U.S. patent application number 14/604047 was filed with the patent office on 2015-07-16 for tumor specific antibody.
The applicant listed for this patent is Viventia Bio Inc.. Invention is credited to Denis Georges Bosc, Francina C. Chahal, Jeannick Cizeau, Joycelyn Entwistle, Nicholas Ronald GLOVER, Glen Christopher MacDonald.
Application Number | 20150197575 14/604047 |
Document ID | / |
Family ID | 35503067 |
Filed Date | 2015-07-16 |
United States Patent
Application |
20150197575 |
Kind Code |
A1 |
GLOVER; Nicholas Ronald ; et
al. |
July 16, 2015 |
TUMOR SPECIFIC ANTIBODY
Abstract
The present invention provides the amino acid and nucleic acid
sequences of heavy chain and light chain complementarity
determining regions of a tumor specific antibody. In addition, the
invention provides tumor-specific antibodies and immunoconjugates
comprising the tumor-specific antibody attached to a toxin or
label, and methods and uses thereof. The invention also relates to
diagnostic methods and kits using the tumor-specific antibodies of
the invention.
Inventors: |
GLOVER; Nicholas Ronald;
(Oakville, CA) ; MacDonald; Glen Christopher;
(Winnipeg, CA) ; Entwistle; Joycelyn; (Winnipeg,
CA) ; Cizeau; Jeannick; (Winnipeg, CA) ; Bosc;
Denis Georges; (Winnipeg, CA) ; Chahal; Francina
C.; (Winnipeg, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Viventia Bio Inc. |
Winnipeg |
|
CA |
|
|
Family ID: |
35503067 |
Appl. No.: |
14/604047 |
Filed: |
January 23, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13743672 |
Jan 17, 2013 |
8969540 |
|
|
14604047 |
|
|
|
|
11570198 |
Jun 27, 2007 |
8383117 |
|
|
PCT/CA2005/000899 |
Jun 10, 2005 |
|
|
|
13743672 |
|
|
|
|
60578291 |
Jun 10, 2004 |
|
|
|
Current U.S.
Class: |
424/135.1 ;
424/133.1; 424/136.1; 424/139.1; 424/178.1; 424/183.1; 530/387.3;
530/388.22; 530/391.7 |
Current CPC
Class: |
C07K 16/30 20130101;
A61P 35/00 20180101; G01N 2333/471 20130101; A61K 47/6829 20170801;
A61K 45/06 20130101; C07K 2317/565 20130101; A61K 47/6849 20170801;
C07K 2317/54 20130101; C07K 2319/55 20130101; A61K 47/6851
20170801; G01N 33/574 20130101; C07K 2317/626 20130101; C07K
2317/622 20130101; C12N 9/1077 20130101; C07K 2317/77 20130101;
A61K 47/6855 20170801; G01N 2333/70585 20130101; C07K 14/415
20130101; C07K 16/2884 20130101; C07K 2317/624 20130101; C07K
2317/55 20130101; A61K 38/00 20130101; A61K 39/39558 20130101; A61K
47/6819 20170801; A61K 2039/505 20130101; C07K 16/3015 20130101;
C07K 2317/31 20130101 |
International
Class: |
C07K 16/28 20060101
C07K016/28; A61K 39/395 20060101 A61K039/395; A61K 45/06 20060101
A61K045/06; C07K 16/30 20060101 C07K016/30; A61K 47/48 20060101
A61K047/48 |
Claims
1-107. (canceled)
108. A binding protein that binds to the 5-v8 interface of
CD44E.
109. The binding protein of claim 108 wherein the binding protein
is an antibody.
110. The binding protein of claim 109 wherein the antibody is an
antibody fragment.
111. The binding protein of claim 110 wherein the antibody fragment
is a Fab, Fab', F(ab').sub.2, scFv, dsFv, ds-scFv, dimers,
minibodies, diabodies, and multimers thereof or bispecific antibody
fragments.
112. A composition comprising any one of the binding proteins of
claim 108 with a pharmaceutically acceptable excipient, carrier,
buffer or stabilizer.
113. An immunotoxin comprising (1) a binding protein according to
claim 108 that binds to the 5-v8 interface of CD44E on or in a
cancer cell, attached to (2) a cancer therapeutic that is
cytotoxic, cytostatic or otherwise prevents or reduces the ability
of the cancer cells to divide and/or metastasize.
114. The immunotoxin of claim 113 wherein the cancer therapeutic is
a toxin, such as a ribosome-inactivating polypeptide, and
optionally wherein the toxin is selected from the group consisting
of gelonin, Bouganin, saproin, ricin, ricin A chain, bryodin,
diphtheria, restrictocin, and Pseudomonas exotoxin A, and
preferably wherein the toxin is modified Bouganin or a truncated
form of Pseudomonas exotoxin A that consists of amino acids
252-608.
115. The immunotoxin of claim 113 wherein the immunotoxin is
internalized by the cancer cell.
116. A composition comprising the immunotoxin of claim 113 with a
pharmaceutically acceptable excipient, carrier, buffer or
stabilizer.
117. A method for treating cancer in a subject in need thereof
comprising administering to said subject a pharmaceutically
effective amount of the binding protein of claim 108.
118. The method of claim 117 wherein the 5-v8 interface of CD44E
comprises the amino acid sequence ATNMDSSHSIT.
119. The method of claim 117 wherein the binding protein is an
antibody.
120. The method of claim 119 wherein the antibody is an antibody
fragment.
121. The method of claim 120 wherein the antibody fragment is a
Fab, Fab', F(ab').sub.2, ScFc, dsFv, ds-scFV, dimers, minibodies,
diabodies and multimers thereof or bispecific antibody
fragments.
122. The method of claim 117 wherein the binding protein is
conjugated to a cancer therapeutic that is cytotoxic, cytostatic,
or otherwise prevents or reduces the ability of cancer cells to
divide and/or metastasize.
123. The method of claim 122 wherein the cancer therapeutic is a
toxin.
124. The method of claim 123 wherein the toxin is a ribosome
inactivating protein.
125. The method of claim 124 wherein the toxin is selected from the
group consisting of gelonin, Bouganin, saporin, ricin, ricin A
chain, bryodin, diphtheria, restictocin, and pseudomonas exotoxin
A.
126. The method of claim 125 wherein the toxin is modified
Bouganin.
127. The method of claim 125 wherein the toxin is a truncated form
of pseudomonas exotoxin A that consists of amino acids 252-608.
128. The method of claim 117 wherein the cancer is breast
cancer.
129. The method of claim 128 wherein the binding protein is
administered before, during or after surgical intervention.
130. The method of claim 117 further comprising administering one
or more additional anticancer drugs to said subject.
131. The method of claim 130 wherein the one or more additional
anticancer drugs is administered prior to, during or after
administration of the binding protein.
Description
FIELD OF THE INVENTION
[0001] The invention relates to human tumor-specific binding
proteins and all uses thereof. In particular, the invention relates
to antibodies or antibody fragments specific for antigens or
molecules on cancer cells and to immunoconjugates comprising the
binding proteins of the invention, and methods of use thereof.
BACKGROUND OF THE INVENTION
[0002] In the year 2000, an estimated 22 million people were
suffering from cancer worldwide and 6.2 millions deaths were
attributed to this class of diseases. Every year, there are over 10
million new cases and this estimate is expected to grow by 50% over
the next 15 years (WHO, World Cancer Report. Bernard W. Stewart and
Paul Kleihues, eds. IARC Press, Lyon, 2003). Current cancer
treatments are limited to invasive surgery, radiation therapy and
chemotherapy, all of which cause either potentially severe
side-effects, non-specific toxicity and/or traumatizing changes to
ones body image and/or quality of life. Cancer can become
refractory to chemotherapy reducing further treatment options and
likelihood of success. The prognosis for some cancer is worse than
for others and some, like lung or pancreatic cancer are almost
always fatal. In addition, some cancers with a relatively high
treatment success rate, such as breast cancer, also have a very
high incidence rate and, thus, remain major killers.
[0003] For instance, there are over 1 million new cases of breast
cancer, worldwide, each year. Treatments consist of minimal to
radical surgical removal of breast tissue and lymph nodes with
radiation and chemotherapy for metastatic disease. Prognosis for
localized disease is relatively good with a 5 years survival rate
of around 50% but once the cancer has metastasized, it is incurable
with an average survival of around 2 years. Despite improving
treatment success rates, nearly 400,000 women die of breast cancer
each year, the highest number of deaths to cancer in woman, ahead
of deaths to lung cancer. Among the short and long term survivors,
most will suffer the life-long trauma of the invasive and
disfiguring surgical treatment.
[0004] Another example is liver cancer, with more than half a
million new cases each year and nearly the same number of deaths
due to poor treatment efficacy. Hepatocellular carcinomas represent
around 80% of all liver cancers and are rarely curable. Five-year
survival rate is only about 10% and survival after diagnosis often
less than 6 months. Although surgical resection of diseased tissue
can be effective, it is not an option for the majority of cases
because of the presence of cirrhosis of the liver. Hepatocellular
carcinomas are largely radiation resistant and response to
chemotherapy is poor.
[0005] Yet another example is that of pancreatic cancer with around
200,000 new cases per year and a very poor prognosis. In fact, the
majority of patients die within a year of diagnosis and only a few
percent of patients survive five years. Surgery is the only
available treatment but is associated with high morbidity and
complication rates because it involves not only the resection of at
least part of the pancreas, but also of all of the duodenum, part
of the jejunum, bile duct and gallbladder and a distal gastrectomy.
In some cases, the spleen and lymph nodes are also removed.
[0006] Bladder cancer is the 9th most common cancer worldwide with
an estimated 330,000 new cases and 130,000 deaths each year. In
Europe, this disease is the cause of death for approximately 50,000
people each year. Current treatment includes the intravesicular
delivery of chemotherapy and immunotherapy with the bacille
Calmette-Guerin (BCG) vaccine that involves the additional risk of
systemic infection with the tuberculosis bacterium. Despite this
aggressive treatment regime, 70% of these superficial papillary
tumors will recur over a prolonged clinical course some will
progress into invasive carcinomas. The high rate of recurrence of
this disease and associated repeated course of treatment makes this
form of cancer one of the most expensive to treat over a patient's
lifetime. For patients with recurring disease, the only options are
to undergo multiple anesthetic-requiring cystoscopy surgery or
major, radical, life-altering surgery (usually cystectomy). Radical
cystectomy consists of excision of the bladder, prostate and
seminal vesicle in males and of the ovaries, uterus, urethra and
part of the vagina in females.
[0007] There are many more examples of cancer where current
treatments do not meet the needs of patients either due to their
lack of efficacy and/or because they have high morbidity rates and
severe side-effects. Those selected statistics and facts however,
illustrate well the need for cancer treatments with better safety
and efficacy profiles.
[0008] One of the causes for the inadequacy of current cancer
treatments is their lack of selectivity for affected tissues and
cells. Surgical resection always involves the removal of apparently
normal tissue as a "safety margin" which can increase morbidity and
risk of complications. It also always removes some of the healthy
tissue that may be interspersed with tumor cells and that could
potentially maintain or restore the function of the affected organ
or tissue. Radiation and chemotherapy will kill or damage many
normal cells due to their non-specific mode of action. This can
result in serious side-effects such as severe nausea, weight loss
and reduced stamina, loss of hair etc., as well as increasing the
risk of developing secondary cancer later in life. Treatment with
greater selectivity for cancer cells would leave normal cells
unharmed thus improving outcome, side-effect profile and quality of
life.
[0009] The selectivity of cancer treatment can be improved by using
antibodies that are specific for molecules present only or mostly
on cancer cells. Such antibodies can be used to modulate the immune
system and enhance the recognition and destruction of the cancer by
the patient's own immune system. They can also block or alter the
function of the target molecule and, thus, of the cancer cells.
They can also be used to target drugs, genes, toxins or other
medically relevant molecules to the cancer cells. Such
antibody-drug complexes are usually referred to as immunotoxins or
immunoconjugates and a number of such compounds have been tested in
recent year [Kreitman R J (1999) Immunotoxins in cancer therapy.
Curr Opin Immunol 11:570-578; Kreitman R J (2000) Immunotoxins.
Expert Opin Pharmacother 1:1117-1129; Wahl R L (1994) Experimental
radioimmunotherapy. A brief overview. Cancer 73:989-992; Grossbard
M L, Fidias P (1995) Prospects for immunotoxin therapy of
non-Hodgkin's lymphoma. Clin Immunol Immunopathol 76:107-114;
Jurcic J G, Caron P C, Scheinberg D A (1995) Monoclonal antibody
therapy of leukemia and lymphoma. Adv Pharmacol 33:287-314; Lewis J
P, DeNardo G L, DeNardo S J (1995) Radioimmunotherapy of lymphoma:
a UC Davis experience. Hybridoma 14:115-120; Uckun F M, Reaman G H
(1995) Immunotoxins for treatment of leukemia and lymphoma. Leuk
Lymphoma 18:195-201; Kreitman R J, Wilson W H, Bergeron K, Raggio
M, Stetler-Stevenson M, FitzGerald D J, Pastan I (2001) Efficacy of
the anti-CD22 recombinant immunotoxin BL22 in
chemotherapy-resistant hairy-cell leukemia. N Engl J Med
345:241-247]. Most antibodies tested to date have been raised
against known cancer markers in the form of mouse monoclonal
antibodies, sometimes "humanized" through molecular engineering.
Unfortunately, their targets can also be present in significant
quantities on a subset of normal cells thus raising the risk of
non-specific toxic effects. Furthermore, these antibodies are
basically mouse proteins that are being seen by the human patient's
immune system as foreign proteins. The ensuing immune reaction and
antibody response can result in a loss of efficacy or in
side-effects.
[0010] The inventors have used a different approach in their
development of antibodies for cancer treatment. Instead of
immunizing experimental animals with cancer cells or isolated
cancer cell markers, they have sought out only those markers that
are recognized by the patient's own immune system or, in other
words, that are seen by the immune system as a foreign molecule.
This implies that the markers or antigens are usually substantially
absent on normal cells and, thus, the risk of non-specific toxicity
is further reduced. Hybridoma libraries are generated from cancer
patient-derived lymphocytes and the antibodies they secrete are
tested for binding to normal and tumor cells. Only antibodies
showing high selectivity for cancer cells are retained for further
evaluation and development as a cancer therapeutic or diagnostic
agent. One such highly selective antibody is the subject of this
patent application. In addition to being selective, this antibody
is fully compatible with the patient's immune system by virtue of
being a fully-human protein. The antibody of the invention can be
used for diagnostic or therapeutic uses or as a basis for
engineering other binding molecules for the target antigen.
[0011] The basic structure of an antibody molecule consists of four
protein chains, two heavy chains and two light chains. These chains
are inter-connected by disulfide bonds. Each light chain is
comprised of a light chain variable region and a light chain
constant region. Each heavy chain is comprised of a heavy chain
variable region and a heavy chain constant region. The light chain
and heavy chain variable regions can be further subdivided into
framework regions and regions of hypervariability, termed
complementarity determining regions (CDR). Each light chain and
heavy chain Variable region is composed of three CDRs and four
framework regions.
[0012] CD44 represents a family of cell surface glycoproteins
encoded by a single gene comprising a total of 20 exons. Exons 19
and 20 are expressed together as the cytoplasmic tail and therefore
grouped as "exon 19" by most research groups (Liao et al. J.
Immunol 151:6490-99, 1993). The term exon 19 will be used
henceforth to designate genomic exons 19 and 20. Structural and
functional diversity is achieved by alternative splicing of the
messenger RNA involving 10 "variant" exons identified as exons 6-15
or, most often, as "variant exons" 1-10 (v1-v10). In human, variant
exon 1 contains a stop codon and is not usually expressed. The
longest potential CD44 variant is therefore CD44v2-10 (see Naor et
al. Adv Cancer Res 71:241-319, 1997 for review of CD44).
[0013] Exons 1-5 and all variant exons are part of the
extracellular domain and contain many potential sites for
post-translational modifications. The transmembrane domain is
highly conserved across species but the intracellular tail can be
truncated leading to another type of variant. One such variant
comprises variant exons 8-10 but lacks part of exon 19. Changes to
the intracellular domain has been shown to change the function of
CD44, in part with respect to binding and internalization of
hyaluronic acid (HA). CD44 is not only involved in binding to the
extracellular molecules but it also has cell signaling properties
(see Turley et al. J Biol Chem 277(7):4589-4592, 2002 for
review).
[0014] The "standard" CD44 (CD44s), the most commonly expressed
form of CD44, contains exons 1-5 and 16-19 and none of the variant
exons. The molecular weight for the core protein is 37-38 kDa but
posttranslational modification can result in a molecule of 85-95
kDa or more (Drillenburg et al., Blood 95(6):1900, 2000). It binds
hyaluronic acid (HA), an extracellular glycosaminoglycan,
constitutively and CD44 is often referred to as the HA receptor. It
is interesting that the presence of variant exons can reduce the
binding of HA by CD44 such that CD44 variants cannot be said to
constitutively bind HA but such binding can be inducible (reviewed
in Naor et al. Adv Cancer Res 71:241-319, 1997). See FIG. 17 for
some examples of variants.
[0015] CD44E, also called CD44v8-10, contains variant exons 8-10 in
addition to the exons 1-5 and 16-19. Other variants include
CD44v3-10, CD44v6, CD44v7-8 and many others. The variant exons are
part of the extracellular domain of the CD44.
[0016] CD44E can be present on certain normal epithelial cells,
particularly by generative cells of the basal cell of stratified
squamous epithelium and of glandular epithelium (Mackay et al. J
Cell Biol 124(1-2):71-82, 1994) and in the fetus at certain stages
development. But importantly, it has been shown to be overexpressed
on various types of cancer cells. Using RT-PCR, lida &
Bourguignon (J Cell Physiol 162(1):127-133, 1995) and Kalish et al.
(Frontiers Bioscience 4(a):1-8, 1999) have shown that CD44E is
present in normal breast tissue and is more abundant than CD44s.
They have also shown that CD44, including CD44E and CD44s are
overexpressed, and preferentially located in metastatic breast
cancer tissues. Miyake et al. (J Urol 167(3):1282-87, 2002)
reported that CD44v8-10 mRNA is strongly expressed in urothelial
cancer and can even be detected in urinary exfoliated cells of
patients with invasive vs superficial urothelial cancer. The ratio
of CD44v8-10 to CD44v10 mRNA increases in cancer and was shown to
have diagnostic value in breast, lung, laryngeal and bladder. The
presence of CD44v8-10 was also confirmed by immunohistochemistry
with a polyclonal antibody (Okamoto et al. J Natl Cancer Inst
90(4): 307-15, 1997). CD44v8-10 can also be overexpressed in
gallbladder cancer (Yamaguchi et al. Oncol Rep 7(3):541-4, 2000),
renal cell carcinoma (Hara et al. Urology 54(3):562-6, 1999),
testicular germ cell tumors (Miyake et al. Am J Pathol
152(5):1157-60, 1998), non-small cell lung carcinomas (Sasaki et
al. Int J Oncol 12(3):525-33, 1998), colorectal cancer (Yamaguchi
et al. J Clin Oncol 14(4):1122-27, 1996) and gastric cancer
(Yamaguchi et al. Jpn J Cancer Res 86(12): 1166-71, 1995).
Overexpression of CD44v8-10 was also shown to have diagnostic value
for prostate cancer (Martegani et al. Amer J Pathol 154(1):
291-300, 1999).
[0017] Alpha-fetoprotein (AFP) is a major serum protein synthesized
during fetal life. Its presence in adults is usually indicative of
carcinomas, particularly those of the liver and teratocarcinomas.
It is part of the albuminoid gene family that also comprises serum
and alpha albumins and vitamin D-binding protein. AFP comprises 590
amino acids for a molecular weight of about 69-70 kDa and has one
site for glycosylation. (Morinaga et al., Proc Natl Acad Sci
80:4604-08, 1983; Mizejewski Exp Biol Med 226(5):377-408, 2002).
Molecular variants have been studied and identified in rodents, but
in humans there are no reports of variant proteins being detected.
A recent report has identified a variant mRNA that, if expressed,
would code for a 65 kDa protein. This protein is expected to remain
in the cytoplasm (Fukusawa et al. J Soc Gynecol Investig May 20,
e-publication, 2005).
SUMMARY OF THE INVENTION
[0018] The present inventors have prepared human tumor-specific
antibodies that bind to several types of tumor cells including
bladder, breast, ovary, prostate and uterus. Importantly, the
antibodies do not significantly bind to normal tissue making them
suitable candidates for tumor therapy. The inventors have cloned
and sequenced the antibodies and determined the sequence of the
antibody light and heavy chain variable regions and complementarity
determining regions 1, 2 and 3. Accordingly, the invention provides
isolated light chain complementarity determining regions 1, 2 and
3, comprising the amino acid sequences SGDNLGNKYVC (SEQ ID NO:1),
EDTKRPS (SEQ ID NO:2) and QAWDSRTEI (SEQ ID NO:3), respectively;
and isolated heavy chain complementarity determining regions 1, 2
and 3, comprising the amino acid sequences GDEYYWS (SEQ ID NO:4),
YMSYRGSSYYSPSLQS (SEQ ID NO:5) and KYCGGDCRSGFDI (SEQ ID NO:6),
respectively.
[0019] The invention also provides isolated nucleic acid sequences
encoding light chain complementarity determining regions 1, 2
and/or 3, comprising the amino acid sequences SGDNLGNKYVC (SEQ ID
NO:1), EDTKRPS (SEQ ID NO:2) and QAWDSRTEI (SEQ ID NO:3),
respectively; and isolated nucleic acid sequences encoding heavy
chain complementarity determining regions 1, 2 and/or 3, comprising
the amino acid sequences GDEYYWS (SEQ ID NO:4), YMSYRGSSYYSPSLQS
(SEQ ID NO:5) and KYCGGDCRSGFDI (SEQ ID NO:6), respectively.
[0020] Additional aspects of the invention are isolated light chain
variable regions comprising light chain complementarity determining
regions 1, 2 and/or 3 of the invention (SEQ ID NOS:1-3), and
isolated heavy chain variable regions comprising heavy chain
complementarity determining regions 1, 2 and/or 3 of the invention
(SEQ ID NOS:4-6). In one embodiment, the light chain variable
region comprises the amino acid sequence shown in FIG. 1 (SEQ ID
NO:7). In another embodiment, the heavy chain variable region
comprises the amino acid sequence shown in FIG. 2 (SEQ ID
NO:9).
[0021] The invention also provides an isolated nucleic acid
sequence encoding the light chain variable region of the invention,
and an isolated nucleic acid sequence encoding the heavy chain
variable region of the invention. In one embodiment, the light
chain variable region comprises the nucleic acid sequence shown in
FIG. 1 (SEQ ID NO: 8). In another embodiment, the heavy chain
variable region comprises the nucleic acid sequence shown in FIG. 2
(SEQ ID NO:10).
[0022] Another aspect of the invention is a binding protein,
preferably an antibody or antibody fragment, that comprises at
least one light chain complementarity determining region of the
invention (i.e. one or more of the SEQ ID NOS:1-3) and/or at least
one heavy chain complementarity determining region of the invention
(i.e. one or more of SEQ ID NO:4-6). The invention also provides a
binding protein, preferably an antibody or antibody fragment that
comprises the light chain variable regions of the invention and/or
the heavy chain variable regions of the invention.
[0023] The inventors have also identified the antigen that binds to
the binding proteins of the invention. Accordingly, the invention
provides the binding protein of the invention that binds to a
protein comprising the 5-v8 interface of CD44E, the v8 exon of CD44
or amino acid sequence ATNMDSSHSIT. The invention also provides a
binding protein of the invention that binds to CD44E;
alpha-fetoprotein; a protein having a molecular weight between
47-53 kDa and an isoelectric point between 5.2-5.5, preferably 5.4;
a protein having a molecular weight between 48-54 kDa and an
isoelectric point between 5.1-5.4, preferably 5.2; or a protein
comprising the amino acid sequence 107 to 487 of AFP (SEQ ID
NO:14), 107 to 590 of AFP (SEQ ID NO: 15) or 107 to 609 of AFP (SEQ
ID NO:16).
[0024] In addition, the invention provides compositions comprising
the binding proteins of the invention, such as antibodies and
antibody fragments, with a pharmaceutically acceptable excipient,
carrier, buffer or stabilizer.
[0025] Another aspect of the invention is an immunoconjugate
comprising (1) binding protein of the invention, preferably an
antibody or antibody fragment that binds to an antigen or molecule
on or in a cancer cell, attached to (2) an effector molecule. A
further aspect of the invention is an immunoconjugate comprising
(1) binding protein of the invention, preferably an antibody or
antibody fragment that binds to an antigen or molecule that is
internalized by a cancer cell, attached to (2) an effector
molecule. In a preferred embodiment, the effector molecule is (i) a
label, which can generate a detectable signal, directly or
indirectly, or (ii) a cancer therapeutic agent, which is either
cytotoxic, cytostatic or otherwise prevents or reduces the ability
of the cancer cells to divide and/or metastasize. Preferably, the
cancer therapeutic agent is a toxin.
[0026] The invention also provides compositions comprising the
immunoconjugate of the invention and uses of the immunoconjugate
for the manufacture of a medicament for treating or preventing
cancer, and diagnostic purposes. In addition, the invention
provides methods of treating or preventing cancer using the
immunoconjugate of the invention and related kits.
[0027] A further aspect of the invention is a method of diagnosing
cancer in a mammal comprising the steps of: [0028] (1) contacting a
test sample taken from said mammal with a binding protein of the
invention that binds to an antigen on or in the cancer cell under
conditions that permit the formulation of a binding protein-antigen
complex; [0029] (2) measuring the amount of binding protein-antigen
complex in the test sample; and [0030] (3) comparing the amount of
binding protein-antigen complex in the test sample to a
control.
[0031] The invention also includes a method of diagnosing cancer in
a mammal comprising the steps of: [0032] (1) contacting a test
sample taken from said mammal with a binding protein of the
invention that binds specifically to alpha-fetoprotein or a variant
thereof under conditions that permit the formulation of a binding
protein-alpha-fetoprotein complex; [0033] (2) measuring the amount
of binding protein-alpha-fetoprotein complex in the test sample;
and [0034] (3) comparing the amount of binding
protein-alpha-fetoprotein complex in the test sample to a
control.
[0035] Another aspect of the invention is a diagnostic agent
comprising the immunoconjugate of the invention, wherein the
effector molecule is a label, which can generate a detectable
signal, directly or indirectly.
[0036] The invention also includes an isolated protein that can
specifically bind with one of the binding proteins of the
invention, nucleic acid sequences and uses thereof.
[0037] Other features and advantages of the present invention will
become apparent from the following detailed description. It should
be understood, however, that the detailed description and the
specific examples while indicating preferred embodiments of the
invention are given by way of illustration only, since various
changes and modifications within the spirit and scope of the
invention will become apparent to those skilled in the art from
this detailed description.
BRIEF DESCRIPTION OF THE DRAWINGS
[0038] The invention will now be described in relation to the
drawings in which:
[0039] FIG. 1 is the nucleic acid and amino acid sequence of the
light chain variable region of VB1-008.
[0040] FIG. 2 is the nucleic acid and amino acid sequence of the
heavy chain variable region of VB1-008.
[0041] FIG. 3 is SKBR-3 (400.times. mag) fixed-cell pellet stained
with VB1-008 (A) and the isotype control antibody 4B5 (B). Notice
prominent membrane staining (arrow).
[0042] FIG. 4 are representative photographs of immunohistochemical
staining of normal testis with VB1-008 and the isotype control
antibody 4B5. (A) Sample 925 testes tissue (400.times. mag) stained
with VB1-008. Membrane staining in mature sperm cells is indicated
by an arrow. (B) Sample 925 testes tissue (400.times. mag) stained
with IgG isotype control 4B5. Notice absence of staining. Arrow
points to mature sperm cell for contrast to staining with VB1-008
in (A).
[0043] FIG. 5 shows Sample 3427A1 breast adenocarcinoma
(400.times.) stained with VB1-008 and IgG isotype control 4B5.
Notice staining of cell membrane of tumor cells, especially of
cells in contact with the extracellular matrix (white arrow). Cells
close to the center of the tumor show primarily cytoplasmic
staining (black arrow). Arrow points to unstained tumor cells.
Tumor cells are stained with VB1-008.
[0044] FIG. 6 shows Sample 946 B1 bladder carcinoma (400.times.)
stained with VB1-008 (A) and IgG isotype control 4B5 (B). Arrows
indicate membrane staining of the tumor cells with VB1-008 (A) but
not with the control antibody (B).
[0045] FIG. 7 shows sample 4036A2 uterus carcinoma (200.times. mag)
stained with VB1-008 and the IgG control antibody 4B5. Notice
membrane staining (arrow) with VB1-008 (A & C) but not with the
control antibody (B). Higher magnification of uterus carcinoma
(600.times.) shows membrane staining (C).
[0046] FIG. 8 is a demonstration of antibody cell surface binding
after incubation of A-375 cells at different temperatures as
determined by flow cytometry. Fluorescence labeling of A-375 cells
after incubation of cell suspensions at 4.degree. C.: 4B5 (1) and
VB1-008 (2) Fluorescence labeling of A-375 cells after warming
antibody-bound cells to 37.degree. C.: VB1-008 for 60 min (3), for
120 min (4).
[0047] FIG. 9 shows confocal microscopy assessment of VB1-008
internalization. A-375 cells were incubated with antibody at
4.degree. C., washed and warmed to 37.degree. C. for 60 min. Cells
were fixed, permeabilized and labeled with fluorescent-labeled
second antibody. Fluorescence labeling of A-375 cells after
incubation of VB1-008 at 4.degree. C. for 60 min, displaying
circumferential surface distribution of labeling,
(60.times..times.4) magnification (A). Following incubation of
antibody-bound cells at 37.degree. C. for 60 min the cells show
strong intracellular staining by internalized antibody,
(60.times..times.4) magnification (B).
[0048] FIGS. 10A, B and C show a western analysis of
immunoprecipitation reactions using VB1-008. FIG. 10A shows the
results of the experiment under non-reducing conditions, while
FIGS. 10B and C show the results of the experiment under reducing
conditions.
[0049] FIGS. 11A and B show the presence of two distinct protein
spots in the purified antigen complex, very close in molecular
weight. The proteins were probably not perceived as two bands in
1D-PAGE due to protein stacking. FIG. 11A represents the western
blot profile of the 2D-gel and FIG. 11B represents the Coomassie
stained counterpart.
[0050] FIGS. 12A and B show the mapping of the peptides obtained
and the sequence coverage of the original AFP molecule, Accession #
GI|4501989. FIG. 12A shows the mapping of peptides obtained from
the 2D gel. The amino acids in bolded font represent the sequences
of amino acids identified from MS analysis. The shaded regions
represent the homology of peptide sequences and thereby depict the
sequence coverage. FIG. 12B shows the complete mapping of the
peptides obtained from the 1D and 2D gels. The amino acids in
bolded font represent the sequences of amino acids from MS
analysis. The shaded regions represent the homology of peptide
sequences and thereby detect the sequence coverage. The underlined
amino acids were not detected.
[0051] FIG. 13 shows immunopurification of the VB1-008 antigen
using 1000 .mu.g of MDA-MB-435S membranes as the source. The
purified antigen(s) was resolved on SDS-PAGE under non-reducing
sample conditions. Reducing agents such as DTT or
.beta.-mercaptoethanol were avoided so as to preserve the native
conformation of the binding antigen(s). The sample was resolved on
two lanes of the gel. One lane (A), was stained for protein; the
other (B) was subjected to western blotting and probed with
VB1-008, to ensure the presence of the specific antigen. Band "E"
from the coomassie stained portion of the gel was excised and sent
for MS analysis.
[0052] FIG. 14 shows the complete mapping of the peptides obtained
and the sequence coverage of CD44 molecule, Accession # GI|105583.
The amino acids in red font represent the sequences of amino acids
identified from MS analysis. The shaded regions represent the
homology of peptide sequences and thereby depict the sequence
coverage. The amino acids in underlined area constitute the
variable region (v8-v10) characteristic of the isoform3 or
CD44E.
[0053] FIG. 15A shows the reactivity of VB1-008 to recombinant AFP
molecule, commercially available from RDI systems. The recombinant
AFP was electrophoresed, transferred on to nitrocellulose membrane
and probed with VB1-008. The results are clearly indicative of the
reactivity of VB1-008 to AFP.
[0054] FIGS. 15B and C are 2D-gel profiles of "B" and "C", which
were immunoprecipitates obtained using VB1-008. The gels were
transferred to nitrocellulose and probed with anti-CD44 and
anti-AFP, both mouse-monoclonal antibodies respectively.
[0055] FIG. 16 is a western analysis under non-reducing conditions.
Anti-CD44 was used to immunopurify CD44 proteins from MDA-MB-435S
cells and the purified fraction was subjected to SDS-PAGE and WB
analysis under non-reducing conditions. The experiment was
performed in three sets and each set was identical to the other.
Each of the sets was probed with 5 .mu.g/mL of anti-CD44, anti-AFP
and VB1-008. Anti-CD44 and anti-AFP were mouse monoclonal
antibodies, whereas, VB1-008 is VBI's human monoclonal
antibody.
[0056] FIG. 17 is a schematic representation of the distribution of
different exons in the CD44 gene in humans. Alternative splicing in
the variable region results in the creation of a number of
isoforms, a few of the reported isoforms are represented
schematically in the corresponding figure.
[0057] FIG. 18A depicts the amino acid sequence of CD44E. The
highlighted portion represents the stretch of 17 amino acids used
to generate peptides 1-3. The negative control peptide is
highlighted in the C-terminal region of the protein. FIG. 18B shows
the results of a binding experiment with VB1-008 to peptides
1-3.
[0058] FIG. 19A shows the results of a competition study using
peptides 1-3 against binding of VB1-008. FIG. 19B shows the results
of a competition study using peptides 1-3 against a control
antibody (anti-EGFR).
[0059] FIG. 20 shows the nucleotide sequence of the immunoconjugate
VB6-008 (SEQ ID NO:11). The sequence of the PelB leader sequence is
in lower case with the initiation codon bolded. The stop codes are
in uppercase and bolded.
[0060] FIG. 21 shows the amino acid sequences of the heavy chain
and light chain of the immunoconjugate VB6-0008 (SEQ ID NO:12 and
13).
[0061] FIG. 22 shows the complete VB6-008 construct.
[0062] FIG. 23 shows the VB6-008 unit #1, which includes the
PelB-VH-CH-Furin-De-Bouganin.
[0063] FIG. 24 shows the VB6-008 #2 unit which consists of
PelB-VL-CL.
