of normal for an individual without such disorder.

[0347] The level or expression of HSF1 can be measured by evaluation of mRNA (e.g., via Northern blots or PCR), or protein (e.g., Western blots). The effect of an RNAi agent on HSF1 expression can be determined by measuring HSF1 gene transcription rates (e.g., via Northern blots; or reverse transcriptase polymerase chain reaction or real-time polymerase chain reaction). RT-PCR has been used to show that mRNA levels of HSF1 are high in kidney, pancreas and prostate, and medium in liver and spleen. Brauner-Osborne et al. 2001. Biochim. Biophys. Acta 1518: 237-248. Direct measurements can be made of levels of HSF1 (which is expressed by the cell surface), e.g. by Western blots of tissues in which HSF1 is expressed.

[0348] RNAi agents to HSF1 can thus be used to treat HSF1-related diseases, particularly those diseases associated with altered (particularly, raised) expression, activity and/or levels of HSF1.

[0349] Use of RNAi Agents for Treatment of HSF1-Related Diseases.

[0350] The RNAi agents to HSF1 described herein can be formulated into pharmaceutical compositions which can be administered to humans or non-human animals. These compositions can comprise one or more RNAi agents, and, optionally, additional treatments useful for treating HSF1-related diseases. They can be administered as part of an early/preventative treatment, and can be administered in a therapeutically-effective dosage. The pharmaceutical composition can comprise a pharmaceutical carrier and can be administered by any method known in the art. These various aspects of the present disclosure are described in additional detail below.

[0351] RNAi agents to HSF1 can be administered to humans and non-human animals for treatment of HSF1-related diseases.

[0352] In one embodiment of the disclosure, the compositions comprising a HSF1 RNAi agent can be administered to non-human animals. For example, the compositions can be given to chickens, turkeys, livestock animals (such as sheep, pigs, horses, cattle, etc.), companion animals (e.g., cats and dogs) and can have efficacy in treatment of cancer and viral diseases. In each case, the RNAi agent to HSF1 would be selected to match the sequence of the HSF1 of the genome of the animal, and to, preferably, contain at least 1 nt mismatch from all other genes in that animal's genome. The RNAi agents of the present disclosure can thus be used in treatment of HSF1-related diseases in humans and non-human animals.

[0353] As used herein in the context of HSF1 expression, the terms "treat," "treatment," and the like, refer to relief from or alleviation of pathological processes mediated by HSF1 expression. In the context of the present disclosure insofar as it relates to any of the other conditions recited herein below (other than pathological processes mediated by HSF1 expression), the terms "treat," "treatment," and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression or anticipated progression of such condition, such as slowing the progression of a lipid disorder, such as atherosclerosis.

[0354] By "treatment" is meant prophylaxis, therapy, cure, or any other change in a patient's condition indicating improvement or absence of degradation of physical condition. By "treatment" is meant treatment of HSF1-related disease (e.g., cancer or viral disease), or any appropriate treatment of any other ailment the patient has. As used herein, the terms "treatment" and "treat" refer to both prophylactic or preventative treatment and curative or disease-modifying treatment, including treatment of patients at risk of contracting a disease or suspected of having a disease, as well as patients already ill or diagnosed as suffering from a condition. The terms "treatment" and "treat" also refer to the maintenance and/or promotion of health in an individual not suffering from a disease but who may be susceptible to developing an unhealthy condition, such as nitrogen imbalance or muscle loss. In one embodiment, "treatment" does not encompass prevention of a disease state. Thus, the present disclosure is useful for suppressing expression of HSF1 and/or treating an HSF1-related disease in an individual afflicted by an HSF1-related disease, or an individual susceptible to an HSF1-related disease. An individual "afflicted" by an HSF1-related disease has demonstrated detectable symptoms characteristics of the disease, or had otherwise been shown clinically to have been exposed to or to carry HSF1-related disease pathogens or markers. As non-limiting examples, an individual afflicted by an HSF1-related disease can show outward symptoms; or can show no outward symptoms but can be shown with a clinical test to carry protein markers associated with an HSF1-related disease, or proteins or genetic material associated with a pathogen in the blood.

[0355] Treatment of some HSF1-related diseases may be more efficacious if administered early rather than later. Thus, in one particular embodiment, the RNAi agent to HSF1 is administered early, prior to disease manifestation, and/or as a preventative agent, rather than administered after disease establishment.

[0356] Treatments of HSF1-related diseases can comprise various treatments, comprising a HSF1 RNAi agent, and optionally further comprising an additional treatment, which can be a method (or procedure), or an additional composition (e.g., an agent or additional RNAi agent).

[0357] Dosages and Effective Amounts of RNAi Agents.

[0358] The RNAi agents of the present disclosure are administered in a dosage of a therapeutically effective amount to a patient in need thereof.

[0359] An "effective amount" or a "therapeutically effective amount" is an amount that treats a disease or medical condition of an individual, or, more generally, provides a nutritional, physiological or medical benefit to an individual. As used herein, the phrases "therapeutically effective amount" and "prophylactically effective amount" refer to an amount that provides a therapeutic benefit in the treatment, prevention, or management of pathological processes mediated by HSF1 expression or an overt symptom of pathological processes mediated by HSF1 expression. The specific amount that is therapeutically effective can be readily determined by an ordinary medical practitioner, and may vary depending on factors known in the art, such as, e.g., the type of pathological processes mediated by HSF1 expression, the patient's history and age, the stage of pathological processes mediated by HSF1 expression, and administration of other agents that inhibit pathological processes mediated by HSF1.

[0360] In various embodiments of the disclosure, the patient is at least about 1, 5, 10, 20, 30, 40, 50, 55, 60, 65, 70, or 75 years of age. In various embodiments, the patient has not yet been born, but receives treatment(s) prior to birth. In various embodiments, the patient is no more than about 1, 5, 10, 20, 30, 40, 50, 55, 60, 65, 70, 75, 80, 90, or 100 years of age. In various embodiments the patient has a body weight of at least about 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380 or 400 lbs. In various embodiments, the patient has a body weight of no more than about 20, 30, 40, 50, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 220, 240, 260, 280, 300, 320, 340, 360, 380 or 400 lbs.

[0361] In various embodiments of the disclosure, the dosage [measuring only the active ingredient(s)] can be at least about 1, 5, 10, 25, 50, 100, 200, 250, 300, 250, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 ng, 1, 5, 10, 25, 50, 100, 200, 250, 300, 250, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 micrograms, 1, 5, 10, 25, 50, 100, 200, 250, 300, 250, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg. In various embodiments, the dosage can be no more than about 10, 25, 50, 100, 200, 250, 300, 250, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg. In various embodiments, the dosage can be administered at least more than once a day, daily, more than once a weekly, weekly, bi-weekly, monthly, and/or every 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or 12 months, or a combination thereof.

[0362] In various embodiments, the dosage is correlated to the body weight or body surface area of the individual. The actual dosage level can be varied to obtain an amount of active agent which is effective for a particular patient, composition and mode of administration, without being toxic to the patient. The selected dose will depend on a variety of pharmacokinetic factors, including the activity of the particular RNAi agent employed, the route of administration, the rate of excretion of the RNAi agent, the duration of the treatment, other drugs, compounds and/or materials used in combination with the RNAi agent, the age, sex, weight, condition, general health and prior medical history of the patient, and like factors well known in the medical arts. A physician or veterinarian having ordinary skill in the art can readily determine the effective amount of the RNAi agent required. A suitable dose will be that amount which is the lowest dose effective to produce a therapeutic effect, or a dose low enough to produce a therapeutic effect without causing side effects.

[0363] In addition to a therapeutically-effective dosage of one or more RNAi agents to HSF1, the pharmaceutical compositions of the present disclosure can comprise or be used in conjunction with an additional disease treatment which works synergistically with the RNAi agent. For example, the pharmaceutical composition can comprise an additional antagonist to HSF1.

Additional Embodiments of RNAi Agents to HSF1

[0364] In a particular embodiment, the present disclosure encompasses a composition comprising one or more HSF1 RNAi agents. In one embodiment, the present disclosure comprises a RNAi agent comprising a sense strand and an antisense strand. In one embodiment, the antisense strand consists of, consists essentially of, or comprises the sequence of the antisense strand of a RNAi agent listed, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one embodiment, the antisense strand consists of, consists essentially of, or comprises a sequence with 0, 1, 2, or 3 mismatches from that of the antisense strand of any RNAi agent listed, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In one embodiment, the antisense strand consists of the sequence of the antisense strand of a RNAi agent listed, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7, and further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides. In one embodiment, the antisense strand consists of a sequence with 0, 1, 2, or 3 mismatches from that of the antisense strand of a RNAi agent listed, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7, and further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 nucleotides.

[0365] In another embodiment, the composition of the claimed disclosure does not comprise any particular individual RNAi agent listed, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In another embodiment of the present disclosure, the RNAi agent to HSF1 does not comprise any specific sequence of any HSF1 RNAi agent disclosed in the patent or scientific literature, e.g., Published U.S. Patent App. No. US-2011-0166058-A1. In one embodiment, the disclosure encompasses a RNAi agent to HSF1 which comprises a sequence of a HSF1 RNAi agent previously disclosed in the patent or scientific literature (e.g., Published U.S. Patent App. No. US-2011-0166058-A1), however with a different set of modifications than that disclosed in the patent or scientific literature.

Specific Embodiments of RNAi Agents to HSF1

[0366] In a particular specific embodiment, the present disclosure is a composition comprising one or more HSF1 RNAi agents disclosed or provided herein, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7, wherein the sequence of the first strand and the second strand of the RNAi agent consists or comprises the sequence of the first and second strand of any HSF1 RNAi agent disclosed herein, or modified or unmodified variants thereof.

[0367] In various embodiments, the disclosure pertains to:

[0368] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs: 180 and 264; or SEQ ID NOs: 348 and 432), or modified or unmodified variants thereof.

[0369] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs: 192 and 276; or SEQ ID NOs: 360 and 444), or modified or unmodified variants thereof.

[0370] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs: 204 and 288; or SEQ ID NOs: 372 and 456), or modified or unmodified variants thereof.

[0371] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs: 216 and 300; or SEQ ID NOs: 384 and 468), or modified or unmodified variants thereof.

[0372] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs: 228 and 312; or SEQ ID NOs: 396 and 480), or modified or unmodified variants thereof.

[0373] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A83_S36 (SEQ ID NOs: 240 and 324; or SEQ ID NOs: 408 and 492), or modified or unmodified variants thereof.

[0374] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs: 252 and 336; or SEQ ID NOs: 420 and 504), or modified or unmodified variants thereof.

[0375] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs: 172 and 256; or SEQ ID NOs: 340 and 424), or modified or unmodified variants thereof.

[0376] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs: 184 and 268; or SEQ ID NOs: 352 and 436), or modified or unmodified variants thereof.

[0377] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs: 196 and 280; or SEQ ID NOs: 364 and 448), or modified or unmodified variants thereof.

[0378] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs: 208 and 292; or SEQ ID NOs: 376 and 460), or modified or unmodified variants thereof.

[0379] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs: 220 and 304; or SEQ ID NOs: 388 and 472), or modified or unmodified variants thereof.

[0380] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs: 232 and 316; or SEQ ID NOs: 400 and 484), or modified or unmodified variants thereof.

[0381] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs: 244 and 328; or SEQ ID NOs: 412 and 496), or modified or unmodified variants thereof.

[0382] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs: 169 and 253; or SEQ ID NOs: 337 and 421), or modified or unmodified variants thereof.

[0383] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs: 181 and 265; or SEQ ID NOs: 349 and 433), or modified or unmodified variants thereof.

[0384] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs: 193 and 277; or SEQ ID NOs: 361 and 445), or modified or unmodified variants thereof.

[0385] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs: 205 and 289; or SEQ ID NOs: 373 and 457), or modified or unmodified variants thereof.

[0386] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs: 217 and 301; or SEQ ID NOs: 385 and 469), or modified or unmodified variants thereof.

[0387] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs: 229 and 313; or SEQ ID NOs: 397 and 481), or modified or unmodified variants thereof.

[0388] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs: 241 and 325; or SEQ ID NOs: 409 and 493), or modified or unmodified variants thereof.

[0389] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs: 170 and 254; or SEQ ID NOs: 338 and 422), or modified or unmodified variants thereof.

[0390] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs: 182 and 266; or SEQ ID NOs: 350 and 434), or modified or unmodified variants thereof.

[0391] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs: 194 and 278; or SEQ ID NOs: 362 and 446), or modified or unmodified variants thereof.

[0392] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs: 206 and 290; or SEQ ID NOs: 374 and 458), or modified or unmodified variants thereof.

[0393] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs: 218 and 302; or SEQ ID NOs: 386 and 470), or modified or unmodified variants thereof.

[0394] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs: 230 and 314; or SEQ ID NOs: 398 and 482), or modified or unmodified variants thereof.

[0395] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs: 242 and 326; or SEQ ID NOs: 410 and 494), or modified or unmodified variants thereof.

[0396] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs: 171 and 255; or SEQ ID NOs: 339 and 423), or modified or unmodified variants thereof.

[0397] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs: 183 and 267; or SEQ ID NOs: 351 and 435), or modified or unmodified variants thereof.

[0398] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs: 195 and 279; or SEQ ID NOs: 363 and 447), or modified or unmodified variants thereof.

[0399] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs: 207 and 291; or SEQ ID NOs: 375 and 459), or modified or unmodified variants thereof.

[0400] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs: 219 and 303; or SEQ ID NOs: 387 and 471), or modified or unmodified variants thereof.

[0401] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs: 231 and 315; or SEQ ID NOs: 399 and 483), or modified or unmodified variants thereof.

[0402] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs: 243 and 327; or SEQ ID NOs: 411 and 495), or modified or unmodified variants thereof.

[0403] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs: 173 and 257; or SEQ ID NOs: 341 and 425), or modified or unmodified variants thereof.

[0404] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs: 185 and 269; or SEQ ID NOs: 353 and 437), or modified or unmodified variants thereof.

[0405] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs: 197 and 281; or SEQ ID NOs: 365 and 449), or modified or unmodified variants thereof.

[0406] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs: 209 and 293; or SEQ ID NOs: 377 and 461), or modified or unmodified variants thereof.

[0407] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs: 221 and 305; or SEQ ID NOs: 389 and 473), or modified or unmodified variants thereof.

[0408] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs: 233 and 317; or SEQ ID NOs: 401 and 485), or modified or unmodified variants thereof.

[0409] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs: 245 and 329; or SEQ ID NOs: 413 and 497), or modified or unmodified variants thereof.

[0410] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs: 174 and 258; or SEQ ID NOs: 342 and 426), or modified or unmodified variants thereof.

[0411] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs: 186 and 270; or SEQ ID NOs: 354 and 438), or modified or unmodified variants thereof.

[0412] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs: 198 and 282; or SEQ ID NOs: 366 and 450), or modified or unmodified variants thereof.

[0413] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs: 210 and 294; or SEQ ID NOs: 378 and 462), or modified or unmodified variants thereof.

[0414] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs: 222 and 306; or SEQ ID NOs: 390 and 474), or modified or unmodified variants thereof.

[0415] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs: 234 and 318; or SEQ ID NOs: 402 and 486), or modified or unmodified variants thereof.

[0416] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs: 246 and 330; or SEQ ID NOs: 414 and 498), or modified or unmodified variants thereof.

[0417] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs: 175 and 259; or SEQ ID NOs: 343 and 427), or modified or unmodified variants thereof.

[0418] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs: 187 and 271; or SEQ ID NOs: 355 and 439), or modified or unmodified variants thereof.

[0419] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs: 199 and 283; or SEQ ID NOs: 367 and 451), or modified or unmodified variants thereof.

[0420] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs: 211 and 295; or SEQ ID NOs: 379 and 463), or modified or unmodified variants thereof.

[0421] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs: 223 and 307; or SEQ ID NOs: 391 and 475), or modified or unmodified variants thereof.

[0422] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs: 235 and 319; or SEQ ID NOs: 403 and 487), or modified or unmodified variants thereof.

[0423] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs: 247 and 331; or SEQ ID NOs: 415 and 499), or modified or unmodified variants thereof.

[0424] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs: 176 and 260; or SEQ ID NOs: 344 and 428), or modified or unmodified variants thereof.

[0425] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs: 188 and 272; or SEQ ID NOs: 356 and 440), or modified or unmodified variants thereof.

[0426] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs: 200 and 284; or SEQ ID NOs: 368 and 452), or modified or unmodified variants thereof.

[0427] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs: 212 and 296; or SEQ ID NOs: 380 and 464), or modified or unmodified variants thereof.

[0428] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs: 224 and 308; or SEQ ID NOs: 392 and 476), or modified or unmodified variants thereof.

[0429] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs: 236 and 320; or SEQ ID NOs: 404 and 488), or modified or unmodified variants thereof.

[0430] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs: 248 and 332; or SEQ ID NOs: 416 and 500), or modified or unmodified variants thereof.

[0431] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs: 177 and 261; or SEQ ID NOs: 345 and 429), or modified or unmodified variants thereof.

[0432] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs: 189 and 273; or SEQ ID NOs: 357 and 441), or modified or unmodified variants thereof.

[0433] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs: 201 and 285; or SEQ ID NOs: 369 and 453), or modified or unmodified variants thereof.

[0434] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs: 213 and 297; or SEQ ID NOs: 381 and 465), or modified or unmodified variants thereof.

[0435] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs: 225 and 309; or SEQ ID NOs: 393 and 477), or modified or unmodified variants thereof.

[0436] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs: 237 and 321; or SEQ ID NOs: 405 and 489), or modified or unmodified variants thereof.

[0437] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs: 249 and 333; or SEQ ID NOs: 417 and 501), or modified or unmodified variants thereof.

[0438] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs: 178 and 262; or SEQ ID NOs: 346 and 430), or modified or unmodified variants thereof.

[0439] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs: 190 and 274; or SEQ ID NOs: 358 and 442), or modified or unmodified variants thereof.

[0440] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs: 202 and 286; or SEQ ID NOs: 370 and 454), or modified or unmodified variants thereof.

[0441] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs: 214 and 298; or SEQ ID NOs: 382 and 466), or modified or unmodified variants thereof.

[0442] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs: 226 and 310; or SEQ ID NOs: 394 and 478), or modified or unmodified variants thereof.

[0443] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs: 238 and 322; or SEQ ID NOs: 406 and 490), or modified or unmodified variants thereof.

[0444] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs: 250 and 334; or SEQ ID NOs: 418 and 502), or modified or unmodified variants thereof.

[0445] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs: 179 and 263; or SEQ ID NOs: 347 and 431), or modified or unmodified variants thereof.

[0446] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs: 191 and 275; or SEQ ID NOs: 359 and 443), or modified or unmodified variants thereof.

[0447] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs: 203 and 287; or SEQ ID NOs: 371 and 455), or modified or unmodified variants thereof.

[0448] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs: 215 and 299; or SEQ ID NOs: 383 and 467), or modified or unmodified variants thereof.

[0449] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs: 227 and 311; or SEQ ID NOs: 395 and 479), or modified or unmodified variants thereof.

[0450] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs: 239 and 323; or SEQ ID NOs: 407 and 491), or modified or unmodified variants thereof.

[0451] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand of the RNAi agent is the sequence of the first strand of, and the sequence of the second strand of the RNAi agent is the sequence of the second strand of: hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs: 251 and 335; or SEQ ID NOs: 419 and 503), or modified or unmodified variants thereof.

[0452] In various embodiments, the disclosure pertains to:

[0453] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs: 180 and 264; or SEQ ID NOs: 348 and 432), or modified or unmodified variants thereof.

[0454] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs: 192 and 276; or SEQ ID NOs: 360 and 444), or modified or unmodified variants thereof.

[0455] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs: 204 and 288; or SEQ ID NOs: 372 and 456), or modified or unmodified variants thereof.

[0456] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs: 216 and 300; or SEQ ID NOs: 384 and 468), or modified or unmodified variants thereof.

[0457] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs: 228 and 312; or SEQ ID NOs: 396 and 480), or modified or unmodified variants thereof.

[0458] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A83_S36 (SEQ ID NOs: 240 and 324; or SEQ ID NOs: 408 and 492), or modified or unmodified variants thereof.

[0459] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs: 252 and 336; or SEQ ID NOs: 420 and 504), or modified or unmodified variants thereof.

[0460] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs: 172 and 256; or SEQ ID NOs: 340 and 424), or modified or unmodified variants thereof.

[0461] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs: 184 and 268; or SEQ ID NOs: 352 and 436), or modified or unmodified variants thereof.

[0462] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs: 196 and 280; or SEQ ID NOs: 364 and 448), or modified or unmodified variants thereof.

[0463] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs: 208 and 292; or SEQ ID NOs: 376 and 460), or modified or unmodified variants thereof.

[0464] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs: 220 and 304; or SEQ ID NOs: 388 and 472), or modified or unmodified variants thereof.

[0465] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs: 232 and 316; or SEQ ID NOs: 400 and 484), or modified or unmodified variants thereof.

[0466] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs: 244 and 328; or SEQ ID NOs: 412 and 496), or modified or unmodified variants thereof.

[0467] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs: 169 and 253; or SEQ ID NOs: 337 and 421), or modified or unmodified variants thereof.

[0468] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs: 181 and 265; or SEQ ID NOs: 349 and 433), or modified or unmodified variants thereof.

[0469] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs: 193 and 277; or SEQ ID NOs: 361 and 445), or modified or unmodified variants thereof.

[0470] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs: 205 and 289; or SEQ ID NOs: 373 and 457), or modified or unmodified variants thereof.

[0471] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs: 217 and 301; or SEQ ID NOs: 385 and 469), or modified or unmodified variants thereof.

[0472] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs: 229 and 313; or SEQ ID NOs: 397 and 481), or modified or unmodified variants thereof.

[0473] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs: 241 and 325; or SEQ ID NOs: 409 and 493), or modified or unmodified variants thereof.

[0474] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs: 170 and 254; or SEQ ID NOs: 338 and 422), or modified or unmodified variants thereof.

[0475] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs: 182 and 266; or SEQ ID NOs: 350 and 434), or modified or unmodified variants thereof.

[0476] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs: 194 and 278; or SEQ ID NOs: 362 and 446), or modified or unmodified variants thereof.

[0477] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs: 206 and 290; or SEQ ID NOs: 374 and 458), or modified or unmodified variants thereof.

[0478] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs: 218 and 302; or SEQ ID NOs: 386 and 470), or modified or unmodified variants thereof.

[0479] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs: 230 and 314; or SEQ ID NOs: 398 and 482), or modified or unmodified variants thereof.

[0480] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs: 242 and 326; or SEQ ID NOs: 410 and 494), or modified or unmodified variants thereof.

[0481] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs: 171 and 255; or SEQ ID NOs: 339 and 423), or modified or unmodified variants thereof.

[0482] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs: 183 and 267; or SEQ ID NOs: 351 and 435), or modified or unmodified variants thereof.

[0483] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs: 195 and 279; or SEQ ID NOs: 363 and 447), or modified or unmodified variants thereof.

[0484] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs: 207 and 291; or SEQ ID NOs: 375 and 459), or modified or unmodified variants thereof.

[0485] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs: 219 and 303; or SEQ ID NOs: 387 and 471), or modified or unmodified variants thereof.

[0486] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs: 231 and 315; or SEQ ID NOs: 399 and 483), or modified or unmodified variants thereof.

[0487] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs: 243 and 327; or SEQ ID NOs: 411 and 495), or modified or unmodified variants thereof.

[0488] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs: 173 and 257; or SEQ ID NOs: 341 and 425), or modified or unmodified variants thereof.

[0489] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs: 185 and 269; or SEQ ID NOs: 353 and 437), or modified or unmodified variants thereof.

[0490] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs: 197 and 281; or SEQ ID NOs: 365 and 449), or modified or unmodified variants thereof.

[0491] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs: 209 and 293; or SEQ ID NOs: 377 and 461), or modified or unmodified variants thereof.

[0492] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs: 221 and 305; or SEQ ID NOs: 389 and 473), or modified or unmodified variants thereof.

[0493] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs: 233 and 317; or SEQ ID NOs: 401 and 485), or modified or unmodified variants thereof.

[0494] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs: 245 and 329; or SEQ ID NOs: 413 and 497), or modified or unmodified variants thereof.

[0495] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs: 174 and 258; or SEQ ID NOs: 342 and 426), or modified or unmodified variants thereof.

[0496] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs: 186 and 270; or SEQ ID NOs: 354 and 438), or modified or unmodified variants thereof.

[0497] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs: 198 and 282; or SEQ ID NOs: 366 and 450), or modified or unmodified variants thereof.

[0498] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs: 210 and 294; or SEQ ID NOs: 378 and 462), or modified or unmodified variants thereof.

[0499] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs: 222 and 306; or SEQ ID NOs: 390 and 474), or modified or unmodified variants thereof.

[0500] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs: 234 and 318; or SEQ ID NOs: 402 and 486), or modified or unmodified variants thereof.

[0501] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs: 246 and 330; or SEQ ID NOs: 414 and 498), or modified or unmodified variants thereof.

[0502] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs: 175 and 259; or SEQ ID NOs: 343 and 427), or modified or unmodified variants thereof.

[0503] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs: 187 and 271; or SEQ ID NOs: 355 and 439), or modified or unmodified variants thereof.

