U.S. patent application number 14/615355 was filed with the patent office on 2015-07-09 for methods and compositions related to mutant kunitz domain i of tfpi-2.
The applicant listed for this patent is The Regents of the University of California. Invention is credited to S. Paul Bajaj.
Application Number | 20150191528 14/615355 |
Document ID | / |
Family ID | 38218885 |
Filed Date | 2015-07-09 |
United States Patent
Application |
20150191528 |
Kind Code |
A1 |
Bajaj; S. Paul |
July 9, 2015 |
METHODS AND COMPOSITIONS RELATED TO MUTANT KUNITZ DOMAIN I OF
TFPI-2
Abstract
Disclosed are methods and compositions relating to plasmin
inhibition.
Inventors: |
Bajaj; S. Paul; (Los
Angeles, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Regents of the University of California |
Oakland |
CA |
US |
|
|
Family ID: |
38218885 |
Appl. No.: |
14/615355 |
Filed: |
February 5, 2015 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12087296 |
Jun 30, 2008 |
8993719 |
|
|
PCT/US2006/062723 |
Dec 29, 2006 |
|
|
|
14615355 |
|
|
|
|
60754731 |
Dec 29, 2005 |
|
|
|
Current U.S.
Class: |
530/402 ;
536/23.5 |
Current CPC
Class: |
A01K 2227/105 20130101;
C07K 14/8114 20130101; A61P 41/00 20180101; A61P 7/00 20180101;
A61P 29/00 20180101; A61P 9/10 20180101; A01K 2267/0375 20130101;
A61P 7/04 20180101; A61P 17/02 20180101; A61P 35/00 20180101; A61P
19/02 20180101; A61P 43/00 20180101; A01K 2217/05 20130101; A61P
19/00 20180101; A61P 9/00 20180101; A61P 19/08 20180101; A61K 48/00
20130101 |
International
Class: |
C07K 14/81 20060101
C07K014/81 |
Goverment Interests
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH
[0001] This invention was made with government support under NIH
Grants HL-70369, HL 64119, and HL-36365. Therefore, the United
States Government may have certain rights in this invention.
Claims
1. A polypeptide comprising the amino acid sequence set forth in
SEQ ID NO:1 or a sequence having at least 79% identity with SEQ ID
NO:1, with a leucine to arginine, serine, threonine, asparagine,
histidine or lysine substitution at position 17, using BPTI
numbering system; wherein the polypeptide inhibits plasmin activity
and has decreased anticoagulation activity as compared to a wild
type KDI polypeptide.
2. The polypeptide of claim 1, wherein the amino acid sequence has
at least 80% identity to SEQ ID NO:1.
3. The polypeptide of claim 1, wherein the amino acid sequence has
at least 81% identity to SEQ ID NO:1.
4. The polypeptide of claim 1, wherein the amino acid sequence has
at least 82% identity to SEQ ID NO:1.
5. The polypeptide of claim 2, which comprises a tyrosine to
glutamic acid substitution at position 46.
6. The polypeptide of claim 1, which comprises a tyrosine to
threonine substitution at position 11.
7. The polypeptide of claim 1, which comprises an aspartic acid to
tyrosine substitution at position 10.
8. The polypeptide of claim 1, which comprises an aspartic acid to
glutamic acid substitution at position 10.
9. The polypeptide of claim 1, which comprises an alanine to
methionine, glycine or serine substitution at position 16.
10. The polypeptide of claim 1, which comprises a leucine to
arginine substitution at position 17.
11. The polypeptide of claim 10, which comprises a tyrosine to
threonine substitution at position 11.
12. The polypeptide of claim 1, which comprises one or more
mutations selected from the group consisting of: a tyrosine to
threonine substitution at position 11, an alanine to methionine,
glycine, or serine substitution at position 16, and an aspartic
acid to tyrosine or glutamic acid substitution at position 10.