[0064] FIG. 25 shows the results of an in vitro cytotoxicity
experiment using VB6-008.
[0065] FIG. 26 is a depiction of the gamma cassette.
[0066] FIG. 27 is a depiction of the assembly of the Fab-bouganin
immunotoxin.
DETAILED DESCRIPTION OF THE INVENTION
(A) Definitions
[0067] The term "administered systemically" as used herein means
that the immunoconjugate and/or other cancer therapeutic may be
administered systemically in a convenient manner such as by
injection (subcutaneous, intravenous, intramuscular, etc.), oral
administration, inhalation, transdermal administration or topical
application (such as topical cream or ointment, etc.), suppository
applications, or means of an implant. An implant can be of a
porous, non-porous, or gelatinous material, including membranes,
such as sialastic membranes, or fibers. Suppositories generally
contain active ingredients in the range of 0.5% to 10% by
weight.
[0068] The term "antibody" as used herein is intended to include
monoclonal antibodies, polyclonal antibodies, and chimeric
antibodies. The antibody may be from recombinant sources and/or
produced in transgenic animals. The term "antibody fragment" as
used herein is intended to include Fab, Fab', F(ab').sub.2, scFv,
dsFv, ds-scFv, dimers, minibodies, diabodies, and multimers thereof
and bispecific antibody fragments. Antibodies can be fragmented
using conventional techniques. For example, F(ab').sub.2 fragments
can be generated by treating the antibody with pepsin. The
resulting F(ab').sub.2 fragment can be treated to reduce disulfide
bridges to produce Fab' fragments. Papain digestion can lead to the
formation of Fab fragments. Fab, Fab' and F(ab').sub.2, scFv, dsFv,
ds-scFv, dimers, minibodies, diabodies, bispecific antibody
fragments and other fragments can also be synthesized by
recombinant techniques.
[0069] The term "antibody or antibody fragment of the invention" as
used herein comprises at least one light chain complementarity
determining region of the invention (i.e. one or more of SEQ ID
NOS:1-3) and/or at least one heavy chain complementarity
determining region of the invention (i.e. one or more of SEQ ID
NOS:4-6). Preferably, the antibody or antibody fragment comprises
the light chain CDR sequences (SEQ ID NOS:1-3) and/or the heavy
chain CDR sequences (SEQ ID NOS:4-6) or functional variants of the
sequences so that the antibody or antibody fragment can bind to the
tumor cell without substantially binding to normal cells.
Antibodies or antibody fragments of the invention also include
antibodies or antibody fragments that bind to CD44E;
alpha-fetoprotein; a protein having a molecular weight between
47-53 kDa and an isoelectric point between 5.2-5.5, preferably 5.4;
a protein having a molecular weight between 48-54 kDa and an
isoelectric point between 5.1-5.4, preferably 5.2; or a protein
comprising the amino acid sequence 107 to 487 of AFP (SEQ ID
NO:14), 107 to 590 of AFP (SEQ ID NO: 15) or 107 to 609 of AFP (SEQ
ID NO:16). In addition, antibodies or antibody fragments of the
invention include antibodies or antibody fragments that bind to a
protein comprising the 5-v8 interface of CD44E, the v8 exon of CD44
or amino acid sequence ATNMDSSHSIT.
[0070] By "at least moderately stringent hybridization conditions"
it is meant that conditions are selected which promote selective
hybridization between two complementary nucleic acid molecules in
solution. Hybridization may occur to all or a portion of a nucleic
acid sequence molecule. The hybridizing portion is typically at
least 15 (e.g. 20, 25, 30, 40 or 50) nucleotides in length. Those
skilled in the art will recognize that the stability of a nucleic
acid duplex, or hybrids, is determined by the Tm, which in sodium
containing buffers is a function of the sodium ion concentration
and temperature (Tm=81.5.degree. C.-16.6 (Log 10
[Na+])+0.41(%(G+C)-600/l), or similar equation). Accordingly, the
parameters in the wash conditions that determine hybrid stability
are sodium ion concentration and temperature. In order to identify
molecules that are similar, but not identical, to a known nucleic
acid molecule a 1% mismatch may be assumed to result in about a
1.degree. C. decrease in Tm, for example if nucleic acid molecules
are sought that have a >95% identity, the final wash temperature
will be reduced by about 5.degree. C. Based on these considerations
those skilled in the art will be able to readily select appropriate
hybridization conditions. In preferred embodiments, stringent
hybridization conditions are selected. By way of example the
following conditions may be employed to achieve stringent
hybridization: hybridization at 5.times. sodium chloride/sodium
citrate (SSC)/5.times.Denhardt's solution/1.0% SDS at Tm-5.degree.
C. based on the above equation, followed by a wash of
0.2.times.SSC/0.1% SDS at 60.degree. C. Moderately stringent
hybridization conditions include a washing step in 3.times.SSC at
42.degree. C. It is understood, however, that equivalent
stringencies may be achieved using alternative buffers, salts and
temperatures. Additional guidance regarding hybridization
conditions may be found in: Current Protocols in Molecular Biology,
John Wiley & Sons, N.Y., 1989, 6.3.1-6.3.6 and in: Sambrook et
al., Molecular Cloning, a Laboratory Manual, Cold Spring Harbor
Laboratory Press, 1989, Vol. 3.
[0071] The term "binding protein" as used herein refers to proteins
that specifically bind to another substance. In an embodiment,
binding proteins are antibodies or antibody fragments.
[0072] The term "binding proteins of the invention" as used herein
includes antibodies or antibody fragments of the invention.
[0073] By "biologically compatible form suitable for administration
in vivo" is meant a form of the substance to be administered in
which any toxic effects are outweighed by the therapeutic
effects.
[0074] The term "cancer" as used herein includes any cancer that
can be bound by a binding protein of the invention, preferably an
antibody or antibody fragment of the invention.
[0075] The term "CD44" as used herein refers to the family of CD44
molecules encoded by a single gene comprising a total of 19 exons.
There are 10 variable exons. Alternative splicing in the variable
regions results in the creation of a number of different CD44
variants (See FIG. 17). The term "CD44E", also known as CD44v8-10,
refers to the epithelial variant of CD44. CD44E contains variant
exons 8-10 in addition to exons 1-5 and 16-19. The term "v8 exon of
CD44" refers to variable exon 8 of CD44. The term "5-v8 interface
of CD44E" refers to the region where exon 5 connects with variable
exon 8 in CD44E. It is a continuous sequence that includes part of
the region of exon 5 and part of the variable exon 8 of CD44E.
[0076] A "conservative amino acid substitution", as used herein, is
one in which one amino acid residue is replaced with another amino
acid residue without abolishing the protein's desired
properties.
[0077] The term "controlled release system" as used means the
immunoconjugate and/or other cancer therapeutic of the invention
can be administered in a controlled fashion. For example, a
micropump may deliver controlled doses directly into the area of
the tumor, thereby finely regulating the timing and concentration
of the pharmaceutical composition (see, e.g., Goodson, 1984, in
Medical Applications of Controlled Release, vol. 2, pp.
115-138).
[0078] The term "direct administration" as used herein means the
imrriunoconjugate and/or other cancer therapeutic may be
administered, without limitation, intratumorally, intravascularly,
and peritumorally. For example, the immunoconjugate may be
administered by one or more direct injections into the tumor, by
continuous or discontinuous perfusion into the tumor, by
introduction of a reservoir of the immunoconjugate, by introduction
of a slow-release apparatus into the tumor, by introduction of a
slow-release formulation into the tumor, and/or by direct
application onto the tumor. By the mode of administration "into the
tumor," introduction of the immunoconjugate and/or other cancer
therapeutic to the area of the tumor, or into a blood vessel or
lymphatic vessel that substantially directly flows into the area of
the tumor, is included.
[0079] As used herein, the phrase "effective amount" means an
amount effective, at dosages and for periods of time necessary to
achieve the desired result. Effective amounts of an immunoconjugate
may vary according to factors such as the disease state, age, sex,
weight of the animal. Dosage regime may be adjusted to provide the
optimum therapeutic response. For example, several divided doses
may be administered daily or the dose may be proportionally reduced
as indicated by the exigencies of the therapeutic situation.
[0080] The term "heavy chain complementarity determining region" as
used herein refers to regions of hypervariability within the heavy
chain variable region of an antibody molecule. The heavy chain
variable region has three complementarity determining regions
termed heavy chain complementarity determining region 1, heavy
chain complementarity determining region 2 and heavy chain
complementarity determining region 3 from the amino terminus to
carboxy terminus.
[0081] The term "heavy chain variable region" as used herein refers
to the variable region of a heavy chain.
[0082] The term "immunoconjugate of the invention" is used herein
comprises (1) a binding protein, preferably an antibody or antibody
fragment, of the invention attached to (2) an effector molecule.
The effector molecule can be any molecule that one wishes to
deliver to the cancer cell, including, but not limited to (i) a
label, which can generate a detectable signal, directly or
indirectly, or (ii) a cancer therapeutic agent, such as a toxin
that is either cytotoxic, cytostatic or otherwise prevents or
reduces the ability of the cancer cells to divide and/or
metastasize.
[0083] The term "isolated nucleic acid sequences" as used herein
refers to a nucleic acid substantially free of cellular material or
culture medium when produced by recombinant DNA techniques, or
chemical precursors, or other chemicals when chemically
synthesized. An isolated nucleic acid is also substantially free of
sequences which naturally flank the nucleic acid (i.e. sequences
located at the 5' and 3' ends of the nucleic acid) from which the
nucleic acid is derived. The term "nucleic acid" is intended to
include DNA and RNA and can be either double stranded or single
stranded.
[0084] The term "isolated proteins", such as light chain
complementarity regions 1, 2 and 3, heavy chain complementarity
regions 1, 2 and 3, light chain variable regions, heavy chain
variable regions, and binding proteins of the invention, refers to
a protein substantially free of cellular material or culture medium
when produced by recombinant DNA techniques, or chemical precursors
or other chemicals when chemically synthesized.
[0085] The term "light chain complementarity determining region" as
used herein refers to regions of hypervariability within the light
chain variable region of an antibody molecule. Light chain variable
regions have three complementarity determining regions termed light
chain complementarity determining region 1, light chain
complementarity determining region 2 and light chain
complementarity determining region 3 from the amino terminus to the
carboxy terminus.
[0086] The term "light chain variable region" as used herein refers
to the variable region of a light chain.
[0087] The term "modified bouganin" as used here means a modified
bouganin that has a reduced propensity to activate an immune
response as described in PCT/CA2005/000410 and U.S. patent
application Ser. No. 11.084,080. In one example, the modified
bouganin has the amino acid sequence (SEQ 1D NO: 17):
TABLE-US-00001 YNTVSFNLGEAYEYPTFIQDLRNELAKGTPVCQLPVTLQTIADDKRFV
LVDITTTSKKTVKVAIDVTDVYVVGYQDKVVDGKDRAVFLDKVPTVAT
SKLFPGVTNRVTLTFDGSYQKLVNAAKADRKALELGVNKLEFSIEAIH
GKTINGQEAAKFFLIVIQMVSEAARFKYIETEWDRGLYGSFKPNFKVL
NLENNWGDISDAIHKSSPQCTTINPALQLISPSNDPWVVNKVSQISPD MGILKFKSSK.
[0088] The term "nucleic acid sequence" as used herein refers to a
sequence of nucleoside or nucleotide monomers consisting of
naturally occurring bases, sugars and intersugar (backbone)
linkages. The term also includes modified or substituted sequences
comprising non-naturally occurring monomers or portions thereof.
The nucleic acid sequences of the present invention may be
deoxyribonucleic acid sequences (DNA) or ribonucleic acid sequences
(RNA) and may include naturally occurring bases including adenine,
guanine, cytosine, thymidine and uracil. The sequences may also
contain modified bases. Examples of such modified bases include aza
and deaza adenine, guanine, cytosine, thymidine and uracil; and
xanthine and hypoxanthine.
[0089] The term "sequence identity" as used herein refers to the
percentage of sequence identity between two polypeptide sequences.
In order to determine the percentage of identity between two
polypeptide sequences, the amino acid sequences of such two
sequences are aligned, preferably using the Clustal W algorithm
(Thompson, J D, Higgins D G, Gibson T J, 1994, Nucleic Acids Res.
22 (22): 4673-4680), together with BLOSUM 62 scoring matrix
(Henikoff S. and Henikoff J. G., 1992, Proc. Natl. Acad. Sci. USA
89: 10915-10919) and a gap opening penalty of 10 and gap extension
penalty of 0.1, so that the highest order match is obtained between
two sequences wherein at least 50% of the total length of one of
the sequences is involved in the alignment. Other methods that may
be used to align sequences are the alignment method of Needleman
and Wunsch (J. Mol. Biol., 1970, 48: 443), as revised by Smith and
Waterman (Adv. Appl. Math., 1981, 2: 482) so that the highest order
match is obtained between the two sequences and the number of
identical amino acids is determined between the two sequences.
Other methods to calculate the percentage identity between two
amino acid sequences are generally art recognized and include, for
example, those described by Carillo and Lipton (SIAM J. Applied
Math., 1988, 48:1073) and those described in Computational
Molecular Biology, Lesk, e.d. Oxford University Press, New York,
1988, Biocomputing: Informatics and Genomics Projects. Generally,
computer programs will be employed for such calculations. Computer
programs that may be used in this regard include, but are not
limited to, GCG (Devereux et al., Nucleic Acids Res., 1984, 12:
387) BLASTP, BLASTN and FASTA (Altschul et al., J. Molec. Biol.,
1990: 215: 403).
[0090] As used herein, the phrase "treating cancer" refers to
inhibition of cancer cell replication, inhibition of cancer spread
(metastasis), inhibition of tumor growth, reduction of cancer cell
number or tumor growth, decrease in the malignant grade of a cancer
(e.g., increased differentiation), or improved cancer-related
symptoms.
[0091] The term "variant" as used herein includes modifications or
chemical equivalents of the amino acid and nucleotide sequences of
the present invention that perform substantially the same function
as the proteins or nucleic acid molecules of the invention in
substantially the same way. For example, variants of proteins of
the invention include, without limitation, conservative amino acid
substitutions. Variants of proteins of the invention also include
additions and deletions to the proteins of the invention.
[0092] The term "variant of alpha-fetoprotein" includes variants of
alpha-fetoprotein, such as a protein comprising the amino acid
sequence of SEQ ID NO:14, 15 or 16; or a protein that is a
truncated version of alpha-fetoprotein and has the molecular weight
of 48-54 kDa and an isoelectric point between 5.1-5.4.
(B) Proteins and Nucleic Acids of the Invention
(i) Light and Heavy Chain Complementarity Determining Regions and
Light and Heavy Chain Variable Regions
[0093] The invention provides isolated light chain complementarity
determining region 1 comprising the amino acid sequence SGDNLGNKYVC
(SEQ ID NO:1). The invention also provides isolated light chain
complementarity determining region 2 comprising the amino acid
sequence EDTKRPS (SEQ ID NO:2). In addition, the invention provides
isolated light chain complementarity determining region 3
comprising the amino acid sequence QAWDSRTEI (SEQ ID NO:3).
[0094] The invention provides isolated light chain complementarity
determining region 1 comprising the amino acid sequence GDEYYWS
(SEQ ID NO:4). The invention also provides isolated light chain
complementarity determining region 2 comprising the amino acid
sequence YMSYRGSSYYSPSLQS (SEQ ID NO:5). In addition, the invention
provides isolated light chain complementarity determining region 3
comprising the amino acid sequence KYCGGDCRSGFDI (SEQ ID NO:6).
[0095] The invention provides isolated light chain complementarity
determining regions 1, 2 and 3, comprising the amino acid sequences
SGDNLGNKYVC (SEQ ID NO:1), EDTKRPS (SEQ ID NO:2) and QAWDSRTEI (SEQ
ID NO:3), respectively; and isolated heavy chain complementarity
determining regions 1, 2 and 3, comprising the amino acid sequences
GDEYYWS (SEQ ID NO:4), YMSYRGSSYYSPSLQS (SEQ ID NO:5) and
KYCGGDCRSGFDI (SEQ ID NO:6), respectively.
[0096] The invention also includes variants of the CDR sequences
that can bind to the same epitope or antigen recognized by the CDR
sequences disclosed above.
[0097] Additional aspects of the invention are isolated light chain
variable regions comprising light chain complementarity determining
regions 1, 2 and/or 3 of the invention (SEQ ID NOS:1-3); and heavy
chain variable regions comprising the heavy chain complementarity
determining regions 1, 2 and/or 3 of the invention (SEQ ID
NOS:4-6). In one embodiment, the light chain variable region
comprises the amino acid sequence shown in FIG. 1 (SEQ ID NO:7),
and the heavy chain variable region comprises the amino acid
sequence shown in FIG. 2 (SEQ ID NO:9).
[0098] The invention also includes variants of the isolated light
chain variable regions and heavy chain variable regions that can
bind to the same epitope or antigen recognized by the isolated
light chain variable regions and isolated heavy chain variable
regions disclosed above.
[0099] A person skilled in the art will appreciate that the
invention includes variants to the amino acid sequences of SEQ ID
NOS:1-6, 7 and 9, including chemical equivalents to the sequences
disclosed by the present invention. Such equivalents include
proteins that perform substantially the same function as the
specific proteins disclosed herein in substantially the same way. A
functional variant of a CDR sequence will be able to bind to the
antigen or epitope recognized by the native CDR sequence. For
example, equivalents include, without limitation, conservative
amino acid substitutions.
[0100] In one embodiment, the variant amino acid sequences of the
light chain complementarity determining regions 1, 2 and 3, and the
heavy chain complementarity determining regions 1, 2 and 3 have at
least 50%, preferably at least 60%, more preferably at least 70%,
most preferably at least 80%, and even more preferably at least 90%
sequence identity to SEQ ID NOS:1-6, respectively.
[0101] In another embodiment, the variant amino acid sequences of
the light chain variable region and the heavy chain variable region
have at least 50%, preferably at least 60%, more preferably at
least 70%, most preferably at least 80%, and even more preferably
at least 90% sequence identity to SEQ ID NOS:7 and 9,
respectively.
[0102] The invention also provides an isolated nucleic acid
sequence encoding the light chain variable region of the invention,
and an isolated nucleic acid sequence encoding the heavy chain
variable region of the invention. In one embodiment, the light
chain variable region comprises the nucleic acid sequence shown in
FIG. 1 (SEQ ID NO: 8). In another embodiment, the heavy chain
variable region comprises the nucleic acid sequence shown in FIG. 2
(SEQ ID NO:10). The invention also includes variants to the nucleic
acid sequences that encode for the light chain variable region and
heavy chain variable region of the invention. For example, the
variants include nucleotide sequences that hybridize to the nucleic
acid sequences encoding the light chain variable region and heavy
chain variable region of the invention under at least moderately
stringent hybridization conditions.
[0103] The invention also provides isolated nucleic acid sequences
encoding light chain complementarity determining regions 1, 2
and/or 3, comprising the amino acid sequences SGDNLGNKYVC (SEQ ID
NO:1), EDTKRPS (SEQ ID NO:2) and QAWDSRTEI (SEQ ID NO:3),
respectively; and isolated nucleic acid sequences encoding heavy
chain complementarity determining regions 1, 2 and/or 3, comprising
the amino acid sequences GDEYYWS (SEQ ID NO:4), YMSYRGSSYYSPSLQS
(SEQ ID NO:5) and KYCGGDCRSGFDI (SEQ ID NO:6), respectively. The
invention also includes isolated nucleic acid sequences encoding
variants of the CDR sequences discussed above. Nucleic acid
sequences encoding variants of the CDR sequences of the invention
include nucleic acid sequences that hybridize to the CDR sequences
encoding the amino acid sequences shown in SEQ ID NOS:1-6 under at
least moderately stringent hybridization conditions.
(ii) Binding Proteins
[0104] Another aspect of the invention is a binding protein,
preferably an antibody or antibody fragment, that comprises at
least one light chain complementarity determining region of the
invention (i.e. one or more of SEQ ID NOS:1-3) and/or at least one
heavy chain complementarity determining region of the invention
(i.e. one or more of SEQ ID NOS:4-6). Such a binding protein can be
generally referred to herein as "a binding protein of the
invention", or preferably "an antibody or antibody fragment of the
invention".
[0105] In one embodiment, the binding protein, preferably an
antibody or antibody fragment, comprises the light chain
complementarity determining regions 1, 2 and 3, comprising the
amino acid sequences SGDNLGNKYVC (SEQ ID NO:1), EDTKRPS (SEQ ID
NO:2) and QAWDSRTEI (SQ ID NO:3), respectively; and heavy chain
complementarity determining regions 1, 2 and 3, comprising the
amino acid sequences GDEYYWS (SEQ ID NO:4), YMSYRGSSYYSPSLQS (SEQ
ID NO:5) and KYCGGDCRSGFDI (SEQ ID NO:6), respectively. The
invention also provides a binding protein, preferably an antibody
or antibody fragment, that comprises the light chain variable
region of the invention and/or the heavy chain variable region of
the invention.
[0106] A person skilled in the art will appreciate that the
invention includes variants to the specific binding proteins
disclosed above, including chemical equivalents to the sequences
disclosed above that perform substantially the same function as the
binding proteins disclosed above in substantially the same way. A
functional variant of a binding protein will be able to bind to a
protein comprising 5-v8 interface of CD44E, the v8 exon of CD44,
the amino acid sequence ATNMDSSHSIT, amino acid SEQ ID NOS:14, 15
or 16, or to a protein having a molecular weight between 47-53 kDa
and an isoelectric point between 5.2-5.5; a protein having a
molecular weight between 48-54 kDa and an isoelectric point between
5.1-5.4, CD44E, or alpha-fetoprotein or a variant thereof.
[0107] As stated above, the inventors have identified the antigen
that binds to the binding protein of the invention. In particular,
the inventors have shown that the binding proteins of the invention
bind to the extracellular domain of CD44E. In addition, the
inventors have shown that the binding proteins of the invention
bind to AFP or a variant thereof.
[0108] It is important to recognize that CD44 molecules have a high
potential for N- and O-glycosylation and for the addition of
chondroitin sulfate and heparan sulfate. However, the pattern of
these post-translational modifications is variable, and appears to
be cell-specific and can potentially affect the ability of CD44 to
bind HA or other extracellular molecules. The variable pattern of
post-translational modifications is particularly relevant to the
preparation of anti-CD44 monoclonal antibodies since antibody
binding has been shown to be affected by the presence of these
modifications, despite the primary structure of the molecule being
the same as that of the antigen used to raise the antibody (Matzuki
et al. Cancer Res 63:8278-83, 2003; Martegani et al. Amer J Pathol
154(1): 291-300, 1999). This also limits the usefulness of
recombinant CD44 as an immunogen since its glycosylation pattern
would likely differ from that of tumor cells. The binding proteins
of the invention is, therefore, particularly unique since it
recognizes a form of the CD44 that is present on human tumor
cells.
[0109] Accordingly, the invention provides a binding protein of the
invention that binds to a protein comprising the 5-v8 interface of
CD44E, the v8 exon of CD44 or amino acid sequence ATNMDSSHSIT. The
invention also provides a binding protein of the invention that
binds to CD44E; alpha-fetoprotein; a protein having a molecular
weight between 47-53 kDa and an isoelectric point between 5.2-5.5,
preferably 5.4; a protein having a molecular weight between 48-54
kDa and an isoelectric point between 5.1-5.4, preferably 5.2; or a
protein comprising the amino acid sequence 107 to 487 of AFP (SEQ
ID NO:14), 107 to 590 of AFP (SEQ ID NO: 15) or 107 to 609 of AFP
(SEQ ID NO:16). The invention also provides a binding protein of
the invention that binds to a protein comprising SEQ ID NOS: 38,
39, 40, 41, 42, 43, 44 or 45 and having a molecular weight between
47-53 kDa and an isoelectric point between 5.2-5.5; or a protein
comprising SEQ ID NOS: 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73,
74 or 75 and having a molecular weight between 48-54 kDa and an
isoelectric point between 5.1-5.4.
[0110] The invention also includes binding proteins that bind to
the amino acid sequence ATNMDSSHSIT.
[0111] In certain embodiments, the antibody or antibody fragment
comprises all or a portion of a heavy chain constant region, such
as an IgG1, IgG2, IgG3, IgG4, IgA1, IgA2, IgE, IgM or IgD constant
region. Preferably, the heavy chain constant region is an IgG1
heavy chain constant region. Furthermore, the antibody or antibody
fragment can comprise all or a portion of a kappa light chain
constant region or a lambda light chain constant region.
Preferably, the light chain constant region is a lambda light chain
constant region.
[0112] To produce monoclonal antibodies derived from humans,
antibody producing cells (lymphocytes) can be harvested from a
human having cancer and fused with myeloma cells by standard
somatic cell fusion procedures thus immortalizing these cells and
yielding hybridoma cells. Such techniques are well known in the
art, (e.g. the hybridoma technique originally developed by Kohler
and Milstein (Nature 256:495-497 (1975)) as well as other
techniques such as the human B-cell hybridoma technique (Kozbor et
al., Immunol. Today 4:72 (1983)), the EBV-hybridoma technique to
produce human monoclonal antibodies (Cole et al., Methods Enzymol,
121:140-67 (1986)), and screening of combinatorial antibody
libraries (Huse et al., Science 246:1275 (1989)). Another example
of making human monoclonal antibodies is described in WO/9947929.
In another example, a myeloma-like fusion partner, as described in
Dan et al. (J Neurosurgery 76:660-69, 1992) can be used. Hybridoma
cells can be screened immunochemically for production of antibodies
specifically reactive with cancer cells and the monoclonal
antibodies can be isolated.
[0113] Specific antibodies, or antibody fragments, reactive against
particular antigens or molecules, such as antigens or molecules on
a cancer cell, may also be generated by screening expression
libraries encoding immunoglobulin genes, or portions thereof,
expressed in bacteria with cell surface components. For example,
complete Fab fragments, VH regions and FV regions can be expressed
in bacteria using phage expression libraries (See for example Ward
et al., Nature 341:544-546 (1989); Huse et al., Science
246:1275-1281 (1989); and McCafferty et al., Nature 348:552-554
(1990)).
[0114] The present invention includes all antibodies and antibody
fragments that bind to the same antigen as the antibodies or
antibody fragments of the invention. A person skilled in the art
will appreciate that binding assays can be used to find other
antibodies and antibody fragments with the same binding
specificities as the antibodies and antibody fragments of the
invention. As exemplified, below, a competition binding assay can
be used to find such other antibodies.
[0115] Before a competition assay is performed using flow
cytometry, the minimal concentration of antibody of the invention
(Ab1) that gives maximal binding against a fixed number of tumor
cells (for example, A-375 cells for VB1-008) is determined. A total
of 10.sup.6 cells are harvested from exponentially growing cultures
and incubated with various antibody concentrations for 1 hr at
4.degree. C. The cells are washed and incubated with a suitable
detection antibody for an additional hour at 4.degree. C. After
washing, the cells are analyzed by flow cytometry. For each test
antibody, a saturation curve is generated from the data by plotting
median fluorescence against the antibody concentration.
[0116] For the competition assay, tumor cells are prepared as above
and treated in duplicate with a fixed concentration of antibody
(Ab1). The fixed concentration is the minimal concentration of
antibody that generates maximal binding against a fixed number of
tumor cells as determined above. Immediately following the addition
of the Ab1, varying concentrations of the potential inhibitory
antibody (Ab2) is added to each tube and the mixture incubated for
1 hr at 4.degree. C. Both the percent inhibition and change over
maximum median fluorescence are calculated by subtracting the
background fluorescence (PBS-5% FCS) from the median fluorescence
reading for each test sample (Ab1+Ab2). The result is then divided
by the median fluorescence of Ab1 alone (maximal binding) minus the
background (see below). The percent of inhibition result is
obtained by multiplying by 100. The mean of the replicates along
with their respective standard error is plotted against antibody
concentration. The following formula is used to calculate the
percent inhibition:
PI=[(MF(.sub.Ab1+Ab2)-MF.sub.Bgd)/(MF.sub.Ab1-MF.sub.Bgd)].times.100
[0117] where PI=percent inhibition; MF(.sub.Ab1+Ab2)=median
fluorescence measured for Ab1+Ab2 mixture; and
MF.sub.Bgd=background median fluorescence with PBS-5% FCS.
[0118] Accordingly, the invention provides a binding protein
capable of binding an antigen on a tumor cell wherein the binding
protein can be identified by a method comprising: [0119] (1)
incubating a fixed number of tumor cells with a minimal
concentration of a binding protein of the invention, preferably an
antibody or antibody fragment (Ab1) that generates maximal binding
against the fixed number of tumor cells and measuring median
fluorescence of Ab1 (MF.sub.Ab1); [0120] (2) testing two or more
concentrations of a test binding protein (Ab2) by adding Ab2 to the
Ab1 and tumor cells, and measuring median fluorescence
(MF(.sub.Ab1+Ab2)); [0121] (3) measuring background median
fluorescence (MF.sub.bgd); [0122] (4) calculating PI, wherein
[0123]
PI=[(MF(.sub.Ab1+Ab2)-MF.sub.Bgd)/(MF.sub.Ab1-MF.sub.Bgd)].times.100;
and [0124] (5) comparing the PI to a control PI value;
[0125] wherein, a PI that has a statistically significant
difference from the control PI indicates that the test binding
protein is capable of binding the antigen on the tumor cell.
[0126] The competition binding assay can also be done with
peptides, preferably the peptide defined by SEQ ID NO:28. Similar
to the method described above, before the competition assay is
performed, the minimal concentration of test binding protein (Ab2)
that gives maximal binding against a fixed number of tumor cells is
determined.
[0127] Accordingly, an embodiment of the invention provides a
binding protein capable of binding an antigen on a tumor cell
wherein the binding protein can be identified by a method
comprising: [0128] (1) incubating a fixed number of tumor cells
with a minimal concentration of a test binding protein (Ab2) that
generates maximal binding against the fixed number of tumor cells
and measuring median fluorescence of Ab2 (MF.sub.Ab2); [0129] (2)
preparing a peptide and Ab2 mixture by incubating a molar excess of
a peptide defined by SEQ ID NO:28 with said minimal concentration
of the test binding protein (Ab2); [0130] (3) adding said mixture
to tumor cells and measuring median fluorescence
(MF.sub.(Ab2+peptide)); [0131] (4) measuring background median
fluorescence (MF.sub.bgd); [0132] (5) calculating PI, wherein
[0133]
PI=[(MF(.sub.Ab2+peptide)-MF.sub.Bgd)/(MF.sub.Ab2-MF.sub.Bgd)].times.100;
and [0134] (6) comparing the PI to a control PI value; [0135]
wherein, a PI that has a statistically significant difference from
the control PI indicates that the test binding protein is capable
of binding the antigen on the tumor cell.
[0136] A person skilled in the art will appreciate that affinity
maturation techniques could be used modify the binding proteins or
immunoconjugates of the invention either by increasing its affinity
for both CD44E and AFP or by selecting out the binding to one
antigen. The latter can lead to the development of 2 separate
antibodies or immunoconjugates with preferential binding to either
AFP or to CD44E.
[0137] Two strategies are routinely used to enhance the binding
affinity of an antibody. One approach utilizes the resolution of
the crystal structure of the Ab-Ag complex to identify the key
residues involved in the antigen binding (Davies D. R., Cohen G. H.
1996. Interactions of protein antigens with antibodies. Proc Natl.
Acad. Sci. U. S A. 93, 7-12). Subsequently, those residues can be
mutated to enhance the interaction. The other approach mimics an in
vivo antigen stimulation that drives the affinity maturation of
immunoglobulin produced by B cells. During the maturation of the
immune response, the variable regions of the immunoglobulins are
subjected to somatic mutations (Mc Heyzer-Williams M. 2003. B-cell
signaling mechanism and activation. Fundamental Immunology, Fifth
edition, 195-225). This process, highly specific for the immune
system, is characterized by the introduction of point mutations at
a very high rate. It occurs only within the DNA fragments encoding
the variable regions and excludes the conserved domains. The B
cells expressing the somatically mutated variant antibody are then
subjected to an antigen-mediated selection resulting in the
selection of higher affinity immunoglobulin. In order to replicate
this phenomenon in vitro, several approaches have been used to
introduce mutations either by random or targeted processes. The
random mutations can be introduced using error-prone PCR, chain
shuffling or mutator E. coli strains (Clackson T. Hoogenboom N. R.,
Griffiths A. D. and Winter G. 1991 Making antibody fragments using
phage display libraries. Nature 352, 624-628, Hawkins R. E.,
Russell S. J. and Winter G. 1992. Selection of phage antibodies by
binding affinity. Mimicking affinity maturation. J. Mol. Biol. 226,
889-896, Low N., Holliger P. and Winter G. 1996. Mimicking somatic
hypermutation: affinity maturation of antibodies displayed on
bacteriophage using a bacterial mutator strain. J Mol. Biol. 260,
359-368). This strategy leads to the creation of large libraries in
which reactive clones are selected with a display technology such
as ribosome, phage or yeast (Min L. (2000). Applications of display
technology in protein analysis. Nat. Biotechnol. 18,
1251-1256).
[0138] The targeted mutations of the CDRs, especially CDR3 of the
light and heavy chains, have been shown to be an effective
technique for increasing antibody affinity. Blocks of 3 to 4 amino
acids of the CDR3 or specific regions called "hot-spots" are
targeted for mutagenesis. Yang et al reported an increase of 420
fold of an anti-HIV gp120 Fab fragment by mutating four CDR
residues (Yang W. P., Green K., Pinz-Sweeney S., Briones A. T.,
Burton D. R. and Barbas C. F. III. 1995. CDR walking mutagenesis
for the affinity maturation of a potent human anti-HIV-1 antibody
into picomolar range. J. Mol. Biol., 254, 392-403). One mutation in
the VL CDR3 combined with three mutations in the VH CDR3 of the
C6.5 scFv yielded a 1230 fold increased affinity (Schier R., McCall
A., Adams G. P., Marshall K. W., Merrit H., Yin M., Crawford R. S.
Weiner L. M., Marks C. and Marks J. D. 1996. Isolation of picomolar
affinity anti-c-erbB-2 single-chain Fv by molecular evolution of
the complementary determining regions in the center of the antibody
binding site. J. Mol. Biol., 263, 551-567).