[0504] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs: 199 and 283; or SEQ ID NOs: 367 and 451), or modified or unmodified variants thereof.

[0505] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs: 211 and 295; or SEQ ID NOs: 379 and 463), or modified or unmodified variants thereof.

[0506] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs: 223 and 307; or SEQ ID NOs: 391 and 475), or modified or unmodified variants thereof.

[0507] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs: 235 and 319; or SEQ ID NOs: 403 and 487), or modified or unmodified variants thereof.

[0508] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs: 247 and 331; or SEQ ID NOs: 415 and 499), or modified or unmodified variants thereof.

[0509] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs: 176 and 260; or SEQ ID NOs: 344 and 428), or modified or unmodified variants thereof.

[0510] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs: 188 and 272; or SEQ ID NOs: 356 and 440), or modified or unmodified variants thereof.

[0511] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs: 200 and 284; or SEQ ID NOs: 368 and 452), or modified or unmodified variants thereof.

[0512] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs: 212 and 296; or SEQ ID NOs: 380 and 464), or modified or unmodified variants thereof.

[0513] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs: 224 and 308; or SEQ ID NOs: 392 and 476), or modified or unmodified variants thereof.

[0514] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs: 236 and 320; or SEQ ID NOs: 404 and 488), or modified or unmodified variants thereof.

[0515] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs: 248 and 332; or SEQ ID NOs: 416 and 500), or modified or unmodified variants thereof.

[0516] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs: 177 and 261; or SEQ ID NOs: 345 and 429), or modified or unmodified variants thereof.

[0517] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs: 189 and 273; or SEQ ID NOs: 357 and 441), or modified or unmodified variants thereof.

[0518] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs: 201 and 285; or SEQ ID NOs: 369 and 453), or modified or unmodified variants thereof.

[0519] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs: 213 and 297; or SEQ ID NOs: 381 and 465), or modified or unmodified variants thereof.

[0520] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs: 225 and 309; or SEQ ID NOs: 393 and 477), or modified or unmodified variants thereof.

[0521] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs: 237 and 321; or SEQ ID NOs: 405 and 489), or modified or unmodified variants thereof.

[0522] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs: 249 and 333; or SEQ ID NOs: 417 and 501), or modified or unmodified variants thereof.

[0523] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs: 178 and 262; or SEQ ID NOs: 346 and 430), or modified or unmodified variants thereof.

[0524] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs: 190 and 274; or SEQ ID NOs: 358 and 442), or modified or unmodified variants thereof.

[0525] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs: 202 and 286; or SEQ ID NOs: 370 and 454), or modified or unmodified variants thereof.

[0526] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs: 214 and 298; or SEQ ID NOs: 382 and 466), or modified or unmodified variants thereof.

[0527] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs: 226 and 310; or SEQ ID NOs: 394 and 478), or modified or unmodified variants thereof.

[0528] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs: 238 and 322; or SEQ ID NOs: 406 and 490), or modified or unmodified variants thereof.

[0529] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs: 250 and 334; or SEQ ID NOs: 418 and 502), or modified or unmodified variants thereof.

[0530] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs: 179 and 263; or SEQ ID NOs: 347 and 431), or modified or unmodified variants thereof.

[0531] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs: 191 and 275; or SEQ ID NOs: 359 and 443), or modified or unmodified variants thereof.

[0532] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs: 203 and 287; or SEQ ID NOs: 371 and 455), or modified or unmodified variants thereof.

[0533] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs: 215 and 299; or SEQ ID NOs: 383 and 467), or modified or unmodified variants thereof.

[0534] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs: 227 and 311; or SEQ ID NOs: 395 and 479), or modified or unmodified variants thereof.

[0535] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs: 239 and 323; or SEQ ID NOs: 407 and 491), or modified or unmodified variants thereof.

[0536] An RNAi agent comprising a first and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of, and the sequence of the second strand comprises the sequence of the second strand of: hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs: 251 and 335; or SEQ ID NOs: 419 and 503), or modified or unmodified variants thereof.

[0537] In various embodiments, wherein it is said that the sequence of a particular strand is the sequence of a particular SEQ ID NO., it is meant that the sequence of that particular strand consists of the sequence of the referenced SEQ ID NO.

Additional Particular Specific Embodiments

[0538] In various embodiments, the disclosure comprises a RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt (e.g., 0, 1, 2 or 3 mismatches) from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt (e.g., 0, 1, 2 or 3 mismatches) from the second strand of any one or more RNAi agent disclosed herein.

[0539] A mismatch is defined herein as a difference between the base sequence or length when two sequences are maximally aligned and compared. A mismatch is defined as a position wherein the base of one sequence does not match the base of the other sequence. Thus, a mismatch is counted, for example, if a position in one sequence has a particular base (e.g., A), and the corresponding position on the other sequence has a different base (e.g., G).

[0540] A mismatch is also counted, e.g., if a position in one sequence has a base (e.g., A), and the corresponding position on the other sequence has no base (e.g., that position is an abasic nucleotide which comprises a phosphate-sugar backbone but no base). A single-stranded nick in either sequence (or in the sense or antisense strand) is not counted as mismatch. Thus, as a non-limiting example, no mismatch would be counted if one sequence comprises the sequence AG, but the other sequence comprises the sequence AG with a single-stranded nick between the A and the G. A base modification is also not considered a mismatch. Thus, if one sequence comprises a C, and the other sequence comprises a modified C (e.g., 2'-modification) at the same position, no mismatch would be counted.

[0541] Neither a 5'-endcap nor a 3' end cap is considered in counting mismatches. Thus a first duplex which identical in sequence to a second duplex has zero mismatches, even if one duplex had an end cap (e.g., a 3' end cap) and the other duplex did not or had a different endcap, or had the same endcap in a different location.

[0542] Various embodiments are further delineated below.

[0543] The disclosure encompasses:

[0544] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A22_S26, or a modified or unmodified variant thereof.

[0545] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A25_S27, or a modified or unmodified variant thereof.

[0546] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A81_S26, or a modified or unmodified variant thereof.

[0547] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A48_S26, or a modified or unmodified variant thereof.

[0548] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A82_S36, or a modified or unmodified variant thereof.

[0549] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A83_S36, or a modified or unmodified variant thereof.

[0550] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--175_A84_S36, or a modified or unmodified variant thereof.

[0551] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A22_S26, or a modified or unmodified variant thereof.

[0552] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A25_S27, or a modified or unmodified variant thereof.

[0553] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A81_S26, or a modified or unmodified variant thereof.

[0554] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A48_S26, or a modified or unmodified variant thereof.

[0555] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A82_S36, or a modified or unmodified variant thereof.

[0556] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A83 S36, or a modified or unmodified variant thereof.

[0557] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--517_A84_S36, or a modified or unmodified variant thereof.

[0558] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A22_S26, or a modified or unmodified variant thereof.

[0559] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A25_S27, or a modified or unmodified variant thereof.

[0560] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A81_S26, or a modified or unmodified variant thereof.

[0561] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A48_S26, or a modified or unmodified variant thereof.

[0562] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A82_S36, or a modified or unmodified variant thereof.

[0563] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A83_S36, or a modified or unmodified variant thereof.

[0564] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--562_A84_S36, or a modified or unmodified variant thereof.

[0565] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A22_S26, or a modified or unmodified variant thereof.

[0566] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A25_S27, or a modified or unmodified variant thereof.

[0567] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A81_S26, or a modified or unmodified variant thereof.

[0568] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A48_S26, or a modified or unmodified variant thereof.

[0569] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A82_S36, or a modified or unmodified variant thereof.

[0570] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A83_S36, or a modified or unmodified variant thereof.

[0571] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--751_A84_S36, or a modified or unmodified variant thereof.

[0572] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A22_S26, or a modified or unmodified variant thereof.

[0573] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A25_S27, or a modified or unmodified variant thereof.

[0574] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A81_S26, or a modified or unmodified variant thereof.

[0575] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A48_S26, or a modified or unmodified variant thereof.

[0576] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A82_S36, or a modified or unmodified variant thereof.

[0577] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A83_S36, or a modified or unmodified variant thereof.

[0578] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--755_A84_S36, or a modified or unmodified variant thereof.

[0579] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A22_S26, or a modified or unmodified variant thereof.

[0580] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A25_S27, or a modified or unmodified variant thereof.

[0581] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A81_S26, or a modified or unmodified variant thereof.

[0582] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A48_S26, or a modified or unmodified variant thereof.

[0583] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A82_S36, or a modified or unmodified variant thereof.

[0584] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A83_S36, or a modified or unmodified variant thereof.

[0585] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--846_A84_S36, or a modified or unmodified variant thereof.

[0586] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A22_S26, or a modified or unmodified variant thereof.

[0587] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A25_S27, or a modified or unmodified variant thereof.

[0588] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A81_S26, or a modified or unmodified variant thereof.

[0589] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A48_S26, or a modified or unmodified variant thereof.

[0590] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A82_S36, or a modified or unmodified variant thereof.

[0591] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A83_S36, or a modified or unmodified variant thereof.

[0592] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--1360_A84_S36, or a modified or unmodified variant thereof.

[0593] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A22_S26, or a modified or unmodified variant thereof.

[0594] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A25_S27, or a modified or unmodified variant thereof.

[0595] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A81_S26, or a modified or unmodified variant thereof.

[0596] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A48_S26, or a modified or unmodified variant thereof.

[0597] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A82_S36, or a modified or unmodified variant thereof.

[0598] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A83_S36, or a modified or unmodified variant thereof.

[0599] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2030_A84_S36, or a modified or unmodified variant thereof.

[0600] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A22_S26, or a modified or unmodified variant thereof.

[0601] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A25_S27, or a modified or unmodified variant thereof.

[0602] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A81_S26, or a modified or unmodified variant thereof.

[0603] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A48_S26, or a modified or unmodified variant thereof.

[0604] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A82_S36, or a modified or unmodified variant thereof.

[0605] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A83_S36, or a modified or unmodified variant thereof.

[0606] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2034_A84_S36, or a modified or unmodified variant thereof.

[0607] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A22_S26, or a modified or unmodified variant thereof.

[0608] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A25_S27, or a modified or unmodified variant thereof.

[0609] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A81_S26, or a modified or unmodified variant thereof.

[0610] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A48_S26, or a modified or unmodified variant thereof.

[0611] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A82_S36, or a modified or unmodified variant thereof.

[0612] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A83_S36, or a modified or unmodified variant thereof.

[0613] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2138_A84_S36, or a modified or unmodified variant thereof.

[0614] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A22_S26, or a modified or unmodified variant thereof.

[0615] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A25_S27, or a modified or unmodified variant thereof.

[0616] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A81_S26, or a modified or unmodified variant thereof.

[0617] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A48_S26, or a modified or unmodified variant thereof.

[0618] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A82_S36, or a modified or unmodified variant thereof.

[0619] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A83_S36, or a modified or unmodified variant thereof.

[0620] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2153_A84_S36, or a modified or unmodified variant thereof.

[0621] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A22_S26, or a modified or unmodified variant thereof.

[0622] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A25_S27, or a modified or unmodified variant thereof.

[0623] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A81_S26, or a modified or unmodified variant thereof.

[0624] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A48_S26, or a modified or unmodified variant thereof.

[0625] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A82_S36, or a modified or unmodified variant thereof.

[0626] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A83_S36, or a modified or unmodified variant thereof.

[0627] An RNAi agent comprising a first and a second strand, wherein the first strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from a first strand, and the second strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the second strand of: hs_HSF1.sub.--2154_A84_S36, or a modified or unmodified variant thereof.

[0628] In various embodiments wherein a RNAi agent is said to comprise a first strand and/or a second strand comprising a particular sequence (or a portion thereof which is least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt), it is meant that the cited strand can be longer than the referenced sequence, for example, it can be up to about 30 nucleotides in length, or further comprise any number of nucleotides, e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.

Additional Particular Specific Embodiments

[0629] In various embodiments, the disclosure comprises a RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of any RNAi agent disclosed herein.

[0630] Thus, in various embodiments the disclosure encompasses:

[0631] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A22_S26, or a modified or unmodified variant thereof.

[0632] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A25_S27, or a modified or unmodified variant thereof.

[0633] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A81_S26, or a modified or unmodified variant thereof.

[0634] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A48_S26, or a modified or unmodified variant thereof.

[0635] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A82_S36, or a modified or unmodified variant thereof.

[0636] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A83_S36, or a modified or unmodified variant thereof.

[0637] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A84_S36, or a modified or unmodified variant thereof.

[0638] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A22_S26, or a modified or unmodified variant thereof.

[0639] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A25_S27, or a modified or unmodified variant thereof.

[0640] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A81_S26, or a modified or unmodified variant thereof.

[0641] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A48_S26, or a modified or unmodified variant thereof.

[0642] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A82_S36, or a modified or unmodified variant thereof.

[0643] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A83_S36, or a modified or unmodified variant thereof.

[0644] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A84_S36, or a modified or unmodified variant thereof.

[0645] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A22_S26, or a modified or unmodified variant thereof.

[0646] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A25_S27, or a modified or unmodified variant thereof.

[0647] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A81_S26, or a modified or unmodified variant thereof.

[0648] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A48_S26, or a modified or unmodified variant thereof.

[0649] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A82_S36, or a modified or unmodified variant thereof.

[0650] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A83_S36, or a modified or unmodified variant thereof.

[0651] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A84_S36, or a modified or unmodified variant thereof.

[0652] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A22_S26, or a modified or unmodified variant thereof.

[0653] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A25_S27, or a modified or unmodified variant thereof.

[0654] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A81_S26, or a modified or unmodified variant thereof.

[0655] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A48_S26, or a modified or unmodified variant thereof.

[0656] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A82_S36, or a modified or unmodified variant thereof.

[0657] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A83_S36, or a modified or unmodified variant thereof.

[0658] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A84_S36, or a modified or unmodified variant thereof.

[0659] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A22_S26, or a modified or unmodified variant thereof.

[0660] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A25_S27, or a modified or unmodified variant thereof.

[0661] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A81_S26, or a modified or unmodified variant thereof.

[0662] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A48_S26, or a modified or unmodified variant thereof.

[0663] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A82_S36, or a modified or unmodified variant thereof.

[0664] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A83_S36, or a modified or unmodified variant thereof.

[0665] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A84_S36, or a modified or unmodified variant thereof.

[0666] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A22_S26, or a modified or unmodified variant thereof.

[0667] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A25_S27, or a modified or unmodified variant thereof.

[0668] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A81_S26, or a modified or unmodified variant thereof.

[0669] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A48_S26, or a modified or unmodified variant thereof.

[0670] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A82_S36, or a modified or unmodified variant thereof.

[0671] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A83_S36, or a modified or unmodified variant thereof.

[0672] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A84_S36, or a modified or unmodified variant thereof.

[0673] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A22_S26, or a modified or unmodified variant thereof.

[0674] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A25_S27, or a modified or unmodified variant thereof.

[0675] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A81_S26, or a modified or unmodified variant thereof.

[0676] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A48_S26, or a modified or unmodified variant thereof.

[0677] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A82_S36, or a modified or unmodified variant thereof.

[0678] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A83_S36, or a modified or unmodified variant thereof.

[0679] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A84_S36, or a modified or unmodified variant thereof.

[0680] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A22_S26, or a modified or unmodified variant thereof.

[0681] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A25_S27, or a modified or unmodified variant thereof.

[0682] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A81_S26, or a modified or unmodified variant thereof.

[0683] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A48_S26, or a modified or unmodified variant thereof.

[0684] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A82_S36, or a modified or unmodified variant thereof.

[0685] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A83_S36, or a modified or unmodified variant thereof.

[0686] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A84_S36, or a modified or unmodified variant thereof.

[0687] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A22_S26, or a modified or unmodified variant thereof.

[0688] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A25_S27, or a modified or unmodified variant thereof.

[0689] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A81_S26, or a modified or unmodified variant thereof.

[0690] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A48_S26, or a modified or unmodified variant thereof.

[0691] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A82_S36, or a modified or unmodified variant thereof.

[0692] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A83_S36, or a modified or unmodified variant thereof.

[0693] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A84_S36, or a modified or unmodified variant thereof.

[0694] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A22_S26, or a modified or unmodified variant thereof.

[0695] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A25_S27, or a modified or unmodified variant thereof.

[0696] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A81_S26, or a modified or unmodified variant thereof.

[0697] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A48_S26, or a modified or unmodified variant thereof.

[0698] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A82_S36, or a modified or unmodified variant thereof.

[0699] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A83_S36, or a modified or unmodified variant thereof.

[0700] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A84_S36, or a modified or unmodified variant thereof.

[0701] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A22_S26, or a modified or unmodified variant thereof.

[0702] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A25_S27, or a modified or unmodified variant thereof.

[0703] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A81_S26, or a modified or unmodified variant thereof.

[0704] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A48_S26, or a modified or unmodified variant thereof.

[0705] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A82_S36, or a modified or unmodified variant thereof.

[0706] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A83_S36, or a modified or unmodified variant thereof.

[0707] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A84_S36, or a modified or unmodified variant thereof.

[0708] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A22_S26, or a modified or unmodified variant thereof.

[0709] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A25_S27, or a modified or unmodified variant thereof.

[0710] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A81_S26, or a modified or unmodified variant thereof.

[0711] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A48_S26, or a modified or unmodified variant thereof.

[0712] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A82_S36, or a modified or unmodified variant thereof.

[0713] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A83_S36, or a modified or unmodified variant thereof.

[0714] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A84_S36, or a modified or unmodified variant thereof.

[0715] In various embodiments wherein a RNAi agent is said to comprise a first strand and/or a second strand comprising a particular sequence (or a portion thereof which is least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt), it is meant that the cited strand can be longer than the referenced sequence, for example, it can be up to about 30 nucleotides in length, or further comprise any number of nucleotides, e.g., about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc.

Additional Particular Embodiments

[0716] In various embodiments, the disclosure comprises a RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises or consists of the antisense strand of any RNAi agent disclosed herein.

[0717] Thus, the following are provided as examples of the various embodiments.

[0718] The disclosure encompasses:

[0719] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A22_S26, or a modified or unmodified variant thereof.

[0720] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A25_S27, or a modified or unmodified variant thereof.

[0721] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A81_S26, or a modified or unmodified variant thereof.

[0722] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A48_S26, or a modified or unmodified variant thereof.

[0723] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A82_S36, or a modified or unmodified variant thereof.

[0724] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A83_S36, or a modified or unmodified variant thereof.

[0725] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--175_A84_S36, or a modified or unmodified variant thereof.

[0726] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A22_S26, or a modified or unmodified variant thereof.

[0727] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A25_S27, or a modified or unmodified variant thereof.

[0728] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A81_S26, or a modified or unmodified variant thereof.

[0729] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A48_S26, or a modified or unmodified variant thereof.

[0730] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A82_S36, or a modified or unmodified variant thereof.

[0731] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A83_S36, or a modified or unmodified variant thereof.

[0732] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--517_A84_S36, or a modified or unmodified variant thereof.

[0733] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A22_S26, or a modified or unmodified variant thereof.

[0734] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A25_S27, or a modified or unmodified variant thereof.

[0735] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A81_S26, or a modified or unmodified variant thereof.

[0736] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A48_S26, or a modified or unmodified variant thereof.

[0737] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A82_S36, or a modified or unmodified variant thereof.

[0738] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A83_S36, or a modified or unmodified variant thereof.

[0739] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--562_A84_S36, or a modified or unmodified variant thereof.

[0740] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A22_S26, or a modified or unmodified variant thereof.

[0741] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A25S27, or a modified or unmodified variant thereof.

[0742] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A81_S26, or a modified or unmodified variant thereof.

[0743] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A48_S26, or a modified or unmodified variant thereof.

[0744] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A82_S36, or a modified or unmodified variant thereof.

[0745] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A83_S36, or a modified or unmodified variant thereof.

[0746] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--751_A84_S36, or a modified or unmodified variant thereof.

[0747] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A22_S26, or a modified or unmodified variant thereof.

[0748] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A25_S27, or a modified or unmodified variant thereof.

[0749] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A81_S26, or a modified or unmodified variant thereof.

[0750] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A48_S26, or a modified or unmodified variant thereof.

[0751] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A82_S36, or a modified or unmodified variant thereof.

[0752] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A83_S36, or a modified or unmodified variant thereof.

[0753] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--755_A84_S36, or a modified or unmodified variant thereof.

[0754] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A22_S26, or a modified or unmodified variant thereof.

[0755] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A25_S27, or a modified or unmodified variant thereof.

[0756] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A81_S26, or a modified or unmodified variant thereof.

[0757] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A48_S26, or a modified or unmodified variant thereof.

[0758] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A82_S36, or a modified or unmodified variant thereof.

[0759] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A83_S36, or a modified or unmodified variant thereof.

[0760] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--846_A84_S36, or a modified or unmodified variant thereof.

[0761] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A22_S26, or a modified or unmodified variant thereof.

[0762] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A25_S27, or a modified or unmodified variant thereof.

[0763] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A81_S26, or a modified or unmodified variant thereof.

[0764] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A48_S26, or a modified or unmodified variant thereof.

[0765] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A82_S36, or a modified or unmodified variant thereof.

[0766] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A83_S36, or a modified or unmodified variant thereof.

[0767] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--1360_A84_S36, or a modified or unmodified variant thereof.

[0768] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A22_S26, or a modified or unmodified variant thereof.

[0769] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A25_S27, or a modified or unmodified variant thereof.

[0770] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A81_S26, or a modified or unmodified variant thereof.

[0771] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A48_S26, or a modified or unmodified variant thereof.

[0772] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A82_S36, or a modified or unmodified variant thereof.

[0773] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A83_S36, or a modified or unmodified variant thereof.

[0774] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2030_A84_S36, or a modified or unmodified variant thereof.

[0775] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A22_S26, or a modified or unmodified variant thereof.

[0776] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A25_S27, or a modified or unmodified variant thereof.

[0777] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A81_S26, or a modified or unmodified variant thereof.

[0778] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A48_S26, or a modified or unmodified variant thereof.

[0779] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A82_S36, or a modified or unmodified variant thereof.

[0780] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A83_S36, or a modified or unmodified variant thereof.

[0781] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2034_A84_S36, or a modified or unmodified variant thereof.

[0782] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A22_S26, or a modified or unmodified variant thereof.

[0783] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A25_S27, or a modified or unmodified variant thereof.

[0784] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A81_S26, or a modified or unmodified variant thereof.

[0785] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A48_S26, or a modified or unmodified variant thereof.

[0786] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A82_S36, or a modified or unmodified variant thereof.

[0787] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A83_S36, or a modified or unmodified variant thereof.

[0788] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2138_A84_S36, or a modified or unmodified variant thereof.

[0789] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A22_S26, or a modified or unmodified variant thereof.

[0790] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A25_S27, or a modified or unmodified variant thereof.

[0791] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A81_S26, or a modified or unmodified variant thereof.

[0792] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A48_S26, or a modified or unmodified variant thereof.

[0793] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A82_S36, or a modified or unmodified variant thereof.

[0794] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A83_S36, or a modified or unmodified variant thereof.

[0795] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2153_A84_S36, or a modified or unmodified variant thereof.

[0796] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A22_S26, or a modified or unmodified variant thereof.

[0797] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A25_S27, or a modified or unmodified variant thereof.

[0798] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A81_S26, or a modified or unmodified variant thereof.

[0799] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A48_S26, or a modified or unmodified variant thereof.

[0800] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A82_S36, or a modified or unmodified variant thereof.

[0801] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A83_S36, or a modified or unmodified variant thereof.

[0802] An RNAi agent comprising a sense and an antisense strand, wherein the sequence of the antisense strand comprises or consists of the sequence of the antisense strand of: hs_HSF1.sub.--2154_A84_S36, or a modified or unmodified variant thereof.