13. A composition comprising the polypeptide of claim 1.
14. A nucleic acid encoding the polypeptide of claim 1.
Description
STATEMENT REGARDING SEQUENCE LISTING
[0002] The Sequence Listing associated with this application is
provided in text format in lieu of a paper copy, and is hereby
incorporated by reference into the specification. The name of the
text file containing the Sequence Listing is
720156.sub.--401D1_SEQUENCE_LISTING.txt. The text file is 3.9 KB,
was created on Feb. 4, 2015, and is being submitted electronically
via EFS-Web.
BACKGROUND OF THE INVENTION
[0003] The agent mainly responsible for fibrinolysis is plasmin,
the activated form of plasminogen. Many substances can activate
plasminogen, including activated Hageman factor, streptokinase,
urokinase (uPA), tissue-type plasminogen activator (tPA), and
plasma kallikrein (pKA). pKA is both an activator of the zymogen
form of urokinase and a direct plasminogen activator.
[0004] Plasmin is undetectable in normal circulating blood, but
plasminogen, the zymogen, is present at about 3 .mu.M. An
additional, unmeasured amount of plasminogen is bound to fibrin and
other components of the extracellular matrix and cell surfaces.
Normal blood contains the physiological inhibitor of plasmin,
.alpha.2-plasmin inhibitor (.alpha.2-PI), at about 2 .mu.M. Plasmin
and .alpha.2-PI form a 1:1 complex. Matrix or cell bound-plasmin is
relatively inaccessible to inhibition by .alpha.2-PI. Thus,
activation of plasmin can exceed the neutralizing capacity of
.alpha.2-PI causing a profibrinolytic state.
[0005] Plasmin, once formed, degrades fibrin clots, sometimes
prematurely; digests fibrinogen (the building material of clots)
impairing hemostasis by causing formation of friable, easily lysed
clots from the degradation products, and inhibition of platelet
adhesion/aggregation by the fibrinogen degradation products;
interacts directly with platelets to cleave glycoproteins Ib and
IIb/IIIa preventing adhesion to injured endothelium in areas of
high shear blood flow and impairing the aggregation response needed
for platelet plug formation (ADEL86); proteolytically inactivates
enzymes in the extrinsic coagulation pathway further promoting a
prolytic state.
[0006] Inappropriate fibrinolysis and fibrinogenolysis leading to
excessive bleeding is a frequent complication of surgical
procedures that require extracorporeal circulation, such as
cardiopulmonary bypass, and is also encountered in thrombolytic
therapy and organ transplantation, particularly liver. Other
clinical conditions characterized by high incidence of bleeding
diathesis include liver cirrhosis, amyloidosis, acute promyelocytic
leukemia, and solid tumors. Restoration of hemostasis requires
infusion of plasma and/or plasma products, which risks
immunological reaction and exposure to pathogens, e.g. hepatitis
virus and HIV.
[0007] Very high blood loss can resist resolution even with massive
infusion. When judged life-threatening, the hemorrhage is treated
with antifibrinolytics such as .epsilon.-amino caproic acid (See
HOOV93) (EACA), tranexamic acid, or aprotinin (NEUH89). Aprotinin
is also known as Trasylol.RTM. and as Bovine Pancreatic Trypsin
Inhibitor (BPTI). Hereinafter, aprotinin will be referred to as
"BPTI." EACA and tranexamic acid only prevent plasmin from binding
fibrin by binding the kringles, thus leaving plasmin as a free
protease in plasma. BPTI is a direct inhibitor of plasmin and is
the most effective of these agents. Due to the potential for
thrombotic complications, renal toxicity and, in the case of BPTI,
immunogenicity, these agents are used with caution and usually
reserved as a "last resort" (PUTT89). All three of the
antifibrinolytic agents lack target specificity and affinity and
interact with tissues and organs through uncharacterized metabolic
pathways. The large doses required due to low affinity, side
effects due to lack of specificity and potential for immune
reaction and organ/tissue toxicity augment against use of these
antifibrinolytics prophylactically to prevent bleeding or as a
routine postoperative therapy to avoid or reduce transfusion
therapy. Thus, there is a need for a safe antifibrinolytic.