[0139] "Hot spots" are the sequences where somatic hypermutation
takes place in vivo (Neuberger M. S and Milstein C. 1995. Somatic
hypermutation. Curr. Opin. Immunol. 7, 248-254). The hotspot
sequences can be defined as consensus nucleotide sequences in
certain codons. The consensus sequence is the tetranucleotide,
RGYW, in which R can be either A or G, Y can be C or T and W can be
either A or T (Neuberger M. S and Milstein C. 1995. Somatic
hypermutation. Curr. Opin. Immunol. 7, 248-254). In addition, the
serine residues encoded by the nucleotides AGY are predominantly
present in the CDRs regions of the variable domain over those
encoded by TCN corresponding to a potential hot-spot sequences
(Wagner S. D., Milstein C. and Neuberger M. S. 1995. Codon bias
targets mutation. Nature, 376, 732). The structural analysis has
shown that the CDR loops contribute the most to the antigen
binding, especially the CDR3 loops (Giudicelli V., Chaume D. and
Lefranc M. P. 2004. IMGT/V-QUEST, an integrated software program
for immunoglobulin and T cell receptor V-J and V-D-J rearrangement
analysis. Nucleis Acids Res. 32, 435-440). Therefore, the
nucleotide sequence of the CDRs of the heavy and light chains of
each antibody of the invention is scanned for the presence of the
hot-spot sequences and AGY codons. The identified hot-spots of the
CDR regions of the light and heavy chain are compared to the
germinal sequences of the heavy and light chains using the
International ImMunoGen Tics database (IMGT,
http://imgt.cines.fr/textes/vquest/) (Davies D. R., Padlan E. A.
and Sheriff S. 1990. Antibody-antigen complexes. Annu. Rev.
Biochem. 59, 439-473). A sequence, identical to the germ line,
suggest that somatic mutation has not occurred; therefore the
random mutations are introduced mimicking the somatic events
occurring in vivo. In contrast, a different sequence shows that
some somatic mutations have already occurred. It will remain to be
determined if the in vivo somatic mutation was optimal. The
hot-spots that code for buried or conserved amino acids within the
CDRs are not mutagenized. These residues are usually critical for
the overall structure and are unlikely to interact with the antigen
since they are buried. In addition, the sequences can be compared
to the predicted locations in the germ line sequences where somatic
mutations occurred predominantly (Tomlinson I. M., Cox J. P. L.,
Gherardi E., Lesk A. M. and Chotia C. 1995. The structural
repertoire of the human Vldomain. EMBO J. 14, 4628-4638, Tomlinson
I. M., Walter G., Jones P. T., Dear P. H., Sonnhammer E. L. L. and
Winter G. 1996. The imprint of somatic hypermutation on the
repertoire of human germline V genes. J. Mol. Biol. 256, 813-817).
A similar strategy was applied for the affinity maturation of BL22
scFv. A point mutation introduced in the CDR3 of the heavy resulted
in 5 to 10 fold increase in binding activity on various
CD22-positive cell lines (Salvatore G., Beers R., Margulies I.,
Kreitman R. J. and Pastan I. 2002. Improved cytotoxic activity
toward cell lines and fresh leukemia cells of a mutant anti-CD22
immunotoxin obtained by antibody phage display. Clinical Cancer
research, 8, 995-1002). Also, the mutation of various amino acids
in the CDR1 and CDR2 loops also produced mutant with increase
affinity ranging from 3 fold to 7 fold (Ho M., Kreitman J., Onda M.
and Pastan I. 2005. In vitro antibody evolution targeting germline
hot spots to increase activity of an anti-CD22 immunotoxin. J.
Biol. Chem., 280, 607-617).
[0140] After mutations are introduced, either by random or targeted
processes, the antibodies are expressed and assessed for function.
For instance, functional screening can be based on binding. Once
function is assessed, then DNA sequencing of the chosen antibodies
can be carried out using known methods.
[0141] In another embodiment, the anchored periplasmic expression
(APEx) method described by Harvey, B et al (PNAS 2004 Jun. 22;
101(25): 9193-8) is used for affinity maturation of the binding
proteins or immunoconjugates of the invention.
[0142] Accordingly, the invention includes binding proteins of the
invention that have been affinity maturized to increase the
affinity of the binding protein to CD44E and AFP or a variant
thereof, or to select a binding protein that has affinity to CD44E
or AFP or a variant thereof.
[0143] The invention also provides compositions comprising the
binding proteins of the invention, preferably antibodies and
antibody fragments, with a pharmaceutically acceptable excipient,
carrier, buffer or stabilizer.
(C) Immunoconjugates
[0144] The invention also includes an immunoconjugate comprising
(1) a binding protein of the invention, preferably an antibody or
antibody fragment, that has been attached to (2) an effector
molecule. In one embodiment, the binding protein of the invention
binds to an antigen or molecule on or in a cancer cell.
[0145] The antigen can be a protein comprising the 5-v8 interface
of CD44E; a protein comprising the v8 exon of CD44; CD44E; a
protein comprising amino acid sequence ATNMDSSHSIT;
alpha-fetoprotein or a variant thereof; a protein having a
molecular weight between 47-53 kDa and an isoelectric point between
5.2-5.5, preferably 5.4; a protein having a molecular weight
between 48-54 kDa and an isoelectric point between 5.1-5.4,
preferably 5.2; or a protein comprising the amino acid sequence 107
to 487 of AFP (SEQ ID NO:14), 107 to 590 of AFP (SEQ ID NO: 15) or
107 to 609 of AFP (SEQ ID NO:16). In another example the antigen is
a protein comprising amino acid SEQ ID NOS: 38, 39, 40, 41, 42, 43,
44 or 45 and having a molecular weight between 47-53 kDa and an
isoelectric point between 5.2-5.5; or a protein comprising amino
acid SEQ ID NOS: 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57,
58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74
or 75 and having a molecular weight between 48-54 kDa and an
isoelectric point between 5.1-5.4.
[0146] In a preferred, embodiment the effector molecule is (i) a
label, which can generate a detectable signal, directly or
indirect, or (ii) a cancer therapeutic agent, which is either
cytotoxic, cytostatic or otherwise prevents or reduces the ability
of the cancer cells to divide and/or metastasize. Such an
immunoconjugate can be generally referred to as "the
immunoconjugate of the invention" herein.
[0147] In the embodiment of the invention the effector molecule is
a cancer therapeutic agent. The cancer therapeutic agent is
preferably a toxin that is either cytotoxic, cytostatic or
otherwise prevents or reduces the ability of the cancer cells to
divide and/or metastasize. Accordingly, one aspect of the invention
is an immunoconjugate comprising (1) a binding protein of the
invention, preferably an antibody or antibody fragment, attached to
(2) a cancer therapeutic agent, such as a toxin.
[0148] In another embodiment, the immunoconjugate is internalized
and the cancer therapeutic agent is a toxin that blocks the protein
synthesis of the cell, therein leading to cell death. Importantly,
since most normal cells do not widely express the antigen present
on the cancer cells, they cannot bind and internalize the
immunoconjugate, and are protected from the killing effect of the
toxin or other cancer therapeutic agents.
[0149] A variety of effector molecules may be used in the
immunoconjugates of the invention and a number of such effector
molecules are intracellularly active molecules. Accordingly, in an
embodiment of the invention, the immunoconjugate is internalized by
the cancer cell.
[0150] In preferred embodiments, the effector molecule is a cancer
therapeutic agent, more preferably a toxin that comprises a
polypeptide having ribosome-inactivating activity including,
without limitation, gelonin, bouganin, saporin, ricin, ricin A
chain, bryodin, diphtheria toxin, restrictocin, Pseudomonas
exotoxin A and variants thereof. When the protein is a
ribosome-inactivating protein, the immunoconjugate must be
internalized upon binding to the cancer cell in order for the toxin
to be cytotoxic to the cells. Accordingly, in an embodiment of the
invention, the effector molecule is a toxin and the immunoconjugate
is internalized by the cancer cell.
[0151] In one embodiment of the invention, the toxin is bouganin or
Pseudomonas exotoxin A, and variants thereof. In another
embodiment, the toxin is modified bouganin or a truncated form of
Pseudomonas exotoxin A that consists of amino acids 252-608.
[0152] The invention includes an immunoconjugate comprising a
protein encoded by nucleic acid sequence of SEQ ID NO:11 (FIG. 20).
The invention also includes an immunoconjugate comprising the amino
acid sequences of SEQ ID NO: 12 and 13 (FIG. 21).
[0153] In other nonlimiting embodiments, the cancer therapeutic
agent comprises an agent that acts to disrupt DNA. Thus, the cancer
therapeutic agents may be selected, without limitation, from
enediynes (e.g., calicheamicin and esperamicin) and non-enediyne
small molecule agents (e.g., bleomycin,
methidiumpropyl-EDTA-Fe(II)). Other cancer therapeutic agents
useful in accordance with the invention include, without
limitation, daunorubicin, doxorubicin, distamycin A, cisplatin,
mitomycin C, ecteinascidins, duocarmycin/CC-1065, and
bleomycin/pepleomycin.
[0154] In other nonlimiting embodiments, the cancer therapeutic
agent comprises an agent that acts to disrupt tubulin. Such agents
may comprise, without limitation, rhizoxin/maytansine, paclitaxel,
vincristine and vinblastine, colchicine, auristatin dolastatin 10
MMAE, and peloruside A.
[0155] In other nonlimiting embodiments, the cancer therapeutic
portion of an immunoconjugate of the invention may comprise an
alkylating agent including, without limitation, Asaley NSC 167780,
AZQ NSC 182986, BCNU NSC 409962, Busulfan NSC 750,
carboxyphthalatoplatinum NSC 271674, CBDCA NSC 241240, CCNU NSC
79037, CHIP NSC 256927, chlorambucil NSC 3088, chlorozotocin NSC
178248, cis-platinum NSC 119875, clomesone NSC 338947,
cyanomorpholinodoxorubicin NSC 357704, cyclodisone NSC 348948,
dianhydrogalactitol NSC 132313, fluorodopan NSC 73754, hepsulfam
NSC 329680, hycanthone NSC 142982, melphalan NSC 8806, methyl CCNU
NSC 95441, mitomycin C NSC 26980, mitozolamide NSC 353451, nitrogen
mustard NSC 762, PCNU NSC 95466, piperazine NSC 344007,
piperazinedione NSC 135758, pipobroman NSC 25154, porfiromycin NSC
56410, spirohydantoin mustard NSC 172112, teroxirone NSC 296934,
tetraplatin NSC 363812, thio-tepa NSC 6396, triethylenemelamine NSC
9706, uracil nitrogen mustard NSC 34462, and Yoshi-864 NSC
102627.
[0156] In other nonlimiting embodiments, the cancer therapeutic
agent portion of the immunoconjugate of the invention may comprise
an antimitotic agent including, without limitation, allocolchicine
NSC 406042, Halichondrin B NSC 609395, colchicine NSC 757,
colchicine derivative NSC 33410, dolastatin 10 NSC 376128
(NG-auristatin derived), maytansine NSC 153858, rhizoxin NSC
332598, taxol NSC 125973, taxol derivative NSC 608832,
thiocolchicine NSC 361792, trityl cysteine NSC 83265, vinblastine
sulfate NSC 49842, and vincristine sulfate NSC 67574.
[0157] In other nonlimiting embodiments, the cancer therapeutic
agent portion of the immunoconjugate of the invention may comprise
an topoisomerase I inhibitor including, without limitation,
camptothecin NSC 94600, camptothecin, Na salt NSC 100880,
aminocamptothecin NSC 603071, camptothecin derivative NSC 95382,
camptothecin derivative NSC 107124, camptothecin derivative NSC
643833, camptothecin derivative NSC 629971, camptothecin derivative
NSC 295500, camptothecin derivative NSC 249910, camptothecin
derivative NSC 606985, camptothecin derivative NSC 374028,
camptothecin derivative NSC 176323, camptothecin derivative NSC
295501, camptothecin derivative NSC 606172, camptothecin derivative
NSC 606173, camptothecin derivative NSC 610458, camptothecin
derivative NSC 618939, camptothecin derivative NSC 610457,
camptothecin derivative NSC 610459, camptothecin derivative NSC
606499, camptothecin derivative NSC 610456, camptothecin derivative
NSC 364830, camptothecin derivative NSC 606497, and
morpholinodoxorubicin NSC 354646.
[0158] In other nonlimiting embodiments, cancer therapeutic agent
portion of the immunoconjugate of the invention may comprise an
topoisomerase II inhibitor including, without limitation,
doxorubicin NSC 123127, amonafide NSC 308847, m-AMSA NSC 249992,
anthrapyrazole derivative NSC 355644, pyrazoloacridine NSC 366140,
bisantrene HCL NSC 337766, daunorubicin NSC 82151, deoxydoxorubicin
NSC 267469, mitoxantrone NSC 301739, menogaril NSC 269148,
N,N-dibenzyl daunomycin NSC 268242, oxanthrazole NSC 349174,
rubidazone NSC 164011, VM-26 NSC 122819, and VP-16 NSC 141540.
[0159] In other nonlimiting embodiments, the cancer therapeutic
agent portion of the immunoconjugate of the invention may comprise
an RNA or DNA antimetabolite including, without limitation,
L-alanosine NSC 153353, 5-azacytidine NSC 102816, 5-fluorouracil
NSC 19893, acivicin NSC 163501, aminopterin derivative NSC 132483,
aminopterin derivative NSC 184692, aminopterin derivative NSC
134033, an antifol NSC 633713, an antifol NSC 623017, Baker's
soluble antifol NSC 139105, dichlorallyl lawsone NSC 126771,
brequinar NSC 368390, ftorafur (pro-drug) NSC
148958,5,6-dihydro-5-azacytidine NSC 264880, methotrexate NSC 740,
methotrexate derivative NSC 174121, N-(phosphonoacetyl)-L-aspartate
(PALA) NSC 224131, pyrazofurin NSC 143095, trimetrexate NSC 352122,
3-HP NSC 95678,2'-deoxy-5-fluorouridine NSC 27640, 5-HP NSC 107392,
alpha-TGDR NSC 71851, aphidicolin glycinate NSC 303812, ara-C NSC
63878,5-aza-2'-deoxycytidine NSC 127716, beta-TGDR NSC 71261,
cyclocytidine NSC 145668, guanazole NSC 1895, hydroxyurea NSC
32065, inosine glycodialdehyde NSC 118994, macbecin II NSC 330500,
pyrazoloimidazole NSC 51143, thioguanine NSC 752, and thiopurine
NSC 755.
[0160] The present invention further provides immunoconjugates
comprising (i) a binding protein of the invention, preferably an
antibody or antibody fragment, attached to (2) an effector
molecule, wherein the effector molecule is a label, which can
generate a detectable signal, indirectly or directly. These
immunoconjugates can be used for research or diagnostic
applications, such as for the in vivo detection of cancer. The
label is preferably capable of producing, either directly or
indirectly, a detectable signal. For example, the label may be
radio-opaque or a radioisotope, such as .sup.3H, .sup.14C,
.sup.32P, .sup.35S, .sup.123I, .sup.125I, .sup.131I; a fluorescent
(fluorophore) or chemiluminescent (chromophore) compound, such as
fluorescein isothiocyanate, rhodamine or luciferin; an enzyme, such
as alkaline phosphatase, beta-galactosidase or horseradish
peroxidase; an imaging agent; or a metal ion.
[0161] In another embodiment, the immunoconjugate is detectable
indirectly. For example, a secondary antibody that is specific for
the immunoconjugate and contains a detectable label can be used to
detect the immunoconjugate.
[0162] The binding protein of the invention, preferably an antibody
of antibody fragment, may be "attached to" the effector molecule by
any means by which the binding protein can be associated with, or
linked to, the effector molecule. For example, the binding protein
may be attached to the effector molecule by chemical or recombinant
means. Chemical means for preparing fusions or conjugates are known
in the art and can be used to prepare the immunoconjugate. The
method used to conjugate the binding protein and effector molecule
must be capable of joining the binding protein with the effector
molecule without interfering with the ability of the binding
protein to bind to the antigen on the cancer cell.
[0163] In one embodiment, the binding protein, preferably an
antibody or antibody fragment, and effector molecule are both
proteins and can be conjugated using techniques well known in the
art. There are several hundred crosslinkers available that can
conjugate two proteins. (See for example "Chemistry of Protein
Conjugation and Crosslinking". 1991, Shans Wong, CRC Press, Ann
Arbor). The crosslinker is generally chosen based on the reactive
functional groups available or inserted on the binding protein,
preferably an antibody or antibody fragment, and/or effector
molecule. In addition, if there are no reactive groups, a
photoactivatible crosslinker can be used. In certain instances, it
may be desirable to include a spacer between the binding protein,
preferably an antibody or antibody fragment, and effector molecule.
Crosslinking agents known to the art include the homobifunctional
agents: glutaraldehyde, dimethyladipimidate and Bis(diazobenzidine)
and the heterobifunctional agents: m
Maleimidobenzoyl-N-Hydroxysuccinimide and Sulfo-m
Maleimidobenzoyl-N-Hydroxysuccinimide.
[0164] A binding protein-effector molecule protein fusion may also
be prepared using recombinant DNA techniques. In such a case a DNA
sequence encoding the binding protein is fused to a DNA sequence
encoding the effector molecule, resulting in a chimeric DNA
molecule. The chimeric DNA sequence is transfected into a host cell
that expresses the fusion protein. The fusion protein can be
recovered from the cell culture and purified using techniques known
in the art.
[0165] Examples of attaching an effector molecule, which is a
label, to the binding protein include the methods described in
Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry
13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981);
Nygren, J. Histochem. and Cytochem. 30:407 (1982); Wensel and
Meares, Radioimmunoimaging And Radioimmunotherapy, Elsevier, N.Y.
(1983); and Colcher et al., "Use Of Monoclonal Antibodies As
Radiopharmaceuticals For The Localization Of Human Carcinoma
Xenografts In Athymic Mice", Meth. Enzymol., 121:802-16 (1986).
(D) Preparation of Proteins of the Invention
[0166] A person skilled in the art will appreciate that the
proteins of the invention, such as the light and heavy
complementarity determining regions, the light and heavy chain
variable regions, antibodies and antibody fragments, and
immunoconjugates, may be prepared in any of several ways, but is
most preferably prepared using recombinant methods.
[0167] Accordingly, the nucleic acid molecules of the present
invention may be incorporated in a known manner into an appropriate
expression vector which ensures good expression of the proteins of
the invention. Possible expression vectors include but are not
limited to cosmids, plasmids, or modified viruses (e.g. replication
defective retroviruses, adenoviruses and adeno-associated viruses),
so long as the vector is compatible with the host cell used. The
expression vectors are "suitable for transformation of a host
cell", which means that the expression vectors contain a nucleic
acid molecule of the invention and regulatory sequences selected on
the basis of the host cells to be used for expression, which is
operatively linked to the nucleic acid molecule. Operatively linked
is intended to mean that the nucleic acid is linked to regulatory
sequences in a manner which allows expression of the nucleic
acid.
[0168] The invention therefore contemplates a recombinant
expression vector of the invention containing a nucleic acid
molecule of the invention, or a fragment thereof, and the necessary
regulatory sequences for the transcription and translation of the
inserted protein-sequence.
[0169] Suitable regulatory sequences may be derived from a variety
of sources, including bacterial, fungal, viral, mammalian, or
insect genes (For example, see the regulatory sequences described
in Goeddel, Gene Expression Technology: Methods in Enzymology 185,
Academic Press, San Diego, Calif. (1990)). Selection of appropriate
regulatory sequences is dependent on the host cell chosen as
discussed below, and may be readily accomplished by one of ordinary
skill in the art. Examples of such regulatory sequences include: a
transcriptional promoter and enhancer or RNA polymerase binding
sequence, a ribosomal binding sequence, including a translation
initiation signal. Additionally, depending on the host cell chosen
and the vector employed, other sequences, such as an origin of
replication, additional DNA restriction sites, enhancers, and
sequences conferring inducibility of transcription may be
incorporated into the expression vector.
[0170] The recombinant expression vectors of the invention may also
contain a selectable marker gene which facilitates the selection of
host cells transformed or transfected with a recombinant molecule
of the invention. Examples of selectable marker genes are genes
encoding a protein such as G418 and hygromycin which confer
resistance to certain drugs, .beta.-galactosidase, chloramphenicol
acetyltransferase, firefly luciferase, or an immunoglobulin or
portion thereof such as the Fc portion of an immunoglobulin
preferably IgG. Transcription of the selectable marker gene is
monitored by changes in the concentration of the selectable marker
protein such as .beta.-galactosidase, chloramphenicol
acetyltransferase, or firefly luciferase. If the selectable marker
gene encodes a protein conferring antibiotic resistance such as
neomycin resistance transformant cells can be selected with G418.
Cells that have incorporated the selectable marker gene will
survive, while the other cells die. This makes it possible to
visualize and assay for expression of recombinant expression
vectors of the invention and in particular to determine the effect
of a mutation on expression and phenotype. It will be appreciated
that selectable markers can be introduced on a separate vector from
the nucleic acid of interest.
[0171] The recombinant expression vectors may also contain genes
which encode a fusion moiety which provides increased expression of
the recombinant protein; increased solubility of the recombinant
protein; and aid in the purification of the target recombinant
protein by acting as a ligand in affinity purification. For
example, a proteolytic cleavage site may be added to the target
recombinant protein to allow separation of the recombinant protein
from the fusion moiety subsequent to purification of the fusion
protein. Typical fusion expression vectors include pGEX (Amrad
Corp., Melbourne, Australia), pMal (New England Biolabs, Beverly,
Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) which fuse
glutathione S-transferase (GST), maltose E binding protein, or
protein A, respectively, to the recombinant protein.
[0172] Recombinant expression vectors can be introduced into host
cells to produce a transformed host cell. The terms "transformed
with", "transfected with", "transformation" and "transfection" are
intended to encompass introduction of nucleic acid (e.g. a vector)
into a cell by one of many possible techniques known in the art.
The term "transformed host cell" as used herein is intended to also
include cells capable of glycosylation that have been transformed
with a recombinant expression vector of the invention. Prokaryotic
cells can be transformed with nucleic acid by, for example,
electroporation or calcium-chloride mediated transformation. For
example, nucleic acid can be introduced into mammalian cells via
conventional techniques such as calcium phosphate or calcium
chloride co-precipitation, DEAE-dextran mediated transfection,
lipofectin, electroporation or microinjection. Suitable methods for
transforming and transfecting host cells can be found in Sambrook
et al. (Molecular Cloning: A Laboratory Manual, 2nd Edition, Cold
Spring Harbor Laboratory press (1989)), and other laboratory
textbooks.
[0173] Suitable host cells include a wide variety of eukaryotic
host cells and prokaryotic cells. For example, the proteins of the
invention may be expressed in yeast cells or mammalian cells. Other
suitable host cells can be found in Goeddel, Gene Expression
Technology: Methods in Enzymology 185, Academic Press, San Diego,
Calif. (1991). In addition, the proteins of the invention may be
expressed in prokaryotic cells, such as Escherichia coli (Zhang et
al., Science 303(5656): 371-3 (2004)).
[0174] Yeast and fungi host cells suitable for carrying out the
present invention include, but are not limited to Saccharomyces
cerevisiae, the genera Pichia or Kluyveromyces and various species
of the genus Aspergillus. Examples of vectors for expression in
yeast S. cerevisiae include pYepSecl (Baldari. et al., Embo J.
6:229-234 (1987)), pMFa (Kurjan and Herskowitz, Cell 30:933-943
(1982)), pJRY88 (Schultz et al., Gene 54:113-123 (1987)), and pYES2
(Invitrogen Corporation, San Diego, Calif.). Protocols for the
transformation of yeast and fungi are well known to those of
ordinary skill in the art (see Hinnen et al., Proc. Natl. Acad.
Sci. USA 75:1929 (1978); Itoh et al., J. Bacteriology 153:163
(1983), and Cullen et al. (BiolTechnology 5:369 (1987)).
[0175] Mammalian cells suitable for carrying out the present
invention include, among others: COS (e.g., ATCC No. CRL 1650 or
1651), BHK (e.g. ATCC No. CRL 6281), CHO (ATCC No. CCL 61), HeLa
(e.g., ATCC No. CCL 2), 293 (ATCC No. 1573) and NS-1 cells.
Suitable expression vectors for directing expression in mammalian
cells generally include a promoter (e.g., derived from viral
material such as polyoma, Adenovirus 2, cytomegalovirus and Simian
Virus 40), as well as other transcriptional and translational
control sequences. Examples of mammalian expression vectors include
pCDM8 (Seed, B., Nature 329:840 (1987)) and pMT2PC (Kaufman et al.,
EMBO J. 6:187-195 (1987)).
[0176] Given the teachings provided herein, promoters, terminators,
and methods for introducing expression vectors of an appropriate
type into plant, avian, and insect cells may also be readily
accomplished. For example, within one embodiment, the proteins of
the invention may be expressed from plant cells (see Sinkar et al.,
J. Biosci (Bangalore) 11:47-58 (1987), which reviews the use of
Agrobacterium rhizogenes vectors; see also Zambryski et al.,
Genetic Engineering, Principles and Methods, Hollaender and Setlow
(eds.), Vol. VI, pp. 253-278, Plenum Press, New York (1984), which
describes the use of expression vectors for plant cells, including,
among others, PAPS2022, PAPS2023, and PAPS2034)
[0177] Insect cells suitable for carrying out the present invention
include cells and cell lines from Bombyx, Trichoplusia or Spodotera
species. Baculovirus vectors available for expression of proteins
in cultured insect cells (SF 9 cells) include the pAc series (Smith
et al., Mol. Cell Biol. 3:2156-2165 (1983)) and the pVL series
(Lucklow, V. A., and Summers, M. D., Virology 170:31-39 (1989)).
Some baculovirus-insect cell expression systems suitable for
expression of the recombinant proteins of the invention are
described in PCT/US/02442.
[0178] Alternatively, the proteins of the invention may also be
expressed in non-human transgenic animals such as, rats, rabbits,
sheep and pigs (Hammer et al. Nature 315:680-683 (1985); Palmiter
et al. Science 222:809-814 (1983); Brinster et al. Proc. Natl.
Acad. Sci. USA 82:4438-4442 (1985); Palmiter and Brinster Cell
41:343-345 (1985) and U.S. Pat. No. 4,736,866).
[0179] The proteins of the invention may also be prepared by
chemical synthesis using techniques well known in the chemistry of
proteins such as solid phase synthesis (Merrifield, J. Am. Chem.
Assoc. 85:2149-2154 (1964); Frische et al., J. Pept. Sci. 2(4):
212-22 (1996)) or synthesis in homogenous solution (Houbenweyl,
Methods of Organic Chemistry, ed. E. Wansch, Vol. 15 I and II,
Thieme, Stuttgart (1987)).
[0180] N-terminal or C-terminal fusion proteins comprising the
proteins of the invention conjugated with other molecules, such as
proteins may be prepared by fusing, through recombinant techniques.
The resultant fusion proteins contain a protein of the invention
fused to the selected protein or marker protein as described
herein. The recombinant protein of the invention may also be
conjugated to other proteins by known techniques. For example, the
proteins may be coupled using heterobifunctional thiol-containing
linkers as described in WO 90/10457,
N-succinimidyl-3-(2-pyridyldithio-proprionate) or N-succinimidyl-5
thioacetate. Examples of proteins which may be used to prepare
fusion proteins or conjugates include cell binding proteins such as
immunoglobulins, hormones, growth factors, lectins, insulin, low
density lipoprotein, glucagon, endorphins, transferrin, bombesin,
asialoglycoprotein glutathione-S-transferase (GST), hemagglutinin
(HA), and truncated myc.
[0181] Accordingly, the invention provides a recombinant expression
vector comprising the nucleic acid sequences that encode the
proteins of the invention, such as the light and heavy chain
complementarity determining regions, the light and heavy chain
variable regions, the binding proteins, such as antibodies and
antibody fragments, and immunoconjugates of the invention. Further,
the invention provides a host cell comprising the recombinant
expression vector of the invention.
(E) Therapeutic Methods and Pharmaceutical Compositions
[0182] The inventors have shown that binding proteins of the
invention bind to the extracellular domain of CD44E and that
binding proteins of the invention are internalized. Thus, the
binding proteins of invention can be used for the targeted delivery
of bioactive or medically relevant agents, such as imaging,
radioactive or cytotoxic agents.
[0183] The inventors have also shown that the binding proteins of
the invention bind to AFP or a variant thereof. Full length AFP can
be found in free form in circulation and it is internalized upon
binding to its receptor. Targeting circulating AFP with the binding
proteins of the invention can thus also be used for targeted drug
delivery.
[0184] In one embodiment, the invention provides a method of
treating or preventing cancer, comprising administering to a
patient suspected of having cancer an effective amount of the
immunoconjugate of the invention, wherein the effector molecule is
a cancer therapeutic agent. In another embodiment, the invention
provides the use of an effective amount of the immunoconjugate of
the invention, wherein the effector molecule is a cancer
therapeutic agent, for the manufacture of a medicament for treating
or preventing cancer. Furthermore, the invention provides the use
of an effective amount of the immunoconjugate of the invention,
wherein the effector molecule is a cancer therapeutic agent,
comprising the use of an additional cancer therapeutic for the
manufacture of a medicament for simultaneous, separate or
sequential treatment or prevention of cancer.
[0185] In one embodiment of the invention, cancer includes, without
limitation, cervical cancer, uterine cancer, ovarian cancer,
pancreatic cancer, kidney cancer, gallbladder cancer, liver cancer,
head and neck cancer, squamous cell carcinoma, gastrointestinal
cancer, breast cancer (such as carcinoma, ductal, lobular, and
nipple), prostate cancer, testicular cancer, lung cancer, non-small
cell lung cancer, non-Hodgkin's lymphoma, multiple myeloma,
leukemia (such as acute lymphocytic leukemia, chronic lymphocytic
leukemia, acute myelogenous leukemia, and chronic myelogenous
leukemia), brain cancer, neuroblastoma, sarcomas, colon cancer,
rectum cancer, stomach cancer, bladder cancer, pancreatic cancer,
endometrial cancer, plasmacytoma, lymphoma, and melanoma. In a
preferred embodiment, the cancer includes, without limitation,
bladder cancer, breast cancer, cervical cancer, colon cancer,
kidney cancer, liver cancer, lung cancer, ovarian cancer,
pancreatic cancer, prostate cancer, rectal cancer, skin cancer,
stomach cancer, uterine cancer, and head and neck cancer.
[0186] The ability of the immunoconjugate of the invention to
selectively inhibit or destroy cancerous cells may be readily
tested in vitro using cancer cell lines. The selective inhibitory
effect of the immunoconjugates of the invention may be determined,
for example by demonstrating the selective inhibition of cellular
proliferation of the cancer cells.
[0187] Toxicity may also be measured based on cell viability, for
example, the viability of cancer and normal cell cultures exposed
to the immunoconjugate may be compared. Cell viability may be
assessed by known techniques, such as trypan blue exclusion
assays.
[0188] In another example, a number of models may be used to test
the effectiveness of the immunoconjugates of the invention.
Thompson, E. W. et al. (Breast Cancer Res. Treatment 31:357-370
(1994)) has described a model for the determination of invasiveness
of human breast cancer cells in vitro by measuring tumor
cell-mediated proteolysis of extracellular matrix and tumor cell
invasion of reconstituted basement membrane (collagen, laminin,
fibronectin, Matrigel or gelatin). Other applicable cancer cell
models include cultured ovarian adenocarcinoma cells (Young, T. N.
et al. Gynecol. Oncol. 62:89-99 (1996); Moore, D. H. et al.
Gynecol. Oncol. 65:78-82 (1997)), human follicular thyroid cancer
cells (Demeure, M. J. et al., World J. Surg. 16:770-776 (1992)),
human melanoma (A-2058) and fibrosarcoma (HT-1080) cell lines
(Mackay, A. R. et al. Lab. Invest. 70:781 783 (1994)), and lung
squamous (HS-24) and adenocarcinoma (SB-3) cell lines (Spiess, E.
et al. J. Histochem. Cytochem. 42:917-929 (1994)). An in vivo test
system involving the implantation of tumors and measurement of
tumor growth and metastasis in athymic nude mice has also been
described (Thompson, E. W. et al., Breast Cancer Res. Treatment
31:357-370 (1994); Shi, Y. E. et al., Cancer Res. 53:1409-1415
(1993)).
[0189] The immunoconjugates of the invention may be formulated into
pharmaceutical compositions for administration to subjects in a
biologically compatible form suitable for administration in vivo.
The substances may be administered to living organisms including
humans, and animals. Administration of a therapeutically active
amount of the pharmaceutical compositions of the present invention
is defined as an amount effective, at dosages and for periods of
time necessary to achieve the desired result. For example, a
therapeutically active amount of a substance may vary according to
factors such as the disease state, age, sex, and weight of the
individual, and the ability of the recombinant protein of the
invention to elicit a desired response in the individual. Dosage
regime may be adjusted to provide the optimum therapeutic response.
For example, several divided doses may be administered daily or the
dose may be proportionally reduced as indicated by the exigencies
of the therapeutic situation.
[0190] Accordingly, the present invention provides a pharmaceutical
composition for treating or preventing cancer comprising the
immunoconjugates of the invention, and a pharmaceutically
acceptable carrier, diluent or excipient. In a preferred
embodiment, the effector molecule of the immunoconjugate in the
pharmaceutical composition is a cancer therapeutic agent, more
preferably a toxin.
[0191] The pharmaceutical preparation comprising the
immunoconjugate of the invention may be administered systemically.
The pharmaceutical preparation may be administered directly to the
cancer site. Depending on the route of administration, the
immunoconjugate may be coated in a material to protect the compound
from the action of enzymes, acids and other natural conditions that
may inactivate the compound.
[0192] In accordance with one aspect of the present invention, the
immunoconjugate is delivered to the patient by direct
administration. The invention contemplates the pharmaceutical
composition being administered in at least an amount sufficient to
achieve the endpoint, and if necessary, comprises a
pharmaceutically acceptable carrier.
[0193] The invention also provides methods for reducing the risk of
post-surgical complications comprising administering an effective
amount of the immunoconjugate of the invention before, during, or
after surgery to treat cancer.
[0194] The compositions described herein can be prepared by per se
known methods for the preparation of pharmaceutically acceptable
compositions that can be administered to subjects, such that an
effective quantity of the active substance is combined in a mixture
with a pharmaceutically acceptable vehicle. Suitable vehicles are
described, for example, in Remington's Pharmaceutical Sciences
(Remington's Pharmaceutical Sciences, Mack Publishing Company,
Easton, Pa., USA 1985). On this basis, the compositions include,
albeit not exclusively, solutions of the substances in association
with one or more pharmaceutically acceptable vehicles or diluents,
and contained in buffered solutions with a suitable pH and
iso-osmotic with the physiological fluids.