[0803] In various embodiments, the disclosure comprises a RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of any RNAi agent disclosed herein, or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises about 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0804] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A22_S26 (SEQ ID NOs: 180 and 264; or SEQ ID NOs: 348 and 432), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0805] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A25_S27 (SEQ ID NOs: 192 and 276; or SEQ ID NOs: 360 and 444), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0806] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A81_S26 (SEQ ID NOs: 204 and 288; or SEQ ID NOs: 372 and 456), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0807] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A48_S26 (SEQ ID NOs: 216 and 300; or SEQ ID NOs: 384 and 468), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0808] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A82_S36 (SEQ ID NOs: 228 and 312; or SEQ ID NOs: 396 and 480), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0809] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A83_S36 (SEQ ID NOs: 240 and 324; or SEQ ID NOs: 408 and 492), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0810] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--175_A84_S36 (SEQ ID NOs: 252 and 336; or SEQ ID NOs: 420 and 504), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0811] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A22_S26 (SEQ ID NOs: 172 and 256; or SEQ ID NOs: 340 and 424), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0812] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A25_S27 (SEQ ID NOs: 184 and 268; or SEQ ID NOs: 352 and 436), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0813] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A81_S26 (SEQ ID NOs: 196 and 280; or SEQ ID NOs: 364 and 448), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0814] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A48_S26 (SEQ ID NOs: 208 and 292; or SEQ ID NOs: 376 and 460), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0815] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A82_S36 (SEQ ID NOs: 220 and 304; or SEQ ID NOs: 388 and 472), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0816] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A83_S36 (SEQ ID NOs: 232 and 316; or SEQ ID NOs: 400 and 484), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0817] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--517_A84_S36 (SEQ ID NOs: 244 and 328; or SEQ ID NOs: 412 and 496), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0818] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A22_S26 (SEQ ID NOs: 169 and 253; or SEQ ID NOs: 337 and 421), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0819] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A25_S27 (SEQ ID NOs: 181 and 265; or SEQ ID NOs: 349 and 433), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0820] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A81_S26 (SEQ ID NOs: 193 and 277; or SEQ ID NOs: 361 and 445), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0821] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A48_S26 (SEQ ID NOs: 205 and 289; or SEQ ID NOs: 373 and 457), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0822] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A82_S36 (SEQ ID NOs: 217 and 301; or SEQ ID NOs: 385 and 469), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0823] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A83_S36 (SEQ ID NOs: 229 and 313; or SEQ ID NOs: 397 and 481), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0824] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--562_A84_S36 (SEQ ID NOs: 241 and 325; or SEQ ID NOs: 409 and 493), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0825] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A22_S26 (SEQ ID NOs: 170 and 254; or SEQ ID NOs: 338 and 422), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0826] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A25_S27 (SEQ ID NOs: 182 and 266; or SEQ ID NOs: 350 and 434), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0827] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A81_S26 (SEQ ID NOs: 194 and 278; or SEQ ID NOs: 362 and 446), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0828] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A48_S26 (SEQ ID NOs: 206 and 290; or SEQ ID NOs: 374 and 458), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0829] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A82_S36 (SEQ ID NOs: 218 and 302; or SEQ ID NOs: 386 and 470), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0830] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A83_S36 (SEQ ID NOs: 230 and 314; or SEQ ID NOs: 398 and 482), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0831] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--751_A84_S36 (SEQ ID NOs: 242 and 326; or SEQ ID NOs: 410 and 494), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0832] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A22_S26 (SEQ ID NOs: 171 and 255; or SEQ ID NOs: 339 and 423), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0833] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A25_S27 (SEQ ID NOs: 183 and 267; or SEQ ID NOs: 351 and 435), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0834] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A81_S26 (SEQ ID NOs: 195 and 279; or SEQ ID NOs: 363 and 447), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0835] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A48_S26 (SEQ ID NOs: 207 and 291; or SEQ ID NOs: 375 and 459), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0836] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A82_S36 (SEQ ID NOs: 219 and 303; or SEQ ID NOs: 387 and 471), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0837] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A83_S36 (SEQ ID NOs: 231 and 315; or SEQ ID NOs: 399 and 483), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0838] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--755_A84_S36 (SEQ ID NOs: 243 and 327; or SEQ ID NOs: 411 and 495), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0839] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A22_S26 (SEQ ID NOs: 173 and 257; or SEQ ID NOs: 341 and 425), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0840] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A25_S27 (SEQ ID NOs: 185 and 269; or SEQ ID NOs: 353 and 437), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0841] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A81_S26 (SEQ ID NOs: 197 and 281; or SEQ ID NOs: 365 and 449), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0842] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A48_S26 (SEQ ID NOs: 209 and 293; or SEQ ID NOs: 377 and 461), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0843] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A82_S36 (SEQ ID NOs: 221 and 305; or SEQ ID NOs: 389 and 473), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0844] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A83_S36 (SEQ ID NOs: 233 and 317; or SEQ ID NOs: 401 and 485), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0845] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--846_A84_S36 (SEQ ID NOs: 245 and 329; or SEQ ID NOs: 413 and 497), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0846] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A22_S26 (SEQ ID NOs: 174 and 258; or SEQ ID NOs: 342 and 426), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0847] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A25_S27 (SEQ ID NOs: 186 and 270; or SEQ ID NOs: 354 and 438), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0848] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A81_S26 (SEQ ID NOs: 198 and 282; or SEQ ID NOs: 366 and 450), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0849] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A48_S26 (SEQ ID NOs: 210 and 294; or SEQ ID NOs: 378 and 462), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0850] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A82_S36 (SEQ ID NOs: 222 and 306; or SEQ ID NOs: 390 and 474), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0851] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A83_S36 (SEQ ID NOs: 234 and 318; or SEQ ID NOs: 402 and 486), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0852] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--1360_A84_S36 (SEQ ID NOs: 246 and 330; or SEQ ID NOs: 414 and 498), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0853] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A22_S26 (SEQ ID NOs: 175 and 259; or SEQ ID NOs: 343 and 427), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0854] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A25_S27 (SEQ ID NOs: 187 and 271; or SEQ ID NOs: 355 and 439), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0855] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A81_S26 (SEQ ID NOs: 199 and 283; or SEQ ID NOs: 367 and 451), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0856] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A48_S26 (SEQ ID NOs: 211 and 295; or SEQ ID NOs: 379 and 463), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0857] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A82_S36 (SEQ ID NOs: 223 and 307; or SEQ ID NOs: 391 and 475), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0858] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A83_S36 (SEQ ID NOs: 235 and 319; or SEQ ID NOs: 403 and 487), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0859] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2030_A84_S36 (SEQ ID NOs: 247 and 331; or SEQ ID NOs: 415 and 499), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0860] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A22_S26 (SEQ ID NOs: 176 and 260; or SEQ ID NOs: 344 and 428), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0861] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A25_S27 (SEQ ID NOs: 188 and 272; or SEQ ID NOs: 356 and 440), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0862] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A81_S26 (SEQ ID NOs: 200 and 284; or SEQ ID NOs: 368 and 452), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0863] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A48_S26 (SEQ ID NOs: 212 and 296; or SEQ ID NOs: 380 and 464), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0864] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A82_S36 (SEQ ID NOs: 224 and 308; or SEQ ID NOs: 392 and 476), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0865] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A83_S36 (SEQ ID NOs: 236 and 320; or SEQ ID NOs: 404 and 488), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0866] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2034_A84_S36 (SEQ ID NOs: 248 and 332; or SEQ ID NOs: 416 and 500), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0867] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A22_S26 (SEQ ID NOs: 177 and 261; or SEQ ID NOs: 345 and 429), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0868] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A25_S27 (SEQ ID NOs: 189 and 273; or SEQ ID NOs: 357 and 441), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0869] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A81_S26 (SEQ ID NOs: 201 and 285; or SEQ ID NOs: 369 and 453), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0870] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A48_S26 (SEQ ID NOs: 213 and 297; or SEQ ID NOs: 381 and 465), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0871] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A82_S36 (SEQ ID NOs: 225 and 309; or SEQ ID NOs: 393 and 477), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0872] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A83_S36 (SEQ ID NOs: 237 and 321; or SEQ ID NOs: 405 and 489), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0873] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2138_A84_S36 (SEQ ID NOs: 249 and 333; or SEQ ID NOs: 417 and 501), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0874] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A22_S26 (SEQ ID NOs: 178 and 262; or SEQ ID NOs: 346 and 430), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0875] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A25_S27 (SEQ ID NOs: 190 and 274; or SEQ ID NOs: 358 and 442), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0876] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A81_S26 (SEQ ID NOs: 202 and 286; or SEQ ID NOs: 370 and 454), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0877] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A48_S26 (SEQ ID NOs: 214 and 298; or SEQ ID NOs: 382 and 466), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0878] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A82_S36 (SEQ ID NOs: 226 and 310; or SEQ ID NOs: 394 and 478), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0879] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A83_S36 (SEQ ID NOs: 238 and 322; or SEQ ID NOs: 406 and 490), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0880] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2153_A84_S36 (SEQ ID NOs: 250 and 334; or SEQ ID NOs: 418 and 502), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0881] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A22_S26 (SEQ ID NOs: 179 and 263; or SEQ ID NOs: 347 and 431), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0882] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A25_S27 (SEQ ID NOs: 191 and 275; or SEQ ID NOs: 359 and 443), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0883] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A81_S26 (SEQ ID NOs: 203 and 287; or SEQ ID NOs: 371 and 455), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0884] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A48_S26 (SEQ ID NOs: 215 and 299; or SEQ ID NOs: 383 and 467), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0885] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A82_S36 (SEQ ID NOs: 227 and 311; or SEQ ID NOs: 395 and 479), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0886] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A83_S36 (SEQ ID NOs: 239 and 323; or SEQ ID NOs: 407 and 491), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0887] An RNAi agent comprising a sense and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nt from the antisense strand of: hs_HSF1.sub.--2154_A84_S36 (SEQ ID NOs: 251 and 335; or SEQ ID NOs: 419 and 503), or modified or unmodified variants thereof, wherein the antisense strand optionally further comprises 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 or more nt (or any range thereof, e.g., 0-1, 1-2, 1-3, 1-4 nt, etc.).

[0888] In one embodiment, the disclosure comprises any one or more of the RNAi agent listed herein.

Additional Particular Specific Embodiments

[0889] Certain RNAi agents to HSF1 are disclosed in the scientific literature, e.g., in Rossi et al. 2006 Cancer Res. 66:7678-85; Dokladny et al. 2008 Am. J. Pathology 72:659-70; Jacobs et al. 2007 J. Biol. Chem. 282: 33412-20; Page et al. 2006 Mol. Biosystems 2:627-39; Zhao et al. 2007 Diabetes 56: 1436-1444; and Du et al. 2009 J. Cell. Phys. 218:631-637. The compositions of this disclosure do not cover these RNAi agents to the extent that they are identical in both sequence and modifications.

[0890] Other particular specific embodiments include compositions comprising 1, 2, 3, 4, or more of these RNAi agents. Another embodiment is a composition comprising any single RNAi agent, along with any other RNAi agents which overlap it. Another embodiment comprises two, three, four or more HSF1 RNAi agents which do not overlap and thus target different parts of the RNA molecule. When two or more RNAi agents are used, they can be administered simultaneously or sequentially.

[0891] Another particular specific embodiment comprises an RNAi agent, wherein the RNAi agent comprises a sense strand comprising at least 15 contiguous nucleotides (identical in sequence) to the sense strand of any of the listed RNAi agents, and an antisense strand comprising at least 15 contiguous nucleotides (identical in sequence) to the antisense strand of the same RNAi agent. In another embodiment, the composition comprises one, two, three, four, or more such RNAi agents.

[0892] In one embodiment, the composition comprises an RNAi agent which comprises an antisense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2 or 3 mismatches from the antisense strand of a RNAi agent described herein.

[0893] In one embodiment, the composition comprises an RNAi agent which comprises an antisense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2 or 3 mismatches from the antisense strand of a RNAi agent described herein.

[0894] In another embodiment, the composition comprises an RNAi agent which comprises a sense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 mismatches from the sense strand of one of the listed RNAi agents, and an antisense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2 or 3 mismatches from the antisense strand of the same RNAi agent.

[0895] A "mismatch" is defined herein as a difference between the base sequence or length when two sequences are maximally aligned and compared. As a non-limiting example, a mismatch is counted if a difference exists between the base at a particular location in one sequence and the base at the corresponding position in another sequence (e.g., between the sequence of a given RNAi agent and an RNAi agent listed herein). Thus, a mismatch is counted, for example, if a position in one sequence has a particular base (e.g., A), and the corresponding position on the other sequence has a different base (e.g., G, C or U). A mismatch is also counted, e.g., if a position in one sequence has a base (e.g., A), and the corresponding position on the other sequence has no base (e.g., that position is an abasic nucleotide which comprises a phosphate-sugar backbone but no base). A single-stranded nick in either sequence (or in the sense or antisense strand) is not counted as mismatch. Thus, as a non-limiting example, no mismatch would be counted if one sequence comprises the sequence A-G, but the other sequence comprises the sequence A-G with a single-stranded nick between the A and the G. A base modification is also not considered a mismatch. If one sequence comprises a C, and the other sequence comprises a modified C (e.g., with a 2'-modification) at the same position, no mismatch would be counted. Thus, modifications of a nucleotide other than replacement or alteration of the base would not constitute a mismatch. For example, no mismatch would occur between a nucleotide which is A, and a nucleotide which is A with a 5' modification (e.g., those illustrated in FIG. 1) and/or a 2'-modification. The key feature of a mismatch (base replacement) is that it would not be able to base-pair with the corresponding base on the opposite strand. Thus, substitution of U with T would not constitute a mismatch. Substitution of a RNA nucleotide with a DNA would also not constitute a mismatch, provided that the base is not changed. In addition, terminal overhangs such as "TT" or "UU" or "dTdT" or "sdTsdT" are not counted when counting the number of mismatches; the terminal "UU" and "dTdT" overhangs are also not included when calculating "15 contiguous nucleotides." This is because Elbashir et al. 2001 Nature 411: 494-498 showed that a terminal dinucleotide, such as dithymidine, does not contribute to target recognition. In addition, terminal caps (e.g., a 5' or 3' end cap) are not considered in counting mismatches.

[0896] In these embodiments, a mismatch is defined as a position wherein the base of one sequence does not match the base of the other sequence.

[0897] In another embodiment, the composition comprises 1, 2, 3, 4, or more such RNAi agents.

[0898] In another embodiment, the composition comprises an RNAi agent which comprises a sense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2 or 3 mismatches from the sense strand of one of the listed RNAi agents, and an antisense strand comprising at least 15 contiguous nucleotides differing by 0, 1, 2 or 3 mismatches from the antisense strand of the same RNAi agent.

EXAMPLES

Example 1

Sequences of RNAi Agents to HSF1

[0899] Table A1, above, provides a list correlating the nickname of a RNAi agent to HSF1 to SEQ ID NOs. of the target sequence, and unmodified and modified variants. The actual sequences are provided below.

[0900] Table 1 provides the sequences of the target sequences (antisense and sense).

[0901] Table 2 provides example unmodified variants of the RNAi agents to HSF1 (antisense and sense).

[0902] Table 3 provides example modified variants of the RNAi agents to HSF1 (antisense and sense). Seven different chemical modification formats are presented for several nucleotide duplex sequences. For each of these, the prefix of the duplex nickname indicates the position (nt) in the HSF1 transcript. Thus, hs_HSF1.sub.--562_begins at nt 562 of the HSF1 transcript. (Thus, all RNAI agents with the same prefix (e.g., hs_HSF1.sub.--562_) have the same nucleotide sequence despite differences in chemical modifications. The suffix (e.g., A22_S26) indicates a particular rule set used to design the set of chemical modifications.

Example 1A

HSF1 RNAi Agent Sequences and Target Sequences

[0903] Table 1. HSF1 RNAi Agent Target Sequences.

[0904] Provided are the nicknames of HSF1 RNAi agents, along with the Antisense (AS) and Sense (S) sequences to the target sequences (wherein each sequence nickname begins with hs_HSF1_*, where * is the nickname provided in each row; e.g., "175_A22_S26" is the same as "hs_HSF1.sub.--175_A22_S26", etc.). Note that the target sequences are presented as DNA (with DNA nucleotides and T instead of U). The corresponding RNAi agents would comprise the corresponding RNA sequence (with RNA nucleotides and U instead of T). The RNAi agents can, optionally, further comprise a terminal UU or TT on either or both strands, and can comprise modifications, as indicated below by example sets of modifications.

[0905] In various embodiments, the phraseology related to "an RNAi agent (with a sequence) of Table 1", "an RNAi agent comprising a first strand and a second strand, wherein the sequence of the first strand comprises (or is) the sequence of a strand of Table 1", and the like, indicate that a strand of the RNAi agent comprises (or has) a RNA sequence corresponding to a disclosed DNA sequence. For example, referring to Table 1, below, RNAi agent (duplex) 175_A22_S26 would comprise one strand having the RNA sequence of UCCAUCUCGAGCAAGGAGG (SEQ ID NO: 514) and one strand having the RNA sequence of CCUCCUUGCUCGAGAUGGA (SEQ ID NO: 515). Example RNAi agents corresponding to these target sequences are provided in Table 2.

TABLE-US-00004 TABLE 1 HSF1 RNAi Agent Target Sequences. Original SEQ Original SEQ Antisense ID Sense ID Nickname Sequence NO: Sequence NO: 175_A22_S26 TCCATCTCGAGCAAGGAGG 12 CCTCCTTGCTCGAGATGGA 96 175_A25_S27 TCCATCTCGAGCAAGGAGG 24 CCTCCTTGCTCGAGATGGA 108 175_A81_S26 TCCATCTCGAGCAAGGAGG 36 CCTCCTTGCTCGAGATGGA 120 175_A48_S26 TCCATCTCGAGCAAGGAGG 48 CCTCCTTGCTCGAGATGGA 132 175_A82_S36 TCCATCTCGAGCAAGGAGG 60 CCTCCTTGCTCGAGATGGA 144 175_A83_S36 TCCATCTCGAGCAAGGAGG 72 CCTCCTTGCTCGAGATGGA 156 175_A84_S36 TCCATCTCGAGCAAGGAGG 84 CCTCCTTGCTCGAGATGGA 168 517_A22_S26 TTGATGTTCTCAAGGAGCT 4 AGCTCCTTGAGAACATCAA 88 517_A25_S27 TTGATGTTCTCAAGGAGCT 16 AGCTCCTTGAGAACATCAA 100 517_A81_S26 TTGATGTTCTCAAGGAGCT 28 AGCTCCTTGAGAACATCAA 112 517_A48_S26 TTGATGTTCTCAAGGAGCT 40 AGCTCCTTGAGAACATCAA 124 517_A82_S36 TTGATGTTCTCAAGGAGCT 52 AGCTCCTTGAGAACATCAA 136 517_A83_S36 TTGATGTTCTCAAGGAGCT 64 AGCTCCTTGAGAACATCAA 148 517_A84_S36 TTGATGTTCTCAAGGAGCT 76 AGCTCCTTGAGAACATCAA 160 562_A22_S26 TTTATGTCTTCACTCTTCA 1 TGAAGAGTGAAGACATAAA 85 562_A25_S27 TTTATGTCTTCACTCTTCA 13 TGAAGAGTGAAGACATAAA 97 562_A81_S26 TTTATGTCTTCACTCTTCA 25 TGAAGAGTGAAGACATAAA 109 562_A48_S26 TTTATGTCTTCACTCTTCA 37 TGAAGAGTGAAGACATAAA 121 562_A82_S36 TTTATGTCTTCACTCTTCA 49 TGAAGAGTGAAGACATAAA 133 562_A83_S36 TTTATGTCTTCACTCTTCA 61 TGAAGAGTGAAGACATAAA 145 562_A84_S36 TTTATGTCTTCACTCTTCA 73 TGAAGAGTGAAGACATAAA 157 751_A22_S26 ATCAGGAACTGAATGAGCT 2 AGCTCATTCAGTTCCTGAT 86 751_A25_S27 ATCAGGAACTGAATGAGCT 14 AGCTCATTCAGTTCCTGAT 98 751_A81_S26 ATCAGGAACTGAATGAGCT 26 AGCTCATTCAGTTCCTGAT 110 751_A48_S26 ATCAGGAACTGAATGAGCT 38 AGCTCATTCAGTTCCTGAT 122 751_A82_S36 ATCAGGAACTGAATGAGCT 50 AGCTCATTCAGTTCCTGAT 134 751_A83_S36 ATCAGGAACTGAATGAGCT 62 AGCTCATTCAGTTCCTGAT 146 751_A84_S36 ATCAGGAACTGAATGAGCT 74 AGCTCATTCAGTTCCTGAT 158 755_A22_S26 TGAGATCAGGAACTGAATG 3 CATTCAGTTCCTGATCTCA 87 755_A25_S27 TGAGATCAGGAACTGAATG 15 CATTCAGTTCCTGATCTCA 99 755_A81_S26 TGAGATCAGGAACTGAATG 27 CATTCAGTTCCTGATCTCA 111 755_A48_S26 TGAGATCAGGAACTGAATG 39 CATTCAGTTCCTGATCTCA 123 755_A82_S36 TGAGATCAGGAACTGAATG 51 CATTCAGTTCCTGATCTCA 135 755_A83_S36 TGAGATCAGGAACTGAATG 63 CATTCAGTTCCTGATCTCA 147 755_A84_S36 TGAGATCAGGAACTGAATG 75 CATTCAGTTCCTGATCTCA 159 846_A22_S26 TATACTTGGGCATGGAATG 5 CATTCCATGCCCAAGTATA 89 846_A25_S27 TATACTTGGGCATGGAATG 17 CATTCCATGCCCAAGTATA 101 846_A81_S26 TATACTTGGGCATGGAATG 29 CATTCCATGCCCAAGTATA 113 846_A48_S26 TATACTTGGGCATGGAATG 41 CATTCCATGCCCAAGTATA 125 846_A82_S36 TATACTTGGGCATGGAATG 53 CATTCCATGCCCAAGTATA 137 846_A83_S36 TATACTTGGGCATGGAATG 65 CATTCCATGCCCAAGTATA 149 846_A84_S36 TATACTTGGGCATGGAATG 77 CATTCCATGCCCAAGTATA 161 1360_A22_S26 TTATCCAGGTTGGAGTCCA 6 TGGACTCCAACCTGGATAA 90 1360_A25_S27 TTATCCAGGTTGGAGTCCA 18 TGGACTCCAACCTGGATAA 102 1360_A81_S26 TTATCCAGGTTGGAGTCCA 30 TGGACTCCAACCTGGATAA 114 1360_A48_S26 TTATCCAGGTTGGAGTCCA 42 TGGACTCCAACCTGGATAA 126 1360_A82_S36 TTATCCAGGTTGGAGTCCA 54 TGGACTCCAACCTGGATAA 138 1360_A83_S36 TTATCCAGGTTGGAGTCCA 66 TGGACTCCAACCTGGATAA 150 1360_A84_S36 TTATCCAGGTTGGAGTCCA 78 TGGACTCCAACCTGGATAA 162 2030_A22_S26 ATTCTGACTATGAACAACC 7 GGTTGTTCATAGTCAGAAT 91 2030_A25_S27 ATTCTGACTATGAACAACC 19 GGTTGTTCATAGTCAGAAT 103 2030_A81_S26 ATTCTGACTATGAACAACC 31 GGTTGTTCATAGTCAGAAT 115 2030_A48_S26 ATTCTGACTATGAACAACC 43 GGTTGTTCATAGTCAGAAT 127 2030_A82_S36 ATTCTGACTATGAACAACC 55 GGTTGTTCATAGTCAGAAT 139 2030_A83_S36 ATTCTGACTATGAACAACC 67 GGTTGTTCATAGTCAGAAT 151 2030_A84_S36 ATTCTGACTATGAACAACC 79 GGTTGTTCATAGTCAGAAT 163 2034_A22_S26 TACAATTCTGACTATGAAC 8 GTTCATAGTCAGAATTGTA 92 2034_A25_S27 TACAATTCTGACTATGAAC 20 GTTCATAGTCAGAATTGTA 104 2034_A81_S26 TACAATTCTGACTATGAAC 32 GTTCATAGTCAGAATTGTA 116 2034_A48_S26 TACAATTCTGACTATGAAC 44 GTTCATAGTCAGAATTGTA 128 2034_A82_S36 TACAATTCTGACTATGAAC 56 GTTCATAGTCAGAATTGTA 140 2034_A83_S36 TACAATTCTGACTATGAAC 68 GTTCATAGTCAGAATTGTA 152 2034_A84_S36 TACAATTCTGACTATGAAC 80 GTTCATAGTCAGAATTGTA 164 2138_A22_S26 TCTGTTTATAGATCTCTGC 9 GCAGAGATCTATAAACAGA 93 2138_A25_S27 TCTGTTTATAGATCTCTGC 21 GCAGAGATCTATAAACAGA 105 2138_A81_S26 TCTGTTTATAGATCTCTGC 33 GCAGAGATCTATAAACAGA 117 2138_A48_S26 TCTGTTTATAGATCTCTGC 45 GCAGAGATCTATAAACAGA 129 2138_A82_S36 TCTGTTTATAGATCTCTGC 57 GCAGAGATCTATAAACAGA 141 2138_A83_S36 TCTGTTTATAGATCTCTGC 69 GCAGAGATCTATAAACAGA 153 2138_A84_S36 TCTGTTTATAGATCTCTGC 81 GCAGAGATCTATAAACAGA 165 2153_A22_S26 TTAGCATAGAGCCTGTCTG 10 CAGACAGGCTCTATGCTAA 94 2153_A25_S27 TTAGCATAGAGCCTGTCTG 22 CAGACAGGCTCTATGCTAA 106 2153_A81_S26 TTAGCATAGAGCCTGTCTG 34 CAGACAGGCTCTATGCTAA 118 2153_A48_S26 TTAGCATAGAGCCTGTCTG 46 CAGACAGGCTCTATGCTAA 130 2153_A82_S36 TTAGCATAGAGCCTGTCTG 58 CAGACAGGCTCTATGCTAA 142 2153_A83_S36 TTAGCATAGAGCCTGTCTG 70 CAGACAGGCTCTATGCTAA 154 2153_A84_S36 TTAGCATAGAGCCTGTCTG 82 CAGACAGGCTCTATGCTAA 166 2154_A22_S26 TTTAGCATAGAGCCTGTCT 11 AGACAGGCTCTATGCTAAA 95 2154_A25_S27 TTTAGCATAGAGCCTGTCT 23 AGACAGGCTCTATGCTAAA 107 2154_A81_S26 TTTAGCATAGAGCCTGTCT 35 AGACAGGCTCTATGCTAAA 119 2154_A48_S26 TTTAGCATAGAGCCTGTCT 47 AGACAGGCTCTATGCTAAA 131 2154_A82_S36 TTTAGCATAGAGCCTGTCT 59 AGACAGGCTCTATGCTAAA 143 2154_A83_S36 TTTAGCATAGAGCCTGTCT 71 AGACAGGCTCTATGCTAAA 155 2154_A84_S36 TTTAGCATAGAGCCTGTCT 83 AGACAGGCTCTATGCTAAA 167

Example 1B

HSF1 RNAi Agent Sequences. (Unmodified)

[0906] Table 2. HSF1 RNAi Agent Sequences. (Example Unmodified)

[0907] Provided are the nicknames and unmodified variants of RNAi agents (wherein each sequence nickname begins with hs_HSF1_*, where * is the nickname provided in each row; e.g., "175_A22_S26" is the same as "hs_HSF1.sub.--175_A22_S26", etc.).