[0008] Excessive bleeding can result from deficient coagulation
activity, elevated fibrinolytic activity, or a combination of the
two conditions. In most bleeding diatheses one must control the
activity of plasmin. The clinically beneficial effect of bovine
pancreatic trypsin inhibitor (BPTI) in reducing blood loss is
thought to result from its inhibition of plasmin (Kd approximately
0.3 nM) or of plasma kallikrein (Kd approximately 100 nM) or both
enzymes.
[0009] Interestingly, BPTI-induced hypersensitivity reaction occurs
in about 1.2 to 2.7 percent of patients reexposed to aprotinin
(30). Of these reactions 50 percent are life threatening with 9
percent fatality rate (30). Thus, a human molecule that is
selectively modified to make it more potent is highly desirable.
Such molecule is also expected to be less immunogenic. Side effects
and toxicity issues for the use of BPTI have recently been outlined
(Manago et al., N Engl J Med 2006; 354:353-65). Textilinin has also
been compared with aprotinin, however, textilinin is a snake
protein and therefore has immunogenecity issues associated with it.
(Pathophysiol Haemost Thromb. 2005; 34 (4-5): 188-93 and U.S. Pat.
No. 7,070,969).
[0010] What is needed in the art is a plasmin inhibitor that is as
potent (or more potent) than BPTI, but that is almost identical to
a human protein domain, thereby offering similar therapeutic
potential but posing less potential for antigenicity.
SUMMARY OF THE INVENTION
[0011] In accordance with the purpose(s) of this invention, as
embodied and broadly described herein, this invention, in one
aspect, relates to a polypeptide comprising SEQ ID NO:1 with one or
more mutations. For example, provided herein is SEQ ID NO:1 with
one or more of the following substitutions: leucine is changed to
arginine or lysine at position 17 (BPTI numbering); tyrosine is
changed to glutamic acid at position 46; tyrosine is changed to
threonine at position 11; aspartic acid is changed to tyrosine or
glutamic acid at position 10; alanine is changed to methionine at
position 16; alanine is changed to glycine at position 16; alanine
is changed to serine at position 16.
[0012] Also disclosed herein are the polypeptides that inhibit
plasmin. Also disclosed herein are polypeptides that inhibit
plasmin and have reduced anticoagulation activity compared to the
wild type Kunitz domain of TFPI-2. Also disclosed herein are
polypeptides that are specific as antifibrinolytic agents.
[0013] Also disclosed are compositions comprising the polypeptides
discussed herein.
[0014] Also disclosed are nucleic acids encoding the polypeptides
disclosed herein.
[0015] Also disclosed are methods of inhibiting at least one
activity of plasmin comprising contacting plasmin with an effective
amount of a polypeptide disclosed herein.
[0016] Also disclosed is a method of treating a subject in need of
inhibition of a plasmin activity, comprising administering to the
subject an effective amount of a polypeptide disclosed herein.
Examples of diseases, disorders, and treatments relating to the
need of inhibition of plasmin include, but are not limited to,
tumorogenesis, angiogenesis, bone remodeling, surgery, hemophilia,
orthopedic surgery, coronary artery bypass grafting (CABG), and
systemic inflammatory response syndrome (SIRS).
[0017] Also disclosed is a method of treating rheumatoid arthritis
in a subject in need thereof, comprising administering to the
subject an effective amount of a polypeptide disclosed herein.
[0018] Also disclosed is a method of identifying a plasmin
inhibitor comprising: modeling a crystal structure of plamsin with
a variant of KD1; determining interaction between the plasmin and
the variant of KD1; based on results of the interaction,
determining if the variant of KD1 is a plasmin inhibitor.
[0019] Also disclosed is a method of inhibiting plasmin in a
subject in need thereof comprising administering to the subject an
effective amount of the nucleic acid disclosed herein.
BRIEF DESCRIPTION OF THE DRAWINGS
[0020] The accompanying drawings, which are incorporated in and
constitute a part of this specification, illustrate embodiments of
the invention and together with the description, serve to explain
the principles of the invention.