[0195] Pharmaceutical compositions include, without limitation,
lyophilized powders or aqueous or non-aqueous sterile injectable
solutions or suspensions, which may further contain antioxidants,
buffers, bacteriostats and solutes that render the compositions
substantially compatible with the tissues or the blood of an
intended recipient. Other components that may be present in such
compositions include water, alcohols, polyols, glycerin and
vegetable oils, for example. Extemporaneous injection solutions and
suspensions may be prepared from sterile powders, granules,
tablets, or concentrated solutions or suspensions. Immunoconjugate
may be supplied, for example but not by way of limitation, as a
lyophilized powder which is reconstituted with sterile water or
saline prior to administration to the patient.
[0196] Pharmaceutical compositions of the invention may comprise a
pharmaceutically acceptable carrier. Suitable pharmaceutically
acceptable carriers include essentially chemically inert and
nontoxic compositions that do not interfere with the effectiveness
of the biological activity of the pharmaceutical composition.
Examples of suitable pharmaceutical carriers include, but are not
limited to, water, saline solutions, glycerol solutions, ethanol,
N-(1(2,3-dioleyloxy)propyl)N,N,N-trimethylammonium chloride
(DOTMA), diolesyiphosphotidyl-ethanolamine (DOPE), and liposomes.
Such compositions should contain a therapeutically effective amount
of the compound, together with a suitable amount of carrier so as
to provide the form for direct administration to the patient.
[0197] The composition may be in the form of a pharmaceutically
acceptable salt which includes, without limitation, those formed
with free amino groups such as those derived from hydrochloric,
phosphoric, acetic, oxalic, tartaric acids, etc., and those formed
with free carboxyl groups such as those derived from sodium,
potassium, ammonium, calcium, ferric hydroxides, isopropylamine,
triethylamine, 2-ethylarnino ethanol, histidine, procaine, etc.
[0198] In various embodiments of the invention, the pharmaceutical
composition is directly administered systemically or directly to
the area of the tumor(s).
[0199] The pharmaceutical compositions may be used in methods for
treating animals, including mammals, preferably humans, with
cancer. The dosage and type of immunoconjugate to be administered
will depend on a variety of factors which may be readily monitored
in human subjects. Such factors include the etiology and severity
(grade and stage) of the cancer.
[0200] Clinical outcomes of cancer treatments using the
immunoconjugates of the invention are readily discernable by one of
skill in the relevant art, such as a physician. For example,
standard medical tests to measure clinical markers of cancer may be
strong indicators of the treatment's efficacy. Such tests may
include, without limitation, physical examination, performance
scales, disease markers, 12-lead ECG, tumor measurements, tissue
biopsy, cytoscopy, cytology, longest diameter of tumor
calculations, radiography, digital imaging of the tumor, vital
signs, weight, recordation of adverse events, assessment of
infectious episodes, assessment of concomitant medications, pain
assessment, blood or serum chemistry, urinalysis, CT scan, and
pharmacokinetic analysis. Furthermore, synergistic effects of a
combination therapy comprising the immunoconjugate and another
cancer therapeutic may be determined by comparative studies with
patients undergoing monotherapy.
[0201] Another embodiment of the invention is a kit for treating or
preventing cancer comprising an effective amount of the
immunoconjugate of the invention, and directions for the use
thereof to treat the cancer.
[0202] In the majority of approved anticancer therapies, the
anticancer therapy is used in combination with other anticancer
therapies. Accordingly, the invention provides a method of
preventing or treating cancer using the immunoconjugate of the
invention in combination with at least one additional anticancer
therapy. The other cancer therapy may be administered prior to,
overlapping with, concurrently, and/or after administration of the
immunoconjugate. When administered concurrently, the
immunoconjugate and the other cancer therapeutic may be
administered in a single formulation or in separate formulations,
and if separately, then optionally, by different modes of
administration. The combination of one or more immunoconjugates and
one or more other cancer therapies may synergistically act to
combat the tumor or cancer. The other cancer therapies include,
without limitation, radiation and other anticancer therapeutic
agents. These other cancer therapeutics may include, without
limitation, 2,2',2''trichlorotriethylamine, 6-azauridine,
6-diazo-5-oxo-L-norleucine, 6-mercaptopurine, aceglarone,
aclacinomycins actinomycin, altretamine, aminoglutethimide,
aminoglutethimide, amsacrine, anastrozole, ancitabine, angiogenin
antisense oligonucleotide, anthramycin, azacitidine, azaserine,
aziridine, batimastar, bcl-2 antisense oligonucleotide, benzodepa,
bicalutamide, bisantrene, bleomycin, buserelin, busulfan,
cactinomycin, calusterone, carboplatin, carboquone, carminomycin,
carmofur, carmustine, carubicin, carzinophilin, chlorambucil,
chlornaphazine, chlormadinone acetate, chlorozotocin, chromomycins,
cisplatin, cladribine, cyclophosphamide, cytarabine, dacarbazine,
dactinomycin, daunorubicin, defosfamide, demecolcine, denopterin,
detorubicin, diaziquone, docetaxel, doxifluridine, doxorubicin,
droloxifene, dromostanolone, edatrexate, eflomithine, elliptinium
acetate, emitefur, enocitabune, epirubicin, epitiostanol,
esorubicin, estramustine, etoglucid, etoposide, fadrozole,
fenretinide, floxuridine, fludarabine, fluorouracil, flutamide,
folinic acid, formestane, fosfestrol, fotemustine, gallium nitrate,
gemcitabine, goserelin, hexestrol, hydroxyurea, idarubicin,
ifosfamide, improsulfan, interferon-alpha, interferon-beta,
interferon-gamma, interleukin-2, L-asparaginase, lentinan,
letrozole, leuprolide, lomustine, lonidamine, mannomustine,
marcellomycin, mechlorethamine, mechlorethamine oxide
hydrochloride, medroxyprogesterone, megestrol acetate,
melengestrol, melphalan, menogaril, mepitiostane, methotrexate,
meturedepa, miboplatin, miltefosine, mitobronitol, mitoguazone,
mitolactol, mitomycins, mitotane, mitoxantrone, mopidamol,
mycophenolic acid, nilutamide, nimustine, nitracine, nogalamycin,
novembichin, olivomycins, oxaliplatin, paclitaxel, pentostatin,
peplomycin, perfosfamide, phenamet, phenesterine, pipobroman,
piposulfan, pirarubicin, piritrexim, plicamycin, podophyllinic acid
2-ethyl-hydrazide, polyestradiol phosphate, porfimer sodium,
porfiromycin, prednimustine, procabazine, propagermanium, PSK,
pteropterin, puromycin, quelamycin, ranimustine, razoxane,
rodorubicin, roquinimex, sizofican, sobuzoxane, spirogermanium,
streptonigrin, streptozocin, tamoxifen, taxotere, tegafur,
temozolomide, teniposide, tenuzonic acid, testolacone, thiamiprine,
thioguanine, thiotepa, Tomudex, topotecan, toremifene, triaziquone,
triethylenemelamine, triethylenephosphoramide,
triethylenethiophosphoramide, trilostane, trimetrexate,
triptorelin, trofosfamide, trontecan, tubercidin, ubenimex, uracil
mustard, uredepa, urethan, vinblastine, vincristine, zinostatin,
and zorubicin, cytosine arabinoside, gemtuzumab, thioepa,
cyclothosphamide, antimetabolites (e.g., methotrexate,
6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil,
fludarabine, gemcitabine, dacarbazine, temozoamide),
hexamethylmelamine, LYSODREN, nucleoside analogues, plant alkaloids
(e.g., Taxol, paclitaxel, camptothecin, topotecan, irinotecan
(CAMPTOSAR,CPT-11), vincristine, vinca alkyloids such as
vinblastine.) podophyllotoxin, epipodophyllotoxin, VP-16
(etoposide), cytochalasin B, gramicidin D, ethidium bromide,
emetine, anthracyclines (e.g., daunorubicin), doxorubicin
liposomal, dihydroxyanthracindione, mithramycin, actinomycin D,
aldesleukin, allutamine, biaomycin, capecitabine, carboplain,
chlorabusin, cyclarabine, daclinomycin, floxuridhe, lauprolide
acetate, levamisole, lomusline, mercaptopurino, mesna, mitolanc,
pegaspergase, pentoslatin, picamycin, riuxlmab, campath-1,
straplozocin, tretinoin, VEGF antisense oligonucleotide, vindesine,
and vinorelbine. Compositions comprising one or more cancer
therapeutics (e.g., FLAG, CHOP) are also contemplated by the
present invention. FLAG comprises fludarabine, cytosine arabinoside
(Ara-C) and G-CSF. CHOP comprises cyclophosphamide, vincristine,
doxorubicin, and prednisone. For a full listing of cancer
therapeutics known in the art, see, e.g., the latest editions of
The Merck Index and the Physician's Desk Reference.
[0203] Pharmaceutical compositions for combination therapy may also
include, without limitation, antibiotics (e.g., dactinomycin,
bleomycin, mithramycin, anthramycin), asparaginase, Bacillus and
Guerin, diphtheria toxin, procaine, tetracaine, lidocaine,
propranolol, anti-mitotic agents, abrin, ricinA, Pseudomonas
exotoxin, nerve growth factor, platelet derived growth factor,
tissue plasminogen activator, antihistaminic agents, anti-nausea
agents, etc.
[0204] Indeed, administration of an effective amount of an
immunoconjugate to a patient in need of such treatment may result
in reduced doses of another cancer therapeutic having clinically
significant efficacy. Such efficacy of the reduced dose of the
other cancer therapeutic may not be observed absent administration
with an immunoconjugate. Accordingly, the present invention
provides methods for treating a tumor or cancer comprising
administering a reduced dose of one or more other cancer
therapeutics.
[0205] Moreover, combination therapy comprising an immunoconjugate
to a patient in need of such treatment may permit relatively short
treatment times when compared to the duration or number of cycles
of standard treatment regimens. Accordingly, the present invention
provides methods for treating a tumor or cancer comprising
administering one or more other cancer therapeutics for relatively
short duration and/or in fewer treatment cycles.
[0206] Thus, in accordance with the present invention, combination
therapies comprising an immunoconjugate and another cancer
therapeutic may reduce toxicity (i.e., side effects) of the overall
cancer treatment. For example, reduced toxicity, when compared to a
monotherapy or another combination therapy, may be observed when
delivering a reduced dose of immunoconjugate and/or other cancer
therapeutic, and/or when reducing the duration of a cycle (i.e.,
the period of a single administration or the period of a series of
such administrations), and/or when reducing the number of
cycles.
[0207] Accordingly, the invention provides a pharmaceutical
composition comprising an immunoconjugate and one or more
additional anticancer therapeutic, optionally in a pharmaceutically
acceptable carrier.
[0208] The present invention also provides a kit comprising an
effective amount of an immunoconjugate, optionally, in combination
with one or more other cancer therapeutic, together with
instructions for the use thereof to treat cancer.
[0209] As stated above, combination therapy with an immunoconjugate
may sensitize the cancer or tumor to administration of an
additional cancer therapeutic. Accordingly, the present invention
contemplates combination therapies for preventing, treating, and/or
preventing recurrence of cancer comprising administering an
effective amount of an immunoconjugate prior to, subsequently, or
concurrently with a reduced dose of a cancer therapeutic. For
example, initial treatment with an immunoconjugate may increase the
sensitivity of a cancer or tumor to subsequent challenge with a
dose of cancer therapeutic. This dose is near, or below, the low
range of standard dosages when the cancer therapeutic is
administered alone, or in the absence of an immunoconjugate. When
concurrently administered, the immunoconjugate may be administered
separately from the cancer therapeutic, and optionally, via a
different mode of administration.
[0210] Accordingly, in one embodiment, the additional cancer
therapeutic comprises cisplatin, e.g., PLATINOL or PLATINOL-AQ
(Bristol Myers), at a dose ranging from approximately 5 to 10, 11
to 20, 21 to 40, or 41 to 75 mg/m.sup.2/cycle.
[0211] In another embodiment, the additional cancer therapeutic
comprises carboplatin, e.g., PARAPLATIN (Bristol Myers), at a dose
ranging from approximately 2 to 3, 4 to 8, 9 to 16, 17 to 35, or 36
to 75 mg/m.sup.2/cycle.
[0212] In another embodiment, the additional cancer therapeutic
comprises cyclophosphamide, e.g., CYTOXAN (Bristol Myers Squibb),
at a dose ranging from approximately 0.25 to 0.5, 0.6 to 0.9, 1 to
2, 3 to 5, 6 to 10, 11 to 20, or 21 to 40 mg/kg/cycle.
[0213] In another embodiment, the additional cancer therapeutic
comprises cytarabine, e.g., CYTOSAR-U (Pharmacia & Upjohn), at
a dose ranging from approximately 0.5 to 1, 2 to 4, 5 to 10, 11 to
25, 26 to 50, or 51 to 100 mg/m.sup.2/cycle. In another embodiment,
the additional cancer therapeutic comprises cytarabine liposome,
e.g., DEPOCYT (Chiron Corp.), at a dose ranging from approximately
5 to 50 mg/m.sup.2/cycle.
[0214] In another embodiment, the additional cancer therapeutic
comprises dacarbazine, e.g., DTIC or DTICDOME (Bayer Corp.), at a
dose ranging from approximately 15 to 250 mg/m.sup.2/cycle or
ranging from approximately 0.2 to 2 mg/kg/cycle.
[0215] In another embodiment, the additional cancer therapeutic
comprises topotecan, e.g., HYCAMTIN (SmithKline Beecham), at a dose
ranging from approximately 0.1 to 0.2, 0.3 to 0.4, 0.5 to 0.8, or
0.9 to 1.5 mg/m.sup.2/Cycle. In another embodiment, the additional
cancer therapeutic comprises irinotecan, e.g., CAMPTOSAR (Pharmacia
& Upjohn), at a dose ranging from approximately 5 to 9, 10 to
25, or 26 to 50 mg/m.sup.2/cycle.
[0216] In another embodiment, the additional cancer therapeutic
comprises fludarabine, e.g., FLUDARA (Berlex Laboratories), at a
dose ranging from approximately 2.5 to 5, 6 to 10, 11 to 15, or 16
to 25 mg/m.sup.2/cycle.
[0217] In another embodiment, the additional cancer therapeutic
comprises cytosine arabinoside (Ara-C) at a dose ranging from
approximately 200 to 2000 mg/m.sup.2/cycle, 300 to 1000
mg/m.sup.2/cycle, 400 to 800 mg/m.sup.2/cycle, or 500 to 700
mg/m.sup.2/cycle.
[0218] In another embodiment, the additional cancer therapeutic
comprises docetaxel, e.g., TAXOTERE (Rhone Poulenc Rorer) at a dose
ranging from approximately 6 to 10, 11 to 30, or 31 to 60
mg/m.sup.2/cycle.
[0219] In another embodiment, the additional cancer therapeutic
comprises paclitaxel, e.g., TAXOL (Bristol Myers Squibb), at a dose
ranging from approximately 10 to 20, 21 to 40, 41 to 70, or 71 to
135 mg/kg/cycle.
[0220] In another embodiment, the additional cancer therapeutic
comprises 5-fluorouracil at a dose ranging from approximately 0.5
to 5 mg/kg/cycle, 1 to 4 mg/kg/cycle, or 2-3 mg/kg/cycle.
[0221] In another embodiment, the additional cancer therapeutic
comprises doxorubicin, e.g., ADRIAMYCIN (Pharmacia & Upjohn),
DOXIL (Alza), RUBEX (Bristol Myers Squibb), at a dose ranging from
approximately 2 to 4, 5 to 8, 9 to 15, 16 to 30, or 31 to 60
mg/kg/cycle.
[0222] In another embodiment, the additional cancer therapeutic
comprises etoposide, e.g., VEPESID (Pharmacia & Upjohn), at a
dose ranging from approximately 3.5 to 7, 8 to 15, 16 to 25, or 26
to 50 mg/m.sup.2/cycle.
[0223] In another embodiment, the additional cancer therapeutic
comprises vinblastine, e.g., VELBAN (Eli Lilly), at a dose ranging
from approximately 0.3 to 0.5, 0.6 to 0.9, 1 to 2, or 3 to 3.6
mg/m.sup.2/cycle.
[0224] In another embodiment, the additional cancer therapeutic
comprises vincristine, e.g., ONCOVIN (Eli Lilly), at a dose ranging
from approximately 0.1, 0.2, 0.3, 0.4, 0.5, 0.6 or 0.7
mg/m.sup.2/cycle.
[0225] In another embodiment, the additional cancer therapeutic
comprises methotrexate at a dose ranging from approximately 0.2 to
0.9, 1 to 5, 6 to 10, or 11 to 20 mg/m.sup.2/cycle.
[0226] In another embodiment, an immunoconjugate is administered in
combination with at least one other immunotherapeutic which
includes, without limitation, rituxan, rituximab, campath-1,
gemtuzumab, and trastuzutmab.
[0227] In another embodiment, an immunoconjugate is administered in
combination with one or more anti-angiogenic agents which include,
without limitation, angiostatin, thalidomide, kringle 5,
endostatin, Serpin (Serine Protease Inhibitor), anti-thrombin, 29
kDa N-terminal and a 40 kDa C-terminal proteolytic fragments of
fibronectin, 16 kDa proteolytic fragment of prolactin, 7.8 kDa
proteolytic fragment of platelet factor-4, a 13 amino acid peptide
corresponding to a fragment of platelet factor-4 (Maione et al.,
1990, Cancer Res. 51:2077-2083), a 14-amino acid peptide
corresponding to a fragment of collagen I (Tolma et al., 1993, J.
Cell Biol. 122:497-51 1), a 19 amino acid peptide corresponding to
a fragment of Thrombospondin I (Tolsma et al., 1993, J. Cell Biol.
122:497-511), a 20-amino acid peptide corresponding to a fragment
of SPARC (Sage et al., 1995, J. Cell. Biochem. 57:1329-1334), and a
variant thereof, including a pharmaceutically acceptable salt
thereof.
[0228] In another embodiment, an immunoconjugate is administered in
combination with a regimen of radiation therapy. The therapy may
also comprise surgery and/or chemotherapy. For example, the
immunoconjugate may be administered in combination with radiation
therapy and cisplatin (Platinol), fluorouracil (5-FU, Adrucil),
carboplatin (Paraplatin), and/or paclitaxel (Taxol). Treatment with
the immunoconjugate may allow use of lower doses of radiation
and/or less frequent radiation treatments, which may for example,
reduce the incidence of severe sore throat that impedes swallowing
function potentially resulting in undesired weight loss or
dehydration.
[0229] In another embodiment, an immunoconjugate is administered in
combination with one or more cytokines which include, without
limitation, a lymphokine, tumor necrosis factors, tumor necrosis
factor-like cytokine, lymphotoxin, interferon, macrophage
inflammatory protein, granulocyte monocyte colony stimulating
factor, interleukin (including, without limitation, interleukin-1,
interleukin-2, interleukin-6, interleukin-12, interleukin-15,
interleukin-18), and a variant thereof, including a
pharmaceutically acceptable salt thereof.
[0230] In yet another embodiment, an immunoconjugate is
administered in combination with a cancer vaccine or biological
agents including, without limitation, autologous cells or tissues,
non-autologous cells or tissues, carcinoembryonic antigen,
alpha-fetoprotein, human chorionic gonadotropin, BCG live vaccine,
Mycobacterial cell wall-DNA complexes, melanocyte lineage proteins,
and mutated, tumor-specific antigens.
[0231] In yet another embodiment, an immunoconjugate is
administered in association with hormonal therapy. Hormonal
therapeutics include, without limitation, a hormonal agonist,
hormonal antagonist (e.g., flutamide, tamoxifen, leuprolide acetate
(LUPRON)), and steroid (e.g., dexamethasone, retinoid,
betamethasone, cortisol, cortisone, prednisone,
dehydrotestosterone, glucocorticoid, mineralocorticoid, estrogen,
testosterone, progestin).
[0232] In yet another embodiment, an immunoconjugate is
administered in association with a gene therapy program to treat or
prevent cancer.
[0233] Combination therapy may thus increase the sensitivity of the
cancer or tumor to the administered immunoconjugate and/or
additional cancer therapeutic. In this manner, shorter treatment
cycles may be possible thereby reducing toxic events. The cycle
duration may vary according to the specific cancer therapeutic in
use. The invention also contemplates continuous or discontinuous
administration, or daily doses divided into several partial
administrations. An appropriate cycle duration for a specific
cancer therapeutic will be appreciated by the skilled artisan, and
the invention contemplates the continued assessment of optimal
treatment schedules for each cancer therapeutic. Specific
guidelines for the skilled artisan are known in the art. See, e.g.,
Therasse et al., 2000, "New guidelines to evaluate the response to
treatment in solid tumors. European Organization for Research and
Treatment of Cancer, National Cancer Institute of the United
States, National Cancer Institute of Canada," J Natl Cancer Inst.
February 2; 92(3):205-16.
[0234] It is contemplated that the immunoconjugate may be
administered by any suitable method such as injection, oral
administration, inhalation, transdermal or intratumorally, whereas
any other cancer therapeutic may be delivered to the patient by the
same or by another mode of administration. Additionally, where
multiple cancer therapeutics are intended to be delivered to a
patient, the immunoconjugate and one or more of the other cancer
therapeutics may be delivered by one method, whereas other cancer
therapeutics may be delivered by another mode of
administration.
(F) Diagnostic Methods and Agents
[0235] The binding proteins of the invention bind selectively to
cancer cells or molecules internalized by cancer cells, and not
significantly to normal cells. Therefore the binding proteins can
be used in the diagnosis of cancer. As stated above, the inventors
have shown that the binding proteins of the invention binds to the
extracellular domain of CD44E. The inventors have also shown that
the binding proteins of the invention bind to AFP or a variant
thereof. AFP is associated with abnormal growth, cell
transformation and cancer. Thus, the specificity of the binding
proteins for tumor antigens makes it useful in the diagnosis of
cancer.
[0236] In a preferred embodiment, the binding proteins are
antibodies or antibody fragments of the invention. In addition,
cancer cells may be evaluated to determine their susceptibility to
the treatment methods of the invention by, for example, obtaining a
sample of the cancer cells and determining the ability of the
sample to bind to the binding proteins of the invention, preferably
antibodies or antibody fragments.
[0237] Accordingly, the present invention includes diagnostic
methods, agents, and kits that can be used by themselves or prior
to, during or subsequent to the therapeutic method of the invention
in order to determine whether or not cancer cells are present that
express the antigen and can bind to the binding proteins of the
invention, preferably antibodies and antibody fragments.
[0238] In one embodiment, the invention provides a method of
diagnosing cancer in a mammal comprising the steps of [0239] (1)
contacting a test sample taken from said mammal with the binding
proteins of the invention that binds to an antigen on or in the
cancer cell under conditions that permit the formation of a binding
protein-antigen complex; [0240] (2) measuring the amount of binding
protein-antigen complex in the test sample; and [0241] (3)
comparing the amount of binding protein-antigen complex in the test
sample to a control.
[0242] In one embodiment, the antigen is CD44E; a protein having a
molecular weight between 47-53 kDa and an isoelectric point between
5.2-5.5, preferably 5.4; or a protein comprising the 5-v8 interface
of CD44E, v8 exon of CD44 or the amino acid sequence ATNMDSSHSIT.
In another embodiment, the antigen is alpha-fetoprotein or a
variant thereof; a protein having a molecular weight between 48-54
kDa and an isoelectric point between 5.1-5.4, preferably 5.2; or a
protein comprising amino acid SEQ ID NOS: 14, 15 or 16. In another
example, the antigen is a protein comprising amino acid SEQ ID NOS:
38, 39, 40, 41, 42, 43, 44 or 45 and has a molecular weight between
47-53 kDa and an isoelectric point between 5.2-5.5; or a protein
comprising amino acid SEQ ID NOS: 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71, 72, 73, 74 or 75 and has a molecular weight between 48-54 kDa
and an isoelectric point between 5.1-5.4.
[0243] Another embodiment of the invention is a method of
diagnosing cancer in a mammal comprising the steps: [0244] (1)
contacting a test sample from said mammal with an antibody that
binds to alpha-fetoprotein or a variant thereof under conditions
that permit the formation of an antibody-alpha-fetoprotein complex
and an antibody that binds to CD44E under conditions that permit
the formation of an antibody-CD44E complex; [0245] (2) measuring
the amount of antibody-alpha-fetoprotein complex and antibody-CD44E
complex in the test sample; and [0246] (3) comparing the amount of
antibody-alpha-fetoprotein complex and antibody-CD44E complex in
the test sample to a control.
[0247] The invention further includes a kit for diagnosing cancer
comprising any one of the binding proteins of the invention and
instructions for the use thereof to diagnose the cancer. The
invention also includes a kit for diagnosing cancer comprising an
antibody that binds to alpha-fetoprotein and an antibody that binds
to CD44E and instructions for the use thereof to diagnose
cancer.
[0248] For use in the diagnostic applications, the binding proteins
of the invention, preferably antibodies or antibody fragments, may
be labeled with a detectable marker such as a radio-opaque or
radioisotope, such as .sup.3H, .sup.14C, .sup.32P, .sup.35S,
.sup.123I, .sup.125I, .sup.131I; a fluorescent (fluorophore) or
chemiluminescent (chromophore) compound, such as fluorescein
isothiocyanate, rhodamine or luciferin; an enzyme, such as alkaline
phosphatase, beta-galactosidase or horseradish peroxidase; an
imaging agent; or a metal ion. As described above, methods of
attaching a label to a binding protein, such as an antibody or
antibody fragment, are known in the art.
[0249] Another aspect of the invention is a method of diagnosing
cancer in a mammal comprising the steps of
[0250] (1) measuring the amount of antibodies of the invention in a
test sample taken from said mammal; and
[0251] (2) comparing the amount of antibodies of the invention in
the test sample to a control.
[0252] In one embodiment, the amount of antibodies of the invention
is measured by measuring the amount of antibodies of the invention
in the test sample, for example by ELISA. In another embodiment,
the amount of antibodies of the invention is measured by measuring
the expression levels of nucleic acids encoding the antibodies of
the invention in the test sample, for example by RT-PCR.
(G) Antigens
[0253] As mentioned above, the inventors have identified the
antigen of the binding proteins of the invention. Accordingly, the
invention includes an isolated protein that can specifically bind
with one of the binding proteins of the invention, and nucleic acid
sequences and uses thereof.
[0254] In one example, the isolated protein has a molecular weight
between 47-53 kDa and an isoelectric point between 5.2-5.5,
preferably 5.4; a protein having a molecular weight between 48-54
kDa and an isoelectric point between 5.1-5.4, preferably 5.2; or a
protein comprising the amino acid sequence 107 to 487 of AFP (SEQ
ID NO:14), 107 to 590 of AFP (SEQ ID NO: 15) or 107 to 609 of AFP
(SEQ ID NO:16). In another example, the isolated protein comprises
amino acid SEQ ID NOS: 38, 39, 40, 41, 42, 43, 44 or 45 and has a
molecular weight between 47-53 kDa and an isoelectric point between
5.2-5.5; or comprises SEQ ID NOS: 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70,
71, 72, 73, 74 or 75 and has a molecular weight between 48-54 kDa
and an isoelectric point between 5.1-5.4, preferably 5.2.
(H) Other Uses of the Binding Proteins of the Invention
[0255] Antibodies to CD44 have been shown to block the PMA-induced
binding of CD44H (the standard form, also called CD44s) and CD44E
to hyaluronic acid (HA) (Liao et al. J Immunol 151(11):6490-99,
1993). Clustering of CD44 variants, particularly those that contain
variant exon 9 appears to be important for binding to HA and can be
induced by PMA. Down stream intracellular signaling is related to
this clustering and interfering with it can affect cell function
(Suzuki et al., JBC 277(10):8022-32, 2002). It is possible that the
blocking effect of antibodies on HA binding is mediated by
interference with clustering. Regardless of the mechanism, the
binding proteins of the invention could be used to modulate the
binding of CD44 to the extracellular molecules and the downstream
cell signaling resulting from clustering, or the binding to HA
or/or other extracellular molecules.
[0256] Accordingly, the invention includes the use of the binding
proteins of the invention to modulate the activity of CD44E. For
example, the binding proteins of the invention can be used to
interfere with the binding of CD44E to HA. The binding proteins of
the invention may also be used to enhance CD44E activity.
[0257] The following non-limiting examples are illustrative of the
present invention:
EXAMPLES
Example 1
Generation of VB1-008 Monoclonal Antibody
[0258] The VB1-008 monoclonal antibody was generated from the
peripheral blood lymphocytes of a breast cancer patient. TM-SH-P2
was used as the fusion partner to generate the monoclonal antibody.
VB1-008 is an IgG1, lambda monoclonal antibody.
[0259] Messenger RNA (mRNA) was isolated from hybridoma cells and
first strand complement DNA (cDNA) was synthesized. The cDNA was
then used to isolate antibody H and L chain genes by PCR. PCR
primers were designed (see note) according to the consensus
framework regions of the H (Gamma) and L (Lambda) chain isotypes.
The PCR products were individually cloned into the TOPO-pCR 2.1
vector and transformed into E. coli cells. Individual clones
containing the inserts in TOPO-pCR 2.1 were isolated and grown.
Plasmid DNA was purified and sequenced.
TABLE-US-00002 Gamma Primers: 1) (SEQ ID NO: 18) 5' TCT AAA GAA GCC
CCT GGG AGC ACA GCT CAT CAC CAT G 3' 2) (SEQ ID NO: 19) 5' GCC CGG
GGA GCG GGG GCT TGC CGG CCG TCG CAC TCA 3' 3) (SEQ ID NO: 20) 5:
ACC ATG AGT GAG AAA AAC TGG ATT TGT GTG GCA 3' 4) (SEQ ID NO: 21)
5' GGA GCC GGT GAC CAG GGT TCC CTG GCC CCA 3' 5) (SEQ ID NO: 22) 5'
CTC ACC ATG GAG TTT GGG CTG AGC TGG GTT 3' 6) (SEQ ID NO: 23) 5'
GGA GGC TGA GGA GAC GGT GAC CAG GGT TCC CTG GCC 3' Lambda Primers:
7) (SEQ ID NO: 24) 5' GGC TCG AGA TGR CCT GSW CYC CTC TCY TYC TSW
YC 3' 8) (SEQ ID NO: 25) 5' CCC GTC GAC GAA GCT CCT TCA GAG GAG GG
3' *
[0260] Note: In order to isolate as many varieties as possible
using a single primer, mixed bases are used for certain consensus
primers: R=A+G, D=A+T+G, Y=C+T, H=A+C+T, V=A+C+G, K=T+G, S=C+G,
W=A+T.
[0261] Each PCR reaction comprised the following components in a 50
.mu.L reaction volume.
[0262] 10.times.PCR buffer 5 .mu.L
[0263] 2 mM dNTPs 5 .mu.L
[0264] 50 mM MgCl2 2 .mu.L
[0265] 5' Primer 20 pmoL
[0266] 3' Primer 20 pmoL
[0267] Taq DNA Polymerase 2.5 U
[0268] DNA template 50 ng
[0269] The PCR cycling conditions were: 94.degree. C. for 1 min.,
62.degree. C. for 1 min., 72.degree. C. for 1.5 min. for 30 cycles
and a final extension for 10 min. at 72.degree. C. Amplified PCR
products were electrophoretically separated on a 1% agarose gel,
excised, purified using a Qiaquick gel extraction kit, cloned into
the TOPO pCR 2.1 cloning vector and then DNA sequenced using the
373 DNA sequencer stretch (Griffin G. H. and Griffin M. A.: PCR
technology, Current innovations. CRC Press, Boca. Raton.
Fla.3431.USA; Cloning vector pCR 2.1, Catalogue #205184.
Invitrogen, Carlsbad, Calif.; Qiagen, Qiaquick gel extraction kit,
Catalogue #28706. Qiagen Inc., Mississauga, ON; and 373 DNA
Stretch. PE Applied Biosystems, Mississauga ON.).
[0270] The CDR sequences for VB1-008 are shown in Table 1.
[0271] The light chain variable region and the heavy chain variable
region are shown in FIGS. 1 and 2, respectively.
Example 2
Antibody Profiling by Measuring Tumor Cell Reactivity
[0272] VB1-008 was tested by flow cytometry for tumor cell
reactivity against two panels of cell lines. The first panel
comprises fifteen different types of epithelial cancers while a
second panel consists of five types of normal cells. The VB1-008
results are summarized in Table 2. VB1-008 had an MF>2.0 for all
cancer types tested. MF values indicate the mean calculated from
the sum of the mean fold increase in median fluorescence over the
control antibody from all cell lines in each indication. The
strongest indications were, but not limited to, breast, lung,
melanoma and prostate. In comparison, VB1-008 was more reactive
with most of the tumor cell lines than with the normal cell lines.
The two exceptions were the kidney and lung cell lines; however,
they were still lower than the corresponding tumor cell type. See
Table 2. The fold-increase in VB1-008 reactivity of tumor: normal
varied from .about.2 to 7.
Example 3
Normal Tissue Microarray
[0273] VB1-008 was tested against the flow positive tumor cell line
SKBR-3 to assess the appropriate tissue format to demonstrate
membrane staining and to define the optimal conditions for
staining. This antibody demonstrated cytoplasmic and cell membrane
staining in all the experimental groups, including fixed embedded
cells. In fixed cell pellets incubated overnight with VB1-008, 80%
of the cells showed cytoplasmic staining, and 10% of them showed
cell membrane staining. Representative pictures of cell membrane
staining of formalin-fixed cell pellet cores are shown in FIG.
3.
[0274] Once the optimal staining conditions were identified, the
antibody was tested in comparison with an isotype control (4B5) on
a low density (LD) array of critical normal for normal tissue
reactivity. The results for VB1-008 are summarized in Table 3. No
significant membrane staining of any of the normal critical tissues
was observed. High density (HD) array staining of non-critical
normal tissue showed that cell surface staining was limited to
epithelial cells associated with reproduction-related tissues
(testis and fallopian tubes, FIG. 4, Table 4). Otherwise, no
significant staining was observed of any of the tissues was
observed.
Example 4
Tumor Tissue Microarray
[0275] VB1-008 was tested in a HD formalin-fixed tumor TMA for
tumor tissue reactivity. See Table 5. VB1-008 exhibited moderate
cell surface reactivity against a wide variety of indications
including, bladder, breast, colon, kidney, liver, ovary, prostate,
rectum, stomach and uterus. VB1-008 cell surface binding was lesser
represented and at a lower reactivity with cancers of the cervix,
lung, pancreas, and skin. Representative pictures illustrating the
cell surface reactivity VB1-008 but not the isotype-matched control
antibody to some of the cancers are shown in FIGS. 5-7.