TABLE-US-00005 TABLE 2 Unmodified variants Original Antisense SEQ Original Sense SEQ Sequence ID Sequence ID Nickname (Generic RNA View) NO: (Generic RNA View) NO: 175_A22_S26 UCCAUCUCGAGCAAGGAGG 180 CCUCCUUGCUCGAGAUGGA 264 175_A25_S27 UCCAUCUCGAGCAAGGAGG 192 CCUCCUUGCUCGAGAUGGA 276 175_A81_S26 UCCAUCUCGAGCAAGGAGG 204 CCUCCUUGCUCGAGAUGGA 288 175_A48_S26 UCCAUCUCGAGCAAGGAGG 216 CCUCCUUGCUCGAGAUGGA 300 175_A82_S36 UCCAUCUCGAGCAAGGAGG 228 CCUCCUUGCUCGAGAUGGA 312 175_A83_S36 UCCAUCUCGAGCAAGGAGG 240 CCUCCUUGCUCGAGAUGGA 324 175_A84_S36 UCCAUCUCGAGCAAGGAGG 252 CCUCCUUGCUCGAGAUGGA 336 517_A22_S26 UUGAUGUUCUCAAGGAGCU 172 AGCUCCUUGAGAACAUCAA 256 517_A25_S27 UUGAUGUUCUCAAGGAGCU 184 AGCUCCUUGAGAACAUCAA 268 517_A81_S26 UUGAUGUUCUCAAGGAGCU 196 AGCUCCUUGAGAACAUCAA 280 517_A48_S26 UUGAUGUUCUCAAGGAGCU 208 AGCUCCUUGAGAACAUCAA 292 517_A82_S36 UUGAUGUUCUCAAGGAGCU 220 AGCUCCUUGAGAACAUCAA 304 517_A83_S36 UUGAUGUUCUCAAGGAGCU 232 AGCUCCUUGAGAACAUCAA 316 517_A84_S36 UUGAUGUUCUCAAGGAGCU 244 AGCUCCUUGAGAACAUCAA 328 562_A22_S26 UUUAUGUCUUCACUCUUCA 169 UGAAGAGUGAAGACAUAAA 253 562_A25_S27 UUUAUGUCUUCACUCUUCA 181 UGAAGAGUGAAGACAUAAA 265 562_A81_S26 UUUAUGUCUUCACUCUUCA 193 UGAAGAGUGAAGACAUAAA 277 562_A48_S26 UUUAUGUCUUCACUCUUCA 205 UGAAGAGUGAAGACAUAAA 289 562_A82_S36 UUUAUGUCUUCACUCUUCA 217 UGAAGAGUGAAGACAUAAA 301 562_A83_S36 UUUAUGUCUUCACUCUUCA 229 UGAAGAGUGAAGACAUAAA 313 562_A84_S36 UUUAUGUCUUCACUCUUCA 241 UGAAGAGUGAAGACAUAAA 325 751_A22_S26 AUCAGGAACUGAAUGAGCU 170 AGCUCAUUCAGUUCCUGAU 254 751_A25_S27 AUCAGGAACUGAAUGAGCU 182 AGCUCAUUCAGUUCCUGAU 266 751_A81_S26 AUCAGGAACUGAAUGAGCU 194 AGCUCAUUCAGUUCCUGAU 278 751_A48_S26 AUCAGGAACUGAAUGAGCU 206 AGCUCAUUCAGUUCCUGAU 290 751_A82_S36 AUCAGGAACUGAAUGAGCU 218 AGCUCAUUCAGUUCCUGAU 302 751_A83_S36 AUCAGGAACUGAAUGAGCU 230 AGCUCAUUCAGUUCCUGAU 314 751_A84_S36 AUCAGGAACUGAAUGAGCU 242 AGCUCAUUCAGUUCCUGAU 326 755_A22_S26 UGAGAUCAGGAACUGAAUG 171 CAUUCAGUUCCUGAUCUCA 255 755_A25_S27 UGAGAUCAGGAACUGAAUG 183 CAUUCAGUUCCUGAUCUCA 267 755_A81_S26 UGAGAUCAGGAACUGAAUG 195 CAUUCAGUUCCUGAUCUCA 279 755_A48_S26 UGAGAUCAGGAACUGAAUG 207 CAUUCAGUUCCUGAUCUCA 291 755_A82_S36 UGAGAUCAGGAACUGAAUG 219 CAUUCAGUUCCUGAUCUCA 303 755_A83_S36 UGAGAUCAGGAACUGAAUG 231 CAUUCAGUUCCUGAUCUCA 315 755_A84_S36 UGAGAUCAGGAACUGAAUG 243 CAUUCAGUUCCUGAUCUCA 327 846_A22_S26 UAUACUUGGGCAUGGAAUG 173 CAUUCCAUGCCCAAGUAUA 257 846_A25_S27 UAUACUUGGGCAUGGAAUG 185 CAUUCCAUGCCCAAGUAUA 269 846_A81_S26 UAUACUUGGGCAUGGAAUG 197 CAUUCCAUGCCCAAGUAUA 281 846_A48_S26 UAUACUUGGGCAUGGAAUG 209 CAUUCCAUGCCCAAGUAUA 293 846_A82_S36 UAUACUUGGGCAUGGAAUG 221 CAUUCCAUGCCCAAGUAUA 305 846_A83_S36 UAUACUUGGGCAUGGAAUG 233 CAUUCCAUGCCCAAGUAUA 317 846_A84_S36 UAUACUUGGGCAUGGAAUG 245 CAUUCCAUGCCCAAGUAUA 329 1360_A22_S26 UUAUCCAGGUUGGAGUCCA 174 UGGACUCCAACCUGGAUAA 258 1360_A25_S27 UUAUCCAGGUUGGAGUCCA 186 UGGACUCCAACCUGGAUAA 270 1360_A81_S26 UUAUCCAGGUUGGAGUCCA 198 UGGACUCCAACCUGGAUAA 282 1360_A48_S26 UUAUCCAGGUUGGAGUCCA 210 UGGACUCCAACCUGGAUAA 294 1360_A82_S36 UUAUCCAGGUUGGAGUCCA 222 UGGACUCCAACCUGGAUAA 306 1360_A83_S36 UUAUCCAGGUUGGAGUCCA 234 UGGACUCCAACCUGGAUAA 318 1360_A84_S36 UUAUCCAGGUUGGAGUCCA 246 UGGACUCCAACCUGGAUAA 330 2030_A22_S26 AUUCUGACUAUGAACAACC 175 GGUUGUUCAUAGUCAGAAU 259 2030_A25_S27 AUUCUGACUAUGAACAACC 187 GGUUGUUCAUAGUCAGAAU 271 2030_A81_S26 AUUCUGACUAUGAACAACC 199 GGUUGUUCAUAGUCAGAAU 283 2030_A48_S26 AUUCUGACUAUGAACAACC 211 GGUUGUUCAUAGUCAGAAU 295 2030_A82_S36 AUUCUGACUAUGAACAACC 223 GGUUGUUCAUAGUCAGAAU 307 2030_A83_S36 AUUCUGACUAUGAACAACC 235 GGUUGUUCAUAGUCAGAAU 319 2030_A84_S36 AUUCUGACUAUGAACAACC 247 GGUUGUUCAUAGUCAGAAU 331 2034_A22_S26 UACAAUUCUGACUAUGAAC 176 GUUCAUAGUCAGAAUUGUA 260 2034_A25_S27 UACAAUUCUGACUAUGAAC 188 GUUCAUAGUCAGAAUUGUA 272 2034_A81_S26 UACAAUUCUGACUAUGAAC 200 GUUCAUAGUCAGAAUUGUA 284 2034_A48_S26 UACAAUUCUGACUAUGAAC 212 GUUCAUAGUCAGAAUUGUA 296 2034_A82_S36 UACAAUUCUGACUAUGAAC 224 GUUCAUAGUCAGAAUUGUA 308 2034_A83_S36 UACAAUUCUGACUAUGAAC 236 GUUCAUAGUCAGAAUUGUA 320 2034_A84_S36 UACAAUUCUGACUAUGAAC 248 GUUCAUAGUCAGAAUUGUA 332 2138_A22_S26 UCUGUUUAUAGAUCUCUGC 177 GCAGAGAUCUAUAAACAGA 261 2138_A25_S27 UCUGUUUAUAGAUCUCUGC 189 GCAGAGAUCUAUAAACAGA 273 2138_A81_S26 UCUGUUUAUAGAUCUCUGC 201 GCAGAGAUCUAUAAACAGA 285 2138_A48_S26 UCUGUUUAUAGAUCUCUGC 213 GCAGAGAUCUAUAAACAGA 297 2138_A82_S36 UCUGUUUAUAGAUCUCUGC 225 GCAGAGAUCUAUAAACAGA 309 2138_A83_S36 UCUGUUUAUAGAUCUCUGC 237 GCAGAGAUCUAUAAACAGA 321 2138_A84_S36 UCUGUUUAUAGAUCUCUGC 249 GCAGAGAUCUAUAAACAGA 333 2153_A22_S26 UUAGCAUAGAGCCUGUCUG 178 CAGACAGGCUCUAUGCUAA 262 2153_A25_S27 UUAGCAUAGAGCCUGUCUG 190 CAGACAGGCUCUAUGCUAA 274 2153_A81_S26 UUAGCAUAGAGCCUGUCUG 202 CAGACAGGCUCUAUGCUAA 286 2153_A48_S26 UUAGCAUAGAGCCUGUCUG 214 CAGACAGGCUCUAUGCUAA 298 2153_A82_S36 UUAGCAUAGAGCCUGUCUG 226 CAGACAGGCUCUAUGCUAA 310 2153_A83_S36 UUAGCAUAGAGCCUGUCUG 238 CAGACAGGCUCUAUGCUAA 322 2153_A84_S36 UUAGCAUAGAGCCUGUCUG 250 CAGACAGGCUCUAUGCUAA 334 2154_A22_S26 UUUAGCAUAGAGCCUGUCU 179 AGACAGGCUCUAUGCUAAA 263 2154_A25_S27 UUUAGCAUAGAGCCUGUCU 191 AGACAGGCUCUAUGCUAAA 275 2154_A81_S26 UUUAGCAUAGAGCCUGUCU 203 AGACAGGCUCUAUGCUAAA 287 2154_A48_S26 UUUAGCAUAGAGCCUGUCU 215 AGACAGGCUCUAUGCUAAA 299 2154_A82_S36 UUUAGCAUAGAGCCUGUCU 227 AGACAGGCUCUAUGCUAAA 311 2154_A83_S36 UUUAGCAUAGAGCCUGUCU 239 AGACAGGCUCUAUGCUAAA 323 2154_A84_S36 UUUAGCAUAGAGCCUGUCU 251 AGACAGGCUCUAUGCUAAA 335

[0908] Note that the sequences in Table 2 represent the HSF1 portion of sense and antisense strands of various RNAi agents. Each strand can further comprise a UU dinucleotide at one or both 3' ends, as shown in Table 3.

Example 1C

HSF1 RNAi Agent Sequences. (Modified)

[0909] Table 3. HSF1 RNAi Agent Sequences. (Example Modified)

[0910] Provided are nicknames and example modified variants for HSF1 RNAi agents. Each of several RNAi agent duplexes is presented in seven different chemical modification formats. Abbreviations are as follows:

002 DNA

004 2'Ome

005 2'MOE

[0911] Thus, U004 indicates a nucleotide with a U base with a 2'Ome modification; U002 indicates a nucleotide with a U base which is DNA; U005 indicates a base with a U base with a 2'MOE modification. Similarly, other nucleotides are modified, e.g., C004 indicates a nucleotide with a C base and a 2'Ome modification. Example modified nucleotides are shown in FIG. 1. Also note that the sequences in Table 3 comprise a UU dinucleotide; this not part of the HSF1 sequence.

TABLE-US-00006 TABLE 3 Example modified variants SEQ SEQ Antisense Sequence ID Sense Sequence ID Nickname (Short View) NO: (Short View) NO: 175_A22_S26 UCC004 AUCUCGAGC004 348 C004 C004 U004 C004 432 AAGGAGGU004 U004 C004 U004 U004 GC004 U004 C004 GAGAU004 GGAU004 U004 175_A25_S27 UCCAUCUCGAGCAAGGAGGU004 360 CCUCCUUGCUCGAGAUGGAU004 444 U004 U004 175_A81_S26 UCC004 AU004 C004 U004 372 C004 C004 U004 C004 456 C004 GAGC004 AAGGAGGU004 C004 U004 U004 GC004 U004 U004 C004 GAGAU004 GGAU004 U004 175_A48_S26 U002 CC004 AUCUCGAGC004 384 C004 C004 U004 C004 468 AAGGAGGU004 U004 C004 U004 U004 GC004 U004 C004 GAGAU004 GGAU004 U004 175_A82_S36 U002 CC004 AUCUCGAGC004 396 C005 C005 UC004 CUUG004 480 AAGGAG005 G005 U004 U004 CUCG004 AGA004 UGG005 A005 U004 U004 175_A83_S36 U002 CC004 AUCU004 408 C005 C005 UC004 CUUG004 492 CGA004 GCAAG004 GAG005 CUCG004 AGA004 UGG005 G005 U004 U004 A005 U004 U004 175_A84_S36 U002 CC005 AUCU005 420 C005 C005 UC004 CUUG004 504 CGA005 GCAAG005 GAG005 CUCG004 AGA004 UGG005 G005 U004 U004 A005 U004 U004 517_A22_S26 UUGAUGUUCUC004 340 AGC004 U004 C004 C004 424 AAGGAGCUU004 U004 U004 U004 GAGAAC004 AU004 C004 AAU004 U004 517_A25_S27 UUGAUGUUCUCAAGGAGCUU004 352 AGCUCCUUGAGAACAUCAAU004 436 U004 U004 517_A81_S26 UUGAU004 GU004 U004 C004 364 AGC004 U004 C004 C004 448 U004 C004 AAGGAGC004 U004 U004 GAGAAC004 U004 U004 U004 AU004 C004 AAU004 U004 517_A48_S26 U002 UGAUGUUCUC004 376 AGC004 U004 C004 C004 460 AAGGAGCUU004 U004 U004 U004 GAGAAC004 AU004 C004 AAU004 U004 517_A82_S36 U002 UGAUGUUCUC004 388 A005 G005 CU004 CCUU004 472 AAGGAGC005 U005 U004 GAGA004 ACA004 UCA005 U004 A005 U004 U004 517_A83_S36 U002 UG004 AUGU004 400 A005 G005 CU004 CCUU004 484 UCU004 CAAGG004 AGC005 GAGA004 ACA004 UCA005 U005 U004 U004 A005 U004 U004 517_A84_S36 U002 UG005 AUGU005 412 A005 G005 CU004 CCUU004 496 UCU005 CAAGG005 AGC005 GAGA004 ACA004 UCA005 U005 U004 U004 A005 U004 U004 562_A22_S26 UUU004 AUGUCUUC004 337 U004 GAAGAGU004 421 ACUCUUC004 AU004 U004 GAAGAC004 AU004 AAAU004 U004 562_A25_S27 UUUAUGUCUUCACUCUUCAU004 349 UGAAGAGUGAAGACAUAAAU004 433 U004 U004 562_A81_S26 UUU004 AU004 GU004 C004 361 U004 GAAGAGU004 445 U004 U004 C004 ACUC004 GAAGAC004 AU004 AAAU004 U004 U004 C004 AU004 U004 U004 562_A48_S26 U002 UU004 AUGUCUUC004 373 U004 GAAGAGU004 457 ACUCUUC004 AU004 U004 GAAGAC004 AU004 AAAU004 U004 562_A82_S36 U002 UU004 AUGUCUUC004 385 U005 G005 AA004 GAGU004 469 ACUCUUC005 A005 U004 GAAG004 ACA004 UAA005 U004 A005 U004 U004 562_A83_S36 U002 UU004 AUGU004 397 U005 G005 AA004 GAGU004 481 CUU004 CACUC004 UUC005 GAAG004 ACA004 UAA005 A005 U004 U004 A005 U004 U004 562_A84_S36 U002 UU005 AUGU005 409 U005 G005 AA004 GAGU004 493 CUU005 CACUC005 UUC005 GAAG004 ACA004 UAA005 A005 U004 U004 A005 U004 U004 751_A22_S26 AUC004 338 AGC004 U004 0004 AU004 422 AGGAACUGAAUGAGCUU004 U004 C004 AGU004 U004 U004 C004 C004 U004 GAU004 U004 U004 751_A25_S27 AUCAGGAACUGAAUGAGCUU004 350 AGCUCAUUCAGUUCCUGAUU004 434 U004 U004 751_A81_S26 AUC004 AGGAAC004 U004 362 AGC004 U004 C004 AU004 446 GAAUGAGC004 U004 U004 U004 C004 AGU004 U004 U004 C004 C004 U004 GAU004 U004 U004 751_A48_S26 A002 UC004 374 AGC004 U004 C004 AU004 458 AGGAACUGAAUGAGCUU004 U004 C004 AGU004 U004 U004 C004 C004 U004 GAU004 U004 U004 751_A82_S36 A002 UC004 386 A005 G005 CU004 CAUU004 470 AGGAACUGAAUGAGC005 U005 CAGU004 UCC004 UGA005 U004 U004 U005 U004 U004 751_A83_S36 A002 UC004 AGGA004 398 A005 G005 CU004 CAUU004 482 ACU004 GAAUG004 AGC005 CAGU004 UCC004 UGA005 U005 U004 U004 U005 U004 U004 751_A84_S36 A002 UC005 AGGA005 410 A005 G005 CU004 CAUU004 494 ACU005 GAAUG005 AGC005 CAGU004 UCC004 UGA005 U005 U004 U004 U005 U004 U004 755_A22_S26 UGAGAUC004 339 C004 AU004 U004 C004 423 AGGAACUGAAUGU004 U004 AGU004 U004 C004 C004 U004 GAU004 C004 U004 C004 AU004 U004 755_A25_S27 UGAGAUCAGGAACUGAAUGU004 351 CAUUCAGUUCCUGAUCUCAU004 435 U004 U004 755_A81_S26 UGAGAU004 C004 363 C004 AU004 U004 C004 447 AGGAACUGAAU004 GU004 AGU004 U004 C004 C004 U004 U004 GAU004 C004 U004 C004 AU004 U004 755_A48_S26 U002 GAGAUC004 375 C004 AU004 U004 C004 459 AGGAACUGAAUGU004 U004 AGU004 U004 C004 C004 U004 GAU004 C004 U004 C004 AU004 U004 755_A82_S36 U002 GAGAUC004 387 C005 A005 UU004 CAGU004 471 AGGAACUGAAU005 G005 U004 UCCU004 GAU004 CUC005 U004 A005 U004 U004 755_A83_S36 U002 GA004 GAUC004 399 C005 A005 UU004 CAGU004 483 AGG004 AACUG004 AAU005 UCCU004 GAU004 CUC005 G005 U004 U004 A005 U004 U004 755_A84_S36 U002 GA005 GAUC005 411 C005 A005 UU004 CAGU004 495 AGG005 AACUG005 AAU005 UCCU004 GAU004 CUC005 G005 U004 U004 A005 U004 U004 846_A22_S26 U004 AU004 ACUUGGGC004 341 C004 AU004 U004 C004 425 AUGGAAUGU004 U004 C004 AU004 GC004 C004 C004 AAGU004 AU004 AU004 U004 846_A25_S27 UAUACUUGGGCAUGGAAUGU004 353 CAUUCCAUGCCCAAGUAUAU004 437 U004 U004 846_A81_S26 UAU004 AC004 U004 U004 365 C004 AU004 U004 C004 449 GGGC004 AUGGAAU004 GU004 C004 AU004 GC004 C004 U004 C004 AAGU004 AU004 AU004 U004 846_A48_S26 U002 AU004 ACUUGGGC004 377 C004 AU004 U004 C004 461 AUGGAAUGU004 U004 C004 AU004 GC004 C004 C004 AAGU004 AU004 AU004 U004 846_A82_S36 U002 AU004 ACUUGGGC004 389 C005 A005 UU004 CCAU004 473 AUGGAAU005 G005 U004 GCCC004 AAG004 UAU005 U004 A005 U004 U004 846_A83_S36 U002 AU004 ACUU004 401 C005 A005 UU004 CCAU004 485 GGG004 CAUGG004 AAU005 GCCC004 AAG004 UAU005 G005 U004 U004 A005 U004 U004 846_A84_S36 U002 AU005 ACUU005 413 C005 A005 UU004 CCAU004 497 GGG005 CAUGG005 AAU005 GCCC004 AAG004 UAU005 G005 U004 U004 A005 U004 U004 1360_A22_S26 UU004 AUCC004 342 U004 GGAC004 U004 0004 426 AGGUUGGAGUCC004 AU004 C004 AAC004 C004 U004 U004 GGAU004 AAU004 U004 1360_A25_S27 UUAUCCAGGUUGGAGUCCAU004 354 UGGACUCCAACCUGGAUAAU004 438 U004 U004 1360_A81_S26 UUAU004 C004 C004 366 U004 GGAC004 U004 C004 450 AGGU004 U004 GGAGU004 C004 AAC004 C004 U004 C004 C004 AU004 U004 GGAU004 AAU004 U004 1360_A48_S26 U002 U004 AUCC004 378 U004 GGAC004 U004 C004 462 AGGUUGGAGUCC004 AU004 C004 AAC004 C004 U004 U004 GGAU004 AAU004 U004 1360_A82_S36 U002 U004 AUCC004 390 U005 G005 GA004 CUCC004 474 AGGUUGGAGUCC005 A005 AACC004 UGG004 AUA005 U004 U004 A005 U004 U004 1360_A83_S36 U002 UA004 UCCA004 402 U005 G005 GA004 CUCC004 486 GGU004 UGGAG004 UCC005 AACC004 UGG004 AUA005 A005 U004 U004 A005 U004 U004 1360_A84_S36 U002 UA005 UCCA005 414 U005 G005 GA004 CUCC004 498 GGU005 UGGAG005 UCC005 AACC004 UGG004 AUA005 A005 U004 U004 A005 U004 U004 2030_A22_S26 AUUCUGACU004 AUGAAC004 343 GGU004 U004 GU004 U004 427 AACCU004 U004 C004 AU004 AGU004 C004 AGAAU004 U004 U004 2030_A25_S27 AUUCUGACUAUGAACAACCU004 355 GGUUGUUCAUAGUCAGAAUU004 439 U004 U004 2030_A81_S26 AUU004 C004 U004 GAC004 367 GGU004 U004 GU004 U004 451 U004 AU004 GAAC004 C004 AU004 AGU004 C004 AAC004 C004 U004 U004 AGAAU004 U004 U004 2030_A48_S26 A002 UUCUGACU004 379 GGU004 U004 GU004 U004 463 AUGAAC004 AACCU004 U004 C004 AU004 AGU004 C004 AGAAU004 U004 U004 2030_A82_S36 A002 UUCUGACU004 391 G005 G005 UU004 GUUC004 475 AUGAAC004 AAC005 C005 AUAG004 UCA004 GAA005 U004 U004 U005 U004 U004 2030_A83_S36 A002 UU004 CUGA004 403 G005 G005 UU004 GUUC004 487 CUA004 UGAAC004 AAC005 AUAG004 UCA004 GAA005 C005 U004 U004 U005 U004 U004 2030_A84_S36 A002 UU005 CUGA005 415 G005 G005 UU004 GUUC004 499 CUA005 UGAAC005 AAC005 AUAG004 UCA004 GAA005 C005 U004 U004 U005 U004 U004 2034_A22_S26 U004 AC004 AAUUCUGACU004 344 GU004 U004 C004 AU004 428 AUGAACU004 U004 AGU004 C004 AGAAU004 U004 GU004 AU004 U004 2034_A25_S27 UACAAUUCUGACUAUGAACU004 356 GUUCAUAGUCAGAAUUGUAU004 440 U004 U004 2034_A81_S26 UAC004 AAU004 U004 C004 368 GU004 U004 C004 AU004 452 U004 GAC004 UAU004 AGU004 C004 AGAAU004 GAAC004 U004 U004 U004 GU004 AU004 U004 2034_A48_S26 U002 AC004 AAUUCUGACU004 380 GU004 U004 C004 AU004 464 AUGAACU004 U004 AGU004 C004 AGAAU004 U004 GU004 AU004 U004