[0021] FIG. 1 shows a model of BPTI and KD1 (Kunitz domain of
TFPI-2) with plasmin. Top shows the sequence alignment of BPTI (SEQ
ID NO:5) KD1 (amino acids 10-67 of SEQ ID NO:1) I (SEQ ID NO: 6).
Addition of 9 to the sequence will result in KD1 numbering. In the
model, plasmin, BPTI and KD1 are shown as ribbons. Plasmin residues
are shown with a suffix p. On the left is the BPTI:plasmin complex
and on the right is the KD1:plasmin complex. Residues 9,11,22,33
and 35 both in the BPTI and KD1 form the hydrophobic core. The
hydrophobic patch in BPTI as well as in KD1 comprised of residues
17, 8, 19, and 34 is shown interacting with the hydrophobic patch
in plasmin consisting of residues 37{583}, 39{585}, and 41 {587}.
Glu39 of the acidic patch in KD1 interacts directly with Arg175
{719} and possibly through water molecules to Arg100 {644} and
Arg221 {767} of the basic patch in plasmin; since in BPTI residue
39 is Arg, such interactions with plasmin are not possible. Tyr46
of KD1 interacts with Lys60A {607} and Arg60D {610} in plasmin;
since residue 46 is Lys in BPTI, such interactions are not
possible. Arg17 in BPTI interacts with Glu73 {623} in plasmin;
since residue 17 is Leu in KD1, such interaction are not possible.
Thr11 in BPTI makes H-bond with the side chain N of Gln192 {738};
since residue 11 is Tyr in KD1, such interactions are not possible.
Residue 192 is not shown in the figure. Also not shown is the
residue 20, which is Arg in both BPTI and KD1 that interacts with
the Glu60 {606} in plasmin. The P1 residue 15 in BPTI is Lys that
interacts with the side chain O of Ser190 (736} and Asp189 {735}
through a water molecule is shown. The P1 residue 15 in KD1 is Arg
that also interacts with Ser190 and Asp 189 in plasmin is shown.
The numbering system used for plasmin is that of chymotrypsin.
Where insertions occur, the chymotrypsin numbering is followed by a
capital letter such as 60A and 60D. The numbers in curly brackets
represent plasminogen numbering.
[0022] FIG. 2 shows control experiments showing Inhibition of
Plasmin by BPTI at different times (0.5 & 1 hr) and substrate
(S-2251) concentrations (0.5 & 1 mM). BPTI binds plasmin with
an apparent dissociation constant Kd of 1.+-.0.5). Also there does
not seem to be any substrate-induced displacement of the bound
inhibitor.
[0023] FIG. 3 shows inhibition of plasmin by WTKD1 at different
times (0.5 and 1 hr) and substrate concentrations (0.5 and 1 mM)
WTKD1 binds plasmin with an apparent Kd of 22.+-.2 nM. Also there
is not any significant substrate induced displacement of
inhibitor.
[0024] FIG. 4 shows inhibition of plasmin by WTKD1, R15K/L17R and
R15K (note that in the figures, R24K=R15K and L26R=L17R, where R24K
and L26R are KD1 numbering, and R15K and L26R are BPTI numbering).
The incubation time was 1 hr at 37.degree. C. and substrate
concentration was 1 mM for the remaining activity measurements. The
R15K/L17R mutant inhibits plasmin with an apparent Kd of 3.+-.1 nM.
The R24K mutant inhibits plasmin with a Kd of 9-11 nM. The WT KD1
inhibits plasmin with a Kd of 22 nM, which is two-fold different
from the Kd of 10.+-.2 nM for the R24K mutant. The L26R (L17R in
BPTI numbering) gave KD value of 6.+-.2, which is .about.4-fold
better than the WT KD1.
[0025] FIG. 5 shows an example wherein surface activator plus
phospholipid was mixed with normal human plasma in equal amounts
(75 microliter). Ten microliter of buffer containing inhibitor (KD1
wt, KD1 L26R or BPTI) was added and the sample incubated for five
minutes at 37.degree. C. Seventy-five microliter of 25 mM
CaCl.sub.2 prewarmed to 37.degree. C. was then added and the time
needed to form the clot through the intrinsic pathway of blood
coagulation was noted. The data show that KD1 WT and BPTI each
inhibit the intrinsic pathway of coagulation whereas L26R mutant
(L17R in BPTI numbering) of KD1 is ineffective in this regard.