Example 5
Assessment of VB1-008 Binding and Internalization by Flow Cytometry
and Confocal Microscopy
[0276] VB1-008 and two control antibodies (5E9 and MA-103) that
demonstrate strong reactivity against the tumor cell line A-375
were used to assess VB1-008 for internalization. A representative
experiment is shown in Table 6. VB1-008 binding results at
different temperatures were not different from the internalizing
antibody 5E9. After 60 min at 37.degree. C., the membrane-bound
VB1-008 disappeared from the cell surface, with a 57.5% reduction
in median fluorescence. Increasing the incubation time at
37.degree. C. was associated with a further decline in median
fluorescence. By 120 min, the median fluorescence had decreased by
62.2%. Flow histograms demonstrating cell-surface binding are
illustrated in FIG. 8. To confirm if the cell-surface bound VB1-008
internalized into A-375 cells or instead was shed from the plasma
membrane, antibody-treated cells were further evaluated by direct
visualization of fluorescence distribution and intracellular
staining with the aid of laser scanning confocal microscopy. Like
MA-103 and 5E9, incubation of A-375 cells with VB1-008 at 4.degree.
C. for 60 min demonstrated a circumferential surface distribution
of fluorescence label (FIG. 9A). Warming the VB1-008 antibody bound
cells to 37.degree. C. revealed a punctuated pattern of
intracellular staining by the internalized antibody within 60
minutes, as shown in FIG. 9B.
Example 6
Binding Affinity
[0277] Flow cytometry was used to assess functional affinity
[Benedict, C. A., NacKrell, A. J. and Anderson, W. F. (1997) J.
Immunol. Methods, 201:223-231]. A range of antibody concentrations
were tested against a fixed number of tumor cells (A-375) for
2-hours to construct a saturation curve. Values and graphical
analysis were generated using Sigma Plot (Jandel Scientific, San
Rafael, Calif.). The inverse of the determined median fluorescence
was plotted as a function of the inverse of antibody concentration
to determine KD by the Lineweaver-Burk method. A straight line was
generated and the KD was calculated from the slope of the curve.
The dissociation constant KD values were determined by the
following equation: 1/F=1/Fmax+(KD/Fmax)(1/IgG or IgM or scFv),
where F=background subtracted median fluorescence and Fmax was
calculated from the plot. The dissociation constant for VB1-008 was
shown to be 5.88.times.10.sup.-8M.
Example 7
VB1-008 Antigen Identification
Cells
[0278] Breast cancer cell lines, MDA-MB 435S, MDA-MB-231; MCF-7;
melanoma cell line, A-375; pancreatic tumor cell line, PANC-1 and
T-cell lines, Daudi and Ramos were used in the study (Table 7).
These cell lines were selected based on the results of tumor cell
line profiling by flow cytometry.
Growth and Maintenance of Tumor cell lines
[0279] The cell lines in the study were purchased from ATCC and
cultured in accordance with the guidelines and recommendations of
ATCC. Cells were harvested at 90% confluence with viability
>90%.
Preliminary Characterization of the Antigen Binding to VB1-008
[0280] Preliminary characterization data was obtained from
experiments designed to assess the feasibility of the gel-based
approach by dot blot assays; and from experiments performed to
determine the nature of the epitope associated with the
antigens.
[0281] The data from these experiments classified the VB1-008
antigen as a "blottable" antigen with a peptide epitope, i.e., the
epitope involved in binding to VB1-008 on the antigen was neither
glycosylated nor lipid associated. It should be noted that the
antigen could be glycosylated at sites other than the binding
site.
VB1-008 Ag enrichment and Purification
Immunoprecipitation
[0282] A minimum of 500 .mu.g membrane protein was used for
immuno-affinity purification. A pre-clearing step using protein-G
sepharose alone was the first step in the purification of the
antigen prior to the addition of the antibody. In certain cases,
pre-clearing was performed twice to add more stringency to the
assay. A total of 15-20 .mu.g of antibody was used as the
precipitating agent in the mixture. The antigen-antibody mixtures
were nutated overnight at 4.degree. C. using buffer conditions that
mimicked physiologic conditions. Care was taken to ensure that
protease inhibitors were used in every step of the antigen
isolation process.
[0283] Immune complexes were centrifuged, washed with RIP-A lysis
buffer and eluted with 0.2 M glycine pH 2.5. Supernatants
representing the unbound fractions were stored to test the proteins
that were not isolated by affinity purification.
Immunoprecipitations were carried out on two very positive cell
lines, i.e., A-375 and MDA-MB-435S, one moderately positive cell
line, MDA-MB-231; one weakly positive cell line, i.e., MCF-7; and
three negative cell lines, i.e., Panc-1; Daudi and Ramos, with
VB1-008 and equal amounts of 4B5 (isotype-matched control)
processed in parallel at all times.
Gel-Based Analysis and Western Blotting
1D-PAGE
[0284] The purified proteins were subjected to reducing and
non-reducing conditions of sample preparation and were subsequently
analyzed by SDS-PAGE/Western Blotting. When reducing conditions
were used, the isolated antigens were treated with sample buffer
containing 1% .beta.-mercaptoethanol at 65.degree. C. for 15
minutes and when non-reducing conditions were used, the antigens
were mixed with sample buffer devoid of any reducing agent. The
resulting blots were probed with the required antibodies and
corresponding secondary antibodies conjugated to HRP, to visualize
the immuno-purified proteins by chemiluminescence.
2D-PAGE
[0285] The immunoprecipitated proteins were separated by
two-dimensional gel electrophoresis to resolve any protein stacking
effect that may have occurred in the 1D-PAGE analysis. The 2D-gel
electrophoresis resolved proteins according to their isoelectric
points (Pi) in the first dimension and on the basis of their
molecular weights in the second dimension. The proteins thus
resolved were transferred to nitrocellulose membranes, overnight,
and processed as in the case of 1D-PAGE. Western blots were probed
with VB1-008, anti-CD44 and anti-AFP as required and reacting
proteins visualized by chemiluminescence.
Peptide Extraction and Antigen ID
[0286] The proteins were excised from 1D-gel and 2D-gels and
analyzed. Raw data was obtained predicting the probable proteins
based on the number of peptides received. The LC-MS/MS runs were
carried out on `QSTAR- and LCQ-dodeca LC-MS/MS from Thermo
Finnigan. De-novo sequencing of the identified proteins was also
performed at the same facility.
Example 7(a)
1D-PAGE/Western Analysis
[0287] Only one specific band was detected after separation on a
1D-PAGE at .about.110 kDa under non-reducing conditions (FIG. 10A)
in antigen-positive cell lines (A-375, MDA-MB-435S,). The same band
was weakly detected in the weakly positive cell lines (MCF-7) and
absent in the antigen-negative cell line (Daudi). When samples were
separated on SDS-PAGE under reducing conditions of sample
preparation, a predominant band at .about.50 kDa and a faint 110
kDa band were observed expressed strongly in antigen-positive cell
lines, MDA-MB-435S, A-375, MDA-MB-231, weakly expressed in MCF-7,
and absent in antigen-negative cell lines, such as Daudi and Panc-1
(FIG. 10B, FIG. 10C); Ramos was an exception to the above
observations (FIGS. 11B and 10C). None of the cell lines showed
positive immunoprecipitation with 4B5. The Western data is
summarized in Table 8.
[0288] To determine the specificity of binding of the antigens
detected by IP and Western blotting, four cell lines were
pre-cleared twice and the resulting solutions immunoprecipitated
with VB1-008. As can be seen in FIG. 10B, no band was detected in
MCF-7, but the rest of the cell lines, showed the same 2 specific
bands at .about.50 kDa and .about.110 kDa (faint). Apart from
these, as seen in FIG. 10A as well, immunoprecipitation with 4B5
did not yield any detectable reactive proteins with VB1-008,
indicating specificity in the purification technique employed. The
binding profiles of VB1-008 to these seven cell lines, measured by
flow cytometry, were comparable to the results observed in the
immunopurification experiments (Table 8).
Example 7(b)
2D-PAGE Analysis
[0289] In order to determine isoelectric points (Pi) and assess the
possibility of protein stacking in the 1D-PAGE analysis, the
purified antigens for VB1-008 were separated on two-dimensional
polyacrylamide gel electrophoresis (2D-PAGE), where the separation
in the first dimension was on the basis of Pi and the second
dimension on the basis of molecular weight. The gels were then
transferred to nitrocellulose membranes and subjected to standard
Western blotting processing. Since the amounts required for the
detection of proteins on a 2D gel is .about.4 times higher than the
requirement for a 1D gel, purified antigens from 4 separate
immunoprecipitation reactions were pooled together for one 2D-PAGE
analysis. Two separate gels were processed simultaneously for
Western blot analysis to ensure that the proteins detected on the
Coomassie stained gels were the same as those observed in the
Western blots. The 2D Western blots were probed with VB1-008 and
detected by ECL (chemiluniscence). As can be seen in FIG. 11A, two
spots were detected at .about.49 kDa/Pi=5.2-5.6.
[0290] FIG. 11B represents the coomassie stained profile of the
immunoprecipitates from MDA-MB-435S separated by two-dimensional
gel electrophoresis. The two spots that were observed, labeled as
spots "C" and "D" were excised for MS analysis. The details of the
proteins identified are given in the Tables 9A and 9B,
respectively.
Peptide Extraction and Protein Analysis
[0291] A-375 and MDA-MB-435S membranes were used to immunopurify
antigen(s) that bind specifically to VB1-008. Under reducing
conditions of gel separation, .about.50 kDa band was observed in
both the cell lines and under non-reducing conditions, .about.110
kDa band was observed, referred to as "E" from MDA-MB-435S cells.
These protein bands were excised from the coomassie stained gels
for MS analysis.
[0292] Proteins from 1D-gel band and 2D-spots were digested with
trypsin to release them from the gel and analyzed on a
reverse-phase LC-MS/MS system. The identities of the proteins were
revealed by database analysis using bioinformatic tools. Raw data
included peptides obtained, and a list of suggested proteins
including contaminants such as keratin. To obtain the analysis
MS/MS spectra were submitted directly to Mascot search engines
available at www.Matrixscience.com.
Analysis of Peptide Masses and their Identities
[0293] The connection between the isoelectric point (Pi) and the
molecular weight of the putative protein candidate is a critical
parameter for protein ID. Care was taken during analysis to ensure
that the identified peptide masses and their Pi were within .+-.3
kDa range and .+-.0.2 Pi respectively. This is because of the
inherent possibility of peptides to exist in different modified
states, resulting in their deviation from the theoretically
calculated masses and Pi. Any acceptable deviation should not be
more than the values specified earlier. In cases, where the number
of peptides was very low, an additional MS step was required to
obtain more information by a process known as "de-novo sequencing".
De-novo sequencing is a process where a second MS step fragments
each of the peptides obtained in the first MS run into peptide
fragment ions (y and b ions), each representing an ionized form of
an amino acid. The sequence of each peptide can then be deduced
from the resulting mass spectrum.
[0294] Peptides have a general tendency to undergo modifications
such as oxidation of methionines; esterification of acidic "R"
groups, acetamide formations of amine groups and hydroxylations of
proline, hydroxyproline and glycine residues during MS/MS
fragmentations. When these modifications occur, the peptide masses,
although identical are perceived as different peptides, resulting
in a false increase in scoring pattern of the protein ID, which is
otherwise a cumulative unit of all the individual peptides
identified. If the peptides are not analyzed properly, spurious
scores may arise leading to incorrect protein identification.
Therefore, it was critical to assess and select "unique" peptides
that were not repetitive or represented elsewhere and award scores
correctly on the basis of these unique peptides. In addition,
several other parameters such as the SE window, the number of
missed cleavages, metastable fragmentation, single amino acid
modifications, etc., were taken into account before the final
analysis was performed in-house. As a consequence of these
stringent steps, a large number of peptides were drastically
reduced to a fewer number. The database searches using these edited
lists pulled down mapped proteins. Since the procedure employed
here is immunopurification, the presence of remnant antibody also
was considered as a contaminant along with well-known contaminants
such as actin, vimentin, keratin, cytokeratin and tubulin. The
resulting 3-4 final proteins were legitimate IDs, selected or
eliminated based on the Pi and molecular weights of the proteins
deduced by 2D-PAGE.
Analysis of 2D Spot "C"
[0295] Spot "C" excised from the 2D-gel identified only
alpha-fetoprotein (AFP), while the other two proteins listed were
protease inhibitors added for the integrity of the protein during
the study. The Pi also matches the possibility of the molecule
being AFP. The MS analysis revealed 65 peptides, but only 30 unique
peptides were retrieved which constituted 54% sequence coverage for
human AFP with each peptide showing 100% homology to the original
protein. However, the AFP molecule lacked the first 160 aa from the
N-terminus. Sequence analysis of the human AFP molecule showed
clear presence of lysine and arginine residues in these first 106
aa, which could be cleaved as peptides, should they be present in
the molecule. De-novo sequencing information of the 2D spot "C",
showed a lack of 160 aa from the N-terminus, which has been a
recurrent phenomenon when the identity of AFP was established (FIG.
12A). The combined results of De-novo sequencing from the 1D gel
and the 2D gel is shown in FIG. 12B. The results show a lack of 106
aa from the N-terminus. Table 11A lists the peptides
identified.
Analysis of 2D-Spot"D"
[0296] Spot "D" from the 2D-gel revealed the identities of 3
proteins in addition to co-purifying contaminants, actin and
actin-binding protein actinin. However, except for CD44, the Pi of
the other two proteins were distinctly different from the one
observed for the 2D spot, therefore they were excluded as protein
IDs. The molecular weight of the CD44 isoform 3 was determined to
be 53.585.+-.3 kDa making it a complete match for the molecular
weight and Pi observed on 2D-PAGE analysis for the spot "D".
Analysis of the 110 kDa Antigen Band
[0297] As mentioned earlier, under reducing conditions the
.about.110 kDa band was visualized by both Coomassie and Western
blot analysis. From the 2D-PAGE analysis, it was clear that there
were two components each around .about.50 kDa, individually
identified as CD44 and AFP, contributing together to form a 110 kDa
band when the conformation was preserved under non-reducing
conditions of gel separation. Thus for confirmation, the 110 kDa
band was excised and analyzed to identify the protein components.
The .about.110 kDa band seen in FIG. 13A, was excised (E) for MS
analysis. The details of the proteins identified from the 100 kDa
band are given in Table 10.
MS Analysis of Protein Band "E"
[0298] The results of the MS analysis for protein band "E" are
given in Table 10. Apart from the co-purifying contaminants, i.e.,
actin, actinin and vimentin, three protein identities were
obtained. Among them were CD44, AFP and heat shock protein 90. Heat
shock protein 90 was not a match for the molecular weight
identified, and was therefore excluded as a potential candidate.
Since CD44 is membrane-associated, it is likely the cognate
antigen. It has also been demonstrated that AFP co-purifies with
CD44 (FIG. 15A), however, AFP was not detected on the membrane
surface.
[0299] Using top-down proteomics approach, it was clear that the
molecular weight of the isolated antigen (50 kDa) corresponded to
the predicted molecular weight of CD44E. Flow experiments and the
binding rank order to the given cell lines also validate this
finding. Data in Tables 11B and 12 describe the details associated
with the mapping of the peptides identified by MS/MS analysis.
Specifically, a set of 8 peptides were isolated that mapped to 3
different regions on the CD44 molecule. Particularly, one peptide
mapped to v8-v9 region which is unique to CD44E in addition to
being present in the parent molecule.
[0300] FIG. 14 represents the sequence coverage obtained from
mapping the peptides obtained in the protein database. A set of 8
peptides were obtained in all mapping the extracellular region, one
in the variable region and 4 in the cytoplasmic region of the CD44
molecule. The homology searches and mapping of peptides to CD44
variants indicate that CD44R1 and CD44 R2 also express v8-v10 exons
in the variable region. However, they lack a major portion of the
cytoplasmic tail from the exon 19. Therefore show homology only to
4 peptides out of 8 identified from our analysis, hence do not fit
into the criterion of Molecular weight/Pi observed from the antigen
purified by immunoprecipitation. The predicted molecular weight of
53.8 kDa for CD44E and the observed molecular weight and Pi proved
to be an exact match. Therefore, the CD44 isoform that is the
possible antigen for VB1-008 is CD44E or the epithelial form, also
referred to as lsoform-3.
Example 7(c)
Validation of VB1-008 Antigen
(1) Cell Surface Reactivity of Anti-CD44 and Anti-AFP by Flow
Cytometry
[0301] The possibility of CD44 being the cognate antigen for
VB1-008 has been clearly established through immunopurification,
gel-based analysis and MS analysis. Membrane preparations have been
used in all the studies performed with VB1-008 based on the
preliminary characterization experiments that clearly suggested the
membrane localization of the antigen binding to VB1-008. To
determine the orientation of the two components of the antigen on
the cell surface, reactivity was measured by flow cytometry on a
panel of cell lines, with VB1-008, anti-CD44, anti-AFP and
anti-EGFR. Appropriate isotype-matched controls were also used in
the study.
[0302] A panel of cell lines expressing different levels of VB1-008
Ag was selected for comparative cell surface reactivity
experiments. Approximately, 300,000 cells from each cell line were
used and the fold-increase in median fluorescence of
VB1-008/anti-CD44/anti-AFP was measured and compared to the
respective isotype-matched controls. The antigen intensity column
was a compilation of the signal intensity observed on WB analysis
for each cell line, probed with the corresponding antibodies. The
isotype-matched control for VB1-008 was 4B5-IgG and the control for
anti-CD44, anti-AFP and anti-EGFR were mouse IgG, since the latter
three antibodies were mouse monoclonal antibodies.
[0303] As seen in Table 13, the rank order of the binding of
anti-CD44 was similar to VB1-008. Anti-AFP did not show any
detectable binding over the isotype-matched control. Since
anti-CD44 and anti-AFP were mouse monoclonal antibodies, anti-EGFR,
a mouse monoclonal antibody was used as a positive control. Not
only was the rank order of binding comparable, anti-CD44 showed an
enormous increase of over 48-fold compared to the binding of
VB1-008, suggesting the presence of a cognate antigen-antibody
interaction. The antigen intensity as observed from Western
blotting profiles also was comparable to the profile obtained by
flow.
(2) 1D-PAGE/Western Blotting Analysis of Recombinant AFP
[0304] AFP is a serum glycoprotein that is available commercially
as a 67 kDa recombinant molecule. This molecule was purchased from
RDI laboratories and 0.3 .mu.g of the pure protein, AFP and 0.3
.mu.g of BSA were electrophoresed on SDS-PAGE, transferred to
nitrocellulose membrane and probed with VB1-008. As can be seen
from FIG. 15A, positive reactivity was observed indicating the
presence of an epitope on AFP that is recognized by VB1-008. Since
AFP was one of the two identified protein molecules purified by
immunoprecipitation with VB1-008 and identified by MS analysis, the
current western blotting experiment proves the presence of AFP in
the immunopurified sample by VB1-008.
(3) Western Blot Analysis of VB1-008 Ag and Reactivity with
Anti-AFP and Anti-CD44
[0305] 2D-PAGE separation of the eluates from the VB1-008
immunoprecipitation reaction of MDA-MB-435S membranes revealed the
presence of two distinct spots, "C" and "D", in the Pi range of
5.1-5.4 and molecular weight 51.+-.3 kDa, and Pi range 5.2-5.5 and
50.+-.3 kDa respectively. The two spots were visualized when probed
with VB1-008 as well. LC-MS/MS analysis of these two spots revealed
the identities of AFP and CD44, whose presence was confirmed even
in the 110 kDa band seen under non-reducing conditions. Therefore,
as a next step, the same conditions of immunopurification were
repeated, resolved on 2D-PAGE, transferred to nitrocellulose
membranes and the Western blots were probed with anti-AFP and
anti-CD44. The results are shown in FIG. 15B and FIG. 15C.
[0306] Each of the commercially available antibodies, anti-AFP and
anti-CD44 reacted specifically with the cognate spots identified by
MS analysis from FIGS. 11A and 11B as spots "C" and "D"
respectively. In FIGS. 15B and C, two spots around the same Pi,
differing by 2-3 kDa were seen interacting to anti-CD44, possibly
due to some random loss of a few amino acids as a processing
by-product or due to the sensitivity of anti-CD44 to recognize the
presence of surrounding CD44 epitopes. The point that needs to be
emphasized is that the two spots that reacted with VB1-008,
identified to be AFP and CD44 have been visualized with the
respective antibodies at the appropriate positions of mass and
Pi.
(4) Cross-Reactivity of AFP to CD44
[0307] In order to understand the relationship of AFP to CD44, an
experiment was designed to immunoprecipitate all CD44 isoforms,
using anti-CD44. These proteins selectively purified were subjected
to SDS-PAGE and WB. Three sets of identical experiments were
carried out simultaneously. Western blots were probed with
anti-CD44.
[0308] As can be seen in FIG. 16, AFP very strongly reacts with
CD44 between 115-200 kDa range when experimented under non-reducing
conditions. VB1-008 reacts with CD44 as expected and is seen as a
clean single band at .about.110 kDa range as has been seen in
previous cases. Therefore it is possible that AFP is yet another
co-purifying protein that possesses an inherent capacity to
interact with CD44. As a result of being bound to CD44, it gets
pulled down when immunopurified with VB1-008.
DISCUSSION
[0309] Immunopurification experiments with VB1-008 showed a single
specific band at .about.110 kDa under non-reducing conditions and a
single 50+3 kDa band under reducing conditions of 1D-PAGE. In order
to resolve protein stacking possibilities and to determine the
isoelectric point of the protein, 2D-PAGE analysis was performed.
Results from 2D-PAGE analysis showed the presence of two spots at
Pi=5.1-5.4 and 5.2-5.5 with molecular weights of 51.+-.3 kDa and
50.+-.3 kDa, respectively. MS/MS analysis of the 2D spots recovered
32 and 8 peptides, spanning 54% and 28% of each protein identified,
respectively. The two putative antigens identified were CD44
isoform 3 and low molecular weight form of alpha-fetoprotein.
[0310] Validation experiments were performed to confirm the
presence of the suggested antigens. SDS-PAGE/Western blot analysis
of recombinant AFP molecule probed with VB1-008 showed positive
reactivity in the 67 kDa range as one strong single band, thus
confirming the presence of AFP. To confirm the presence of CD44,
the same panel of cells was tested using anti-CD44 by flow
cytometry. CD44 showed a dramatic increase in binding compared to
VB1-008, also preserving the same rank order. AFP failed to bind to
any of the cell lines tested. These results suggest that CD44 is
the cell surface antigen that is recognized by VB1-008. Also,
immunopurification and subsequent MS/MS analysis clearly implicate
the involvement of AFP.
CD44E as the VB1-008 Ag
[0311] Protein identification was done with m/z measurements of
tryptic peptides from VB1-008 Ag purified by immunoprecipitation.
Thorough searches of the protein databases led to one perfect hit
corresponding to a set of 8 peptides identified from the
immunopurified VB1-008 Ag, pointing to CD44 isoform 3 also known as
CD44E or the epithelial form. The molecular weight of the purified
antigen, rules out the possibility of both isoforms (1 and 2) as
the antigen recognized by VB1-008 on the cells lines. Other
isoforms such as isoform 2 which encodes all the exons except v1 or
CD44v3, 8-10 could also be expected to react with VB1-008 but their
molecular weight and/or pI are not consistent with those observed
for the VB1-008 cell surface antigen.
[0312] We show evidence for the occurrence of the predicted
molecular weight of the CD44E or isoform 3 as 50.+-.3 kDa on both
2D-PAGE, probed with anti-CD44 and on 1D-PAGE under reducing
conditions of sample preparation, which under non-reducing
conditions was observed as 110.+-.10 kDa on 1D-PAGE and Western
blot analysis. LC-MS/MS analysis of the proteins confirms the
presence of CD44E.
Example 8
Epitope Mapping--Binding Experiments
[0313] As described above, immunoprecipitation and MS analysis have
identified CD44E (isoform 3) as the VB1-008 antigen. CD44E differs
from other splice variants in having exons v8-v10 in between the
conserved sequences, exons 1-5 and 16-20. Peptides were then
synthesized from the unique region of CD44E (i.e., the amino acid
sequence that spans the exon 5-v8 junction) in order to identify
the reactive epitope of VB1-008. A peptide of the same length taken
from the C-terminal region of CD44E was used the negative
control.
Methods and Reagents
[0314] Peptides from the Unique Region of CD44E:
[0315] Synthetic peptides spanning the exon 5-V8 junction of CD44E
were ordered from Global peptide services, LLC. The amino acid
sequence (17 aa) from CD44E spans a length of 6 amino acids from
exon 5 and 11 amino acids from the unique peptide of the v8 region.
The highlighted portion of FIG. 18A represents the stretch of 17
amino acids which has been split into 3 peptides, and the negative
control peptide sequence is as highlighted in the C-terminal region
of the protein.
[0316] The amino acid sequence of each peptide is as follows:
[0317] Peptide 1: Biotin-STDRIPATNMD--1445.2 amu (SEQ ID NO: 26)
[0318] Peptide 2: Biotin-RIPATNMDSSH--1453.27 amu (SEQ ID NO: 27)
[0319] Peptide 3: Biotin-ATNMDSSHSIT--1387.58 amu (SEQ ID NO: 28)
[0320] Negative: Biotin-AVEDRKPSGLN--1410.19 amu (SEQ ID NO:
29)
Solubilizing Peptides:
[0321] All peptides were solubilized in PBS. The pH of the solution
was adjusted with 0.01N HCl or 0.01N NaOH if any difficulty in
solubility was observed. The peptide was stored in stock solutions
(1000 nM) at -20.degree. C.
Coating the Peptides on an ELISA Plate:
[0322] Peptide solutions were diluted 1-in-100 with Hank's buffered
saline solution (HBSS) containing 0.5% formaldehyde. 100 .mu.L of
diluted peptide solution was distributed to each well in a 96-well
plate. The plates were incubated at room temperature for 1 hour.
The supernatant was removed and the plates were placed uncovered in
a 37.degree. C. incubator for 16-18 hours. The peptide-coated
plates were placed in plastic bags and stored at 2-8.degree. C.
until required.
[0323] Alternatively, the peptides were diluted in
carbonate/bicarbonate buffer pH 9.6 and coated on the plates. All
the other steps with the exception of a change in the coating
buffer were the same.
Binding of VB1-008 to the Peptide-Coated ELISA Plates:
[0324] VB1-008 binding to immobilized peptides was performed
according to SOP 2.1.19 and SOP 2.2.7:
[0325] Following overnight incubation of the peptide-coated plates,
300 .mu.L of wash buffer (PBS containing 0.5% Tween20) was manually
added to each plate, with the help of a repeator pipette equipped
with an 8-channel adaptor. The contents of the plates were
discarded; the plates were inverted and patted on 3-4 inches of
paper towel to remove excess liquid. The above steps were repeated
two more times.
Blocking:
[0326] The peptide-coated plates were blocked with 300 .mu.L/well
with blocking buffer (PBS containing 1% BSA). The plates were
incubated for 30-60 minutes at room temperature. The block buffer
was discarded after the incubation.
Binding:
[0327] Aliquots equivalent to 75 .mu.g/mL of VB1-008 were added to
each of the wells and incubated at 37.degree. C. for two hours. The
plates were washed as previously described with the wash buffer
(PBS containing 0.5% Tween 20). The plates were incubated with
1:6000 dilution of anti-human IgG-HRP for one hour at room
temperature. The plates were washed as previously described. 100
.mu.L of TMB substrate (TMB peroxidase substrate KPL cat#50-76-00)
was added to each well and incubated for 5-10 minutes in the dark.
The reaction was terminated by adding 100 .mu.L of 1M phosphoric
acid to each well. The optical density was measured at 450 nm using
an ELISA plate reader.
[0328] Alternatively, ELISA plates were coated with 100 .mu.g/mL of
VB1-008, according to the SOP 2.1.111, and binding of the
biotinylated peptides to VB1-008 were assayed according to SOP
2.1.41 for the detection of biotinylated probes.
Results
[0329] Screening of synthetic peptides from the unique region of
CD44E (i.e., the amino acid sequence that spans the exon 5-v8
junction), revealed that Peptide 3 showed the strongest binding,
followed by peptide 2 which demonstrated 50-60% of the binding
observed with Peptide 3. A peptide of the same length taken from
the C-terminal region of CD44E used as negative control did not
show any reactivity as was the case with Peptide 1. Reactivity of
VB1-008 with peptide 3 demonstrated that this region of CD44E
contains the reactive epitope of VB1-008. See FIG. 18B.
Example 9
Epitope Mapping--Competition Experiments
[0330] The competing efficiency of the peptides for VB1-008 binding
was then assayed.
Methods and Reagents
Growth and Maintenance of Tumor Cell Lines:
[0331] Cell lines that are VB1-008-positive, i.e., MDA-MB-435S were
cultured and maintained according to ATCC guidelines.
Synthetic Peptides:
[0332] All peptides were solubilized in PBS and stored at 1.428 mM
(2 mg/mL) and as 100 .mu.M solutions at -20.degree. C.
Competition Assay:
[0333] VB1-008 (75 .mu.g/mL)-0.5 .mu.M concentration, was used as
the non-competed control. Molar excesses, i.e., 20.times.,
40.times., 100.times. and 200.times. of peptides were used to
compete with VB1-008. The peptides/VB1-008 mixtures were incubated
on ice for 10 minutes prior to binding by flow. 4B5-IgG was used as
the Isotype-matched control and anti-EGFR was used as the unrelated
antibody. These two antibodies were processed exactly the same as
VB1-008.
Binding of VB1-008:
[0334] The binding of VB1-008, along with the anti-EGFR and 4B5-IgG
antibodies to MDA-MB435S cells was assessed by flow cytometry; and
was performed according to the optimized protocol previously
described. Cells treated with peptides and those that were
untreated were processed similarly.
Results
[0335] As seen in FIG. 19A, peptide 1 did not compete with VB1-008
binding to MDA-MB435S, peptide 2 competed at 60% efficiency with
VB1-008 binding to MDA-MB435S and peptide 3 competed at 96%
efficiency with VB1-008 binding to MDA-MB435S. The control showed
no competition to VB1-008.
[0336] FIG. 19B shows the results of the isotype-matched control.
None of the peptides or controls compete with anti-EGFR for
binding.
Example 10
Cytotoxicity of VB1-008 Immunotoxin
Methods and Reagents
[0337] The VB6-008 construct, comprising VB1-008 attached to a
modified bouganin was constructed using the methods disclosed in
PCT/CA2005/000410 and U.S. patent application Ser. No.
11/084,080.
[0338] A dicistronic expression unit was generated comprising the
VH-CH domain of VB1-008 linked to modified bouganin using a
furin-sensitive linker immediately followed by the VL-CL of VB1-008
domain. Both the VH and VL were preceded by a PelB leader sequence
(See FIGS. 26 and 27). The dicistronic unit was cloned into the
pING3302 Xoma vector and was under the control of the
arabinose-inducible araBAD promoter. The presence of the PelB
leader sequence, adjacent to VH-CH Bouganin and VL-CL, will result
in secretion of the proteins into the periplasmic space where the
reducing environment will allow the formation of the disulphide
bridge between the two constant domains. Ultimately, the
Fab-bouganin fusion protein will be secreted into the culture
supernatant. A histidine affinity tag, placed at the N-terminal of
the VL-CL enables the Fab-bouganin protein to be purified using a
Ni.sup.2+-chelating capture method. The VH fragment of VB6-008 (395
bp) was amplified with the following primers and cloned into
PelB-VB6-011-F-boug gamma cassette using PvulI and NheI restriction
sites.
TABLE-US-00003 5' PvuII-QVQL (SEQ ID NO: 30) 5' ATG GCG CAG GTG CAG
CTG CAG GAG TTG GGT CCA 3' VB4-008-NheI (SEQ ID NO: 31) 5' CGA TGG
GCC CTT GGT GGA GGC GCT AGC GAC AGT GAC CAT TGT CCC
[0339] VB1-008 light chain is a lambda and since the lambda CL
domain contains a SpeI restriction site, a different restriction
site was used to assemble VB6-008. Therefore, in the 5' end of the
VB6-008 light chain fragment, the HindIII restriction site (in
bouganin) was used to assemble the final construct into pSP73
plasmid (See FIG. 27). No restriction site was found around the
VL-CL junction therefore the VL-CL of each clones was obtained by
the Splice Overlapping Extension PCR approach. The following
primers were used along with D-bouganin 156, PelB signal and cDNA
of VB1-008 hybridoma as templates:
[0340] HindIII-boug-PelB-VB6-008 lambda was assembled by the Splice
Overlapping Extension Polymerase Chain Reaction method using the
following primers:
TABLE-US-00004 5' Furin Linker D-bouganin (SEQ ID NO: 32) 5' CAC
AGG CAG CCC AGA GGC TGG GAG CAG CTC TAC AAC ACC GTG TCA TTT AAC CTT
3' 008-PeIB (SEQ ID NO: 33) 5' CGT TCC ATA GAC CTG CAG TCT AGA GTC
GAC TCA CTA TTT GGA GCT TTT AAA CTT 5' PeIB-SaII (SEQ ID NO: 34) 5'
AAG TTT AAA AGC TCC AAA TAG TGA TCT AGA GTC GAC CTG CAG GTC TAT GGA
ACG ATA AAT 3' 008-VL CL (SEQ ID NO: 35) 5' CAC TGA GGG TGG CTG AGT
CAG CTC ATA GTG ATG GTG GTA GTG AGT 5' 008-VL CL (SEQ ID NO: 36) 5'
CAT CAC CAT CAC CAT CAC TAT GAG CTG ACT CAG CCA CCC TCA GTG 3' 008
CL STOP (SEQ ID NO: 37) 5' CTC GAG TCA CTA TGA ACA TTC TGT AGG GGC
CAC TGT CTT CTC CAC
[0341] A three-step Splice Overlapping Extension PCR approach was
undertaken using all 6 primers listed above for amplification.
[0342] Step 1
[0343] Primers 1 and 2 was used to amplify bouganin containing a
portion of the PelB promoter (820 bp) in the 3' end. In a second
PCR reaction, primers 3 and 4 was used to amplify the PelB
containing in the 3' end a His tag and a portion of VB6-008 VL (179
bp). In a third PCR reaction, primers 5 and 6 was used to amplify
the VB6-008 lambda chain with two stop codons and the XhoI site
(666 bp) in the 3' end.
[0344] Step 2
[0345] In the second PCR reaction, primers 1 and 6 was used with 1
.mu.l from each PCR product to produce the
HindIII-bouganin-PelB-VB6-008 lambda chain (1591 bp).
[0346] Electrophoresis on a 1% agarose gel was used to separate the
amplified PCR products. The bands of interest was excised and
purified using a Qiaquick gel extraction kit, cloned into the TOPO
pCR 2.1 cloning vector and sequenced using the 373 DNA
sequencer.