2034_A82_S36 U002 AC004 AAUUCUGACU004 392 G005 U005 UC004 AUAG004 476 AUGAA005 C005 U004 U004 UCAG004 AAU004 UGU005 A005 U004 U004 2034_A83_S36 U002 AC004 AAUU004 404 G005 U005 UC004 AUAG004 488 CUG004 ACUAU004 GAA005 UCAG004 AAU004 UGU005 C005 U004 U004 A005 U004 U004 2034_A84_S36 U002 AC005 AAUU005 416 G005 U005 UC004 AUAG004 500 CUG005 ACUAU005 GAA005 UCAG004 AAU004 UGU005 C005 U004 U004 A005 U004 U004 2138_A22_S26 UCUGUUU004 AU004 345 GC004 AGAGAU004 C004 429 AGAUCUCUGCU004 U004 U004 AU004 AAAC004 AGAU004 U004 2138_A25_S27 UCUGUUUAUAGAUCUCUGCU004 357 GCAGAGAUCUAUAAACAGAU004 441 U004 U004 2138_A81_S26 UCU004 GU004 U004 U004 369 GC004 AGAGAU004 C004 453 AU004 AGAUCU004 C004 U004 AU004 AAAC004 U004 GC004 U004 U004 AGAU004 U004 2138_A48_S26 U002 CUGUUU004 AU004 381 GC004 AGAGAU004 C004 465 AGAUCUCUGCU004 U004 U004 AU004 AAAC004 AGAU004 U004 2138_A82_S36 U002 CUGUUU004 AU004 393 G005 C005 AG004 AGAU004 477 AGAUCUCUG005 C005 U004 CUAU004 AAA004 CAG005 U004 A005 U004 U004 2138_A83_S36 U002 CU004 GUUU004 405 G005 C005 AG004 AGAU004 489 AUA004 GAUCU004 CUG005 CUAU004 AAA004 CAG005 C005 U004 U004 A005 U004 U004 2138_A84_S36 U002 CU005 GUUU005 417 G005 C005 AG004 AGAU004 501 AUA005 GAUCU005 CUG005 CUAU004 AAA004 CAG005 C005 U004 U004 A005 U004 U004 2153_A22_S26 UU004 AGC004 AU004 346 C004 AGAC004 AGGC004 430 AGAGCCUGUCUGU004 U004 U004 C004 U004 AU004 GC004 U004 AAU004 U004 2153_A25_S27 UUAGCAUAGAGCCUGUCUGU004 358 CAGACAGGCUCUAUGCUAAU004 442 U004 U004 2153_A81_S26 UUAGC004 AU004 AGAGC004 370 C004 AGAC004 AGGC004 454 CUGU004 C004 U004 GU004 U004 C004 U004 AU004 U004 GC004 U004 AAU004 U004 2153_A48_S26 U002 U004 AGC004 AU004 382 C004 AGAC004 AGGC004 466 AGAGCCUGUCUGU004 U004 U004 C004 U004 AU004 GC004 U004 AAU004 U004 2153_A82_S36 U002 U004 AGC004 AU004 394 C005 A005 GA004 CAGG004 478 AGAGCCUGUCU005 G005 U004 CUCU004 AUG004 CUA005 U004 A005 U004 U004 2153_A83_S36 U002 UA004 GCAU004 406 C005 A005 GA004 CAGG004 490 AGA004 GCCUG004 UCU005 CUCU004 AUG004 CUA005 G005 U004 U004 A005 U004 U004 2153_A84_S36 U002 UA005 GCAU005 418 C005 A005 GA004 CAGG004 502 AGA005 GCCUG005 UCU005 CUCU004 AUG004 CUA005 G005 U004 U004 A005 U004 U004 2154_A22_S26 UUU004 AGC004 AU004 347 AGAC004 AGGC004 U004 431 AGAGCCUGUCUU004 U004 C004 U004 AU004 GC004 U004 AAAU004 U004 2154_A25_S27 UUUAGCAUAGAGCCUGUCUU004 359 AGACAGGCUCUAUGCUAAAU004 443 U004 U004 2154_A81_S26 UUU004 AGC004 AU004 371 AGAC004 AGGC004 U004 455 AGAGCCU004 GU004 C004 C004 U004 AU004 GC004 U004 U004 U004 U004 AAAU004 U004 2154_A48_S26 U002 UU004 AGC004 AU004 383 AGAC004 AGGC004 U004 467 AGAGCCUGUCUU004 U004 C004 U004 AU004 GC004 U004 AAAU004 U004 2154_A82_S36 U002 UU004 AGC004 AU004 395 A005 G005 AC004 AGGC004 479 AGAGCCUGUC005 U005 U004 UCUA004 UGC004 UAA005 U004 A005 U004 U004 2154_A83_S36 U002 UU004 AGCA004 407 A005 G005 AC004 AGGC004 491 UAG004 AGCCU004 GUC005 UCUA004 UGC004 UAA005 U005 U004 U004 A005 U004 U004 2154_A84_S36 U002 UU005 AGCA005 419 A005 G005 AC004 AGGC004 503 UAG005 AGCCU005 GUC005 UCUA004 UGC004 UAA005 U005 U004 U004 A005 U004 U004

Example 1D

Groups of Overlapping HSF1 RNAi Agent Sequences

[0912] Some of the RNAi agents listed herein overlap each other in sequence. Table 4, below, provides a compilation of some of the groups of overlapping RNAi agents, wherein each member of a group overlaps each other member of the same group by at least 12 nt.

[0913] In various embodiments, the disclosure relates to groups of RNAi agents with overlapping sequences. Thus, the disclosure encompasses groups of RNAi agents wherein each RNAi agent in the group overlaps with each other RNAi agent in the same group by at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or more nucleotides. Particularly, in one embodiment, the overlap is at least 12 nt. Groups of sequences that overlap are shown in Table 4.

TABLE-US-00007 TABLE 4 Overlapping sequences in HSF1 RNAi agents. Groups of Antisense SEQ Sense SEQ Overlapping Sequence ID Sequence ID RNAi Agents Overlap NO: Overlap NO: to HSF1 ATCAGGAAC 507 CATTCAGT 510 751_A22_S26 TGAATG TCCTGAT 751_A25_S27 751_A81_S26 751_A48_S26 751_A82_S36 751_A83_S36 751_A84_S36 755_A22_S26 755_A25_S27 755_A81_S26 755_A48_S26 755_A82_S36 755_A83_S36 755_A84_S36 ATTCTGACT 508 GTTCATAG 511 2030_A22_S26 ATGAAC TCAGAAT 2030_A25_S27 2030_A81_S26 2030_A48_S26 2030_A82_S36 2030_A83_S36 2030_A84_S36 2034_A22_S26 2034_A25_S27 2034_A81_S26 2034_A48_S26 2034_A82_S36 2034_A83_S36 2034_A84_S36 TTAGCATAG 509 AGACAGGC 512 2153_A22_S26 AGCCTGTCT TCTATGCT 2153_A25_S27 G AA 2153_A81_S26 2153_A48_S26 2153_A82_S36 2153_A83_S36 2153_A84_S36 2154_A22_S26 2154_A25_S27 2154_A81_S26 2154_A48_S26 2154_A82_S36 2154_A83_S36 2154_A84_S36

This Table presents sets of HSF1 RNAi agents (last column) wherein all the RNAi agents within each set comprise the same overlapping sequence in the antisense strand (first column) or sense strand (second column). In the column "Groups of Overlapping RNAi Agents to HSF1", groups of overlapping RNAi agents are presented by nickname. As in other Tables, the nicknames are preceded by "hs_HSF1_"; thus, for example, "A22_S26" is the same as "hs_HSF1.sub.--751_A22_S26", etc.

[0914] The present disclosure contemplates any group of overlapping RNAi agents disclosed herein (e.g., 751_A22_S26, 751_A25_S27, 751_A81_S26, 751_A48_S26, 751_A82_S36, 751_A83_S36, 751_A84_S36, 755_A22_S26, 755_A25_S27, 755_A81_S26, 755_A48_S26, 755_A82_S36, 755_A83_S36, and 755_A84_S36) or any portion or subgroup of that group (e.g., 751_A22_S26, 751_A25_S27, and 751_A81_S26; and/or 755_A82_S36, 755_A83_S36, and 755_A84_S36 and/or 751_A84_S36, 755_A22_S26, 755_A25_S27, and 755_A81_S26), etc.

[0915] Tables 2, 3 and 4 show, for example, that all RNAi agents with the prefix hs_HSF1.sub.-- 751 and hs_HSF1.sub.--755 (e.g., hs_HSF1.sub.--751_A22_S26, hs_HSF1.sub.--751_A25_S27, hs_HSF1.sub.-- 751_A81_S26, hs_HSF1.sub.--751_A48_S26, hs_HSF1.sub.--751_A82_S36, hs_HSF1.sub.--751_A83 S36, hs_HSF1.sub.--751_A84_S36, hs_HSF1.sub.--755_A22_S26, hs_HSF1.sub.--755_A25_S27, hs HSF1.sub.--755_A81_S26, hs_HSF1.sub.--755_A48_S26, hs_HSF1.sub.--755_A82_S36, and hs_HSF1.sub.--755_A83_S36, and hs_HSF1.sub.--755_A84_S36, modified variants thereof, etc.) share the common technical feature of the sequence of CATTCAGTTCCTGAT (SEQ ID NO: 510) in the sense strand, and the sequence of ATCAGGAACTGAATG (SEQ ID NO: 507) in the antisense strand.

[0916] The disclosure thus encompasses various embodiments comprising groups of overlapping RNAi agents, for example (1) RNAi agents comprising the sequences of CATTCAGTTCCTGAT (SEQ ID NO: 510) or ATCAGGAACTGAATG (SEQ ID NO: 507) (e.g., any combination of or all of hs_HSF1.sub.--751_A22.sub.--526; hs_HSF1.sub.--751_A25.sub.--527; hs_HSF1.sub.--751_A81_S26; hs_HSF1.sub.--751_A48_S26; hs_HSF1.sub.--751_A82_S36; hs_HSF1.sub.--751_A83_S36; hs_HSF1.sub.--751_A84_S36; hs_HSF1.sub.--755_A22_S26; hs_HSF1.sub.--755_A25_S27; hs_HSF1.sub.--755_A81_S26; hs_HSF1.sub.--755_A48_S26; and hs_HSF1.sub.--755_A82_S36; and hs_HSF1.sub.--755_A83_S36; hs_HSF1.sub.--755_A84_S36, and modified variants thereof); (2) RNAi agents comprising the sequences of CATTCAGTTCCTGAT (SEQ ID NO: 510) or ATCAGGAACTGAATG (SEQ ID NO: 507); (3) RNAi agents comprising a first strand and/or a second strand comprising a sequence of CATTCAGTTCCTGAT (SEQ ID NO: 510) or ATCAGGAACTGAATG (SEQ ID NO: 507); (4) RNAi agents comprising a sense strand and/or a antisense strand comprising 15 contiguous nt with 0 to 3 mismatches from a sequence of CATTCAGTTCCTGAT (SEQ ID NO: 510) or ATCAGGAACTGAATG (SEQ ID NO: 507); (5) RNAi agents comprising a first strand comprising 15 contiguous nt with 0 to 3 mismatches from a sequence of CATTCAGTTCCTGAT (SEQ ID NO: 510); (6) RNAi agents comprising a strand comprising 15 contiguous nt with 0 to 3 mismatches from a sequence of ATCAGGAACTGAATG (SEQ ID NO: 507); etc. The disclosure also encompasses similar embodiments reflecting all the overlapping groups of RNAi agents as described in Table A2.

[0917] Variants of RNAi agents (e.g., comprising different modifications, caps, etc.) are disclosed herein, e.g., in Tables A1, 1, 2, 3, 4, 5, 6, or 7. In these texts and tables, for example, hs_HSF1.sub.--751_A22_S26 shares the same sequence as hs_HSF1.sub.--751_A25_S27, and hs_HSF1.sub.--751_A81_S26, though the RNAi agents may differ in their modifications, caps (e.g., 5' and/or 3' caps), etc. However, any overlapping group comprising a RNAi agent of a given sequence also comprises any other RNAi agent which has the same sequence, but different variations in modifications, caps, etc. Thus, any group of overlapping RNAi agents that includes hs_HSF1.sub.--751_A22_S26 also includes HSF1.sub.--751_A25_S27, hs_HSF1.sub.--751_A81_S26 and other variants of the same sequence (e.g., with different modifications, caps, etc.). More embodiments are provided herein, and are included in the scope of each group of RNAi agents of the disclosure.

Example 2

Activity of RNAi Agents to HSF1

[0918] RNAi agent activity is tested in vitro in HeLa cells (Example 2A), GTL-16 cells (Example 2B) and SK-BR-3 (SKBR3) cells (Example 2C).

[0919] In various assays, the transfection agent is RNAiMAX.

[0920] To establish a dose-response for a RNAi agent, the starting concentration is 10 nM, with various 1:3 dilutions for a 9-point single agent dose response curve.

[0921] The timepoint for measuring KD (gene knockdown) is 48 hours.

[0922] Media is changed at 24 hours.

Additional details are provided in the protocols in Example 3.

Example 2A

Activity of RNAi Agents to HSF1 in Hela Cells

[0923] For in vitro experiments, RNAi agent dose-response activity is measured in HeLa cells. HeLa cells are transfected with RNAi agents at 1, 5 or 10 nM. HSF1 qRT-PCR protocols were performed at 48 hours after transfection.

[0924] Results are shown in FIG. 2A for A22_S26 modification formats for HSF1 RNAi agents hs_HSF1.sub.--175_; hs_HSF1.sub.--517_; hs_HSF1.sub.--562_; hs_HSF1.sub.--751_; hs_HSF1.sub.--755_; hs_HSF1.sub.--846; hs_HSF1.sub.--1360; hs_HSF1.sub.--2030; hs_HSF1.sub.--2034; hs_HSF1.sub.--2138_; hs_HSF1.sub.--2153_; and hs_HSF1.sub.--2154_. Vertical bars indicate residual gene activity; e.g., for hs_HSF1.sub.--562, residual gene activity at 10 nM is <20%, indicating that gene knockdown is >80%.

[0925] FIG. 2B shows activity for A25_S27 variants of these sequences.

[0926] FIG. 2C shows activity for AV14_S26 [also known as A_LO_V14_S26 or A81_S26] variants of these sequences.

[0927] FIG. 2D shows activity for A48_S26 variants of these sequences.

[0928] FIG. 2E shows activity for AV15_SV7 (A82_S50, also known as A_LO_V15 S_LO_V7) variants of these sequences.

[0929] FIG. 2F shows activity for AV16_SV1 (A83.sub.--536, also known as A_LO_V16 S_LO_V1) variants of these sequences.

[0930] FIG. 2G shows activity for AV17_SV1 (A84_S36, also known as A_LO_V17 S_LO_V1) variants of these sequences.

[0931] The results in FIGS. 2A to 2G show that at least one variant of each of hs_HSF1.sub.--175; hs_HSF1.sub.--517; hs_HSF1.sub.--562; hs_HSF1.sub.--751; hs_HSF1.sub.--755; hs_HSF1.sub.--846; hs_HSF1.sub.--1360; hs_HSF1.sub.--2030; hs_HSF1.sub.--2034; and hs_HSF1.sub.--2138 was effective in mediating RNA interference against HeLa cells in vitro.

Example 2B

Activity of HSF1 RNAi Agents in GTL-16 Cells

[0932] HSF1 RNAi agents are tested in vitro on GTL-16 cells. The results are shown in Table 5, below.

[0933] This Table provides the EC50 for proliferation, the EC50 for knockdown, and % knockdown at 10 nM. Thus, for hsHSF1.sub.--846_A25_S27, the EC50 for proliferation is >10 nM, the EC50 for 50% knockdown is 0.03 nM; and the % knockdown at 10 nM is 80% (indicating 20% residual gene activity). "-" indicates that this data point was not performed.

[0934] The table is arranged with the most potent RNAi agents (lowest EC50 knockdown in nM) at the top.

TABLE-US-00008 TABLE 5 EC50 Prolif- EC50 % Knock- eration Knock-down down at siRNAs (nM) (nM) 10 nM hsHSF1_846_A25_S27 >10 0.03 80 hsHSF1_751_A25_S27 >10 0.04 80 hsHSF1_755_A25_S27 >10 0.04 80 hsHSF1_2138_A25_S27 >10 0.05 80 hsHSF1_2030_A25_S27 >10 0.06 80 hsHSF1_562_A25_S27 >10 0.10 70 hsHSF1_846_A48_S26 >10 0.17 70 hsHSF1_2030_A22_S26 >10 0.19 70 hsHSF1_846_A22_S26 >10 0.26 70 hsHSF1_751_A22_S26 >10 0.63 70 hsHSF1_751_A_LO_V14_S26 >10 0.04 60 hsHSF1_2030_A48_S26 >10 0.05 60 hsHSF1_175_A25_S27 >10 0.09 60 hsHSF1_2138_A22_S26 >10 0.23 60 hsHSF1_755_A22_S26 >10 0.62 60 hsHSF1_562_A22_S26 >10 0.73 60 hsHSF1_2034_A25_S27 >10 0.05 50 hsHSF1_2138_A_LO.sub.-- >10 0.13 50 V16_S_LO_V1 hsHSF1_751_A48_S26 >10 0.38 50 hsHSF1_755_A_LO_V14_S26 >10 0.89 50 hsHSF1_562_A48_S26 >10 0.05 40 hsHSF1_2138_A_LO_V14_S26 >10 0.06 40 hsHSF1_2034_A22_S26 >10 1.90 60 hsHSF1_2030_A_LO_V14_S26 >10 3.61 50 hsHSF1_846_A_LO_V14_S26 >10 8.40 60 hsHSF1_175_A22_S26 >10 >10 50 hsHSF1_562_A_LO_V14_S26 >10 >10 -- hsHSF1_2034_A_LO_V14_S26 >10 >10 20 hsHSF1_755_A48_S26 >10 >10 30 hsHSF1_2034_A48_S26 >10 >10 30 hsHSF1_2138_A48_S26 >10 >10 60 hsHSF1_175_A48_S26 >10 >10 50 hsHSF1_2034_A_LO.sub.-- >10 >10 50 V16_S_LO_V1

Example 2C

Activity of HSF1 RNAi Agents in SK-BR-3 Cells

[0935] HSF1 RNAi agents are tested in vitro on SK-BR-3 (SKBR3) cells. The results are shown in Table 6, below. RNAiMAX is 0.3 ul. 7 day CTG assay is performed, as is a 4 day KD (gene knockdown) assay.

TABLE-US-00009 TABLE 6 Activity of HSF1 RNAi Agents in SK-BR-3 Cells in vitro. % Inhibition % Knockdown SiRNAs at 10 nM at 10 nM hsHSF1_846_A22_S26 0 92 hsHSF1_2138_A22_S26 8 92 hsHSF1_751_A48_S26 20 92 hsHSF1_751_A22_S26 25 95 hsHSF1_846_A48_S26 25 94 hsHSF1_751_A_LO_V14_S26 35 92 hsHSF1_2030_A48_S26 40 94 hsHSF1_2030_A22_S26 50 93

Example 2D

Activity of HSF1 RNAi Agents in GTL-16 and SK-BR-3 Cells

[0936] Table 7 provides a comparison of the activity of selected HSF1 RNAi agents in GTL-16 and SK-BR-3 cells in vitro.

TABLE-US-00010 TABLE 7 % Inhibition % Knockdown % Inhibition % Knockdown SiRNAs in GTL-16 in GTL-16 in SK-BR-3 in SK-BR-3 hsHSF1_846_A22_S26 0 70 0 92 hsHSF1_2138_A22_S26 0 60 8 92 hsHSF1_751_A48_S26 0 50 20 92 hsHSF1_751_A22_S26 0 70 25 95 hsHSF1_846_A48_S26 8 70 25 94 hsHSF1_751_A_LO_V14_S26 8 60 35 92 hsHSF1_2030_A48_S26 5 60 40 94 hsHSF1_2030_A22_S26 6 70 50 93

Example 3

Specificity of HSF1 RNAi Agents to HSF1

[0937] RNAi agent hs_HSF1.sub.--2138, shown by experimental data discussed above to be effective in mediating RNAi against HSF1, was found to have a 19-mer complementarity to a portion of the sense strand of another gene, DGAT1 mRNA.

[0938] hs_HSF1.sub.--2138, PBS (phosphate-buffered saline, a negative control), hs_HSF1.sub.--544 or HSF-544-1 (hs_HSF.sub.--562], HSF1.sub.--2120-1 [hs_HSF12138] and the unrelated luc (luciferase, another negative control) were tested for RNA interference in vivo in Hep3B subcutaneous tumors in test animals. RNAi agents were delivered in a lipid nanoparticle.

[0939] The results showed that hs_HSF.sub.--562 (about 75% gene knockdown) and hs_HSF1.sub.--2138 (about 73% gene knockdown) both mediated RNAi against HSF1 but not significantly against DGAT1, with RNAi in the range of only about 20% for both hs_HSF.sub.--562 and hs_HSF1.sub.--2138.

[0940] As for the controls, PBS did not knockdown either HSF1 or DGAT1 expression. The luciferase RNAi agent was also ineffective in knocking down either HSF1 or DGAT1 expression.

[0941] These results show that hs_HSF1.sub.--2138 (which was shown above to mediate RNAi against HSF1) did not mediate RNAi against DGAT1, despite having a 19-mer complementary to the DGAT1 mRNA.

[0942] Similar results are also obtained using the same RNAi agents in HeLa cells in vitro.

Example 4

Experimental Protocols

[0943] This Example details experimental protocols for screening of duplexes in gene knockdown and cell proliferation assays. This Example describes: (A) the overall screening procedure for measuring the effects of duplexes on HSF1 gene knockdown and cell proliferation; (B) the cDNA synthesis procedure for measuring gene knockdown; and (C) the proliferation CTG (PROMEGA CELL TITER GLO.TM. luminescent cell viability assay) assay procedure.

[0944] A. Overall Screening Procedure for Measuring Effects of Duplexes on Knockdown and Cell Proliferation.

[0945] The overall screening procedure involves these steps: inputting platemap to template (to program the TECAN FREEDOM EVO.TM. robotic worktable in preparing initial multi-well plates); creating the master block (by the TECAN); aliquoting 20 ul per cell plate (performed by PERKIN ELMER JANUS.TM. automated workstation); cell plating; changing media at 24 hours; measuring knockdown at 48 hours (performed by ZYMARK CALIPER SCICLONE ALH3000.TM. liquid handing system); and measuring cell proliferation with CTG assay.

[0946] Details: The total number of duplexes screened is 33. A 9-point dose response is performed, starting with a concentration of 10 nM and 1:3 dilutions for 9-point single agent dose response. The number of cell lines tested is 2 (GTL-16 and SK-BR-3). The timepoint for measuring knockdown is 48 hours. The timepoints for measuring proliferation are 5 days and 10 days.

[0947] Additional Details: The transfection agent is RNAiMax. OptiMem I media is also used. The volume of transfection reagent=0.1 ul/well.times.100 wells.times.number of cell plates to be screened+Dead volume for 2 plates. The volume of OptiMem I media=9.9 ul/well.times.100 wells.times.number of cell plates to be screened+Dead volume for 2 plates. For example, for 2 blocks and 2 cell lines, the transfection reagent needed=200 ul, and OptiMem I media needed=19.8 ml. This mix is incubated for 10 min. at room temperature. 1.8 ul of siRNA as per plate map in the workbook is aliquoted to column 2 of 96-well U-bottom plate. A siRNA aliquoted plate is prepared and put into position. An empty 96-well U-bottom plate is prepared and placed into position. The method is run to create a block with siRNA+transfection reagent and incubated for 20 minutes at room temperature.

[0948] B. cDNA Synthesis for TAQMAN.TM. Assay System for Measuring Knockdown Mediated by Duplexes.

[0949] This procedure involves the following steps (CELLS-TO-CT.TM. kit from Applied Biosystems): 1.times.PBS is placed at 4 degrees or on ice. Lysis buffer is prepared by mixing 49.5 ul/well of lysis solution+0.5 ul/well of DNAse I and aliquoting to U-bottom 96-well plate. Plates are checked for confluency or contamination. Stop solution, 2.times.RT buffer and 20.times.RT-enzyme mix are thawed. Stop solution is aliquoted to 96-well PCR plate and 10 ul of dead volume is added. Cells in contaminated wells are disposed of.

[0950] cDNA is generated via RT (reverse transcription). This procedure involves the following steps: RT mastermix plates are prepared. Mix is made and aliquoted 16 ul/well to 96-well PCR plate and plates are placed on ice. 10 ul of 2.times.RT buffer, 1 ul of 20.times.RT Enzyme mix, and 5 ul of DNAase RNAse free ultrapure water is used per well. CALIPER SCICLONE ALH3000.TM. liquid handing system is used to apirate media and add 50 ul of cold 1.times.PBS (phosphate-buffered saline solution) to 4 plates that undergo lysis and RT steps. Plates are transferred to ice. PBS is aspirated. Cell plates, lysis, RT and stop solution plates are placed on deck per the layout. A method is run on the ALH3000.TM. liquid handling system, where it transfers prealiquoted lysis buffer, stop solution and RT-mix to cell plates for generating cDNA for knockdown. Plates are transferred to a BIORAD.TM. PCR machine and the PCR method run. Cell plates are stored at -80 C for processing for lysis, stop reactions and RT reactions, if required to repeat the experiment.