Similarly, the extrinsic pathway of coagulation is expected not to
be inhibited by the L26R change.
[0026] FIG. 6 shows both wt KD1 and L26R inhibited mouse plasmin
effectively. The WtKd1 and the L26R mutant are quite effective in
inhibiting mouse plasmin with an apparent KD value of .about.80 nM.
Complete inhibition was obtained at 1 .mu.M for both wt and L26R
KD1.
DETAILED DESCRIPTION OF THE INVENTION
[0027] The present invention may be understood more readily by
reference to the following detailed description of preferred
embodiments of the invention and the examples included therein and
to the figures and their previous as well as the following
description.
A. DEFINITIONS
[0028] As used in the specification and the appended claims, the
singular forms "a," "an" and "the" include plural referents unless
the context clearly dictates otherwise. Thus, for example,
reference to "a small molecule" includes mixtures of one or more
small molecules, and the like.
[0029] Ranges may be expressed herein as from "about" one
particular value, and/or to "about" another particular value. When
such a range is expressed, another embodiment includes from the one
particular value and/or to the other particular value. Similarly,
when values are expressed as approximations, by use of the
antecedent "about," it will be understood that the particular value
forms another embodiment. It will be further understood that the
endpoints of each of the ranges are significant both in relation to
the other endpoint, and independently of the other endpoint.
[0030] The terms "higher," "increases," "elevates," or "elevation"
refer to increases above basal levels, e.g., as compared to a
control. The terms "low," "lower," "reduces," or "reduction" refer
to decreases below basal levels, e.g., as compared to a
control.
B. METHODS OF USING
[0031] Bovine pancreatic trypsin inhibitor (BPTI) is a Kunitz-type
serine protease inhibitor. It inhibits plasmin and it is being used
in open heart surgery and recommended in orthopaedic surgery to
minimize preoperative bleeding and administration of blood products
(1-5). Recently, plasminogen/plasmin system has also been
implicated in development of the rheumatoid arthritis (6-10) as
well as in bone remodeling and resorption (11-15) and tumorogenesis
and angiogenesis (8, 16, 17).
[0032] Human tissue factor pathway inhibitor-2 (TFPI-2), also known
as matrix serine protease inhibitor or placental protein 5,
contains three Kunitz-type (similar to BPTI) domains in tandem with
a short acidic amino terminus and very basic C-terminal tail
(18,19). A variety of cells, including keratinocytes, dermal
fibroblasts, smooth muscle cells, syncytiotrophoblasts,
synovioblasts, and endothelial cells synthesize and secrete TFPI-2
into the extracellular matrix (ECM) (20-23). TFPI-2 is found in
three forms due to differences in glycosylation with Mr 27,000,
30,000 and 32,000(24). First Kunitz domain (KD1) of human TFPI-2 is
homologous to BPTI and it also inhibits plasmin (25). Although KD1
is specific for inhibiting plasmin, the other two Kunitz domains in
TFPI-2 have no discernable inhibitory activity. The C-terminal
basic tail, however, may anchor TFPI-2 to the glycosamine moieties
in the ECM for localized inhibition of plasmin.
[0033] The crystal structure of BPTI (26) and that of the KD1 (27)
with trypsin have been determined. The crystal structure of the
protease domain of human plasmin has also been determined (28).
Using these structures as templates, the complexes of plasmin with
BPTI as well as plasmin and KD1 have been modeled with a high
degree of accuracy. The relative positions of the inhibitors and
the proteinase domain of plasmin were maintained and minor
adjustments were only made in the side chains. Hydrophobic/van der
Waals, hydrogen bonds, and ionic interactions were observed between
each proteinase-inhibitor complex. All of these interactions were
taken into consideration in evaluating each inhibitor-proteinase
complex, and it was assumed that all potential hydrogen bond donors
and acceptors would participate in these interactions. Bulk solvent
was excluded from the proteinase-inhibitor complex and,
accordingly, it was anticipated that hydrogen bonds and ionic
interactions that may play an important role in specificity could
be accurately evaluated. The protocols for modeling these complexes
have been described earlier (29).