[0347] The PCR product was purified and sequenced. A verified clone
was digested with HindIII and XhoI and ligated into the
PelB-VB4-008-F-boug/pSP73 previously digested with the
corresponding enzymes (FIG. 27). The VB6-008 fragment was then be
digested with EcoRI and XhoI and cloned into the pING3302
expression vector and transformed into E104 cells.
[0348] E104 cells were propagated in 30 mL of TB media (1%
innoculum) in a 250 mL shake flask at 37.degree. C., shaken at 225
rpm for approximately 5 hours until the optical density (O.D. 600
nm) reached 2. At this time, the culture was induced with a final
concentration of 0.1% L-(+) arabinose for 16 hours and incubated at
25.degree. C. Subsequently, the cell pellet and supernatant was
collected by centrifugation at 14000 rpm for 5 minutes. Both the
cell pellet and supernatant was analyzed by Western blot using an
anti-His (Amersham Biosciences 27-4710-01) and an anti-human kappa
light chain (Sigma A-7164) or anti-human lambda light chain (Sigma
A-5175) under reducing and non-reducing conditions to confirm the
presence and size of the immunotoxin. A Research Cell Bank of the
clone with the highest expression level was made and three
independent vials will be tested for induction at a scale of 500 mL
TB in 2 L shake flasks. Every 6 hours, the cell pellet and
supernatant was isolated and Western blot analysis was used to
indicate the optimal post-induction time for harvesting.
[0349] Flow cytometry was used to demonstrate that the purified VB6
immunotoxins retain the binding specificity of their respective
parent antibody using antigen positive and negative cell lines.
Binding will be detected using a mouse anti-His monoclonal antibody
(Amersham Biosciences 27-4710-01). The specificity of the binding
was assessed by competition assay. Briefly, the VB6-immunotoxin (at
a fixed concentration) and the corresponding VB1 antibody or an
isotype-matched control antibody (at varying concentrations) was
incubated simultaneously with antigen positive cells. Binding was
detected using a mouse anti-His monoclonal antibody. Decreased
binding using the anti-His monoclonal antibody indicated that the
VB6 immunotoxins and the corresponding VB1 antibody bind to the
same antigen. It is expected that the level of binding of the VB6
immunotoxins will not be altered in the presence of the
isotype-matched control antibody. The functional affinity of the
VB6 immunotoxins was calculated with a titration curve using an
antigen positive cell line. An MTS assay was used to measure the
IC.sub.50 of each VB6 immunotoxin using antigen positive and
negative cell lines. VB6-4B5 was used as a negative control. The
specificity of the cytotoxicity was measured by the difference in
IC.sub.50 between the VB6 immunotoxins and VB6-4B5.
Results
[0350] An immunoconjugate (VB6-008) comprising VB1-008 attached to
a modified bouganin was constructed. The nucleotide sequence of the
immunoconjugate is depicted in FIG. 20 (SEQ ID NO:11). The amino
acid sequence of the immunoconjugate is depicted in FIG. 21 (SEQ ID
NO:12). FIG. 22 shows the complete VB6-080 construct. FIG. 23 shows
VB6-008 unit #1, which includes PelB-VH-CH-Furin-De-Bouganin. FIG.
24 shows VB6-008 unit #2, which consists of PelB-VL-CL.
[0351] The cytotoxicity of VB6-008 was assessed in vitro against
the antigen-positive cells, MB-435SC. Colo-320 was used as the
negative control. The cells were incubated with VB8-008 ranging
from 1000 to 1 nm and after 5 days of incubation variability was
measured. As can be seen, in FIG. 25, the VB6-008 immunoconjugate
significantly killed the antigen-positive cells as compared to the
negative control.
[0352] While the present invention has been described with
reference to what are presently considered to be the preferred
examples, it is to be understood that the invention is not limited
to the disclosed examples. To the contrary, the invention is
intended to cover various modifications and equivalent arrangements
included within the spirit and scope of the appended claims.
[0353] All publications, patents and patent applications are herein
incorporated by reference in their entirety to the same extent as
if each individual publication, patent or patent application was
specifically and individually indicated to be incorporated by
reference in its entirety.
TABLE-US-00005 TABLE 1 CDR Sequences VB1-008 L-chain H-chain CDR1
SGDNLGN SEQ ID NO: 1 GDEYYWS SEQ ID NO: 4 KYVC CDR2 EDTKRPS SEQ ID
NO: 2 YMSYRGS SEQ ID NO: 5 SYYSPSL QS CDR3 QAWDSRT SEQ ID NO: 3
KYCGGDC SEQ ID NO: 6 EI RSGFDI
TABLE-US-00006 TABLE 2 Comparison of normal and tumor cell surface
binding with VB1-008 Clinical Representative Relative Indication
Tumor Cell lines N.sup.1 MF.sup.2 Rank Breast MCF-7, MDA-MB-231, 3
17.2 1 MDA-MB-435S Lung A-549, NCI-H460, NCI-H69 3 16.1 2 Melanoma
A-375, SK-MEL-5.sup.a,b, 3 15.6 3 SK-MEL-28.sup.a Prostate
DU-145.sup.a,b,f, PC-3.sup.a,b,g, 3 14.2 4 LNCaP.sup.a,b,g Ovarian
SK-OV-3.sup.a, OVCar-3 2 10.8 5 Kidney Caki-1.sup.a, A498.sup.a,
ACHN.sup.a 3 10.5 6 Liver SK-HEP-1, Hep-G2 2 8.3 7 Rectum SW837,
NCI-H630 2 7.5 8 Colon HT-29.sup.a, SW480, WiDr 3 7.2 9 Cervix
HeLa, C-41, C-33A 3 4.4 10 Stomach AGS, NCI-N-87, KATO III 3 4.0 11
Bladder UM-UC-3, T24 2 3.9 12 Endometrium RL-95-2, HEC-1-A 2 3.9 12
Pancreas PANC-1, BxPC-3, MIA PaCa-2 3 3.8 14 Head & Neck
SCC-15, SCC-25 2 2.9 15 Normal Cell Tumor: Type Cell Line normal
Kidney HRE 1 6.1 1.7 Lung NHLF 1 5.6 2.9 Endothelial HUVEC 1 1.6
N/A Breast HMEC 1 2.4 7.2 Prostate PrEC 1 4.0 3.6 .sup.1N indicates
the number of cell lines tested per indication. .sup.2MF: Values
indicate the mean calculated from the sum of the mean fold increase
in median fluorescence over the control antibody from all cell
lines in each indication. A zero value indicates no measurable
reactivity relative to the control antibody. .sup.aIndicates
orthotopic models offered by AntiCancer Inc. .sup.bIndicates cell
lines available as GFP (green fluorescent protein)-transfectants.
.sup.CHer2/neu.sup.-, ER.sup.+. .sup.dHer2/neu.sup.-, ER.sup.-,
p53.sup.wt, ras.sup.wt. .sup.eHer2/neu.sup.-, ER.sup.-, p53.sup.mt,
ras.sup.wt. .sup.fAndrogen-responsive. .sup.gAndrogen-unresponsive.
N/A, not applicable. The mean-fold increase (MF) is used to
calculate the tumor:normal ratio.
TABLE-US-00007 TABLE 3 LD Array of Critical Normal Tissue for
VB1-008 Tissue Membrane Staining Score Range* Brain None (0/2) 0
Colon None (0/5) 0 Heart None (0/5) 0 Kidney 2/3 0-1 (10%) Liver
None (0/5) 0 Lung None (0/5) 0 Pancreas 1/5 1 (30%) Stomach 1/5 1
(70%) *Scoring was evaluated on a 0-3+ scale, with 0 = no staining
and trace being less than 1+ but greater than 0. Grades 1+ to 3+
represent increased intensity of staining, with 3+ being strong,
dark brown staining. In general, a single specimen of 6 different
patients was screened. Where fewer than 6 patients were screened
indicates cores were either missing or were not representative of
the tissue to be stained. Values in parentheses indicate the
percentage of cells stained in the scored range.
TABLE-US-00008 TABLE 4 HD Normal TMA for VB1-008 Tissue Membrane
Staining Score Range* Adrenal None (0/2) 0 Aorta None (0/5) 0
Artery None (0/5) 0 Bladder None (0/5) 0 Brain None (0/5) 0 Breast
None (0/5) 0 Fallopian tube 3/4 1-2 (30-60%) LN None (0/3) 0 Muscle
None (0/4) 0 Ovary None (0/5) 0 Pituitary None (0/5) 0 Placenta
None (0/4) 0 Prostate 4/5 0-1 (10-20%) Skin ND Spinal cord None
(0/1) 0 Spleen None (0/2) 0 Testis 3/5 1-2 (95%) Thymus None (0/1)
0 Thyroid None (0/5) 0 Ureter 1/2 Uterus None (0/5) 0 *Scoring was
evaluated on a 0-3+ scale, with 0 = no staining and trace being
less than 1+ but greater than 0. Grades 1+ to 3+ represent
increased intensity of staining, with 3+ being strong, dark brown
staining. In general, 2 specimens of 8 different patients were
screened. Where fewer than 8 patients were screened indicates cores
were either missing or were not representative of the tissue to be
stained. Values in parentheses indicate the percentage of cells
stained in the scored range.
TABLE-US-00009 TABLE 5 HD Tumor TMA for VB1-008 Tissue Membrane
Staining Score Range* Bladder 6/6 1-2 (100%) Breast 6/7 1-2 (100%)
Cervix 2/7 1 (100%) Colon 3/3 1-2 (100%) Kidney 5/8 1-2 (100%)
Liver 5/7 1-2 (100%) Lung 1/8 1 (100%) Ovary 6/7 1-2 (100%)
Pancreas 4/7 1 (100%) Prostate 5/5 1-2 (100%) Rectum 4/6 1-2 (100%)
Skin 1/4 1 (100%) Stomach 4/5 1-2 (100%) Uterus 8/8 1-2 (100%) Head
& Neck 4/8 1 (100%) *Scoring was evaluated on a 0-3+ scale,
with 0 = no staining and trace being less than 1+ but greater than
0. Grades 1+ to 3+ represent increased intensity of staining, with
3+ being strong, dark brown staining. In general, 2 specimens of 8
different proteins were screened. Where fewer than 8 proteins were
screened indicates cores were either missing or were not
representative of the tissue to be stained. Head & neck cancers
included carcinomas of the throat, lip, larynx, mouth, tonsil, and
gingival surface. Values in parentheses indicate the percentage of
cells stained in the scored range.
TABLE-US-00010 TABLE 6 Flow cytometry assessment of antibody
binding as a function of time and temperature Incubation Median
Fold- % Re- Anti- Time (min) Fluorescence increase duction MAb ID
bodies.sup.1 at 37.degree. C. (MF) in MF.sup.2 in MF.sup.3 VB1-008
17P2/C12 --.sup.4 134.0 .+-. 11 31.7 -- 60 57.0 .+-. 1.0 13.5 57.5
120 50.7 .+-. 1.1 12.0 62.2 Non- MA-103 -- 536.1 .+-. 31.3 112.8 --
Internal- 120 535.5 .+-. 16.8 113.0 -- izing Control Internal- 5E9
-- 246 .+-. 11 60.0 -- izing 60 53.5 .+-. 1.5 13.0 78.3 Control 120
48 .+-. 4 11.7 80.5 .sup.1A representative experiment is shown.
.sup.2MF increase above the negative control, mouse myeloma IgG or
human IgG (4B5). .sup.3Percent reduction of MF from the
cell-surface of tumor cells. .sup.4(--) cells incubated on ice for
120 minutes.
TABLE-US-00011 TABLE 7 Increase in median fluorescence for VB1-008
over an isotype- matched control for each cell line used in the
study Cell line MF* A-375 13.3 MDA-MB-435S 15.8 MDA-MB-231 14.2
MCF-7 4.67 PANC-1 8.3 DAUDI 1.1 RAMOS 1.3
TABLE-US-00012 TABLE 8 Summary of the antigens purified Sample
preparation Cell line reduced non-reduced Flow results intensity
A-375 50 .+-. 2 kDa 100 .+-. 5 kDa 11.08 +++ MB435S 50 .+-. 2 kDa
100 .+-. 5 kDa 15.8 ++++ MB231 50 .+-. 2 kDa 100 .+-. 5 kDa 14.2 ++
MCF-7 50 .+-. 2 kDa 100 .+-. 5 kDa 4.63 + PANC-1 -- -- 8.95 - DAUDI
-- -- 1 - RAMOS 50 .+-. 2 kDa 100 .+-. 5 kDa 1.1 +++
TABLE-US-00013 TABLE 9A Summary of the proteins identified by
LC-MS/MS from 2D spot - `C` 2D Spot `C` - 48.8 kDa from MDA-MB-435S
Accession Match # Protein ID Mw/Pi Peptides to 2DE gi|4501989
alpha-fetoprotein 68813/5.2 30 [Homo sapiens] (AFP) gi|231315
alpha-1proteinase 39099/5.27 7 C inhibitor gi|224224 alpha-1
antitrypsin 46731/4.35 6 C C- Co-purifying contaminant; X - does
not match Pi and/or Mw observed; = matches Pi and Mw
TABLE-US-00014 TABLE 9B Summary of the proteins identified by
LC-MS/MS from 2D spot - `D` 2D Spot `D` - 45 + 2 kDa Accession
Match # Protein ID Mw/PI Peptides to 2DE gi|105583 cell adhesion
53585/5.4 3 molecule CD44 - human gi|87056 nucleolin-related
77453/4.5 3 X protein - human gi|2804273 alpha-actinin 4
102661/5.27 5 C [Homo sapiens] gi|34862435 ER protein 92713/4.72 2
X 99/integrin gi|71620 actin-beta - bovine 41786/5.22 1 C C-
Co-purifying contaminant; X - does not match Pi and Mw observed; =
matches pI and Mw within acceptable range
TABLE-US-00015 TABLE 10 Summary of the proteins identified by
LC-MS/MS from protein band `E` Protein band `E` - 110 kDa band from
VB1-008 IP (non-reducing conditions) Accession Match # Protein ID
Mw/PI to 2DE gi|4501989 alpha-fetoprotein 68813/5.2 16 [Homo
sapiens] (AFP) Gi|105583 cell adhesion molecule 53585/5.4 8 CD44 -
human gi|20177936 heat shock protein 81912/4.77 10 X Hsp90-beta[Hsp
84] gi|34862435 Alpha-actinin 92713/4.72 2 C gi|71620 actin-beta -
bovine 41786/5.22 5 C gi|55408 vimentin [Mus musculus] 54418/5.01 3
C C- Co-purifying contaminant; X - does not match Pi and Mw
observed; = matches pI and Mw within acceptable range
TABLE-US-00016 TABLE 11A List of peptides recovered from MS/MS for
AFP Peptide SEQ ID NO YGHSDCCSQSEEGR 46 HNCFLAHK 47 FIYEIAR 48
HPFLYAPTILLWAAR 49 IIPSCCK 50 AENAVECFQTK 51 ESSLLNQHACAVMK 52
TFQAITVTK 53 LSQKFTK 54 LVLDVAHVHEHCCR 55 GDVLDCLQDGEK 56
IMSYICSQQDTLSNK 57 GQCIIHAENDEKPEGLSPNLNR 58 FLGDRDFNQFSSGEK 59
DFNQFSSGEK 60 DFNQFSSGEKNIFLASFVHEYSR 61 NIFLASFVHEYSR 62
RHPQLAVSVILR 63 HPQLAVSVILR 64 GYQELLEK 65 YIQESQALAKR 66 RSCGLFQK
67 LGEYYLQNAFLVAYTKK 68 KAPQLTSSELMAITR 69 APQLTSSELMAITR 70
MAATAATCCQLSEDKLLACGEGAADIIIGHLCIR 71 LLACGEGAADIIIGHLCIR 72
DLCQAQGVALQTMKQEFLINLVK 73 QEFLINLVK 74 QKPQITEEQLEAVIADFSGLLEK
75
TABLE-US-00017 TABLE 11B List of peptides recovered from MS
analysis of immunopurified CD44 Exon 20 (SEQ ID NO: 38) NLQNVDMK
Exon 5 (SEQ ID NO: 39) YVQKGEYR Exon 20 (SEQ ID NO: 40) KPSGLNGEASK
Exon 3 (SEQ ID NO: 41) YGFIEGHVVIPR Exon 2 (SEQ ID NO: 42) TEAADLCK
Exon 19 (SEQ ID NO: 43) LVINSGNGAVEDR Exon 20 (SEQ ID NO: 44)
ESSETPDQFMTADETR Exon v8-v9 (SEQ ID NO: 45)
TGPLSMTTQQSNSQSFSTSHEGLEED
TABLE-US-00018 TABLE 12 Peptide matches between different CD44
isoforms Accession peptide CD44 isoform Number matches homology
CD44 PGP Hutch protein Gi|87056 2 100% CD44 E/Isoform 3 GI|105583/
8* 100% GI|48255939 CD44 M4 isoform GI|346672 1 58.7% CD44 Isoform
1 (parent) GI|48255935 8 100% CD44H/CD44s Isoform 2 (standard)
GI|48255937 7 100% CD44 isoform 4 GI|48255941 7 100% CD44 isoform
5/isoform RC GI|48255943 1 100% CD44 isoform v3-v6 GI|11139066 2
100% CD44 homing antigen GI|10432374 3 78.7% CD44 T-cell antigen
GI|13936302 1 100% CD44 M3 isoform GI|346670 0 -- CD44 isoform v6
GI|11139062 0 -- CD44 isoform R1, R2 GI|87053 4 100%
TABLE-US-00019 TABLE 13 Comparative binding profiles of VB1-008,
anti CD44, anti-AFP and anti-EGFR Ag Anti- Cell line VB1-008
Anti-CD44 Anti-AFP intensity EGFR MB435S 15.8 773.5 1.95 ++++ 33.1
MB231 14.2 292 1.3 ++ 149 A-375 13.3 368 1.3 +++ 16 PANC-1 8.3
192.5 1.1 - 132.4 MCF-7 4.63 52 1.1 + 7 DAUDI 1 1.6 1.4 - 1.1 RAMOS
1.1 1.3 1.3 +++ 1.2
Sequence CWU 1
1
87111PRTHomo sapiens 1Ser Gly Asp Asn Leu Gly Asn Lys Tyr Val Cys 1
5 10 27PRTHomo sapiens 2Glu Asp Thr Lys Arg Pro Ser 1 5 39PRTHomo
sapiens 3Gln Ala Trp Asp Ser Arg Thr Glu Ile 1 5 47PRTHomo sapiens
4Gly Asp Glu Tyr Tyr Trp Ser 1 5 516PRTHomo sapiens 5Tyr Met Ser
Tyr Arg Gly Ser Ser Tyr Tyr Ser Pro Ser Leu Gln Ser 1 5 10 15
613PRTHomo sapiens 6Lys Tyr Cys Gly Gly Asp Cys Arg Ser Gly Phe Asp
Ile 1 5 10 7106PRTHomo sapiens 7Tyr Glu Leu Thr Gln Pro Pro Ser Val
Ser Val Ser Pro Gly Gln Lys 1 5 10 15 Ala Phe Ile Thr Cys Ser Gly
Asp Asn Leu Gly Asn Lys Tyr Val Cys 20 25 30 Trp Tyr Gln Gln Lys
Pro Gly Gln Ser Pro Val Leu Val Ile Tyr Glu 35 40 45 Asp Thr Lys
Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Ala Ser Asn 50 55 60 Ser
Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Pro Ile Asp 65 70
75 80 Glu Ala Asp Tyr Tyr Cys Gln Ala Trp Asp Ser Arg Thr Glu Ile
Phe 85 90 95 Gly Thr Gly Thr Lys Val Thr Val Leu Ser 100 105
8318DNAHomo sapiens 8tatgagctga ctcagccacc ctcagtgtcc gtgtccccag
gacagaaagc cttcataacc 60tgctctggag ataacctggg gaataaatat gtgtgctggt
atcaacagaa gccaggccag 120tcccctgtcc tggtcatcta tgaagatacc
aagaggccct cagggatccc tgagcgattc 180tctgcctcca actctgggaa
tacagccact ctgaccatca gcgggacgca gcctatagat 240gaggctgact
actactgtca ggcgtgggac agccgcactg aaatcttcgg aactgggacc
300aaggtcaccg tcctaagt 3189123PRTHomo sapiens 9Gln Val Gln Leu Gln
Glu Leu Gly Pro Arg Leu Val Arg Pro Ser Gln 1 5 10 15 Thr Leu Ile
Leu Thr Cys Thr Val Ser Gly Gly Ser Val Ser Gly Asp 20 25 30 Glu
Tyr Tyr Trp Ser Trp Leu Arg Gln Thr Pro Gly Lys Gly Leu Glu 35 40
45 Trp Ile Gly Tyr Met Ser Tyr Arg Gly Ser Ser Tyr Tyr Ser Pro Ser
50 55 60 Leu Gln Ser Arg Val Thr Ile Ala Val Asp Arg Ser Lys Asn
Glu Phe 65 70 75 80 Ser Leu Lys Leu Thr Ser Val Thr Ala Ala Asp Ala
Ala Val Tyr Phe 85 90 95 Cys Ala Arg Lys Tyr Cys Gly Gly Asp Cys
Arg Ser Gly Phe Asp Ile 100 105 110 Trp Gly Arg Gly Thr Met Val Thr
Val Ala Ser 115 120 10369DNAHomo sapiens 10caggtgcagc tgcaggagtt
gggtccaagg ctggtgaggc cttcacagac cctgatcctc 60acctgcactg tctctggagg
ctccgtcagc ggcgatgagt attactggag ttggctccgt 120cagaccccag
ggaagggcct ggagtggatt gggtacatgt cttacagagg gagcagttat
180tacagtccgt ccctccagag tcgagttacc attgcagtgg acaggtccaa
gaacgaattt 240tccctgaagc tgacgtctgt gactgccgca gacgcggccg
tatatttctg tgccagaaaa 300tattgtggtg gcgattgcag gagtggtttt
gatatctggg gccgagggac aatggtcacc 360gtcgcttca 369112400DNAHomo
sapiens 11gaattcctgc aggtctatgg aacgataaat gcccatgaaa attctatttc
aaggagacag 60tcataatgaa atacctattg cctacggcag ccgctggatt gttattactc
gctgcccaac 120cagcgatggc gcaggtgcag ctgcaggagt tgggtccaag
gctggtgagg ccttcacaga 180ccctgatcct cacctgcact gtctctggag
gctccgtcag cggcgatgag tattactgga 240gttggctccg tcagacccca
gggaagggcc tggagtggat tgggtacatg tcttacagag 300ggagcagtta
ttacagtccg tccctccaga gtcgagttac cattgcagtg gacaggtcca
360agaacgaatt ttccctgaag ctgacgtctg tgactgccgc agacgcggcc
gtatatttct 420gtgccagaaa atattgtggt ggcgattgca ggagtggttt
tgatatctgg ggccgaggga 480caatggtcac tgtcgctagc gcctccacca
agggcccatc ggtcttcccc ctggcaccct 540cctccaaggc acctctgggg
gcacagcggc cctgggctgc ctggtcaagg actacttccc 600cgaaccggtg
acggtgtcgt ggaactcagg cgccctgacc agcggcgtgc acaccttccc
660ggctgtccta cagtcctcag gactctactc cctcagcagc gtggtgaccg
tgccctccag 720cagcttgggc acccagacct acatctgcaa cgtgaatcac
aagcccagca acaccaaggt 780ggacaagaaa gttgagccca aatcttgtac
caggcacagg cagcccagag gctgggagca 840gctctacaac actgtgtcat
ttaaccttgg agaagcttat gagtacccca cttttataca 900agatttgcgc
aatgaattgg ctaagggcac accagtatgt caacttccag tgacactaca
960aaccatagcc gatgacaagc gatttgttct agttgatatc actacgacct
cgaagaaaac 1020agttaaggtt gctatagatg tgacagatgt gtatgttgtg
ggttatcaag acaaatggga 1080tggcaaagat cgagctgttt tccttgacaa
ggttcctact gttgcaacta gtaaactttt 1140cccaggggtg actaatcgtg
taacgttaac atttgatggc agctatcaga aacttgtgaa 1200tgctgccaaa
gctgatagaa aggctctcga actgggggtt aacaaattgg aattttccat
1260tgaagcaatc catggtaaaa cgataaatgg tcaagaggca gccaagttct
ttcttattgt 1320catccaaatg gtttcagagg cagctcggtt caaatatatt
gagactgagg tggttgatag 1380aggattatat ggatcattca aacctaattt
taaagtattg aacttggaga acaattgggg 1440cgacatctct gatgccattc
acaaatcatc cccacaatgt accactatta atccggcact 1500tcagttgata
agcccctcaa atgacccatg ggttgtaaat aaagtgagtc aaattagtcc
1560cgatatgggt atccttaagt ttaaaagctc caaatagtga gtcgactcta
gactgcaggt 1620ctatggaacg ataaatgccc atgaaaattc tatttcaagg
agacagtcat aatgaaatac 1680ctattgccta cggcagccgc tggattgtta
ttactcgctg cccaaccagc gatggcgcat 1740caccatcacc atcactatga
gctgactcag ccaccctcag tgtccgtgtc cccaggacag 1800aaagccttca
taacctgctc tggagataac ctggggaata aatatgtgtg ctggtatcaa
1860cagaagccag gccagtcccc tgtcctggtc atctatgaag ataccaagag
gccctcaggg 1920atccctgagc gattctctgc ctccaactct gggaatacag
ccactctgac catcagcggg 1980acgcagccta tagatgaggc tgactactac
tgtcaggcgt gggacagccg cactgaaatc 2040ttcggaactg ggaccaaggt
caccgtccta agtcagccca aggccaaccc cactgtcact 2100ctgttcccgc
cctcctctga ggagctccaa gccaacaagg ccacactagt gtgtctgatc
2160agtgacttct acccgggagc tgtgacagtg gcctggaagg cagatggcag
ccccgtcaag 2220gcgggagtgg agaccaccaa accctccaaa cagagcaaca
acaagtacgc ggccagcagc 2280tacctgagcc tgacgcccga gcagtggaag
tcccacagaa gctacagctg ccaggtcacg 2340catgaaggga gcaccgtgga
gaagacagtg gcccctacag aatgttcata gtgactcgag 240012510PRTHomo
sapiens 12Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala Gly Leu Leu Leu
Leu Ala 1 5 10 15 Ala Gln Pro Ala Met Ala Gln Val Gln Leu Gln Glu
Leu Gly Pro Arg 20 25 30 Leu Val Arg Pro Ser Gln Thr Leu Ile Leu
Thr Cys Thr Val Ser Gly 35 40 45 Gly Ser Val Ser Gly Asp Glu Tyr
Tyr Trp Ser Trp Leu Arg Gln Thr 50 55 60 Pro Gly Lys Gly Leu Glu
Trp Ile Gly Tyr Met Ser Tyr Arg Gly Ser 65 70 75 80 Ser Tyr Tyr Ser
Pro Ser Leu Gln Ser Arg Val Thr Ile Ala Val Asp 85 90 95 Arg Ser
Lys Asn Glu Phe Ser Leu Lys Leu Thr Ser Val Thr Ala Ala 100 105 110
Asp Ala Ala Val Tyr Phe Cys Ala Arg Lys Tyr Cys Gly Gly Asp Cys 115
120 125 Arg Ser Gly Phe Asp Ile Trp Gly Arg Gly Thr Met Val Thr Val
Ala 130 135 140 Ser Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala
Pro Ser Ser 145 150 155 160 Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu
Gly Cys Leu Val Lys Asp 165 170 175 Tyr Phe Pro Glu Pro Val Thr Val
Ser Trp Asn Ser Gly Ala Leu Thr 180 185 190 Ser Gly Val His Thr Phe
Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr 195 200 205 Ser Leu Ser Ser
Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln 210 215 220 Thr Tyr
Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val Asp 225 230 235
240 Lys Lys Val Glu Pro Lys Ser Cys Thr Arg His Arg Gln Pro Arg Gly
245 250 255 Trp Glu Gln Leu Tyr Asn Thr Val Ser Phe Asn Leu Gly Glu
Ala Tyr 260 265 270 Glu Tyr Pro Thr Phe Ile Gln Asp Leu Arg Asn Glu
Leu Ala Lys Gly 275 280 285 Thr Pro Val Cys Gln Leu Pro Val Thr Leu
Gln Thr Ile Ala Asp Asp 290 295 300 Lys Arg Phe Val Leu Val Asp Ile
Thr Thr Thr Ser Lys Lys Thr Val 305 310 315 320 Lys Val Ala Ile Asp
Val Thr Asp Val Tyr Val Val Gly Tyr Gln Asp 325 330 335 Lys Trp Asp
Gly Lys Asp Arg Ala Val Phe Leu Asp Lys Val Pro Thr 340 345 350 Val
Ala Thr Ser Lys Leu Phe Pro Gly Val Thr Asn Arg Val Thr Leu 355 360
365 Thr Phe Asp Gly Ser Tyr Gln Lys Leu Val Asn Ala Ala Lys Ala Asp
370 375 380 Arg Lys Ala Leu Glu Leu Gly Val Asn Lys Leu Glu Phe Ser
Ile Glu 385 390 395 400 Ala Ile His Gly Lys Thr Ile Asn Gly Gln Glu
Ala Ala Lys Phe Phe 405 410 415 Leu Ile Val Ile Gln Met Val Ser Glu
Ala Ala Arg Phe Lys Tyr Ile 420 425 430 Glu Thr Glu Val Val Asp Arg
Gly Leu Tyr Gly Ser Phe Lys Pro Asn 435 440 445 Phe Lys Val Leu Asn
Leu Glu Asn Asn Trp Gly Asp Ile Ser Asp Ala 450 455 460 Ile His Lys
Ser Ser Pro Gln Cys Thr Thr Ile Asn Pro Ala Leu Gln 465 470 475 480
Leu Ile Ser Pro Ser Asn Asp Pro Trp Val Val Asn Lys Val Ser Gln 485
490 495 Ile Ser Pro Asp Met Gly Ile Leu Lys Phe Lys Ser Ser Lys 500
505 510 13239PRTHomo sapiens 13Met Lys Tyr Leu Leu Pro Thr Ala Ala
Ala Gly Leu Leu Leu Leu Ala 1 5 10 15 Ala Gln Pro Ala Met Ala His
His His His His His Tyr Glu Leu Thr 20 25 30 Gln Pro Pro Ser Val
Ser Val Ser Pro Gly Gln Lys Ala Phe Ile Thr 35 40 45 Cys Ser Gly
Asp Asn Leu Gly Asn Lys Tyr Val Cys Trp Tyr Gln Gln 50 55 60 Lys
Pro Gly Gln Ser Pro Val Leu Val Ile Tyr Glu Asp Thr Lys Arg 65 70
75 80 Pro Ser Gly Ile Pro Glu Arg Phe Ser Ala Ser Asn Ser Gly Asn
Thr 85 90 95 Ala Thr Leu Thr Ile Ser Gly Thr Gln Pro Ile Asp Glu
Ala Asp Tyr 100 105 110 Tyr Cys Gln Ala Trp Asp Ser Arg Thr Glu Ile
Phe Gly Thr Gly Thr 115 120 125 Lys Val Thr Val Leu Ser Gln Pro Lys
Ala Asn Pro Thr Val Thr Leu 130 135 140 Phe Pro Pro Ser Ser Glu Glu
Leu Gln Ala Asn Lys Ala Thr Leu Val 145 150 155 160 Cys Leu Ile Ser
Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys 165 170 175 Ala Asp
Gly Ser Pro Val Lys Ala Gly Val Glu Thr Thr Lys Pro Ser 180 185 190
Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr 195
200 205 Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser Cys Gln Val Thr
His 210 215 220 Glu Gly Ser Thr Val Glu Lys Thr Val Ala Pro Thr Glu
Cys Ser 225 230 235 14381PRTHomo sapiens 14Lys Tyr Gly His Ser Asp
Cys Cys Ser Gln Ser Glu Glu Gly Arg His 1 5 10 15 Asn Cys Phe Leu
Ala His Lys Lys Pro Thr Pro Ala Ser Ile Pro Leu 20 25 30 Phe Gln
Val Pro Glu Pro Val Thr Ser Cys Glu Ala Tyr Glu Glu Asp 35 40 45
Arg Glu Thr Phe Met Asn Lys Phe Ile Tyr Glu Ile Ala Arg Arg His 50
55 60 Pro Phe Leu Tyr Ala Pro Thr Ile Leu Leu Trp Ala Ala Arg Tyr
Asp 65 70 75 80 Lys Ile Ile Pro Ser Cys Cys Lys Ala Glu Asn Ala Val
Glu Cys Phe 85 90 95 Gln Thr Lys Ala Ala Thr Val Thr Lys Glu Leu
Arg Glu Ser Ser Leu 100 105 110 Leu Asn Gln His Ala Cys Ala Val Met
Lys Asn Phe Gly Thr Arg Thr 115 120 125 Phe Gln Ala Ile Thr Val Thr
Lys Leu Ser Gln Lys Phe Thr Lys Val 130 135 140 Asn Phe Thr Glu Ile
Gln Lys Leu Val Leu Asp Val Ala His Val His 145 150 155 160 Glu His
Cys Cys Arg Gly Asp Val Leu Asp Cys Leu Gln Asp Gly Glu 165 170 175
Lys Ile Met Ser Tyr Ile Cys Ser Gln Gln Asp Thr Leu Ser Asn Lys 180
185 190 Ile Thr Glu Cys Cys Lys Leu Thr Thr Leu Glu Arg Gly Gln Cys
Ile 195 200 205 Ile His Ala Glu Asn Asp Glu Lys Pro Glu Gly Leu Ser
Pro Asn Leu 210 215 220 Asn Arg Phe Leu Gly Asp Arg Asp Phe Asn Gln
Phe Ser Ser Gly Glu 225 230 235 240 Lys Asn Ile Phe Leu Ala Ser Phe
Val His Glu Tyr Ser Arg Arg His 245 250 255 Pro Gln Leu Ala Val Ser
Val Ile Leu Arg Val Ala Lys Gly Tyr Gln 260 265 270 Glu Leu Leu Glu
Lys Cys Phe Gln Thr Glu Asn Pro Leu Glu Cys Gln 275 280 285 Asp Lys
Gly Glu Glu Glu Leu Gln Lys Tyr Ile Gln Glu Ser Gln Ala 290 295 300
Leu Ala Lys Arg Ser Cys Gly Leu Phe Gln Lys Leu Gly Glu Tyr Tyr 305
310 315 320 Leu Gln Asn Ala Phe Leu Val Ala Tyr Thr Lys Lys Ala Pro
Gln Leu 325 330 335 Thr Ser Ser Glu Leu Met Ala Ile Thr Arg Lys Met
Ala Ala Thr Ala 340 345 350 Ala Thr Cys Cys Gln Leu Ser Glu Asp Lys
Leu Leu Ala Cys Gly Glu 355 360 365 Gly Ala Ala Asp Ile Ile Ile Gly
His Leu Cys Ile Arg 370 375 380 15484PRTHomo sapiens 15Lys Tyr Gly
His Ser Asp Cys Cys Ser Gln Ser Glu Glu Gly Arg His 1 5 10 15 Asn
Cys Phe Leu Ala His Lys Lys Pro Thr Pro Ala Ser Ile Pro Leu 20 25
30 Phe Gln Val Pro Glu Pro Val Thr Ser Cys Glu Ala Tyr Glu Glu Asp
35 40 45 Arg Glu Thr Phe Met Asn Lys Phe Ile Tyr Glu Ile Ala Arg
Arg His 50 55 60 Pro Phe Leu Tyr Ala Pro Thr Ile Leu Leu Trp Ala
Ala Arg Tyr Asp 65 70 75 80 Lys Ile Ile Pro Ser Cys Cys Lys Ala Glu
Asn Ala Val Glu Cys Phe 85 90 95 Gln Thr Lys Ala Ala Thr Val Thr
Lys Glu Leu Arg Glu Ser Ser Leu 100 105 110 Leu Asn Gln His Ala Cys
Ala Val Met Lys Asn Phe Gly Thr Arg Thr 115 120 125 Phe Gln Ala Ile
Thr Val Thr Lys Leu Ser Gln Lys Phe Thr Lys Val 130 135 140 Asn Phe
Thr Glu Ile Gln Lys Leu Val Leu Asp Val Ala His Val His 145 150 155
160 Glu His Cys Cys Arg Gly Asp Val Leu Asp Cys Leu Gln Asp Gly Glu
165 170 175 Lys Ile Met Ser Tyr Ile Cys Ser Gln Gln Asp Thr Leu Ser
Asn Lys 180 185 190 Ile Thr Glu Cys Cys Lys Leu Thr Thr Leu Glu Arg
Gly Gln Cys Ile 195 200 205 Ile His Ala Glu Asn Asp Glu Lys Pro Glu
Gly Leu Ser Pro Asn Leu 210 215 220 Asn Arg Phe Leu Gly Asp Arg Asp
Phe Asn Gln Phe Ser Ser Gly Glu 225 230 235 240 Lys Asn Ile Phe Leu
Ala Ser Phe Val His Glu Tyr Ser Arg Arg His 245 250 255 Pro Gln Leu
Ala Val Ser Val Ile Leu Arg Val Ala Lys Gly Tyr Gln 260 265 270 Glu
Leu Leu Glu Lys Cys Phe Gln Thr Glu Asn Pro Leu Glu Cys Gln 275 280
285 Asp Lys Gly Glu Glu Glu Leu Gln Lys Tyr Ile Gln Glu Ser Gln Ala
290 295 300 Leu Ala Lys Arg Ser Cys Gly Leu Phe Gln Lys Leu Gly Glu
Tyr Tyr 305 310 315 320 Leu Gln Asn Ala Phe Leu Val Ala Tyr Thr Lys
Lys Ala Pro Gln Leu 325 330 335 Thr Ser Ser Glu Leu Met Ala Ile Thr
Arg Lys Met Ala Ala Thr Ala 340 345 350 Ala Thr Cys
Cys Gln Leu Ser Glu Asp Lys Leu Leu Ala Cys Gly Glu 355 360 365 Gly
Ala Ala Asp Ile Ile Ile Gly His Leu Cys Ile Arg His Glu Met 370 375
380 Thr Pro Val Asn Pro Gly Val Gly Gln Cys Cys Thr Ser Ser Tyr Ala
385 390 395 400 Asn Arg Arg Pro Cys Phe Ser Ser Leu Val Val Asp Glu
Thr Tyr Val 405 410 415 Pro Pro Ala Phe Ser Asp Asp Lys Phe Ile Phe
His Lys Asp Leu Cys 420 425 430 Gln Ala Gln Gly Val Ala Leu Gln Thr
Met Lys Gln Glu Phe Leu Ile 435 440 445 Asn Leu Val Lys Gln Lys Pro
Gln Ile Thr Glu Glu Gln Leu Glu Ala 450 455 460 Val Ile Ala Asp Phe
Ser Gly Leu Leu Glu Lys Cys Cys Gln Gly Gln 465 470 475 480 Glu Gln
Glu Val 16503PRTHomo sapiens 16Lys Tyr Gly His Ser Asp Cys Cys Ser
Gln Ser Glu Glu Gly Arg His 1 5 10 15 Asn Cys Phe Leu Ala His Lys
Lys Pro Thr Pro Ala Ser Ile Pro Leu 20 25 30 Phe Gln Val Pro Glu
Pro Val Thr Ser Cys Glu Ala Tyr Glu Glu Asp 35 40 45 Arg Glu Thr
Phe Met Asn Lys Phe Ile Tyr Glu Ile Ala Arg Arg His 50 55 60 Pro
Phe Leu Tyr Ala Pro Thr Ile Leu Leu Trp Ala Ala Arg Tyr Asp 65 70
75 80 Lys Ile Ile Pro Ser Cys Cys Lys Ala Glu Asn Ala Val Glu Cys
Phe 85 90 95 Gln Thr Lys Ala Ala Thr Val Thr Lys Glu Leu Arg Glu
Ser Ser Leu 100 105 110 Leu Asn Gln His Ala Cys Ala Val Met Lys Asn
Phe Gly Thr Arg Thr 115 120 125 Phe Gln Ala Ile Thr Val Thr Lys Leu
Ser Gln Lys Phe Thr Lys Val 130 135 140 Asn Phe Thr Glu Ile Gln Lys
Leu Val Leu Asp Val Ala His Val His 145 150 155 160 Glu His Cys Cys
Arg Gly Asp Val Leu Asp Cys Leu Gln Asp Gly Glu 165 170 175 Lys Ile
Met Ser Tyr Ile Cys Ser Gln Gln Asp Thr Leu Ser Asn Lys 180 185 190
Ile Thr Glu Cys Cys Lys Leu Thr Thr Leu Glu Arg Gly Gln Cys Ile 195
200 205 Ile His Ala Glu Asn Asp Glu Lys Pro Glu Gly Leu Ser Pro Asn
Leu 210 215 220 Asn Arg Phe Leu Gly Asp Arg Asp Phe Asn Gln Phe Ser
Ser Gly Glu 225 230 235 240 Lys Asn Ile Phe Leu Ala Ser Phe Val His
Glu Tyr Ser Arg Arg His 245 250 255 Pro Gln Leu Ala Val Ser Val Ile
Leu Arg Val Ala Lys Gly Tyr Gln 260 265 270 Glu Leu Leu Glu Lys Cys
Phe Gln Thr Glu Asn Pro Leu Glu Cys Gln 275 280 285 Asp Lys Gly Glu
Glu Glu Leu Gln Lys Tyr Ile Gln Glu Ser Gln Ala 290 295 300 Leu Ala
Lys Arg Ser Cys Gly Leu Phe Gln Lys Leu Gly Glu Tyr Tyr 305 310 315
320 Leu Gln Asn Ala Phe Leu Val Ala Tyr Thr Lys Lys Ala Pro Gln Leu
325 330 335 Thr Ser Ser Glu Leu Met Ala Ile Thr Arg Lys Met Ala Ala
Thr Ala 340 345 350 Ala Thr Cys Cys Gln Leu Ser Glu Asp Lys Leu Leu
Ala Cys Gly Glu 355 360 365 Gly Ala Ala Asp Ile Ile Ile Gly His Leu
Cys Ile Arg His Glu Met 370 375 380 Thr Pro Val Asn Pro Gly Val Gly
Gln Cys Cys Thr Ser Ser Tyr Ala 385 390 395 400 Asn Arg Arg Pro Cys
Phe Ser Ser Leu Val Val Asp Glu Thr Tyr Val 405 410 415 Pro Pro Ala
Phe Ser Asp Asp Lys Phe Ile Phe His Lys Asp Leu Cys 420 425 430 Gln
Ala Gln Gly Val Ala Leu Gln Thr Met Lys Gln Glu Phe Leu Ile 435 440
445 Asn Leu Val Lys Gln Lys Pro Gln Ile Thr Glu Glu Gln Leu Glu Ala
450 455 460 Val Ile Ala Asp Phe Ser Gly Leu Leu Glu Lys Cys Cys Gln
Gly Gln 465 470 475 480 Glu Gln Glu Val Cys Phe Ala Glu Glu Gly Gln
Lys Leu Ile Ser Lys 485 490 495 Thr Arg Ala Ala Leu Gly Val 500
17250PRTHomo sapiens 17Tyr Asn Thr Val Ser Phe Asn Leu Gly Glu Ala
Tyr Glu Tyr Pro Thr 1 5 10 15 Phe Ile Gln Asp Leu Arg Asn Glu Leu
Ala Lys Gly Thr Pro Val Cys 20 25 30 Gln Leu Pro Val Thr Leu Gln
Thr Ile Ala Asp Asp Lys Arg Phe Val 35 40 45 Leu Val Asp Ile Thr
Thr Thr Ser Lys Lys Thr Val Lys Val Ala Ile 50 55 60 Asp Val Thr
Asp Val Tyr Val Val Gly Tyr Gln Asp Lys Trp Asp Gly 65 70 75 80 Lys
Asp Arg Ala Val Phe Leu Asp Lys Val Pro Thr Val Ala Thr Ser 85 90
95 Lys Leu Phe Pro Gly Val Thr Asn Arg Val Thr Leu Thr Phe Asp Gly
100 105 110 Ser Tyr Gln Lys Leu Val Asn Ala Ala Lys Ala Asp Arg Lys
Ala Leu 115 120 125 Glu Leu Gly Val Asn Lys Leu Glu Phe Ser Ile Glu
Ala Ile His Gly 130 135 140 Lys Thr Ile Asn Gly Gln Glu Ala Ala Lys
Phe Phe Leu Ile Val Ile 145 150 155 160 Gln Met Val Ser Glu Ala Ala
Arg Phe Lys Tyr Ile Glu Thr Glu Val 165 170 175 Val Asp Arg Gly Leu
Tyr Gly Ser Phe Lys Pro Asn Phe Lys Val Leu 180 185 190 Asn Leu Glu
Asn Asn Trp Gly Asp Ile Ser Asp Ala Ile His Lys Ser 195 200 205 Ser
Pro Gln Cys Thr Thr Ile Asn Pro Ala Leu Gln Leu Ile Ser Pro 210 215
220 Ser Asn Asp Pro Trp Val Val Asn Lys Val Ser Gln Ile Ser Pro Asp
225 230 235 240 Met Gly Ile Leu Lys Phe Lys Ser Ser Lys 245 250
1837DNAartificial sequenceprimer 18tctaaagaag cccctgggag cacagctcat
caccatg 371936DNAartificial sequenceprimer 19gcccggggag cgggggcttg
ccggccgtcg cactca 362033DNAartificial sequenceprimer 20accatgagtg
agaaaaactg gatttgtgtg gca 332130DNAartificial sequenceprimer
21ggagccggtg accagggttc cctggcccca 302230DNAartificial
sequenceprimer 22ctcaccatgg agtttgggct gagctgggtt
302336DNAartificial sequenceprimer 23ggaggctgag gagacggtga
ccagggttcc ctggcc 362435DNAartificial sequenceprimer 24ggctcgagat
grcctgswcy cctctcytyc tswyc 352529DNAartificial sequenceprimer
25cccgtcgacg aagctccttc agaggaggg 292611PRTartificial
sequencesynthetic peptide 26Ser Thr Asp Arg Ile Pro Ala Thr Asn Met
Asp 1 5 10 2711PRTartificial sequencesynthetic peptide 27Arg Ile
Pro Ala Thr Asn Met Asp Ser Ser His 1 5 10 2811PRTartificial
sequencesynthetic peptide 28Ala Thr Asn Met Asp Ser Ser His Ser Ile
Thr 1 5 10 2911PRTartificial sequencesynthetic peptide 29Ala Val
Glu Asp Arg Lys Pro Ser Gly Leu Asn 1 5 10 3033DNAartificial
sequenceprimer 30atggcgcagg tgcagctgca ggagttgggt cca
333145DNAartificial sequenceprimer 31cgatgggccc ttggtggagg
cgctagcgac agtgaccatt gtccc 453254DNAartificial sequenceprimer
32cacaggcagc ccagaggctg ggagcagctc tacaacaccg tgtcatttaa cctt
543354DNAartificial sequenceprimer 33cgttccatag acctgcagtc
tagagtcgac tcactatttg gagcttttaa actt 543460DNAartificial
sequenceprimer 34aagtttaaaa gctccaaata gtgatctaga gtcgacctgc
aggtctatgg aacgataaat 603545DNAartificial sequenceprimer
35cactgagggt ggctgagtca gctcatagtg atggtggtag tgagt
453645DNAartificial sequenceprimer 36catcaccatc accatcacta
tgagctgact cagccaccct cagtg 453745DNAartificial sequenceprimer
37ctcgagtcac tatgaacatt ctgtaggggc cactgtcttc tccac 45388PRTHomo
sapiens 38Asn Leu Gln Asn Val Asp Met Lys 1 5 398PRTHomo sapiens
39Tyr Val Gln Lys Gly Glu Tyr Arg 1 5 4011PRTHomo sapiens 40Lys Pro
Ser Gly Leu Asn Gly Glu Ala Ser Lys 1 5 10 4112PRTHomo sapiens
41Tyr Gly Phe Ile Glu Gly His Val Val Ile Pro Arg 1 5 10 428PRTHomo
sapiens 42Thr Glu Ala Ala Asp Leu Cys Lys 1 5 4313PRTHomo sapiens
43Leu Val Ile Asn Ser Gly Asn Gly Ala Val Glu Asp Arg 1 5 10
4416PRTHomo sapiens 44Glu Ser Ser Glu Thr Pro Asp Gln Phe Met Thr
Ala Asp Glu Thr Arg 1 5 10 15 4526PRTHomo sapiens 45Thr Gly Pro Leu
Ser Met Thr Thr Gln Gln Ser Asn Ser Gln Ser Phe 1 5 10 15 Ser Thr
Ser His Glu Gly Leu Glu Glu Asp 20 25 4614PRTHomo sapiens 46Tyr Gly
His Ser Asp Cys Cys Ser Gln Ser Glu Glu Gly Arg 1 5 10 478PRTHomo
sapiens 47His Asn Cys Phe Leu Ala His Lys 1 5 487PRTHomo sapiens
48Phe Ile Tyr Glu Ile Ala Arg 1 5 4915PRTHomo sapiens 49His Pro Phe
Leu Tyr Ala Pro Thr Ile Leu Leu Trp Ala Ala Arg 1 5 10 15
507PRTHomo sapiens 50Ile Ile Pro Ser Cys Cys Lys 1 5 5111PRTHomo
sapiens 51Ala Glu Asn Ala Val Glu Cys Phe Gln Thr Lys 1 5 10
5214PRTHomo sapiens 52Glu Ser Ser Leu Leu Asn Gln His Ala Cys Ala
Val Met Lys 1 5 10 539PRTHomo sapiens 53Thr Phe Gln Ala Ile Thr Val
Thr Lys 1 5 547PRTHomo sapiens 54Leu Ser Gln Lys Phe Thr Lys 1 5
5514PRTHomo sapiens 55Leu Val Leu Asp Val Ala His Val His Glu His
Cys Cys Arg 1 5 10 5612PRTHomo sapiens 56Gly Asp Val Leu Asp Cys
Leu Gln Asp Gly Glu Lys 1 5 10 5715PRTHomo sapiens 57Ile Met Ser
Tyr Ile Cys Ser Gln Gln Asp Thr Leu Ser Asn Lys 1 5 10 15
5822PRTHomo sapiens 58Gly Gln Cys Ile Ile His Ala Glu Asn Asp Glu
Lys Pro Glu Gly Leu 1 5 10 15 Ser Pro Asn Leu Asn Arg 20
5915PRTHomo sapiens 59Phe Leu Gly Asp Arg Asp Phe Asn Gln Phe Ser
Ser Gly Glu Lys 1 5 10 15 6010PRTHomo sapiens 60Asp Phe Asn Gln Phe
Ser Ser Gly Glu Lys 1 5 10 6123PRTHomo sapiens 61Asp Phe Asn Gln
Phe Ser Ser Gly Glu Lys Asn Ile Phe Leu Ala Ser 1 5 10 15 Phe Val
His Glu Tyr Ser Arg 20 6213PRTHomo sapiens 62Asn Ile Phe Leu Ala
Ser Phe Val His Glu Tyr Ser Arg 1 5 10 6312PRTHomo sapiens 63Arg
His Pro Gln Leu Ala Val Ser Val Ile Leu Arg 1 5 10 6411PRTHomo
sapiens 64His Pro Gln Leu Ala Val Ser Val Ile Leu Arg 1 5 10
658PRTHomo sapiens 65Gly Tyr Gln Glu Leu Leu Glu Lys 1 5
6611PRTHomo sapiens 66Tyr Ile Gln Glu Ser Gln Ala Leu Ala Lys Arg 1
5 10 678PRTHomo sapiens 67Arg Ser Cys Gly Leu Phe Gln Lys 1 5
6817PRTHomo sapiens 68Leu Gly Glu Tyr Tyr Leu Gln Asn Ala Phe Leu
Val Ala Tyr Thr Lys 1 5 10 15 Lys 6915PRTHomo sapiens 69Lys Ala Pro
Gln Leu Thr Ser Ser Glu Leu Met Ala Ile Thr Arg 1 5 10 15
7014PRTHomo sapiens 70Ala Pro Gln Leu Thr Ser Ser Glu Leu Met Ala
Ile Thr Arg 1 5 10 7134PRTHomo sapiens 71Met Ala Ala Thr Ala Ala
Thr Cys Cys Gln Leu Ser Glu Asp Lys Leu 1 5 10 15 Leu Ala Cys Gly
Glu Gly Ala Ala Asp Ile Ile Ile Gly His Leu Cys 20 25 30 Ile Arg
7219PRTHomo sapiens 72Leu Leu Ala Cys Gly Glu Gly Ala Ala Asp Ile
Ile Ile Gly His Leu 1 5 10 15 Cys Ile Arg 7323PRTHomo sapiens 73Asp
Leu Cys Gln Ala Gln Gly Val Ala Leu Gln Thr Met Lys Gln Glu 1 5 10
15 Phe Leu Ile Asn Leu Val Lys 20 749PRTHomo sapiens 74Gln Glu Phe
Leu Ile Asn Leu Val Lys 1 5 7523PRTHomo sapiens 75Gln Lys Pro Gln
Ile Thr Glu Glu Gln Leu Glu Ala Val Ile Ala Asp 1 5 10 15 Phe Ser
Gly Leu Leu Glu Lys 20 76609PRTHomo sapiens 76Met Lys Trp Val Glu
Ser Ile Phe Leu Ile Phe Leu Leu Asn Phe Thr 1 5 10 15 Glu Ser Arg
Thr Leu His Arg Asn Glu Tyr Gly Ile Ala Ser Ile Leu 20 25 30 Asp
Ser Tyr Gln Cys Thr Ala Glu Ile Ser Leu Ala Asp Leu Ala Thr 35 40
45 Ile Phe Phe Ala Gln Phe Val Gln Glu Ala Thr Tyr Lys Glu Val Ser
50 55 60 Lys Met Val Lys Asp Ala Leu Thr Ala Ile Glu Lys Pro Thr
Gly Asp 65 70 75 80 Glu Gln Ser Ser Gly Cys Leu Glu Asn Gln Leu Pro
Ala Phe Leu Glu 85 90 95 Glu Leu Cys His Glu Lys Glu Ile Leu Glu
Lys Tyr Gly His Ser Asp 100 105 110 Cys Cys Ser Gln Ser Glu Glu Gly
Arg His Asn Cys Phe Leu Ala His 115 120 125 Lys Lys Pro Thr Pro Ala
Ser Ile Pro Leu Phe Gln Val Pro Glu Pro 130 135 140 Val Thr Ser Cys
Glu Ala Tyr Glu Glu Asp Arg Glu Thr Phe Met Asn 145 150 155 160 Lys
Phe Ile Tyr Glu Ile Ala Arg Arg His Pro Phe Leu Tyr Ala Pro 165 170
175 Thr Ile Leu Leu Trp Ala Ala Arg Tyr Asp Lys Ile Ile Pro Ser Cys
180 185 190 Cys Lys Ala Glu Asn Ala Val Glu Cys Phe Gln Thr Lys Ala
Ala Thr 195 200 205 Val Thr Lys Glu Leu Arg Glu Ser Ser Leu Leu Asn
Gln His Ala Cys 210 215 220 Ala Val Met Lys Asn Phe Gly Thr Arg Thr
Phe Gln Ala Ile Thr Val 225 230 235 240 Thr Lys Leu Ser Gln Lys Phe
Thr Lys Val Asn Phe Thr Glu Ile Gln 245 250 255 Lys Leu Val Leu Asp
Val Ala His Val His Glu His Cys Cys Arg Gly 260 265 270 Asp Val Leu
Asp Cys Leu Gln Asp Gly Glu Lys Ile Met Ser Tyr Ile 275 280 285 Cys
Ser Gln Gln Asp Thr Leu Ser Asn Lys Ile Thr Glu Cys Cys Lys 290 295
300 Leu Thr Thr Leu Glu Arg Gly Gln Cys Ile Ile His Ala Glu Asn Asp
305 310 315 320 Glu Lys Pro Glu Gly Leu Ser Pro Asn Leu Asn Arg Phe
Leu Gly Asp 325 330 335 Arg Asp Phe Asn Gln Phe Ser Ser Gly Glu Lys
Asn Ile Phe Leu Ala 340 345 350 Ser Phe Val His Glu Tyr Ser Arg Arg
His Pro Gln Leu Ala Val Ser 355 360 365 Val Ile Leu Arg Val Ala Lys
Gly Tyr Gln Glu Leu Leu Glu Lys Cys 370 375 380 Phe Gln Thr Glu Asn
Pro Leu Glu Cys Gln Asp Lys Gly Glu Glu Glu 385 390 395 400 Leu Gln
Lys Tyr Ile Gln Glu Ser Gln Ala Leu Ala Lys Arg Ser Cys 405 410 415
Gly Leu Phe Gln Lys Leu Gly Glu Tyr Tyr Leu Gln Asn Ala Phe Leu 420
425 430 Val Ala Tyr Thr Lys Lys Ala Pro Gln Leu Thr Ser Ser Glu Leu
Met 435 440 445 Ala Ile Thr Arg Lys Met Ala Ala Thr Ala Ala Thr Cys
Cys Gln Leu 450 455 460 Ser Glu Asp Lys Leu Leu Ala Cys Gly Glu Gly
Ala Ala Asp Ile Ile 465 470 475 480 Ile Gly His Leu Cys Ile Arg His
Glu Met Thr Pro Val Asn Pro Gly 485 490 495 Val Gly Gln Cys Cys Thr
Ser Ser
Tyr Ala Asn Arg Arg Pro Cys Phe 500 505 510 Ser Ser Leu Val Val Asp
Glu Thr Tyr Val Pro Pro Ala Phe Ser Asp 515 520 525 Asp Lys Phe Ile
Phe His Lys Asp Leu Cys Gln Ala Gln Gly Val Ala 530 535 540 Leu Gln
Thr Met Lys Gln Glu Phe Leu Ile Asn Leu Val Lys Gln Lys 545 550 555
560 Pro Gln Ile Thr Glu Glu Gln Leu Glu Ala Val Ile Ala Asp Phe Ser
565 570 575 Gly Leu Leu Glu Lys Cys Cys Gln Gly Gln Glu Gln Glu Val
Cys Phe 580 585 590 Ala Glu Glu Gly Gln Lys Leu Ile Ser Lys Thr Arg
Ala Ala Leu Gly 595 600 605 Val 77609PRTHomo sapiens 77Met Lys Trp
Val Glu Ser Ile Phe Leu Ile Phe Leu Leu Asn Phe Thr 1 5 10 15 Glu
Ser Arg Thr Leu His Arg Asn Glu Tyr Gly Ile Ala Ser Ile Leu 20 25
30 Asp Ser Tyr Gln Cys Thr Ala Glu Ile Ser Leu Ala Asp Leu Ala Thr
35 40 45 Ile Phe Phe Ala Gln Phe Val Gln Glu Ala Thr Tyr Lys Glu
Val Ser 50 55 60 Lys Met Val Lys Asp Ala Leu Thr Ala Ile Glu Lys
Pro Thr Gly Asp 65 70 75 80 Glu Gln Ser Ser Gly Cys Leu Glu Asn Gln
Leu Pro Ala Phe Leu Glu 85 90 95 Glu Leu Cys His Glu Lys Glu Ile
Leu Glu Lys Tyr Gly His Ser Asp 100 105 110 Cys Cys Ser Gln Ser Glu
Glu Gly Arg His Asn Cys Phe Leu Ala His 115 120 125 Lys Lys Pro Thr
Pro Ala Ser Ile Pro Leu Phe Gln Val Pro Glu Pro 130 135 140 Val Thr
Ser Cys Glu Ala Tyr Glu Glu Asp Arg Glu Thr Phe Met Asn 145 150 155
160 Lys Phe Ile Tyr Glu Ile Ala Arg Arg His Pro Phe Leu Tyr Ala Pro
165 170 175 Thr Ile Leu Leu Trp Ala Ala Arg Tyr Asp Lys Ile Ile Pro
Ser Cys 180 185 190 Cys Lys Ala Glu Asn Ala Val Glu Cys Phe Gln Thr
Lys Ala Ala Thr 195 200 205 Val Thr Lys Glu Leu Arg Glu Ser Ser Leu
Leu Asn Gln His Ala Cys 210 215 220 Ala Val Met Lys Asn Phe Gly Thr
Arg Thr Phe Gln Ala Ile Thr Val 225 230 235 240 Thr Lys Leu Ser Gln
Lys Phe Thr Lys Val Asn Phe Thr Glu Ile Gln 245 250 255 Lys Leu Val
Leu Asp Val Ala His Val His Glu His Cys Cys Arg Gly 260 265 270 Asp
Val Leu Asp Cys Leu Gln Asp Gly Glu Lys Ile Met Ser Tyr Ile 275 280
285 Cys Ser Gln Gln Asp Thr Leu Ser Asn Lys Ile Thr Glu Cys Cys Lys
290 295 300 Leu Thr Thr Leu Glu Arg Gly Gln Cys Ile Ile His Ala Glu
Asn Asp 305 310 315 320 Glu Lys Pro Glu Gly Leu Ser Pro Asn Leu Asn
Arg Phe Leu Gly Asp 325 330 335 Arg Asp Phe Asn Gln Phe Ser Ser Gly
Glu Lys Asn Ile Phe Leu Ala 340 345 350 Ser Phe Val His Glu Tyr Ser
Arg Arg His Pro Gln Leu Ala Val Ser 355 360 365 Val Ile Leu Arg Val
Ala Lys Gly Tyr Gln Glu Leu Leu Glu Lys Cys 370 375 380 Phe Gln Thr
Glu Asn Pro Leu Glu Cys Gln Asp Lys Gly Glu Glu Glu 385 390 395 400
Leu Gln Lys Tyr Ile Gln Glu Ser Gln Ala Leu Ala Lys Arg Ser Cys 405
410 415 Gly Leu Phe Gln Lys Leu Gly Glu Tyr Tyr Leu Gln Asn Ala Phe
Leu 420 425 430 Val Ala Tyr Thr Lys Lys Ala Pro Gln Leu Thr Ser Ser
Glu Leu Met 435 440 445 Ala Ile Thr Arg Lys Met Ala Ala Thr Ala Ala
Thr Cys Cys Gln Leu 450 455 460 Ser Glu Asp Lys Leu Leu Ala Cys Gly
Glu Gly Ala Ala Asp Ile Ile 465 470 475 480 Ile Gly His Leu Cys Ile
Arg His Glu Met Thr Pro Val Asn Pro Gly 485 490 495 Val Gly Gln Cys
Cys Thr Ser Ser Tyr Ala Asn Arg Arg Pro Cys Phe 500 505 510 Ser Ser
Leu Val Val Asp Glu Thr Tyr Val Pro Pro Ala Phe Ser Asp 515 520 525
Asp Lys Phe Ile Phe His Lys Asp Leu Cys Gln Ala Gln Gly Val Ala 530
535 540 Leu Gln Thr Met Lys Gln Glu Phe Leu Ile Asn Leu Val Lys Gln
Lys 545 550 555 560 Pro Gln Ile Thr Glu Glu Gln Leu Glu Ala Val Ile
Ala Asp Phe Ser 565 570 575 Gly Leu Leu Glu Lys Cys Cys Gln Gly Gln
Glu Gln Glu Val Cys Phe 580 585 590 Ala Glu Glu Gly Gln Lys Leu Ile
Ser Lys Thr Arg Ala Ala Leu Gly 595 600 605 Val 78493PRTHomo
sapiens 78Met Asp Lys Phe Trp Trp His Ala Ala Trp Gly Leu Cys Leu
Val Pro 1 5 10 15 Leu Ser Leu Ala Gln Ile Asp Leu Asn Ile Thr Cys
Arg Phe Ala Gly 20 25 30 Val Phe His Val Glu Lys Asn Gly Arg Tyr
Ser Ile Ser Arg Thr Glu 35 40 45 Ala Ala Asp Leu Cys Lys Ala Phe
Asn Ser Thr Leu Pro Thr Met Ala 50 55 60 Gln Met Glu Lys Ala Leu
Ser Ile Gly Phe Glu Thr Cys Arg Tyr Gly 65 70 75 80 Phe Ile Glu Gly
His Val Val Ile Pro Arg Ile His Pro Asn Ser Ile 85 90 95 Cys Ala
Ala Asn Asn Thr Gly Val Tyr Ile Leu Thr Ser Asn Thr Ser 100 105 110
Gln Tyr Asp Thr Tyr Cys Phe Asn Ala Ser Ala Pro Pro Glu Glu Asp 115
120 125 Cys Thr Ser Val Thr Asp Leu Pro Asn Ala Phe Asp Gly Pro Ile
Thr 130 135 140 Ile Thr Ile Val Asn Arg Asp Gly Thr Arg Tyr Val Gln
Lys Gly Glu 145 150 155 160 Tyr Arg Thr Asn Pro Glu Asp Ile Tyr Pro
Ser Asn Pro Thr Asp Asp 165 170 175 Asp Val Ser Ser Gly Ser Ser Ser
Glu Arg Ser Ser Thr Ser Gly Gly 180 185 190 Tyr Ile Phe Tyr Thr Phe
Ser Thr Val His Pro Ile Pro Asp Glu Asp 195 200 205 Ser Pro Trp Ile
Thr Asp Ser Thr Asp Arg Ile Pro Ala Thr Asn Met 210 215 220 Asp Ser
Ser His Ser Ile Thr Leu Gln Pro Thr Ala Asn Pro Asn Thr 225 230 235
240 Gly Leu Val Glu Asp Leu Asp Arg Thr Gly Pro Leu Ser Met Thr Thr
245 250 255 Gln Gln Ser Asn Ser Gln Ser Phe Ser Thr Ser His Glu Gly
Leu Glu 260 265 270 Glu Asp Lys Asp His Pro Thr Thr Ser Thr Leu Thr
Ser Ser Asn Arg 275 280 285 Asn Asp Val Thr Gly Gly Arg Arg Asp Pro
Asn His Ser Glu Gly Ser 290 295 300 Thr Thr Leu Leu Glu Gly Tyr Thr
Ser His Tyr Pro His Thr Lys Glu 305 310 315 320 Ser Arg Thr Phe Ile
Pro Val Thr Ser Ala Lys Thr Gly Ser Phe Gly 325 330 335 Val Thr Ala
Val Thr Val Gly Asp Ser Asn Ser Asn Val Asn Arg Ser 340 345 350 Leu
Ser Gly Asp Gln Asp Thr Phe His Pro Ser Gly Gly Ser His Thr 355 360
365 Thr His Gly Ser Glu Ser Asp Gly His Ser His Gly Ser Gln Glu Gly
370 375 380 Gly Ala Asn Thr Thr Ser Gly Pro Ile Arg Thr Pro Gln Ile
Pro Glu 385 390 395 400 Trp Leu Ile Ile Leu Ala Ser Leu Leu Ala Leu
Ala Leu Ile Leu Ala 405 410 415 Val Cys Ile Ala Val Asn Ser Arg Arg
Arg Cys Gly Gln Lys Lys Lys 420 425 430 Leu Val Ile Asn Ser Gly Asn
Gly Ala Val Glu Asp Arg Lys Pro Ser 435 440 445 Gly Leu Asn Gly Glu
Ala Ser Lys Ser Gln Glu Met Val His Leu Val 450 455 460 Asn Lys Glu
Ser Ser Glu Thr Pro Asp Gln Phe Met Thr Ala Asp Glu 465 470 475 480
Thr Arg Asn Leu Gln Asn Val Asp Met Lys Ile Gly Val 485 490
79493PRTHomo sapiens 79Met Asp Lys Phe Trp Trp His Ala Ala Trp Gly
Leu Cys Leu Val Pro 1 5 10 15 Leu Ser Leu Ala Gln Ile Asp Leu Asn
Ile Thr Cys Arg Phe Ala Gly 20 25 30 Val Phe His Val Glu Lys Asn
Gly Arg Tyr Ser Ile Ser Arg Thr Glu 35 40 45 Ala Ala Asp Leu Cys
Lys Ala Phe Asn Ser Thr Leu Pro Thr Met Ala 50 55 60 Gln Met Glu
Lys Ala Leu Ser Ile Gly Phe Glu Thr Cys Arg Tyr Gly 65 70 75 80 Phe
Ile Glu Gly His Val Val Ile Pro Arg Ile His Pro Asn Ser Ile 85 90
95 Cys Ala Ala Asn Asn Thr Gly Val Tyr Ile Leu Thr Ser Asn Thr Ser
100 105 110 Gln Tyr Asp Thr Tyr Cys Phe Asn Ala Ser Ala Pro Pro Glu
Glu Asp 115 120 125 Cys Thr Ser Val Thr Asp Leu Pro Asn Ala Phe Asp
Gly Pro Ile Thr 130 135 140 Ile Thr Ile Val Asn Arg Asp Gly Thr Arg
Tyr Val Gln Lys Gly Glu 145 150 155 160 Tyr Arg Thr Asn Pro Glu Asp
Ile Tyr Pro Ser Asn Pro Thr Asp Asp 165 170 175 Asp Val Ser Ser Gly
Ser Ser Ser Glu Arg Ser Ser Thr Ser Gly Gly 180 185 190 Tyr Ile Phe
Tyr Thr Phe Ser Thr Val His Pro Ile Pro Asp Glu Asp 195 200 205 Ser
Pro Trp Ile Thr Asp Ser Thr Asp Arg Ile Pro Ala Thr Asn Met 210 215
220 Asp Ser Ser His Ser Ile Thr Leu Gln Pro Thr Ala Asn Pro Asn Thr
225 230 235 240 Gly Leu Val Glu Asp Leu Asp Arg Thr Gly Pro Leu Ser
Met Thr Thr 245 250 255 Gln Gln Ser Asn Ser Gln Ser Phe Ser Thr Ser
His Glu Gly Leu Glu 260 265 270 Glu Asp Lys Asp His Pro Thr Thr Ser