[0951] The TAQMAN.TM. Assay is performed. This procedure involves the following steps: cDNA plates are thawed and centrifuged at 3000 rpm (revolutions per minutes) for 3 min. 2.times. Taqman universal master mix and 20.times. beta-actin are added. Appropriate probes are added and aliquoted to 96 well PCR plates and the assay run.

[0952] C. Proliferation CTG Reads.

[0953] The following steps are used in the CTG procedure: After the plates are incubated either day 4 or day 5 (as per the project), 100 ul of PROMEGA CELL TITER GLO.TM. (CTG) luminescent cell viability assay solution is added. The plates are shaken for 15-20 min on plate shaker and read. The data is collected and saved.

Equivalents

[0954] A composition of embodiment 1 is a composition comprising a RNAi agent for inhibition of HSF1 comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

[0955] The composition of embodiment 1, wherein the composition further comprises a second RNAi agent to HSF1.

[0956] The composition of embodiment 1, wherein the antisense strand is 30 or fewer nucleotides in length.

[0957] The composition of embodiment 1, wherein the sense strand and the antisense strand form a duplex region 15 to 30 nucleotide pairs in length.

[0958] The composition of embodiment 1, wherein the antisense strand and the sense strand are independently 19 to 23 nucleotides in length.

[0959] The composition of embodiment 1, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[0960] The composition of embodiment 1, wherein the RNAi agent comprises at least one modified backbone and/or at least one 2'-modified nucleotide.

[0961] The composition of embodiment 1, wherein the RNAi agent comprises:

[0962] a) at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or

[0963] b) at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; and/or

[0964] c) at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; and/or

[0965] d) at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[0966] The composition of embodiment 1, wherein the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[0967] The composition of embodiment 1, wherein the RNAi agent comprises a blunt end.

[0968] The composition of embodiment 1, wherein the RNAi agent comprises a 3' end cap.

[0969] The composition of embodiment 1, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[0970] The composition of embodiment 1, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[0971] The composition of embodiment 1, wherein the RNAi agent comprises a 5' end cap.

[0972] The composition of embodiment 1, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[0973] The composition of embodiment 1, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[0974] The composition of embodiment 1, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[0975] The composition of embodiment 1, wherein the RNAi agent comprises an overhang having 1 to 4 unpaired nucleotides.

[0976] The composition of embodiment 1, wherein the RNAi agent comprises an overhang at the 3'-end of the antisense strand of the RNAi agent.

[0977] The composition of embodiment 1, wherein the RNAi agent is ligated to one or more agent selected from: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[0978] The composition of embodiment 1, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 60% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[0979] The composition of embodiment 1, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 70% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[0980] The composition of embodiment 1, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 80% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[0981] The composition of embodiment 1, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 90% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[0982] The composition of embodiment 1, wherein the RNAi has an EC50 of no more than about 0.1 nM.

[0983] The composition of embodiment 1, wherein the RNAi has an EC50 of no more than about 0.01 nM.

[0984] The composition of embodiment 1, wherein the RNAi has an EC50 of no more than about 0.001 nM.

[0985] A composition of embodiment 2 is a composition comprising a RNAi agent for inhibition of HSF1 comprising a first strand and a second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of a RNAi agent specific to HSF1 provided in Table A1.

[0986] The composition of embodiment 2, wherein the composition comprises a second RNAi agent to HSF1.

[0987] The composition of embodiment 2, wherein the second strand is 30 or fewer nucleotides in length.

[0988] The composition of embodiment 2, wherein the first strand and the second strand form a duplex region 15 to 30 nucleotide pairs in length.

[0989] The composition of embodiment 2, wherein the first strand and the second strand are independently 19 to 23 nucleotides in length.

[0990] The composition of embodiment 2, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[0991] The composition of embodiment 2, wherein the RNAi agent comprises a phosphorothioate and/or a 2'-modified nucleotide.

[0992] The composition of embodiment 2, wherein the RNAi agent comprises:

[0993] at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide;

[0994] and/or at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide;

[0995] and/or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[0996] The composition of embodiment 2, wherein the RNAi agent comprises one or more 2'-modifications selected from the group consisting of:

[0997] 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-0-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[0998] The composition of embodiment 2, wherein the RNAi agent comprises a blunt end.

[0999] The composition of embodiment 2, wherein the RNAi agent comprises a 3' end cap.

[1000] The composition of embodiment 2, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1001] The composition of embodiment 2, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1002] The composition of embodiment 2, wherein the RNAi agent comprises a 5' end cap.

[1003] The composition of embodiment 2, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1004] The composition of embodiment 2, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1005] The composition of embodiment 2, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1006] The composition of embodiment 2, wherein the RNAi agent comprises an overhang having 1 to 4 unpaired nucleotides.

[1007] The composition of embodiment 2, wherein the RNAi agent comprises an overhang at the 3'-end of the antisense strand.

[1008] The composition of embodiment 2, wherein the RNAi agent is ligated to one or more agents, the agent selected from a: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[1009] The composition of embodiment 2, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 60% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1010] The composition of embodiment 2, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 70% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1011] The composition of embodiment 2, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 80% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1012] The composition of embodiment 2, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 90% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1013] The composition of embodiment 2, wherein the RNAi has an EC50 of no more than about 0.1 nM.

[1014] The composition of embodiment 2, wherein the RNAi has an EC50 of no more than about 0.01 nM.

[1015] The composition of embodiment 2, wherein the RNAi has an EC50 of no more than about 0.001 nM.

[1016] A method of embodiment 3 is a method comprising a method of treating a HSF1-related disease in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising a RNAi agent for inhibition of HSF1 comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

[1017] The method of embodiment 3, wherein the HSF1-related disease is cancer, or autoimmune, or a viral disease.

[1018] The method of embodiment 3, wherein the HSF1-related disease is cancer.

[1019] The method of embodiment 3, wherein the method further comprises the step of administering an additional treatment for cancer, or autoimmune, or a viral disease.

[1020] The method of embodiment 3, wherein the composition comprises a second RNAi agent to HSF1.

[1021] The method of embodiment 3, wherein the method further comprises the step of administering an additional RNAi agent to HSF1.

[1022] The method of embodiment 3, further comprising the administration of an additional treatment.

[1023] The method of embodiment 3, further comprising the administration of an additional treatment and wherein the additional treatment is a composition.

[1024] The method of embodiment 3, further comprising the administration of an additional treatment and wherein the additional treatment is a composition, and wherein the composition is a HSP90 inhibitor.

[1025] The method of embodiment 3, further comprising the administration of an additional treatment and wherein the additional treatment is a composition, and wherein the composition is a HSP90 inhibitor, and wherein the HSP90 inhibitor is AUY922.

[1026] The method of embodiment 3, further comprising the administration of an additional treatment and wherein the additional treatment is a method.

[1027] The method of embodiment 3, further comprising the administration of an additional treatment and wherein the additional treatment and the RNAi agent can be administered in any order.

[1028] The method of embodiment 3, wherein the antisense strand is 30 or fewer nucleotides in length.

[1029] The method of embodiment 3, wherein the sense strand and the antisense strand form a duplex region 15 to 30 nucleotide pairs in length.

[1030] The method of embodiment 3, wherein the sense strand and the antisense strand are independently 19 to 23 nucleotides in length.

[1031] The method of embodiment 3, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[1032] The method of embodiment 3, wherein the RNAi agent comprises a phosphorothioate and/or a 2'-modified nucleotide.

[1033] The method of embodiment 3, wherein the RNAi agent comprises:

[1034] at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide;

[1035] and/or at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide;

[1036] and/or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[1037] The method of embodiment 3, wherein the RNAi agent comprises one or more 2'-modifications selected from the group consisting of:

[1038] 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[1039] The method of embodiment 3, wherein the RNAi agent comprises a blunt end.

[1040] The method of embodiment 3, wherein the RNAi agent comprises a 3' end cap.

[1041] The method of embodiment 3, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1042] The method of embodiment 3, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1043] The method of embodiment 3, wherein the RNAi agent comprises a 5' end cap.

[1044] The method of embodiment 3, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1045] The method of embodiment 3, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1046] The method of embodiment 3, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1047] A method of embodiment 4 is a method comprising a method of inhibiting the expression of the HSF1 gene in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising a RNAi agent for inhibition of HSF1 comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

[1048] The method of embodiment 4, wherein the individual is afflicted with or susceptible to a HSF1-related disease.

[1049] The method of embodiment 4, wherein the HSF1-related disease is cancer, or autoimmune, or a viral disease.

[1050] The method of embodiment 4, wherein the HSF1-related disease is cancer.

[1051] The method of embodiment 4, further comprising the administration of an additional treatment.

[1052] The method of embodiment 4, further comprising the administration of an additional treatment.

[1053] The method of embodiment 4, wherein the additional treatment is a composition.

[1054] The method of embodiment 4, further comprising the administration of an additional treatment.

[1055] The method of embodiment 4, wherein the additional treatment is a method.

[1056] The method of embodiment 4, further comprising the administration of an additional treatment.

[1057] The method of embodiment 4, wherein the additional treatment and the RNAi agent can be administered in any order.

[1058] The method of embodiment 4, further comprising the administration of an additional treatment.

[1059] The method of embodiment 4, wherein the additional treatment is a HSP90 inhibitor.

[1060] The method of embodiment 4, further comprising the administration of an additional treatment.

[1061] The method of embodiment 4, wherein the additional treatment is a HSP90 inhibitor and wherein the HSP90 inhibitor is AUY922.

[1062] The method of embodiment 4, wherein the antisense strand is 30 or fewer nucleotides in length.

[1063] The method of embodiment 4, wherein the sense strand and the antisense strand form a duplex region 15 to 30 nucleotide pairs in length.

[1064] The method of embodiment 4, wherein the sense strand and the antisense strand are independently 19 to 23 nucleotides in length.

[1065] The method of embodiment 4, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[1066] The method of embodiment 4, wherein the RNAi agent comprises a phosphorothioate and/or a 2'-modified nucleotide.

[1067] The method of embodiment 4, wherein the RNAi agent comprises:

[1068] at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide;

[1069] and/or at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide;

[1070] and/or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[1071] The method of embodiment 3, wherein the RNAi agent comprises one or more 2'-modifications selected from the group consisting of:

[1072] 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[1073] The method of embodiment 4, wherein the RNAi agent comprises a blunt end.

[1074] The method of embodiment 4, wherein the RNAi agent comprises a 3' end cap.

[1075] The method of embodiment 4, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1076] The method of embodiment 4, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1077] The method of embodiment 4, wherein the RNAi agent comprises a 5' end cap.

[1078] The method of embodiment 4, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1079] The method of embodiment 4, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1080] The method of embodiment 4, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1081] A composition of embodiment 5 comprises a medicament for use in an RNAi formulation comprising a RNAi agent for inhibition of HSF1 comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

[1082] Any composition above in a pharmaceutically effective formulation.

[1083] The composition according to embodiment 5, for use in a method of treating a HSF1-related disease in an individual, the method comprising the step of administering to the individual a therapeutically effective amount of a composition according to embodiment 5.

[1084] The use of a composition according to embodiment 5, in the manufacture of a medicament for the treatment of a HSF1-related disease.

[1085] The use of a composition according to embodiment 5, wherein the HSF1-related disease is cancer, or autoimmune, or a viral disease.

[1086] The composition of embodiment 5, wherein all the pyrimidines are 2' O-methyl-modified nucleotides.

[1087] The composition of embodiment 5, wherein all the pyrimidines are 2' O-methyl-modified nucleotides.

[1088] The composition of embodiment 5, wherein the composition comprises a second RNAi agent to HSF1.

[1089] The composition of embodiment 5, wherein the second strand is 30 or fewer nucleotides in length.

[1090] The composition of embodiment 5, wherein the first strand and the second strand form a duplex region 15 to 30 nucleotide pairs in length.

[1091] The composition of embodiment 5, wherein the first strand and the second strand are independently 19 to 23 nucleotides in length.

[1092] The composition of embodiment 5, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[1093] The composition of embodiment 5, wherein the RNAi agent comprises a phosphorothioate and/or a 2'-modified nucleotide.

[1094] The composition of embodiment 5, wherein the RNAi agent comprises:

[1095] at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide;

[1096] and/or at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide;

[1097] and/or at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[1098] The composition of embodiment 5, wherein the RNAi agent comprises one or more 2'-modifications selected from the group consisting of:

[1099] 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[1100] The composition of embodiment 5, wherein the RNAi agent comprises a blunt end.

[1101] The composition of embodiment 5, wherein the RNAi agent comprises a 3' end cap.

[1102] The composition of embodiment 5, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1103] The composition of embodiment 5, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1104] The composition of embodiment 5, wherein the RNAi agent comprises a 5' end cap.

[1105] The composition of embodiment 5, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1106] The composition of embodiment 5, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1107] The composition of embodiment 5, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1108] The composition of embodiment 5, wherein the RNAi agent comprises an overhang having 1 to 4 unpaired nucleotides.

[1109] The composition of embodiment 5, wherein the RNAi agent comprises an overhang at the 3'-end of the antisense strand.

[1110] The composition of embodiment 5, wherein the RNAi agent is ligated to one or more agents, the agent selected from a: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[1111] The composition of embodiment 5, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 60% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1112] The composition of embodiment 5, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 70% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1113] The composition of embodiment 5, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 80% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1114] The composition of embodiment 5, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 90% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1115] The composition of embodiment 5, wherein the RNAi has an EC50 of no more than about 0.1 nM.

[1116] The composition of embodiment 5, wherein the RNAi has an EC50 of no more than about 0.01 nM.

[1117] The composition of embodiment 5, wherein the RNAi has an EC50 of no more than about 0.001 nM.

[1118] A composition of embodiment 6 is a composition comprising a RNAi agent for inhibition of HSF1 comprising a first strand and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of a RNAi agent specific to HSF1 provided in Table A1.

[1119] A composition of embodiment 6 is a composition comprising a RNAi agent for inhibition of HSF1 comprising a first strand and a second strand, wherein the sequence of the first strand comprises the sequence of the first strand of a RNAi agent specific to HSF1 provided in Table A1, the sequence of the first strand further comprising up to about 6 additional nucleotides.

[1120] The composition of embodiment 6, wherein the composition further comprises a second RNAi agent to HSF1.

[1121] The composition of embodiment 6, wherein the antisense strand is 30 or fewer nucleotides in length.

[1122] The composition of embodiment 6, wherein the sense strand and the antisense strand form a duplex region 15 to 30 nucleotide pairs in length.

[1123] The composition of embodiment 6, wherein the antisense strand and the sense strand are independently 19 to 23 nucleotides in length.

[1124] The composition of embodiment 6, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[1125] The composition of embodiment 6, wherein the RNAi agent comprises at least one modified backbone and/or at least one 2'-modified nucleotide.

[1126] The composition of embodiment 6, wherein the RNAi agent comprises:

[1127] a) at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or

[1128] b) at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; and/or

[1129] c) at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; and/or

[1130] d) at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[1131] The composition of embodiment 6, wherein the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[1132] The composition of embodiment 6, wherein the RNAi agent comprises a blunt end.

[1133] The composition of embodiment 6, wherein the RNAi agent comprises an overhang having 1 to 4 unpaired nucleotides.

[1134] The composition of embodiment 6, wherein the RNAi agent comprises an overhang at the 3'-end of the antisense strand of the RNAi agent.

[1135] The composition of embodiment 6, wherein the RNAi agent is ligated to one or more agent selected from: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[1136] The composition of embodiment 6, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 60% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1137] The composition of embodiment 6, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 70% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1138] The composition of embodiment 6, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 80% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1139] The composition of embodiment 6, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 90% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1140] The composition of embodiment 6, wherein the RNAi has an EC50 of no more than about 0.1 nM.

[1141] The composition of embodiment 6, wherein the RNAi has an EC50 of no more than about 0.01 nM.

[1142] The composition of embodiment 6, wherein the RNAi has an EC50 of no more than about 0.001 nM.

[1143] The composition of embodiment 6, wherein the RNAi agent comprises a blunt end.

[1144] The composition of embodiment 6, wherein the RNAi agent comprises a 3' end cap.

[1145] The composition of embodiment 6, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1146] The composition of embodiment 6, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1147] The composition of embodiment 6, wherein the RNAi agent comprises a 5' end cap.

[1148] The composition of embodiment 6, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1149] The composition of embodiment 6, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1150] The composition of embodiment 6, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1151] A composition of embodiment 7 is a composition comprising a RNAi agent for inhibition of HSF1 comprising a first strand and a second strand, wherein the sequence of the first strand is the sequence of the first strand of a RNAi agent specific to HSF1 provided in Table A1.

[1152] The composition of embodiment 7, wherein the composition further comprises a second RNAi agent to HSF1.

[1153] The composition of embodiment 7, wherein the antisense strand is 30 or fewer nucleotides in length.

[1154] The composition of embodiment 7, wherein the sense strand and the antisense strand form a duplex region 15 to 30 nucleotide pairs in length.

[1155] The composition of embodiment 7, wherein the antisense strand and the sense strand are independently 19 to 23 nucleotides in length.

[1156] The composition of embodiment 7, wherein the RNAi agent comprises a modification that causes the RNAi agent to have increased stability in a biological sample or environment.

[1157] The composition of embodiment 7, wherein the RNAi agent comprises at least one modified backbone and/or at least one 2'-modified nucleotide.

[1158] The composition of embodiment 7, wherein the RNAi agent comprises:

[1159] a) at least one 5'-uridine-adenine-3' (5'-ua-3') dinucleotide, wherein the uridine is a 2'-modified nucleotide; and/or

[1160] b) at least one 5'-uridine-guanine-3' (5'-ug-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide; and/or

[1161] c) at least one 5'-cytidine-adenine-3' (5'-ca-3') dinucleotide, wherein the 5'-cytidine is a 2'-modified nucleotide; and/or

[1162] d) at least one 5'-uridine-uridine-3' (5'-uu-3') dinucleotide, wherein the 5'-uridine is a 2'-modified nucleotide.

[1163] The composition of embodiment 7, wherein the RNAi agent comprises a 2'-modification selected from the group consisting of: 2'-deoxy, 2'-deoxy-2'-fluoro, 2'-O-methyl, 2'-O-methoxyethyl (2'-O-MOE), 2'-O-aminopropyl (2'-O-AP), 2'-O-dimethylaminoethyl (2'-O-DMAOE), 2'-O-dimethylaminopropyl (2'-O-DMAP), 2'-O-dimethylaminoethyloxyethyl (2'-O-DMAEOE), and 2'-O--N-methylacetamido (2'-O-NMA).

[1164] The composition of embodiment 7, wherein the RNAi agent comprises a blunt end.

[1165] The composition of embodiment 7, wherein the RNAi agent comprises an overhang having 1 to 4 unpaired nucleotides.

[1166] The composition of embodiment 7, wherein the RNAi agent comprises an overhang at the 3'-end of the antisense strand of the RNAi agent.

[1167] The composition of embodiment 7, wherein the RNAi agent is ligated to one or more agent selected from: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

[1168] The composition of embodiment 7, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 60% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1169] The composition of embodiment 7, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 70% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1170] The composition of embodiment 7, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 80% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1171] The composition of embodiment 7, wherein the RNAi agent is capable of inhibiting expression of the HSF1 gene by at least about 90% at a concentration of 10 nM in HeLa, GTL-16, or SK-BR-3 cells in vitro.

[1172] The composition of embodiment 7, wherein the RNAi has an EC50 of no more than about 0.1 nM.

[1173] The composition of embodiment 7, wherein the RNAi has an EC50 of no more than about 0.01 nM.

[1174] The composition of embodiment 7, wherein the RNAi has an EC50 of no more than about 0.001 nM.

[1175] The composition of embodiment 7, wherein the RNAi agent comprises a blunt end.

[1176] The composition of embodiment 7, wherein the RNAi agent comprises a 3' end cap.

[1177] The composition of embodiment 7, wherein the RNAi agent comprises a 3' end cap and a blunt end.

[1178] The composition of embodiment 7, wherein the RNAi agent comprises a 3' end cap and at least one 2' modification.

[1179] The composition of embodiment 7, wherein the RNAi agent comprises a 5' end cap.

[1180] The composition of embodiment 7, wherein the RNAi agent comprises a 5' end cap and a 3' end cap.

[1181] The composition of embodiment 7, wherein the RNAi agent comprises a 3' end cap, a blunt end and a 5' end cap.

[1182] The composition of embodiment 7, wherein the RNAi agent comprises any one or more of: at least one 2' modification, a 3' end cap, a 5' end cap, and a blunt end.

[1183] Unless defined otherwise, the technical and scientific terms used herein have the same meaning as that usually understood by a specialist familiar with the field to which the disclosure belongs.

[1184] Unless indicated otherwise, all methods, steps, techniques and manipulations that are not specifically described in detail can be performed and have been performed in a manner known per se, as will be clear to the skilled person. Reference is for example again made to the standard handbooks and the general background art mentioned herein and to the further references cited therein. Unless indicated otherwise, each of the references cited herein is incorporated in its entirety by reference.

[1185] Claims to the invention are non-limiting and are provided below.

[1186] Although particular embodiments and claims have been disclosed herein in detail, this has been done by way of example for purposes of illustration only, and is not intended to be limiting with respect to the scope of the appended claims, or the scope of subject matter of claims of any corresponding future application. In particular, it is contemplated by the inventors that various substitutions, alterations, and modifications may be made to the disclosure without departing from the spirit and scope of the disclosure as defined by the claims. The choice of nucleic acid starting material, clone of interest, or library type is believed to be a matter of routine for a person of ordinary skill in the art with knowledge of the embodiments described herein. Other aspects, advantages, and modifications considered to be within the scope of the following claims. Those skilled in the art will recognize or be able to ascertain, using no more than routine experimentation, many equivalents of the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims. Redrafting of claim scope in later filed corresponding applications may be due to limitations by the patent laws of various countries and should not be interpreted as giving up subject matter of the claims.

Sequence CWU 1

1

515119DNAHomo sapiens 1tttatgtctt cactcttca 19219DNAHomo sapiens 2atcaggaact gaatgagct 19319DNAHomo sapiens 3tgagatcagg aactgaatg 19419DNAHomo sapiens 4ttgatgttct caaggagct 19519DNAHomo sapiens 5tatacttggg catggaatg 19619DNAHomo sapiens 6ttatccaggt tggagtcca 19719DNAHomo sapiens 7attctgacta tgaacaacc 19819DNAHomo sapiens 8tacaattctg actatgaac 19919DNAHomo sapiens 9tctgtttata gatctctgc 191019DNAHomo sapiens 10ttagcataga gcctgtctg 191119DNAHomo sapiens 11tttagcatag agcctgtct 191219DNAHomo sapiens 12tccatctcga gcaaggagg 191319DNAHomo sapiens 13tttatgtctt cactcttca 191419DNAHomo sapiens 14atcaggaact gaatgagct 191519DNAHomo sapiens 15tgagatcagg aactgaatg 191619DNAHomo sapiens 16ttgatgttct caaggagct 191719DNAHomo sapiens 17tatacttggg catggaatg 191819DNAHomo sapiens 18ttatccaggt tggagtcca 191919DNAHomo sapiens 19attctgacta tgaacaacc 192019DNAHomo sapiens 20tacaattctg actatgaac 192119DNAHomo sapiens 21tctgtttata gatctctgc 192219DNAHomo sapiens 22ttagcataga gcctgtctg 192319DNAHomo sapiens 23tttagcatag agcctgtct 192419DNAHomo sapiens 24tccatctcga gcaaggagg 192519DNAHomo sapiens 25tttatgtctt cactcttca 192619DNAHomo sapiens 26atcaggaact gaatgagct 192719DNAHomo sapiens 27tgagatcagg aactgaatg 192819DNAHomo sapiens 28ttgatgttct caaggagct 192919DNAHomo sapiens 29tatacttggg catggaatg 193019DNAHomo sapiens 30ttatccaggt tggagtcca 193119DNAHomo sapiens 31attctgacta tgaacaacc 193219DNAHomo sapiens 32tacaattctg actatgaac 193319DNAHomo sapiens 33tctgtttata gatctctgc 193419DNAHomo sapiens 34ttagcataga gcctgtctg 193519DNAHomo sapiens 35tttagcatag agcctgtct 193619DNAHomo sapiens 36tccatctcga gcaaggagg 193719DNAHomo sapiens 37tttatgtctt cactcttca 193819DNAHomo sapiens 38atcaggaact gaatgagct 193919DNAHomo sapiens 39tgagatcagg aactgaatg 194019DNAHomo sapiens 40ttgatgttct caaggagct 194119DNAHomo sapiens 41tatacttggg catggaatg 194219DNAHomo sapiens 42ttatccaggt tggagtcca 194319DNAHomo sapiens 43attctgacta tgaacaacc 194419DNAHomo sapiens 44tacaattctg actatgaac 194519DNAHomo sapiens 45tctgtttata gatctctgc 194619DNAHomo sapiens 46ttagcataga gcctgtctg 194719DNAHomo sapiens 47tttagcatag agcctgtct 194819DNAHomo sapiens 48tccatctcga gcaaggagg 194919DNAHomo sapiens 49tttatgtctt cactcttca 195019DNAHomo sapiens 50atcaggaact gaatgagct 195119DNAHomo sapiens 51tgagatcagg aactgaatg 195219DNAHomo sapiens 52ttgatgttct caaggagct 195319DNAHomo sapiens 53tatacttggg catggaatg 195419DNAHomo sapiens 54ttatccaggt tggagtcca 195519DNAHomo sapiens 55attctgacta tgaacaacc 195619DNAHomo sapiens 56tacaattctg actatgaac 195719DNAHomo sapiens 57tctgtttata gatctctgc 195819DNAHomo sapiens 58ttagcataga gcctgtctg 195919DNAHomo sapiens 59tttagcatag agcctgtct 196019DNAHomo sapiens 60tccatctcga gcaaggagg 196119DNAHomo sapiens 61tttatgtctt cactcttca 196219DNAHomo sapiens 62atcaggaact gaatgagct 196319DNAHomo sapiens 63tgagatcagg aactgaatg 196419DNAHomo sapiens 64ttgatgttct caaggagct 196519DNAHomo sapiens 65tatacttggg catggaatg 196619DNAHomo sapiens 66ttatccaggt tggagtcca 196719DNAHomo sapiens 67attctgacta tgaacaacc 196819DNAHomo sapiens 68tacaattctg actatgaac 196919DNAHomo sapiens 69tctgtttata gatctctgc 197019DNAHomo sapiens 70ttagcataga gcctgtctg 197119DNAHomo sapiens 71tttagcatag agcctgtct 197219DNAHomo sapiens 72tccatctcga gcaaggagg 197319DNAHomo sapiens 73tttatgtctt cactcttca 197419DNAHomo sapiens 74atcaggaact gaatgagct 197519DNAHomo sapiens 75tgagatcagg aactgaatg 197619DNAHomo sapiens 76ttgatgttct caaggagct 197719DNAhomo sapien 77tatacttggg catggaatg 197819DNAHomo sapiens 78ttatccaggt tggagtcca 197919DNAHomo sapiens 79attctgacta tgaacaacc 198019DNAHomo sapiens 80tacaattctg actatgaac 198119DNAHomo sapiens 81tctgtttata gatctctgc 198219DNAHomo sapiens 82ttagcataga gcctgtctg 198319DNAHomo sapiens 83tttagcatag agcctgtct 198419DNAHomo sapiens 84tccatctcga gcaaggagg 198519DNAHomo sapiens 85tgaagagtga agacataaa 198619DNAHomo sapiens 86agctcattca gttcctgat 198719DNAHomo sapiens 87cattcagttc ctgatctca 198819DNAHomo sapiens 88agctccttga gaacatcaa 198919DNAHomo sapiens 89cattccatgc ccaagtata 199019DNAHomo sapiens 90tggactccaa cctggataa 199119DNAHomo sapiens 91ggttgttcat agtcagaat 199219DNAHomo sapiens 92gttcatagtc agaattgta 199319DNAHomo sapiens 93gcagagatct ataaacaga 199419DNAHomo sapiens 94cagacaggct ctatgctaa 199519DNAHomo sapiens 95agacaggctc tatgctaaa 199619DNAHomo sapiens 96cctccttgct cgagatgga 199719DNAHomo sapiens 97tgaagagtga agacataaa 199819DNAHomo sapiens 98agctcattca gttcctgat 199919DNAHomo sapiens 99cattcagttc ctgatctca 1910019DNAHomo sapiens 100agctccttga gaacatcaa 1910119DNAHomo sapiens 101cattccatgc ccaagtata 1910219DNAHomo sapiens 102tggactccaa cctggataa 1910319DNAHomo sapiens 103ggttgttcat agtcagaat 1910419DNAHomo sapiens 104gttcatagtc agaattgta 1910519DNAHomo sapiens 105gcagagatct ataaacaga 1910619DNAHomo sapiens 106cagacaggct ctatgctaa 1910719DNAHomo sapiens 107agacaggctc tatgctaaa 1910819DNAHomo sapiens 108cctccttgct cgagatgga 1910919DNAHomo sapiens 109tgaagagtga agacataaa 1911019DNAHomo sapiens 110agctcattca gttcctgat 1911119DNAHomo sapiens 111cattcagttc ctgatctca 1911219DNAHomo sapiens 112agctccttga gaacatcaa 1911319DNAHomo sapiens 113cattccatgc ccaagtata 1911419DNAHomo sapiens 114tggactccaa cctggataa 1911519DNAHomo sapiens 115ggttgttcat agtcagaat 1911619DNAHomo sapiens 116gttcatagtc agaattgta 1911719DNAHomo sapiens 117gcagagatct ataaacaga 1911819DNAHomo sapiens 118cagacaggct ctatgctaa 1911919DNAHomo sapiens 119agacaggctc tatgctaaa 1912019DNAHomo sapiens 120cctccttgct cgagatgga 1912119DNAHomo sapiens 121tgaagagtga agacataaa 1912219DNAHomo sapiens 122agctcattca gttcctgat 1912319DNAHomo sapiens 123cattcagttc ctgatctca 1912419DNAHomo sapiens 124agctccttga gaacatcaa 1912519DNAHomo sapiens 125cattccatgc ccaagtata 1912619DNAHomo sapiens 126tggactccaa cctggataa 1912719DNAHomo sapiens 127ggttgttcat agtcagaat 1912819DNAHomo sapiens 128gttcatagtc agaattgta 1912919DNAHomo sapiens 129gcagagatct ataaacaga 1913019DNAHomo sapiens 130cagacaggct ctatgctaa 1913119DNAHomo sapiens 131agacaggctc tatgctaaa 1913219DNAHomo sapiens 132cctccttgct cgagatgga 1913319DNAHomo sapiens 133tgaagagtga agacataaa 1913419DNAHomo sapiens 134agctcattca gttcctgat 1913519DNAHomo sapiens 135cattcagttc ctgatctca 1913619DNAHomo sapiens 136agctccttga gaacatcaa 1913719DNAHomo sapiens 137cattccatgc ccaagtata 1913819DNAHomo sapiens 138tggactccaa cctggataa 1913919DNAHomo sapiens 139ggttgttcat agtcagaat 1914019DNAHomo sapiens 140gttcatagtc agaattgta 1914119DNAHomo sapiens 141gcagagatct ataaacaga 1914219DNAHomo sapiens 142cagacaggct ctatgctaa 1914319DNAHomo sapiens 143agacaggctc tatgctaaa 1914419DNAHomo sapiens 144cctccttgct cgagatgga 1914519DNAHomo sapiens 145tgaagagtga agacataaa 1914619DNAHomo sapiens 146agctcattca gttcctgat 1914719DNAHomo sapiens 147cattcagttc ctgatctca 1914819DNAHomo sapiens 148agctccttga gaacatcaa 1914919DNAHomo sapiens 149cattccatgc ccaagtata 1915019DNAHomo sapiens 150tggactccaa cctggataa 1915119DNAHomo sapiens 151ggttgttcat agtcagaat 1915219DNAHomo sapiens 152gttcatagtc agaattgta 1915319DNAHomo sapiens 153gcagagatct ataaacaga 1915419DNAHomo sapiens 154cagacaggct ctatgctaa 1915519DNAHomo sapiens 155agacaggctc tatgctaaa 1915619DNAHomo sapiens 156cctccttgct cgagatgga 1915719DNAHomo sapiens 157tgaagagtga agacataaa 1915819DNAHomo sapiens 158agctcattca gttcctgat 1915919DNAHomo sapiens 159cattcagttc ctgatctca 1916019DNAHomo sapiens 160agctccttga gaacatcaa 1916119DNAHomo sapiens 161cattccatgc ccaagtata 1916219DNAHomo sapiens 162tggactccaa cctggataa 1916319DNAHomo sapiens 163ggttgttcat agtcagaat 1916419DNAHomo sapiens 164gttcatagtc agaattgta 1916519DNAHomo sapiens 165gcagagatct ataaacaga 1916619DNAHomo sapiens 166cagacaggct ctatgctaa 1916719DNAHomo sapiens 167agacaggctc tatgctaaa 1916819DNAHomo sapiens 168cctccttgct cgagatgga 1916919RNAHomo sapiens 169uuuaugucuu cacucuuca 1917019RNAHomo sapiens 170aucaggaacu gaaugagcu 1917119RNAHomo sapiens 171ugagaucagg aacugaaug 1917219RNAHomo sapiens 172uugauguucu caaggagcu 1917319RNAHomo sapiens 173uauacuuggg cauggaaug 1917419RNAHomo sapiens 174uuauccaggu uggagucca 1917519RNAHomo sapiens 175auucugacua ugaacaacc 1917619RNAHomo sapiens 176uacaauucug acuaugaac 1917719RNAHomo sapiens 177ucuguuuaua gaucucugc 1917819RNAHomo sapiens 178uuagcauaga gccugucug 1917919RNAHomo sapiens 179uuuagcauag agccugucu 1918019RNAHomo sapiens 180uccaucucga gcaaggagg 1918119RNAHomo sapiens 181uuuaugucuu cacucuuca 1918219RNAHomo sapiens 182aucaggaacu gaaugagcu 1918319RNAHomo sapiens 183ugagaucagg aacugaaug 1918419RNAHomo sapiens 184uugauguucu caaggagcu 1918519RNAHomo sapiens 185uauacuuggg cauggaaug 1918619RNAHomo sapiens 186uuauccaggu uggagucca 1918719RNAHomo sapiens 187auucugacua ugaacaacc 1918819RNAHomo sapiens 188uacaauucug acuaugaac 1918919RNAHomo sapiens 189ucuguuuaua gaucucugc

1919019RNAHomo sapiens 190uuagcauaga gccugucug 1919119RNAHomo sapiens 191uuuagcauag agccugucu 1919219RNAHomo sapiens 192uccaucucga gcaaggagg 1919319RNAHomo sapiens 193uuuaugucuu cacucuuca 1919419RNAHomo sapiens 194aucaggaacu gaaugagcu 1919519RNAHomo sapiens 195ugagaucagg aacugaaug 1919619RNAHomo sapiens 196uugauguucu caaggagcu 1919719RNAHomo sapiens 197uauacuuggg cauggaaug 1919819RNAHomo sapiens 198uuauccaggu uggagucca 1919919RNAHomo sapiens 199auucugacua ugaacaacc 1920019RNAHomo sapiens 200uacaauucug acuaugaac 1920119RNAHomo sapiens 201ucuguuuaua gaucucugc 1920219RNAHomo sapiens 202uuagcauaga gccugucug 1920319RNAHomo sapiens 203uuuagcauag agccugucu 1920419RNAHomo sapiens 204uccaucucga gcaaggagg 1920519RNAHomo sapiens 205uuuaugucuu cacucuuca 1920619RNAHomo sapiens 206aucaggaacu gaaugagcu 1920719RNAHomo sapiens 207ugagaucagg aacugaaug 1920819RNAHomo sapiens 208uugauguucu caaggagcu 1920919RNAHomo sapiens 209uauacuuggg cauggaaug 1921019RNAHomo sapiens 210uuauccaggu uggagucca 1921119RNAHomo sapiens 211auucugacua ugaacaacc 1921219RNAHomo sapiens 212uacaauucug acuaugaac 1921319RNAHomo sapiens 213ucuguuuaua gaucucugc 1921419RNAHomo sapiens 214uuagcauaga gccugucug 1921519RNAHomo sapiens 215uuuagcauag agccugucu 1921619RNAHomo sapiens 216uccaucucga gcaaggagg 1921719RNAHomo sapiens 217uuuaugucuu cacucuuca 1921819RNAHomo sapiens 218aucaggaacu gaaugagcu 1921919RNAHomo sapiens 219ugagaucagg aacugaaug 1922019RNAHomo sapiens 220uugauguucu caaggagcu 1922119RNAHomo sapiens 221uauacuuggg cauggaaug 1922219RNAHomo sapiens 222uuauccaggu uggagucca 1922319RNAHomo sapiens 223auucugacua ugaacaacc 1922419RNAHomo sapiens 224uacaauucug acuaugaac 1922519RNAHomo sapiens 225ucuguuuaua gaucucugc 1922619RNAHomo sapiens 226uuagcauaga gccugucug 1922719RNAHomo sapiens 227uuuagcauag agccugucu 1922819RNAHomo sapiens 228uccaucucga gcaaggagg 1922919RNAHomo sapiens 229uuuaugucuu cacucuuca 1923019RNAHomo sapiens 230aucaggaacu gaaugagcu 1923119RNAHomo sapiens 231ugagaucagg aacugaaug 1923219RNAHomo sapiens 232uugauguucu caaggagcu 1923319RNAHomo sapiens 233uauacuuggg cauggaaug 1923419RNAHomo sapiens 234uuauccaggu uggagucca 1923519RNAHomo sapiens 235auucugacua ugaacaacc 1923619RNAHomo sapiens 236uacaauucug acuaugaac 1923719RNAHomo sapiens 237ucuguuuaua gaucucugc 1923819RNAHomo sapiens 238uuagcauaga gccugucug 1923919RNAHomo sapiens 239uuuagcauag agccugucu 1924019RNAHomo sapiens 240uccaucucga gcaaggagg 1924119RNAHomo sapiens 241uuuaugucuu cacucuuca 1924219RNAHomo sapiens 242aucaggaacu gaaugagcu 1924319RNAHomo sapiens 243ugagaucagg aacugaaug 1924419RNAHomo sapiens 244uugauguucu caaggagcu 1924519RNAhomo sapien 245uauacuuggg cauggaaug 1924619RNAHomo sapiens 246uuauccaggu uggagucca 1924719RNAHomo sapiens 247auucugacua ugaacaacc 1924819RNAHomo sapiens 248uacaauucug acuaugaac 1924919RNAHomo sapiens 249ucuguuuaua gaucucugc 1925019RNAHomo sapiens 250uuagcauaga gccugucug 1925119RNAHomo sapiens 251uuuagcauag agccugucu 1925219RNAHomo sapiens 252uccaucucga gcaaggagg 1925319RNAHomo sapiens 253ugaagaguga agacauaaa 1925419RNAHomo sapiens 254agcucauuca guuccugau 1925519RNAHomo sapiens 255cauucaguuc cugaucuca 1925619RNAHomo sapiens 256agcuccuuga gaacaucaa 1925719RNAHomo sapiens 257cauuccaugc ccaaguaua 1925819RNAHomo sapiens 258uggacuccaa ccuggauaa 1925919RNAHomo sapiens 259gguuguucau agucagaau 1926019RNAHomo sapiens 260guucauaguc agaauugua 1926119RNAHomo sapiens 261gcagagaucu auaaacaga 1926219RNAHomo sapiens 262cagacaggcu cuaugcuaa 1926319RNAHomo sapiens 263agacaggcuc uaugcuaaa 1926419RNAHomo sapiens 264ccuccuugcu cgagaugga 1926519RNAHomo sapiens 265ugaagaguga agacauaaa 1926619RNAHomo sapiens 266agcucauuca guuccugau 1926719RNAHomo sapiens 267cauucaguuc cugaucuca 1926819RNAHomo sapiens 268agcuccuuga gaacaucaa 1926919RNAHomo sapiens 269cauuccaugc ccaaguaua 1927019RNAHomo sapiens 270uggacuccaa ccuggauaa 1927119RNAHomo sapiens 271gguuguucau agucagaau 1927219RNAHomo sapiens 272guucauaguc agaauugua 1927319RNAHomo sapiens 273gcagagaucu auaaacaga 1927419RNAHomo sapiens 274cagacaggcu cuaugcuaa 1927519RNAHomo sapiens 275agacaggcuc uaugcuaaa 1927619RNAHomo sapiens 276ccuccuugcu cgagaugga 1927719RNAHomo sapiens 277ugaagaguga agacauaaa 1927819RNAHomo sapiens 278agcucauuca guuccugau 1927919RNAHomo sapiens 279cauucaguuc cugaucuca 1928019RNAHomo sapiens 280agcuccuuga gaacaucaa 1928119RNAHomo sapiens 281cauuccaugc ccaaguaua 1928219RNAHomo sapiens 282uggacuccaa ccuggauaa 1928319RNAHomo sapiens 283gguuguucau agucagaau 1928419RNAHomo sapiens 284guucauaguc agaauugua 1928519RNAHomo sapiens 285gcagagaucu auaaacaga 1928619RNAHomo sapiens 286cagacaggcu cuaugcuaa 1928719RNAHomo sapiens 287agacaggcuc uaugcuaaa 1928819RNAhomo sapien 288ccuccuugcu cgagaugga 1928919RNAHomo sapiens 289ugaagaguga agacauaaa 1929019RNAHomo sapiens 290agcucauuca guuccugau 1929119RNAHomo sapiens 291cauucaguuc cugaucuca 1929219RNAHomo sapiens 292agcuccuuga gaacaucaa 1929319RNAHomo sapiens 293cauuccaugc ccaaguaua 1929419RNAHomo sapiens 294uggacuccaa ccuggauaa 1929519RNAHomo sapiens 295gguuguucau agucagaau 1929619RNAHomo sapiens 296guucauaguc agaauugua 1929719RNAHomo sapiens 297gcagagaucu auaaacaga 1929819RNAHomo sapiens 298cagacaggcu cuaugcuaa 1929919RNAHomo sapiens 299agacaggcuc uaugcuaaa 1930019RNAHomo sapiens 300ccuccuugcu cgagaugga 1930119RNAHomo sapiens 301ugaagaguga agacauaaa 1930219RNAHomo sapiens 302agcucauuca guuccugau 1930319RNAHomo sapiens 303cauucaguuc cugaucuca 1930419RNAHomo sapiens 304agcuccuuga gaacaucaa 1930519RNAHomo sapiens 305cauuccaugc ccaaguaua 1930619RNAHomo sapiens 306uggacuccaa ccuggauaa 1930719RNAHomo sapiens 307gguuguucau agucagaau 1930819RNAHomo sapiens 308guucauaguc agaauugua 1930919RNAHomo sapiens 309gcagagaucu auaaacaga 1931019RNAHomo sapiens 310cagacaggcu cuaugcuaa 1931119RNAHomo sapiens 311agacaggcuc uaugcuaaa 1931219RNAHomo sapiens 312ccuccuugcu cgagaugga 1931319RNAHomo sapiens 313ugaagaguga agacauaaa 1931419RNAHomo sapiens 314agcucauuca guuccugau 1931519RNAHomo sapiens 315cauucaguuc cugaucuca 1931619RNAHomo sapiens 316agcuccuuga gaacaucaa 1931719RNAHomo sapiens 317cauuccaugc ccaaguaua 1931819RNAHomo sapiens 318uggacuccaa ccuggauaa 1931919RNAHomo sapiens 319gguuguucau agucagaau 1932019RNAHomo sapiens 320guucauaguc agaauugua 1932119RNAHomo sapiens 321gcagagaucu auaaacaga 1932219RNAHomo sapiens 322cagacaggcu cuaugcuaa 1932319RNAHomo sapiens 323agacaggcuc uaugcuaaa 1932419RNAHomo sapiens 324ccuccuugcu cgagaugga 1932519RNAHomo sapiens 325ugaagaguga agacauaaa 1932619RNAHomo sapiens 326agcucauuca guuccugau 1932719RNAHomo sapiens 327agcucauuca guuccugau 1932819RNAHomo sapiens 328agcuccuuga gaacaucaa 1932919RNAHomo sapiens 329cauuccaugc ccaaguaua 1933019RNAHomo sapiens 330uggacuccaa ccuggauaa 1933119RNAHomo sapiens 331gguuguucau agucagaau 1933219RNAHomo sapiens 332guucauaguc agaauugua 1933319RNAHomo sapiens 333gcagagaucu auaaacaga 1933419RNAHomo sapiens 334cagacaggcu cuaugcuaa 1933519RNAHomo sapiens 335agacaggcuc uaugcuaaa 1933619RNAHomo sapiens 336ccuccuugcu cgagaugga 1933721RNAArtificialRNAi agent sequence 337uuuaugucuu cacucuucau u 2133821RNAArtificialRNAi agent sequence 338aucaggaacu gaaugagcuu u 2133921RNAArtificialRNAi agent sequence 339ugagaucagg aacugaaugu u 2134021RNAArtificialRNAi agent sequence 340uugauguucu caaggagcuu u 2134121RNAArtificialRNAi agent sequence 341uauacuuggg cauggaaugu u 2134221RNAArtificialRNAi agent sequence 342uuauccaggu uggaguccau u 2134321RNAArtificialRNAi agent sequence 343auucugacua ugaacaaccu u 2134421RNAArtificialRNAi agent sequence 344uacaauucug acuaugaacu u 2134521RNAArtificialRNAi agent sequence 345ucuguuuaua gaucucugcu u 2134621RNAArtificialRNAi agent sequence 346uuagcauaga gccugucugu u 2134721RNAArtificialRNAi agent sequence 347uuuagcauag agccugucuu u 2134821RNAArtificialRNAi agent sequence 348uccaucucga gcaaggaggu u 2134921RNAArtificialRNAi agent sequence 349uuuaugucuu cacucuucau u 2135021RNAArtificialRNAi agent sequence 350aucaggaacu gaaugagcuu u 2135121RNAArtificialRNAi agent sequence 351ugagaucagg aacugaaugu u 2135221RNAArtificialRNAi agent sequence 352uugauguucu caaggagcuu u 2135321RNAArtificialRNAi agent sequence 353uauacuuggg cauggaaugu u 2135421RNAArtificialRNAi agent sequence 354uuauccaggu uggaguccau u 2135521RNAArtificialRNAi agent sequence 355auucugacua ugaacaaccu u 2135621RNAArtificialRNAi agent sequence 356uacaauucug acuaugaacu u 2135721RNAArtificialRNAi agent sequence 357ucuguuuaua gaucucugcu u 2135821RNAArtificialRNAi agent sequence 358uuagcauaga gccugucugu u 2135921RNAArtificialRNAi agent sequence 359uuuagcauag agccugucuu u 2136021RNAArtificialRNAi agent sequence 360uccaucucga gcaaggaggu u 2136121RNAArtificialRNAi agent sequence 361uuuaugucuu cacucuucau u 2136221RNAArtificialRNAi agent sequence 362aucaggaacu gaaugagcuu u 2136321RNAArtificialRNAi agent sequence 363ugagaucagg aacugaaugu u 2136421RNAArtificialRNAi agent sequence 364uugauguucu caaggagcuu u 2136521RNAArtificialRNAi agent sequence 365uauacuuggg cauggaaugu u 2136621RNAArtificialRNAi agent sequence 366uuauccaggu uggaguccau u 2136721RNAArtificialRNAi agent sequence 367auucugacua ugaacaaccu u 2136821RNAArtificialRNAi agent sequence 368uacaauucug acuaugaacu u 2136921RNAArtificialRNAi agent sequence 369ucuguuuaua gaucucugcu u 2137021RNAArtificialRNAi agent sequence 370uuagcauaga gccugucugu u 2137121RNAArtificialRNAi agent sequence 371uuuagcauag