Thr Leu Thr Ser Ser Asn Arg 275 280 285 Asn Asp Val Thr Gly Gly Arg
Arg Asp Pro Asn His Ser Glu Gly Ser 290 295 300 Thr Thr Leu Leu Glu
Gly Tyr Thr Ser His Tyr Pro His Thr Lys Glu 305 310 315 320 Ser Arg
Thr Phe Ile Pro Val Thr Ser Ala Lys Thr Gly Ser Phe Gly 325 330 335
Val Thr Ala Val Thr Val Gly Asp Ser Asn Ser Asn Val Asn Arg Ser 340
345 350 Leu Ser Gly Asp Gln Asp Thr Phe His Pro Ser Gly Gly Ser His
Thr 355 360 365 Thr His Gly Ser Glu Ser Asp Gly His Ser His Gly Ser
Gln Glu Gly 370 375 380 Gly Ala Asn Thr Thr Ser Gly Pro Ile Arg Thr
Pro Gln Ile Pro Glu 385 390 395 400 Trp Leu Ile Ile Leu Ala Ser Leu
Leu Ala Leu Ala Leu Ile Leu Ala 405 410 415 Val Cys Ile Ala Val Asn
Ser Arg Arg Arg Cys Gly Gln Lys Lys Lys 420 425 430 Leu Val Ile Asn
Ser Gly Asn Gly Ala Val Glu Asp Arg Lys Pro Ser 435 440 445 Gly Leu
Asn Gly Glu Ala Ser Lys Ser Gln Glu Met Val His Leu Val 450 455 460
Asn Lys Glu Ser Ser Glu Thr Pro Asp Gln Phe Met Thr Ala Asp Glu 465
470 475 480 Thr Arg Asn Leu Gln Asn Val Asp Met Lys Ile Gly Val 485
490 8017PRTHomo sapiens 80Ser Thr Asp Arg Ile Pro Ala Thr Asn Met
Asp Ser Ser His Ser Ile 1 5 10 15 Thr 812401DNAArtificial
SequenceImmunoconjugate 81gaattcctgc aggtctatgg aacgataaat
gcccatgaaa attctatttc aaggagacag 60tcata atg aaa tac cta ttg cct
acg gca gcc gct gga ttg tta tta ctc 110 Met Lys Tyr Leu Leu Pro Thr
Ala Ala Ala Gly Leu Leu Leu Leu 1 5 10 15 gct gcc caa cca gcg atg
gcg cag gtg cag ctg cag gag ttg ggt cca 158Ala Ala Gln Pro Ala Met
Ala Gln Val Gln Leu Gln Glu Leu Gly Pro 20 25 30 agg ctg gtg agg
cct tca cag acc ctg atc ctc acc tgc act gtc tct 206Arg Leu Val Arg
Pro Ser Gln Thr Leu Ile Leu Thr Cys Thr Val Ser 35 40 45 gga ggc
tcc gtc agc ggc gat gag tat tac tgg agt tgg ctc cgt cag 254Gly Gly
Ser Val Ser Gly Asp Glu Tyr Tyr Trp Ser Trp Leu Arg Gln 50 55 60
acc cca ggg aag ggc ctg gag tgg att ggg tac atg tct tac aga ggg
302Thr Pro Gly Lys Gly Leu Glu Trp Ile Gly Tyr Met Ser Tyr Arg Gly
65 70 75 agc agt tat tac agt ccg tcc ctc cag agt cga gtt acc att
gca gtg 350Ser Ser Tyr Tyr Ser Pro Ser Leu Gln Ser Arg Val Thr Ile
Ala Val 80 85 90 95 gac agg tcc aag aac gaa ttt tcc ctg aag ctg acg
tct gtg act gcc 398Asp Arg Ser Lys Asn Glu Phe Ser Leu Lys Leu Thr
Ser Val Thr Ala 100 105 110 gca gac gcg gcc gta tat ttc tgt gcc aga
aaa tat tgt ggt ggc gat 446Ala Asp Ala Ala Val Tyr Phe Cys Ala Arg
Lys Tyr Cys Gly Gly Asp 115 120 125 tgc agg agt ggt ttt gat atc tgg
ggc cga ggg aca atg gtc act gtc 494Cys Arg Ser Gly Phe Asp Ile Trp
Gly Arg Gly Thr Met Val Thr Val 130 135 140 gcc agc gct agc acc aag
ggc cca tcg gtc ttc ccc ctg gca ccc tcc 542Ala Ser Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro Ser 145 150 155 tcc aag agc acc
tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag 590Ser Lys Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys 160 165 170 175 gac
tac ttc ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg 638Asp
Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu 180 185
190 acc agc ggc gtg cac acc ttc ccg gct gtc cta cag tcc tca gga ctc
686Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
195 200 205 tac tcc ctc agc agc gtg gtg acc gtg ccc tcc agc agc ttg
ggc acc 734Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu
Gly Thr 210 215 220 cag acc tac atc tgc aac gtg aat cac aag ccc agc
aac acc aag gtg 782Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser
Asn Thr Lys Val 225 230 235 gac aag aaa gtt gag ccc aaa tct tgt acc
agg cac agg cag ccc aga 830Asp Lys Lys Val Glu Pro Lys Ser Cys Thr
Arg His Arg Gln Pro Arg 240 245 250 255 ggc tgg gag cag ctc tac aac
acc gtg tca ttt aac ctt gga gaa gct 878Gly Trp Glu Gln Leu Tyr Asn
Thr Val Ser Phe Asn Leu Gly Glu Ala 260 265 270 tat gag tac ccc act
ttt ata caa gat ttg cgc aat gaa ttg gct aag 926Tyr Glu Tyr Pro Thr
Phe Ile Gln Asp Leu Arg Asn Glu Leu Ala Lys 275 280 285 ggc aca cca
gta tgt caa ctt cca gtg aca cta caa acc ata gcc gat 974Gly Thr Pro
Val Cys Gln Leu Pro Val Thr Leu Gln Thr Ile Ala Asp 290 295 300 gac
aag cga ttt gtt cta gtt gat atc act acg acc tcg aag aaa aca 1022Asp
Lys Arg Phe Val Leu Val Asp Ile Thr Thr Thr Ser Lys Lys Thr 305 310
315 gtt aag gtt gct ata gat gtg aca gat gtg tat gtt gtg ggt tat
caa
1070Val Lys Val Ala Ile Asp Val Thr Asp Val Tyr Val Val Gly Tyr Gln
320 325 330 335 gac aaa tgg gat ggc aaa gat cga gct gtt ttc ctt gac
aag gtt cct 1118Asp Lys Trp Asp Gly Lys Asp Arg Ala Val Phe Leu Asp
Lys Val Pro 340 345 350 act gtt gca act agt aaa ctt ttc cca ggg gtg
act aat cgt gta acg 1166Thr Val Ala Thr Ser Lys Leu Phe Pro Gly Val
Thr Asn Arg Val Thr 355 360 365 tta aca ttt gat ggc agc tat cag aaa
ctt gtg aat gct gcc aaa gct 1214Leu Thr Phe Asp Gly Ser Tyr Gln Lys
Leu Val Asn Ala Ala Lys Ala 370 375 380 gat aga aag gct ctc gaa ctg
ggg gtt aac aaa ttg gaa ttt tcc att 1262Asp Arg Lys Ala Leu Glu Leu
Gly Val Asn Lys Leu Glu Phe Ser Ile 385 390 395 gaa gca atc cat ggt
aaa acg ata aat ggt caa gag gca gcc aag ttc 1310Glu Ala Ile His Gly
Lys Thr Ile Asn Gly Gln Glu Ala Ala Lys Phe 400 405 410 415 ttt ctt
att gtc atc caa atg gtt tca gag gca gct cgg ttc aaa tat 1358Phe Leu
Ile Val Ile Gln Met Val Ser Glu Ala Ala Arg Phe Lys Tyr 420 425 430
att gag act gag gtg gtt gat aga gga tta tat gga tca ttc aaa cct
1406Ile Glu Thr Glu Val Val Asp Arg Gly Leu Tyr Gly Ser Phe Lys Pro
435 440 445 aat ttt aaa gta ttg aac ttg gag aac aat tgg ggc gac atc
tct gat 1454Asn Phe Lys Val Leu Asn Leu Glu Asn Asn Trp Gly Asp Ile
Ser Asp 450 455 460 gcc att cac aaa tca tcc cca caa tgt acc act att
aat ccg gca ctt 1502Ala Ile His Lys Ser Ser Pro Gln Cys Thr Thr Ile
Asn Pro Ala Leu 465 470 475 cag ttg ata agc ccc tca aat gac cca tgg
gtt gta aat aaa gtg agt 1550Gln Leu Ile Ser Pro Ser Asn Asp Pro Trp
Val Val Asn Lys Val Ser 480 485 490 495 caa att agt ccc gat atg ggt
atc ctt aag ttt aaa agc tcc aaa 1595Gln Ile Ser Pro Asp Met Gly Ile
Leu Lys Phe Lys Ser Ser Lys 500 505 510 tagtgatcta gagtcgacct
gcaggtctat ggaacgataa atgcccatga aaattctatt 1655tcaaggagac agtcata
atg aaa tac cta ttg cct acg gca gcc gct gga 1705 Met Lys Tyr Leu
Leu Pro Thr Ala Ala Ala Gly 515 520 ttg tta tta ctc gcg gcc caa ccg
gcc atg gcg cac cat cat cac cat 1753Leu Leu Leu Leu Ala Ala Gln Pro
Ala Met Ala His His His His His 525 530 535 cac tat gag ctg act cag
cca ccc tca gtg tcc gtg tcc cca gga cag 1801His Tyr Glu Leu Thr Gln
Pro Pro Ser Val Ser Val Ser Pro Gly Gln 540 545 550 aaa gcc ttc ata
acc tgc tct gga gat aac ctg ggg aat aaa tat gtg 1849Lys Ala Phe Ile
Thr Cys Ser Gly Asp Asn Leu Gly Asn Lys Tyr Val 555 560 565 tgc tgg
tat caa cag aag cca ggc cag tcc cct gtc ctg gtc atc tat 1897Cys Trp
Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 570 575 580
585 gaa gat acc aag agg ccc tca ggg atc cct gag cga ttc tct gcc tcc
1945Glu Asp Thr Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Ala Ser
590 595 600 aac tct ggg aat aca gcc act ctg acc atc agc ggg acg cag
cct ata 1993Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln
Pro Ile 605 610 615 gat gag gct gac tac tac tgt cag gcg tgg gac agc
cgc act gaa atc 2041Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp Asp Ser
Arg Thr Glu Ile 620 625 630 ttc gga act ggg acc aag gtc acc gtc cta
agt cag ccc aag gcc aac 2089Phe Gly Thr Gly Thr Lys Val Thr Val Leu
Ser Gln Pro Lys Ala Asn 635 640 645 ccc act gtc act ctg ttc ccg ccc
tcc tct gag gag ctc caa gcc aac 2137Pro Thr Val Thr Leu Phe Pro Pro
Ser Ser Glu Glu Leu Gln Ala Asn 650 655 660 665 aag gcc aca cta gtg
tgt ctg atc agt gac ttc tac ccg gga gct gtg 2185Lys Ala Thr Leu Val
Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val 670 675 680 aca gtg gcc
tgg aag gca gat ggc agc ccc gtc aag gcg gga gtg gag 2233Thr Val Ala
Trp Lys Ala Asp Gly Ser Pro Val Lys Ala Gly Val Glu 685 690 695 acc
acc aaa ccc tcc aaa cag agc aac aac aag tac gcg gcc agc agc 2281Thr
Thr Lys Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser 700 705
710 tac ctg agc ctg acg ccc gag cag tgg aag tcc cac aga agc tac agc
2329Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser
715 720 725 tgc cag gtc acg cat gaa ggg agc acc gtg gag aag aca gtg
gcc cct 2377Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val
Ala Pro 730 735 740 745 aca gaa tgt tca tag tga ctcgag 2401Thr Glu
Cys Ser 82510PRTArtificial SequenceImmunoconjugate 82Met Lys Tyr
Leu Leu Pro Thr Ala Ala Ala Gly Leu Leu Leu Leu Ala 1 5 10 15 Ala
Gln Pro Ala Met Ala Gln Val Gln Leu Gln Glu Leu Gly Pro Arg 20 25
30 Leu Val Arg Pro Ser Gln Thr Leu Ile Leu Thr Cys Thr Val Ser Gly
35 40 45 Gly Ser Val Ser Gly Asp Glu Tyr Tyr Trp Ser Trp Leu Arg
Gln Thr 50 55 60 Pro Gly Lys Gly Leu Glu Trp Ile Gly Tyr Met Ser
Tyr Arg Gly Ser 65 70 75 80 Ser Tyr Tyr Ser Pro Ser Leu Gln Ser Arg
Val Thr Ile Ala Val Asp 85 90 95 Arg Ser Lys Asn Glu Phe Ser Leu
Lys Leu Thr Ser Val Thr Ala Ala 100 105 110 Asp Ala Ala Val Tyr Phe
Cys Ala Arg Lys Tyr Cys Gly Gly Asp Cys 115 120 125 Arg Ser Gly Phe
Asp Ile Trp Gly Arg Gly Thr Met Val Thr Val Ala 130 135 140 Ser Ala
Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Ser Ser 145 150 155
160 Lys Ser Thr Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys Asp
165 170 175 Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala
Leu Thr 180 185 190 Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser
Ser Gly Leu Tyr 195 200 205 Ser Leu Ser Ser Val Val Thr Val Pro Ser
Ser Ser Leu Gly Thr Gln 210 215 220 Thr Tyr Ile Cys Asn Val Asn His
Lys Pro Ser Asn Thr Lys Val Asp 225 230 235 240 Lys Lys Val Glu Pro
Lys Ser Cys Thr Arg His Arg Gln Pro Arg Gly 245 250 255 Trp Glu Gln
Leu Tyr Asn Thr Val Ser Phe Asn Leu Gly Glu Ala Tyr 260 265 270 Glu
Tyr Pro Thr Phe Ile Gln Asp Leu Arg Asn Glu Leu Ala Lys Gly 275 280
285 Thr Pro Val Cys Gln Leu Pro Val Thr Leu Gln Thr Ile Ala Asp Asp
290 295 300 Lys Arg Phe Val Leu Val Asp Ile Thr Thr Thr Ser Lys Lys
Thr Val 305 310 315 320 Lys Val Ala Ile Asp Val Thr Asp Val Tyr Val
Val Gly Tyr Gln Asp 325 330 335 Lys Trp Asp Gly Lys Asp Arg Ala Val
Phe Leu Asp Lys Val Pro Thr 340 345 350 Val Ala Thr Ser Lys Leu Phe
Pro Gly Val Thr Asn Arg Val Thr Leu 355 360 365 Thr Phe Asp Gly Ser
Tyr Gln Lys Leu Val Asn Ala Ala Lys Ala Asp 370 375 380 Arg Lys Ala
Leu Glu Leu Gly Val Asn Lys Leu Glu Phe Ser Ile Glu 385 390 395 400
Ala Ile His Gly Lys Thr Ile Asn Gly Gln Glu Ala Ala Lys Phe Phe 405
410 415 Leu Ile Val Ile Gln Met Val Ser Glu Ala Ala Arg Phe Lys Tyr
Ile 420 425 430 Glu Thr Glu Val Val Asp Arg Gly Leu Tyr Gly Ser Phe
Lys Pro Asn 435 440 445 Phe Lys Val Leu Asn Leu Glu Asn Asn Trp Gly
Asp Ile Ser Asp Ala 450 455 460 Ile His Lys Ser Ser Pro Gln Cys Thr
Thr Ile Asn Pro Ala Leu Gln 465 470 475 480 Leu Ile Ser Pro Ser Asn
Asp Pro Trp Val Val Asn Lys Val Ser Gln 485 490 495 Ile Ser Pro Asp
Met Gly Ile Leu Lys Phe Lys Ser Ser Lys 500 505 510
83239PRTArtificial SequenceImmunoconjugate 83Met Lys Tyr Leu Leu
Pro Thr Ala Ala Ala Gly Leu Leu Leu Leu Ala 1 5 10 15 Ala Gln Pro
Ala Met Ala His His His His His His Tyr Glu Leu Thr 20 25 30 Gln
Pro Pro Ser Val Ser Val Ser Pro Gly Gln Lys Ala Phe Ile Thr 35 40
45 Cys Ser Gly Asp Asn Leu Gly Asn Lys Tyr Val Cys Trp Tyr Gln Gln
50 55 60 Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr Glu Asp Thr
Lys Arg 65 70 75 80 Pro Ser Gly Ile Pro Glu Arg Phe Ser Ala Ser Asn
Ser Gly Asn Thr 85 90 95 Ala Thr Leu Thr Ile Ser Gly Thr Gln Pro
Ile Asp Glu Ala Asp Tyr 100 105 110 Tyr Cys Gln Ala Trp Asp Ser Arg
Thr Glu Ile Phe Gly Thr Gly Thr 115 120 125 Lys Val Thr Val Leu Ser
Gln Pro Lys Ala Asn Pro Thr Val Thr Leu 130 135 140 Phe Pro Pro Ser
Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val 145 150 155 160 Cys
Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys 165 170
175 Ala Asp Gly Ser Pro Val Lys Ala Gly Val Glu Thr Thr Lys Pro Ser
180 185 190 Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser Tyr Leu Ser
Leu Thr 195 200 205 Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser Cys
Gln Val Thr His 210 215 220 Glu Gly Ser Thr Val Glu Lys Thr Val Ala
Pro Thr Glu Cys Ser 225 230 235 841601DNAArtificial
SequenceImmunoconjugate 84gaattcctgc aggtctatgg aacgataaat
gcccatgaaa attctatttc aaggagacag 60tcata atg aaa tac cta ttg cct
acg gca gcc gct gga ttg tta tta ctc 110 Met Lys Tyr Leu Leu Pro Thr
Ala Ala Ala Gly Leu Leu Leu Leu 1 5 10 15 gct gcc caa cca gcg atg
gcg cag gtg cag ctg cag gag ttg ggt cca 158Ala Ala Gln Pro Ala Met
Ala Gln Val Gln Leu Gln Glu Leu Gly Pro 20 25 30 agg ctg gtg agg
cct tca cag acc ctg atc ctc acc tgc act gtc tct 206Arg Leu Val Arg
Pro Ser Gln Thr Leu Ile Leu Thr Cys Thr Val Ser 35 40 45 gga ggc
tcc gtc agc ggc gat gag tat tac tgg agt tgg ctc cgt cag 254Gly Gly
Ser Val Ser Gly Asp Glu Tyr Tyr Trp Ser Trp Leu Arg Gln 50 55 60
acc cca ggg aag ggc ctg gag tgg att ggg tac atg tct tac aga ggg
302Thr Pro Gly Lys Gly Leu Glu Trp Ile Gly Tyr Met Ser Tyr Arg Gly
65 70 75 agc agt tat tac agt ccg tcc ctc cag agt cga gtt acc att
gca gtg 350Ser Ser Tyr Tyr Ser Pro Ser Leu Gln Ser Arg Val Thr Ile
Ala Val 80 85 90 95 gac agg tcc aag aac gaa ttt tcc ctg aag ctg acg
tct gtg act gcc 398Asp Arg Ser Lys Asn Glu Phe Ser Leu Lys Leu Thr
Ser Val Thr Ala 100 105 110 gca gac gcg gcc gta tat ttc tgt gcc aga
aaa tat tgt ggt ggc gat 446Ala Asp Ala Ala Val Tyr Phe Cys Ala Arg
Lys Tyr Cys Gly Gly Asp 115 120 125 tgc agg agt ggt ttt gat atc tgg
ggc cga ggg aca atg gtc act gtc 494Cys Arg Ser Gly Phe Asp Ile Trp
Gly Arg Gly Thr Met Val Thr Val 130 135 140 gcc agc gct agc acc aag
ggc cca tcg gtc ttc ccc ctg gca ccc tcc 542Ala Ser Ala Ser Thr Lys
Gly Pro Ser Val Phe Pro Leu Ala Pro Ser 145 150 155 tcc aag agc acc
tct ggg ggc aca gcg gcc ctg ggc tgc ctg gtc aag 590Ser Lys Ser Thr
Ser Gly Gly Thr Ala Ala Leu Gly Cys Leu Val Lys 160 165 170 175 gac
tac ttc ccc gaa ccg gtg acg gtg tcg tgg aac tca ggc gcc ctg 638Asp
Tyr Phe Pro Glu Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu 180 185
190 acc agc ggc gtg cac acc ttc ccg gct gtc cta cag tcc tca gga ctc
686Thr Ser Gly Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu
195 200 205 tac tcc ctc agc agc gtg gtg acc gtg ccc tcc agc agc ttg
ggc acc 734Tyr Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu
Gly Thr 210 215 220 cag acc tac atc tgc aac gtg aat cac aag ccc agc
aac acc aag gtg 782Gln Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser
Asn Thr Lys Val 225 230 235 gac aag aaa gtt gag ccc aaa tct tgt acc
agg cac agg cag ccc aga 830Asp Lys Lys Val Glu Pro Lys Ser Cys Thr
Arg His Arg Gln Pro Arg 240 245 250 255 ggc tgg gag cag ctc tac aac
acc gtg tca ttt aac ctt gga gaa gct 878Gly Trp Glu Gln Leu Tyr Asn
Thr Val Ser Phe Asn Leu Gly Glu Ala 260 265 270 tat gag tac ccc act
ttt ata caa gat ttg cgc aat gaa ttg gct aag 926Tyr Glu Tyr Pro Thr
Phe Ile Gln Asp Leu Arg Asn Glu Leu Ala Lys 275 280 285 ggc aca cca
gta tgt caa ctt cca gtg aca cta caa acc ata gcc gat 974Gly Thr Pro
Val Cys Gln Leu Pro Val Thr Leu Gln Thr Ile Ala Asp 290 295 300 gac
aag cga ttt gtt cta gtt gat atc act acg acc tcg aag aaa aca 1022Asp
Lys Arg Phe Val Leu Val Asp Ile Thr Thr Thr Ser Lys Lys Thr 305 310
315 gtt aag gtt gct ata gat gtg aca gat gtg tat gtt gtg ggt tat caa
1070Val Lys Val Ala Ile Asp Val Thr Asp Val Tyr Val Val Gly Tyr Gln
320 325 330 335 gac aaa tgg gat ggc aaa gat cga gct gtt ttc ctt gac
aag gtt cct 1118Asp Lys Trp Asp Gly Lys Asp Arg Ala Val Phe Leu Asp
Lys Val Pro 340 345 350 act gtt gca act agt aaa ctt ttc cca ggg gtg
act aat cgt gta acg 1166Thr Val Ala Thr Ser Lys Leu Phe Pro Gly Val
Thr Asn Arg Val Thr 355 360 365 tta aca ttt gat ggc agc tat cag aaa
ctt gtg aat gct gcc aaa gct 1214Leu Thr Phe Asp Gly Ser Tyr Gln Lys
Leu Val Asn Ala Ala Lys Ala 370 375 380 gat aga aag gct ctc gaa ctg
ggg gtt aac aaa ttg gaa ttt tcc att 1262Asp Arg Lys Ala Leu Glu Leu
Gly Val Asn Lys Leu Glu Phe Ser Ile 385 390 395 gaa gca atc cat ggt
aaa acg ata aat ggt caa gag gca gcc aag ttc 1310Glu Ala Ile His Gly
Lys Thr Ile Asn Gly Gln Glu Ala Ala Lys Phe 400 405 410 415 ttt ctt
att gtc atc caa atg gtt tca gag gca gct cgg ttc aaa tat 1358Phe Leu
Ile Val Ile Gln Met Val Ser Glu Ala Ala Arg Phe Lys Tyr 420 425 430
att gag act gag gtg gtt gat aga gga tta tat gga tca ttc aaa cct
1406Ile Glu Thr Glu Val Val Asp Arg Gly Leu Tyr Gly Ser Phe Lys Pro
435 440 445
aat ttt aaa gta ttg aac ttg gag aac aat tgg ggc gac atc tct gat
1454Asn Phe Lys Val Leu Asn Leu Glu Asn Asn Trp Gly Asp Ile Ser Asp
450 455 460 gcc att cac aaa tca tcc cca caa tgt acc act att aat ccg
gca ctt 1502Ala Ile His Lys Ser Ser Pro Gln Cys Thr Thr Ile Asn Pro
Ala Leu 465 470 475 cag ttg ata agc ccc tca aat gac cca tgg gtt gta
aat aaa gtg agt 1550Gln Leu Ile Ser Pro Ser Asn Asp Pro Trp Val Val
Asn Lys Val Ser 480 485 490 495 caa att agt ccc gat atg ggt atc ctt
aag ttt aaa agc tcc aaa 1595Gln Ile Ser Pro Asp Met Gly Ile Leu Lys
Phe Lys Ser Ser Lys 500 505 510 tagtga 160185510PRTArtificial
SequenceImmunoconjugate 85Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala
Gly Leu Leu Leu Leu Ala 1 5 10 15 Ala Gln Pro Ala Met Ala Gln Val
Gln Leu Gln Glu Leu Gly Pro Arg 20 25 30 Leu Val Arg Pro Ser Gln
Thr Leu Ile Leu Thr Cys Thr Val Ser Gly 35 40 45 Gly Ser Val Ser
Gly Asp Glu Tyr Tyr Trp Ser Trp Leu Arg Gln Thr 50 55 60 Pro Gly
Lys Gly Leu Glu Trp Ile Gly Tyr Met Ser Tyr Arg Gly Ser 65 70 75 80
Ser Tyr Tyr Ser Pro Ser Leu Gln Ser Arg Val Thr Ile Ala Val Asp 85
90 95 Arg Ser Lys Asn Glu Phe Ser Leu Lys Leu Thr Ser Val Thr Ala
Ala 100 105 110 Asp Ala Ala Val Tyr Phe Cys Ala Arg Lys Tyr Cys Gly
Gly Asp Cys 115 120 125 Arg Ser Gly Phe Asp Ile Trp Gly Arg Gly Thr
Met Val Thr Val Ala 130 135 140 Ser Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Ser Ser 145 150 155 160 Lys Ser Thr Ser Gly Gly
Thr Ala Ala Leu Gly Cys Leu Val Lys Asp 165 170 175 Tyr Phe Pro Glu
Pro Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr 180 185 190 Ser Gly
Val His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr 195 200 205
Ser Leu Ser Ser Val Val Thr Val Pro Ser Ser Ser Leu Gly Thr Gln 210
215 220 Thr Tyr Ile Cys Asn Val Asn His Lys Pro Ser Asn Thr Lys Val
Asp 225 230 235 240 Lys Lys Val Glu Pro Lys Ser Cys Thr Arg His Arg
Gln Pro Arg Gly 245 250 255 Trp Glu Gln Leu Tyr Asn Thr Val Ser Phe
Asn Leu Gly Glu Ala Tyr 260 265 270 Glu Tyr Pro Thr Phe Ile Gln Asp
Leu Arg Asn Glu Leu Ala Lys Gly 275 280 285 Thr Pro Val Cys Gln Leu
Pro Val Thr Leu Gln Thr Ile Ala Asp Asp 290 295 300 Lys Arg Phe Val
Leu Val Asp Ile Thr Thr Thr Ser Lys Lys Thr Val 305 310 315 320 Lys
Val Ala Ile Asp Val Thr Asp Val Tyr Val Val Gly Tyr Gln Asp 325 330
335 Lys Trp Asp Gly Lys Asp Arg Ala Val Phe Leu Asp Lys Val Pro Thr
340 345 350 Val Ala Thr Ser Lys Leu Phe Pro Gly Val Thr Asn Arg Val
Thr Leu 355 360 365 Thr Phe Asp Gly Ser Tyr Gln Lys Leu Val Asn Ala
Ala Lys Ala Asp 370 375 380 Arg Lys Ala Leu Glu Leu Gly Val Asn Lys
Leu Glu Phe Ser Ile Glu 385 390 395 400 Ala Ile His Gly Lys Thr Ile
Asn Gly Gln Glu Ala Ala Lys Phe Phe 405 410 415 Leu Ile Val Ile Gln
Met Val Ser Glu Ala Ala Arg Phe Lys Tyr Ile 420 425 430 Glu Thr Glu
Val Val Asp Arg Gly Leu Tyr Gly Ser Phe Lys Pro Asn 435 440 445 Phe
Lys Val Leu Asn Leu Glu Asn Asn Trp Gly Asp Ile Ser Asp Ala 450 455
460 Ile His Lys Ser Ser Pro Gln Cys Thr Thr Ile Asn Pro Ala Leu Gln
465 470 475 480 Leu Ile Ser Pro Ser Asn Asp Pro Trp Val Val Asn Lys
Val Ser Gln 485 490 495 Ile Ser Pro Asp Met Gly Ile Leu Lys Phe Lys
Ser Ser Lys 500 505 510 86799DNAArtificial SequenceImmunoconjugate
86ctagagtcga cctgcaggtc tatggaacga taaatgccca tgaaaattct atttcaagga
60gacagtcata atg aaa tac cta ttg cct acg gca gcc gct gga ttg tta
109 Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala Gly Leu Leu 1 5 10 tta
ctc gcg gcc caa ccg gcc atg gcg cac cat cat cac cat cac tat 157Leu
Leu Ala Ala Gln Pro Ala Met Ala His His His His His His Tyr 15 20
25 gag ctg act cag cca ccc tca gtg tcc gtg tcc cca gga cag aaa gcc
205Glu Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Lys Ala
30 35 40 45 ttc ata acc tgc tct gga gat aac ctg ggg aat aaa tat gtg
tgc tgg 253Phe Ile Thr Cys Ser Gly Asp Asn Leu Gly Asn Lys Tyr Val
Cys Trp 50 55 60 tat caa cag aag cca ggc cag tcc cct gtc ctg gtc
atc tat gaa gat 301Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val
Ile Tyr Glu Asp 65 70 75 acc aag agg ccc tca ggg atc cct gag cga
ttc tct gcc tcc aac tct 349Thr Lys Arg Pro Ser Gly Ile Pro Glu Arg
Phe Ser Ala Ser Asn Ser 80 85 90 ggg aat aca gcc act ctg acc atc
agc ggg acg cag cct ata gat gag 397Gly Asn Thr Ala Thr Leu Thr Ile
Ser Gly Thr Gln Pro Ile Asp Glu 95 100 105 gct gac tac tac tgt cag
gcg tgg gac agc cgc act gaa atc ttc gga 445Ala Asp Tyr Tyr Cys Gln
Ala Trp Asp Ser Arg Thr Glu Ile Phe Gly 110 115 120 125 act ggg acc
aag gtc acc gtc cta agt cag ccc aag gcc aac ccc act 493Thr Gly Thr
Lys Val Thr Val Leu Ser Gln Pro Lys Ala Asn Pro Thr 130 135 140 gtc
act ctg ttc ccg ccc tcc tct gag gag ctc caa gcc aac aag gcc 541Val
Thr Leu Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala 145 150
155 aca cta gtg tgt ctg atc agt gac ttc tac ccg gga gct gtg aca gtg
589Thr Leu Val Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val
160 165 170 gcc tgg aag gca gat ggc agc ccc gtc aag gcg gga gtg gag
acc acc 637Ala Trp Lys Ala Asp Gly Ser Pro Val Lys Ala Gly Val Glu
Thr Thr 175 180 185 aaa ccc tcc aaa cag agc aac aac aag tac gcg gcc
agc agc tac ctg 685Lys Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala Ala
Ser Ser Tyr Leu 190 195 200 205 agc ctg acg ccc gag cag tgg aag tcc
cac aga agc tac agc tgc cag 733Ser Leu Thr Pro Glu Gln Trp Lys Ser
His Arg Ser Tyr Ser Cys Gln 210 215 220 gtc acg cat gaa ggg agc acc
gtg gag aag aca gtg gcc cct aca gaa 781Val Thr His Glu Gly Ser Thr
Val Glu Lys Thr Val Ala Pro Thr Glu 225 230 235 tgt tca tag
tgactcgag 799Cys Ser 87239PRTArtificial SequenceImmunoconjugate
87Met Lys Tyr Leu Leu Pro Thr Ala Ala Ala Gly Leu Leu Leu Leu Ala 1
5 10 15 Ala Gln Pro Ala Met Ala His His His His His His Tyr Glu Leu
Thr 20 25 30 Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln Lys Ala
Phe Ile Thr 35 40 45 Cys Ser Gly Asp Asn Leu Gly Asn Lys Tyr Val
Cys Trp Tyr Gln Gln 50 55 60 Lys Pro Gly Gln Ser Pro Val Leu Val
Ile Tyr Glu Asp Thr Lys Arg 65 70 75 80 Pro Ser Gly Ile Pro Glu Arg
Phe Ser Ala Ser Asn Ser Gly Asn Thr 85 90 95 Ala Thr Leu Thr Ile
Ser Gly Thr Gln Pro Ile Asp Glu Ala Asp Tyr 100 105 110 Tyr Cys Gln
Ala Trp Asp Ser Arg Thr Glu Ile Phe Gly Thr Gly Thr 115 120 125 Lys
Val Thr Val Leu Ser Gln Pro Lys Ala Asn Pro Thr Val Thr Leu 130 135
140 Phe Pro Pro Ser Ser Glu Glu Leu Gln Ala Asn Lys Ala Thr Leu Val
145 150 155 160 Cys Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val Thr Val
Ala Trp Lys 165 170 175 Ala Asp Gly Ser Pro Val Lys Ala Gly Val Glu
Thr Thr Lys Pro Ser 180 185 190 Lys Gln Ser Asn Asn Lys Tyr Ala Ala
Ser Ser Tyr Leu Ser Leu Thr 195 200 205 Pro Glu Gln Trp Lys Ser His
Arg Ser Tyr Ser Cys Gln Val Thr His 210 215 220 Glu Gly Ser Thr Val
Glu Lys Thr Val Ala Pro Thr Glu Cys Ser 225 230 235
* * * * *
References