agccugucuu u 2137221RNAArtificialRNAi agent sequence 372uccaucucga gcaaggaggu u 2137321RNAArtificialRNAi agent sequence 373uuuaugucuu cacucuucau u 2137421RNAArtificialRNAi agent sequence 374aucaggaacu gaaugagcuu u 2137521RNAArtificialRNAi agent sequence 375ugagaucagg aacugaaugu u 2137621RNAArtificialRNAi agent sequence 376uugauguucu caaggagcuu u 2137721RNAArtificialRNAi agent sequence 377uauacuuggg cauggaaugu u 2137821RNAArtificialRNAi agent sequence 378uuauccaggu uggaguccau u 2137921RNAArtificialRNAi agent sequence 379auucugacua ugaacaaccu u 2138021RNAArtificialRNAi agent sequence 380uacaauucug acuaugaacu u 2138121RNAArtificialRNAi agent sequence 381ucuguuuaua gaucucugcu u 2138221RNAArtificialRNAi agent sequence 382uuagcauaga gccugucugu u 2138321RNAArtificialRNAi agent sequence 383uuuagcauag agccugucuu u 2138421RNAArtificialRNAi agent sequence 384uccaucucga gcaaggaggu u 2138521RNAArtificialRNAi agent sequence 385uuuaugucuu cacucuucau u 2138621RNAArtificialRNAi agent sequence 386aucaggaacu gaaugagcuu u 2138721RNAArtificialRNAi agent sequence 387ugagaucagg aacugaaugu u 2138821RNAArtificialRNAi agent sequence 388uugauguucu caaggagcuu u 2138921RNAArtificialRNAi agent sequence 389uauacuuggg cauggaaugu u 2139021RNAArtificialRNAi agent sequence 390uuauccaggu uggaguccau u 2139121RNAArtificialRNAi agent sequence 391auucugacua ugaacaaccu u 2139221RNAArtificialRNAi agent sequence 392uacaauucug acuaugaacu u 2139321RNAArtificialRNAi agent sequence 393ucuguuuaua gaucucugcu u 2139421RNAArtificialRNAi agent sequence 394uuagcauaga gccugucugu u 2139521RNAArtificialRNAi agent sequence 395uuuagcauag agccugucuu u 2139621RNAArtificialRNAi agent sequence 396uccaucucga gcaaggaggu u 2139721RNAArtificialRNAi agent sequence 397uuuaugucuu cacucuucau u 2139821RNAArtificialRNAi agent sequence 398aucaggaacu gaaugagcuu u 2139921RNAArtificialRNAi agent sequence 399ugagaucagg aacugaaugu u 2140021RNAArtificialRNAi agent sequence 400uugauguucu caaggagcuu u 2140121RNAArtificialRNAi agent sequence 401uauacuuggg cauggaaugu u 2140221RNAArtificialRNAi agent sequence 402uuauccaggu uggaguccau u 2140321RNAArtificialRNAi agent sequence 403auucugacua ugaacaaccu u 2140421RNAArtificialRNAi agent sequence 404uacaauucug acuaugaacu u 2140521RNAArtificialRNAi agent sequence 405ucuguuuaua gaucucugcu u 2140621RNAArtificialRNAi agent sequence 406uuagcauaga gccugucugu u 2140721RNAArtificialRNAi agent sequence 407uuuagcauag agccugucuu u 2140821RNAArtificialRNAi agent sequence 408uccaucucga gcaaggaggu u 2140921RNAArtificialRNAi agent sequence 409uuuaugucuu cacucuucau u 2141021RNAArtificialRNAi agent sequence 410aucaggaacu gaaugagcuu u 2141121RNAArtificialRNAi agent sequence 411ugagaucagg aacugaaugu u 2141221RNAArtificialRNAi agent sequence 412uugauguucu caaggagcuu u 2141321RNAArtificialRNAi agent sequence 413uauacuuggg cauggaaugu u 2141421RNAArtificialRNAi agent sequence 414uuauccaggu uggaguccau u 2141521RNAArtificialRNAi agent sequence 415auucugacua ugaacaaccu u 2141621RNAArtificialRNAi agent sequence 416uacaauucug acuaugaacu u 2141721RNAArtificialRNAi agent sequence 417ucuguuuaua gaucucugcu u 2141821RNAArtificialRNAi agent sequence 418uuagcauaga gccugucugu u 2141921RNAArtificialRNAi agent sequence 419uuuagcauag agccugucuu u 2142021RNAArtificialRNAi agent sequence 420uccaucucga gcaaggaggu u 2142121RNAArtificialRNAi agent sequence 421ugaagaguga agacauaaau u 2142221RNAArtificialRNAi agent sequence 422agcucauuca guuccugauu u 2142321RNAArtificialRNAi agent sequence 423cauucaguuc cugaucucau u 2142421RNAArtificialRNAi agent sequence 424agcuccuuga gaacaucaau u 2142521RNAArtificialRNAi agent sequence 425cauuccaugc ccaaguauau u 2142621RNAArtificialRNAi agent sequence 426uggacuccaa ccuggauaau u 2142721RNAArtificialRNAi agent sequence 427gguuguucau agucagaauu u 2142821RNAArtificialRNAi agent sequence 428guucauaguc agaauuguau u 2142921RNAArtificialRNAi agent sequence 429gcagagaucu auaaacagau u 2143021RNAArtificialRNAi agent sequence 430cagacaggcu cuaugcuaau u 2143121RNAArtificialRNAi agent sequence 431agacaggcuc uaugcuaaau u 2143221RNAArtificialRNAi agent sequence 432ccuccuugcu cgagauggau u 2143321RNAArtificialRNAi agent sequence 433ugaagaguga agacauaaau u 2143421RNAArtificialRNAi agent sequence 434agcucauuca guuccugauu u 2143521RNAArtificialRNAi agent sequence 435cauucaguuc cugaucucau u 2143621RNAArtificialRNAi agent sequence 436agcuccuuga gaacaucaau u 2143721RNAArtificialRNAi agent sequence 437cauuccaugc ccaaguauau u 2143821RNAArtificialRNAi agent sequence 438uggacuccaa ccuggauaau u 2143921RNAArtificialRNAi agent sequence 439gguuguucau agucagaauu u 2144021RNAArtificialRNAi agent sequence 440guucauaguc agaauuguau u 2144121RNAArtificialRNAi agent sequence 441gcagagaucu auaaacagau u 2144221RNAArtificialRNAi agent sequence 442cagacaggcu cuaugcuaau u 2144321RNAArtificialRNAi agent sequence 443agacaggcuc uaugcuaaau u 2144421RNAArtificialRNAi agent sequence 444ccuccuugcu cgagauggau u 2144521RNAArtificialRNAi agent sequence 445ugaagaguga agacauaaau u 2144621RNAArtificialRNAi agent sequence 446agcucauuca guuccugauu u 2144721RNAArtificialRNAi agent sequence 447cauucaguuc cugaucucau u 2144821RNAArtificialRNAi agent sequence 448agcuccuuga gaacaucaau u 2144921RNAArtificialRNAi agent sequence 449cauuccaugc ccaaguauau u 2145021RNAArtificialRNAi agent sequence 450uggacuccaa ccuggauaau u 2145121RNAArtificialRNAi agent sequence 451gguuguucau agucagaauu u 2145221RNAArtificialRNAi agent sequence 452guucauaguc agaauuguau u 2145321RNAArtificialRNAi agent sequence 453gcagagaucu auaaacagau u 2145421RNAArtificialRNAi agent sequence 454cagacaggcu cuaugcuaau u 2145521RNAArtificialRNAi agent sequence 455agacaggcuc uaugcuaaau u 2145621RNAArtificialRNAi agent sequence 456ccuccuugcu cgagauggau u 2145721RNAArtificialRNAi agent sequence 457ugaagaguga agacauaaau u 2145821RNAArtificialRNAi agent sequence 458agcucauuca guuccugauu u 2145921RNAArtificialRNAi agent sequence 459cauucaguuc cugaucucau u 2146021RNAArtificialRNAi agent sequence 460agcuccuuga gaacaucaau u 2146121RNAArtificialRNAi agent sequence 461cauuccaugc ccaaguauau u 2146221RNAArtificialRNAi agent sequence 462uggacuccaa ccuggauaau u 2146321RNAArtificialRNAi agent sequence 463gguuguucau agucagaauu u 2146421RNAArtificialRNAi agent sequence 464guucauaguc agaauuguau u 2146521RNAArtificialRNAi agent sequence 465gcagagaucu auaaacagau u 2146621RNAArtificialRNAi agent sequence 466cagacaggcu cuaugcuaau u 2146721RNAArtificialRNAi agent sequence 467agacaggcuc uaugcuaaau u 2146821RNAArtificialRNAi agent sequence 468ccuccuugcu cgagauggau u 2146921RNAArtificialRNAi agent sequence 469ugaagaguga agacauaaau u 2147021RNAArtificialRNAi agent sequence 470agcucauuca guuccugauu u 2147121RNAArtificialRNAi agent sequence 471cauucaguuc cugaucucau u 2147221RNAArtificialRNAi agent sequence 472agcuccuuga gaacaucaau u 2147321RNAArtificialRNAi agent sequence 473cauuccaugc ccaaguauau u 2147421RNAArtificialRNAi agent sequence 474uggacuccaa ccuggauaau u 2147521RNAArtificialRNAi agent sequence 475gguuguucau agucagaauu u 2147621RNAArtificialRNAi agent sequence 476guucauaguc agaauuguau u 2147721RNAArtificialRNAi agent sequence 477gcagagaucu auaaacagau u 2147821RNAArtificialRNAi agent sequence 478cagacaggcu cuaugcuaau u 2147921RNAArtificialRNAi agent sequence 479agacaggcuc uaugcuaaau u 2148021RNAArtificialRNAi agent sequence 480ccuccuugcu cgagauggau u 2148121RNAArtificialRNAi agent sequence 481ugaagaguga agacauaaau u 2148221RNAArtificialRNAi agent sequence 482agcucauuca guuccugauu u 2148321RNAArtificialRNAi agent sequence 483cauucaguuc cugaucucau u 2148421RNAArtificialRNAi agent sequence 484agcuccuuga gaacaucaau u 2148521RNAArtificialRNAi agent sequence 485cauuccaugc ccaaguauau u 2148621RNAArtificialRNAi agent sequence 486uggacuccaa ccuggauaau u 2148721RNAArtificialRNAi agent sequence 487gguuguucau agucagaauu u 2148821RNAArtificialRNAi agent sequence 488guucauaguc agaauuguau u 2148921RNAArtificialRNAi agent sequence 489gcagagaucu auaaacagau u 2149021RNAArtificialRNAi agent sequence 490cagacaggcu cuaugcuaau u 2149121RNAArtificialRNAi agent sequence 491agacaggcuc uaugcuaaau u 2149221RNAArtificialRNAi agent sequence 492ccuccuugcu cgagauggau u 2149321RNAArtificialRNAi agent sequence 493ugaagaguga agacauaaau u 2149421RNAArtificialRNAi agent sequence 494agcucauuca guuccugauu u 2149521RNAArtificialRNAi agent sequence 495cauucaguuc cugaucucau u 2149621RNAArtificialRNAi agent sequence 496agcuccuuga gaacaucaau u 2149721RNAArtificialRNAi agent sequence 497cauuccaugc ccaaguauau u 2149821RNAArtificialRNAi agent sequence 498uggacuccaa ccuggauaau u 2149921RNAArtificialRNAi agent sequence 499gguuguucau agucagaauu u 2150021RNAArtificialRNAi agent sequence 500guucauaguc agaauuguau u 2150121RNAArtificialRNAi agent sequence 501gcagagaucu auaaacagau u 2150221RNAArtificialRNAi agent sequence 502cagacaggcu cuaugcuaau u 2150321RNAArtificialRNAi agent sequence 503agacaggcuc uaugcuaaau u 2150421RNAArtificialRNAi agent sequence 504ccuccuugcu cgagauggau u 21505529PRTHomo sapiens 505Met Asp Leu Pro Val Gly Pro Gly Ala Ala Gly Pro Ser Asn Val Pro 1 5 10 15 Ala Phe Leu Thr Lys Leu Trp Thr Leu Val Ser Asp Pro Asp Thr Asp 20 25 30 Ala Leu Ile Cys Trp Ser Pro Ser Gly Asn Ser Phe His Val Phe Asp 35 40 45 Gln Gly Gln Phe Ala Lys Glu Val Leu Pro Lys Tyr Phe Lys His Asn 50 55 60 Asn Met Ala Ser Phe Val Arg Gln Leu Asn Met Tyr Gly Phe Arg Lys 65 70 75 80 Val Val His Ile Glu Gln Gly Gly Leu Val Lys Pro Glu Arg Asp Asp 85 90 95 Thr Glu Phe Gln His Pro Cys Phe Leu Arg Gly Gln Glu Gln Leu Leu 100 105 110 Glu Asn Ile Lys Arg Lys Val Thr Ser Val Ser Thr Leu Lys Ser Glu 115 120 125 Asp Ile Lys Ile Arg Gln Asp Ser Val Thr Lys Leu Leu Thr Asp Val 130 135 140 Gln Leu Met Lys Gly Lys Gln Glu Cys Met Asp Ser Lys Leu Leu Ala 145 150 155 160 Met Lys His Glu Asn Glu Ala Leu Trp Arg Glu Val Ala Ser Leu Arg 165 170 175 Gln Lys His Ala Gln Gln Gln Lys Val Val Asn Lys Leu Ile Gln Phe 180 185 190 Leu Ile Ser Leu Val Gln Ser Asn Arg Ile Leu Gly Val Lys Arg Lys 195 200 205 Ile Pro Leu Met Leu Asn Asp Ser Gly Ser Ala His Ser Met Pro Lys 210 215 220 Tyr Ser Arg Gln Phe Ser Leu Glu His Val His Gly Ser Gly Pro Tyr 225 230 235 240 Ser Ala Pro Ser Pro Ala Tyr Ser Ser Ser Ser Leu Tyr Ala Pro Asp 245 250 255 Ala Val Ala Ser Ser Gly Pro Ile Ile Ser Asp Ile Thr Glu Leu Ala 260 265 270 Pro Ala Ser Pro Met Ala Ser Pro Gly Gly Ser Ile Asp Glu Arg Pro 275 280 285 Leu Ser Ser Ser Pro Leu Val Arg Val Lys Glu Glu Pro Pro Ser Pro 290 295 300 Pro Gln Ser Pro Arg Val Glu Glu Ala Ser Pro Gly Arg Pro Ser Ser 305 310 315 320 Val Asp Thr Leu Leu Ser Pro Thr Ala Leu Ile Asp Ser Ile Leu Arg 325 330 335 Glu Ser Glu Pro Ala Pro Ala Ser Val

Thr Ala Leu Thr Asp Ala Arg 340 345 350 Gly His Thr Asp Thr Glu Gly Arg Pro Pro Ser Pro Pro Pro Thr Ser 355 360 365 Thr Pro Glu Lys Cys Leu Ser Val Ala Cys Leu Asp Lys Asn Glu Leu 370 375 380 Ser Asp His Leu Asp Ala Met Asp Ser Asn Leu Asp Asn Leu Gln Thr 385 390 395 400 Met Leu Ser Ser His Gly Phe Ser Val Asp Thr Ser Ala Leu Leu Asp 405 410 415 Leu Phe Ser Pro Ser Val Thr Val Pro Asp Met Ser Leu Pro Asp Leu 420 425 430 Asp Ser Ser Leu Ala Ser Ile Gln Glu Leu Leu Ser Pro Gln Glu Pro 435 440 445 Pro Arg Pro Pro Glu Ala Glu Asn Ser Ser Pro Asp Ser Gly Lys Gln 450 455 460 Leu Val His Tyr Thr Ala Gln Pro Leu Phe Leu Leu Asp Pro Gly Ser 465 470 475 480 Val Asp Thr Gly Ser Asn Asp Leu Pro Val Leu Phe Glu Leu Gly Glu 485 490 495 Gly Ser Tyr Phe Ser Glu Gly Asp Gly Phe Ala Glu Asp Pro Thr Ile 500 505 510 Ser Leu Leu Thr Gly Ser Glu Pro Pro Lys Ala Lys Asp Pro Thr Val 515 520 525 Ser 5062137DNACynomolgus monkeymisc_feature(68)..(156)n is a, c, g, or t 506cgcgcccgtt gcaagatggc ggcggcaaag ctgggccttg gggctggggg ggcgcagggg 60gaggcggnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn 120nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncgag atggatctgc ccgtgggccc 180cggtgcggcg gggcccagca ancgtcccgg ccttcctgac caagctgtgg accctcgtga 240gcgacccgga caccgacgcg ctcatctgct ggagcccgag tgggaacagc ttccatgtgt 300tcgaccaggg ccagtttgcc aaggaggtgc tgcccaagta tttcaagcac aacaacatgg 360ccagcttcgt gcggcagctc aacatgtatg gtttccggaa agtggtccac atcgagcagg 420gtggcctggt caagccagag agagacgaca cggagttcca gcacccgtgc ttcctgcgcg 480gccaggagca gctccttgag aacatcanag aggaaagtga ccagtgtgtc caccctgaag 540agtgaagaca taaagatccg tcaggacagt gtcaccaagc tgctgacgga cgtgcagctg 600atgaagggga agcaggagtg catggactcc aagctcctgg ccatgaagca tgagaatgag 660gctctgtggc gggaggtggc cagccttcgg cagaagcatg cccagcaaca gaaagtcgtc 720aacaagctca ttcagttcct gatctcactg gtgcagtcaa accggatcct gggggtgaag 780agaaagatcc ccctgatgct gaacgacagt ggctcagcac attccatgcc caagtatggc 840cggcagttct ccctggagca cgtccacggc tcgggcccct actcggcccc ctccccagcc 900tacagtagct ccagcctcta cgcccccgat tctgtggcca actccggacc catcatctcc 960gacatcaccg agctggctcc tgccagcccc gtggcctccc ctggcgggag catagacgag 1020aggcccctgt ctagcagccc cctggtgcgt gtcaaagagg agccccccag cccgcctcag 1080agcccccggg tagaggaggc gagtcccggg cgcccatctt ccgtggacac cctcttgtcc 1140ccgaccgccc tcattgactc catcctgcgg gagagtgaac ctacccccgc ctccgccaca 1200gccctcaccg atgccagggg ccacacggac accgagggcc ggcctccctc acccccgccc 1260acctccaccc ctgaaaagtg cctcagcgta gcctgcctgg acaagaatga gctcagtgat 1320cacttggatg ctatggactc caacctggac aacctgcaga ccatgctgag cagccacggc 1380ttcagcgtgg acaccagcgc cctgctggac ctgttcagcc cctcggtgac cgtgcccgac 1440atgagcctgc ctgaccttga cagcagcctg gctagtatcc aagagctcct gtctccccag 1500gagccctcca ggcctcccga ggcagagaac agcagcccgg attcagggaa gcagctggtg 1560cactacacag cacagccact gttcctgctc gaccccggct ccgtgggcac cgggagcagc 1620gacttgccgg tgctgtttga gctgggggag ggctcctact tctccgaagg ggacggcttc 1680gcagaggacc ccaccatctc cctgctgaca ggctcagagc ctcccaaagc caaggacccc 1740actgtctcct aggcgcccgg gaggagctgg gccagccgcc cacccccacc cccagtgcag 1800ggctggcctt ggggaggaag aggcagcctc gaggtcctgg gcactggtgg gttggccacc 1860acagccccag taggacaaac aggggctcag gtctgggcag cacctctggt caggagggtc 1920accccggcct cccagtctgc cttcccccaa ccccgtgtcc tgtggtttgg ttggggcttc 1980gtagccacac ctggactgac cctgcaggtt gttcataatc agaattgtat tttggatttt 2040tacacaactg tcccattccc tgttccatag agatatacag atatatacac acaggtggat 2100ggacggacaa gacaggcaga gatctataaa cagacag 213750715DNAHomo sapiens 507atcaggaact gaatg 1550815DNAHomo sapiens 508attctgacta tgaac 1550919DNAHomo sapiens 509ttagcataga gcctgtctg 1951015DNAHomo sapiens 510cattcagttc ctgat 1551115DNAHomo sapiens 511gttcatagtc agaat 1551218DNAHomo sapiens 512agacaggctc tatgctaa 185132286DNAHomo sapiens 513gcggcgggag cgcgcccgtt gcaagatggc ggcggccatg ctgggccccg gggctgtgtg 60tgcgcagcgg gcggcggcgc ggcccggaag gctggcgcgg cgacggcgtt agcccggccc 120tcggcccctc tttgcggccg ctccctccgc ctattccctc cttgctcgag atggatctgc 180ccgtgggccc cggcgcggcg gggcccagca acgtcccggc cttcctgacc aagctgtgga 240ccctcgtgag cgacccggac accgacgcgc tcatctgctg gagcccgagc gggaacagct 300tccacgtgtt cgaccagggc cagtttgcca aggaggtgct gcccaagtac ttcaagcaca 360acaacatggc cagcttcgtg cggcagctca acatgtatgg cttccggaaa gtggtccact 420tccacgtgtt cgaccagggc cagtttgcca aggaggtgct gcccaagtac ttcaagcaca 480acaacatggc cagcttcgtg cggcagctca acatgtatgg cttccggaaa gtggtccaca 540tcgagcaggg cggcctggtc aagccagaga gagacgacac ggagttccag cacccatgct 600tcctgcgtgg ccaggagcag ctccttgaga acatcaagag gaaagtgacc agtgtgtcca 660ccctgaagag tgaagacata aagatccgcc aggacagcgt caccaagctg ctgacggacg 720tgcagctgat gaaggggaag caggagtgca tggactccaa gctcctggcc atgaagcatg 780agaatgaggc tctgtggcgg gaggtggcca gccttcggca gaagcatgcc cagcaacaga 840aagtcgtcaa caagctcatt cagttcctga tctcactggt gcagtcaaac cggatcctgg 900gggtgaagag aaagatcccc ctgatgctga acgacagtgg ctcagcacat tccatgccca 960agtatagccg gcagttctcc ctggagcacg tccacggctc gggcccctac tcggccccct 1020ccccagccta cagcagctcc agcctctacg cccctgatgc tgtggccagc tctggaccca 1080tcatctccga catcaccgag ctggctcctg ccagccccat ggcctccccc ggcgggagca 1140tagacgagag gcccctatcc agcagccccc tggtgcgtgt caaggaggag ccccccagcc 1200cgcctcagag cccccgggta gaggaggcga gtcccgggcg cccatcttcc gtggacaccc 1260tcttgtcccc gaccgccctc attgactcca tcctgcggga gagtgaacct gcccccgcct 1320ccgtcacagc cctcacggac gccaggggcc acacggacac cgagggccgg cctccctccc 1380ccccgcccac ctccacccct gaaaagtgcc tcagcgtagc ctgcctggac aagaatgagc 1440tcagtgacca cttggatgct atggactcca acctggataa cctgcagacc atgctgagca 1500gccacggctt cagcgtggac accagtgccc tgctggacct gttcagcccc tcggtgaccg 1560tgcccgacat gagcctgcct gaccttgaca gcagcctggc cagtatccaa gagctcctgt 1620ctccccagga gccccccagg cctcccgagg cagagaacag cagcccggat tcagggaagc 1680agctggtgca ctacacagcg cagccgctgt tcctgctgga ccccggctcc gtggacaccg 1740ggagcaacga cctgccggtg ctgtttgagc tgggagaggg ctcctacttc tccgaagggg 1800acggcttcgc cgaggacccc accatctccc tgctgacagg ctcggagcct cccaaagcca 1860aggaccccac tgtctcctag aggccccgga ggagctgggc cagccgccca cccccacccc 1920cagtgcaggg ctggtcttgg ggaggcaggg cagcctcgcg gtcttgggca ctggtgggtc 1980ggccgccata gccccagtag gacaaacggg ctcgggtctg ggcagcacct ctggtcagga 2040gggtcaccct ggcctgccag tctgccttcc cccaaccccg tgtcctgtgg tttggttggg 2100gcttcacagc cacacctgga ctgaccctgc aggttgttca tagtcagaat tgtattttgg 2160atttttacac aactgtcccg ttccccgctc cacagagata cacagatata tacacacagt 2220ggatggacgg acaagacagg cagagatcta taaacagaca ggctctatgc taaaaaaaaa 2280aaaaaa 228651419RNAHomo sapiens 514uccaucucga gcaaggagg 1951519RNAHomo sapiens 515ccuccuugcu cgagaugga 19

Claims

1. A composition comprising a RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

2. The composition of claim 1, wherein the composition further comprises a second RNAi agent to HSF1.

3. The composition of claim 1, wherein the RNAi agent comprises at least one modified backbone and/or at least one 2'-modified nucleotide.

4. The composition of claim 1, wherein the RNAi agent is ligated to one or more agent selected from: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

5. A composition comprising a RNAi agent comprising a first strand and a second strand, wherein the first strand and second strand comprise at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the first and second strand, respectively, of a RNAi agent specific to HSF1 provided in Table A1.

6. The composition of claim 1, wherein the composition comprises a second RNAi agent to HSF1.

7. The composition of claim 1, wherein the RNAi agent comprises a phosphorothioate and/or a 2'-modified nucleotide.

8. The composition of claim 1, wherein the RNAi agent is ligated to one or more agents, the agent selected from a: one or more diagnostic compound, reporter group, cross-linking agent, nuclease-resistance conferring moiety, natural or unusual nucleobase, lipophilic molecule, cholesterol, lipid, lectin, steroid, uvaol, hecigenin, diosgenin, terpene, triterpene, sarsasapogenin, Friedelin, epifriedelanol-derivatized lithocholic acid, vitamin, carbohydrate, dextran, pullulan, chitin, chitosan, synthetic carbohydrate, oligo lactate 15-mer, natural polymer, low- or medium-molecular weight polymer, inulin, cyclodextrin, hyaluronic acid, protein, protein-binding agent, integrin-targeting molecule, polycationic, peptide, polyamine, peptide mimic, and/or transferrin.

9. A method of treating a HSF1-related disease in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising a RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

10. The method of claim 9, wherein the HSF1-related disease is cancer, or autoimmune, or a viral disease.

11. The method of claim 9, wherein the method further comprises the step of administering an additional treatment for cancer, or autoimmune, or a viral disease.

12. The method of claim 11, wherein the method further comprises the step of administering an additional RNAi agent to HSF1.

13. A method of inhibiting the expression of the HSF1 gene in an individual, comprising the step of administering to the individual a therapeutically effective amount of a composition comprising a RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

14. The method of claim 13, wherein the HSF1-related disease is cancer, or autoimmune, or a viral disease.

15. A medicament for use in an RNAi formulation comprising a RNAi agent comprising a sense strand and an antisense strand, wherein the antisense strand comprises at least 15 contiguous nucleotides differing by 0, 1, 2, or 3 nucleotides from the antisense strand of a RNAi agent specific to HSF1 provided in Table A1.

16. Any composition above in a pharmaceutically effective formulation.

17. The composition according to claim 1, for use in a method of treating a HSF1-related disease in an individual, the method comprising the step of administering to the individual a therapeutically effective amount of a composition according to claim 1.

18. The use of a composition according to claim 1, in the manufacture of a medicament for the treatment of a HSF1-related disease.

19. The composition of claim 1, wherein all the pyrimidines are 2' O-methyl-modified nucleotides.

20. The composition of claim 5, wherein all the pyrimidines are 2' O-methyl-modified nucleotides.

21. The method of claim 11, wherein the additional treatment is a HSP90 inhibitor.

22. The method of claim 21, wherein the HSP90 inhibitor is AUY922.