[0034] FIG. 1 depicts the residues in BPTI and KD1 that interacts
with plasmin. From the models presented in FIG. 1, changing Leu17
to Arg, and Tyr11 to Thr in KD1 yields a molecule that has
significantly higher affinity and specificity towards human
plasmin. Changing Tyr46 to Glu and Asp10 to Tyr (or Glu) also
increases affinity and specificity towards inhibiting plasmin. On
the other hand, changing Glu39 to Arg and Tyr46 to Lys can result
in substantial loss of affinity of KD1 for the human plasmin.
Systematically, changing those residues that result in gain of
function such as modified KD1 with Thr11 and Arg17 yields a
molecule that is more potent than BPTI and native KD1. Such a
molecule can also be less immunogenic than BPTI. The basic tail to
the selective molecule can also be added to the C-terminal
containing few extra residues as a linker such that its half-life
in the extracellular matrix is increased. Herein disclosed are
methods of inhibiting at least one activity of plasmin comprising
contacting plasmin with an effective amount of a polypeptide
disclosed herein.
[0035] Some forms of the disclosed molecules and polypeptides can
inhibit plasmin but have reduced anticoagulation activity compared
to the wild type Kunitz domain of TFPI-2. Some forms of the
disclosed molecules and polypeptides are also specific as
antifibrinolytic agents. Thus, some forms of the disclosed
molecules and polypeptides are more active as antifibrinoltic
agents but no longer have anticoagulant activity or have reduced
anticoagulant activity. This property makes such molecules and
polypeptides quite useful for preventing bleeding.
[0036] Also disclosed is a method of treating a subject in need of
inhibition of a plasmin activity, comprising administering to the
subject an effective amount of a polypeptide disclosed herein.
Examples of diseases, disorders, and treatments relating to the
need of inhibition of plasmin include, but are not limited to,
tumorogenesis, angiogenesis, bone remodeling, surgery, hemophilia,
orthopedic surgery, coronary artery bypass grafting (CABG), and
systemic inflammatory response syndrome (SIRS).
Also disclosed is a method of treating rheumatoid arthritis in a
subject in need thereof, comprising administering to the subject an
effective amount of a polypeptide disclosed herein.
[0037] Also disclosed is a method of identifying a plasmin
inhibitor comprising: modeling a crystal structure of plamsin with
a variant of KD1; determining interaction between the plasmin and
the variant of KD1; based on the interaction, determining if the
variant of KD1 is a plasmin inhibitor.
[0038] Also disclosed is a method of inhibiting plasmin in a
subject in need thereof comprising administering to the subject an
effective amount of the nucleic acid disclosed herein.
[0039] Also disclosed is a method of showing efficacy of a compound
for human use in a mosue model of reduced blood loss. It has been
discovered that wild-type KD1 and the disclosed mutants both
inhibit mouse plasmin (see Example 3). Thus, the mutant can be used
to show efficacy in a mouse model of reduced blood loss.
[0040] Proteins of this invention may be produced by any
conventional technique, including nonbiological synthesis by
sequential coupling of components, e.g., amino acids, production by
recombinant DNA techniques in suitable host cells, and
semisynthesis, for example, by removal of undesired sequences and
coupling of synthetic replacement sequences. Proteins disclosed
herein are preferably produced, recombinantly, in a suitable host,
such as bacteria from the genera Bacillus, Escherichia, Salmonella,
Erwinia, and yeasts from the genera Hansenula, Kluyveromyces,
Pichia, Rhinosporidium, Saccharomyces, and Schizosaccharomyces, or
cultured mammalian cells such as COS-1. The more preferred hosts
are microorganisms of the species Pichia pastoris, Bacillus
subtilis, Bacillus brevis, Saccharomyces cerevisiae, Escherichia
coli and Yarrowia lipolytica. Any promoter which is functional in
the host cell may be used to control gene expression.
[0041] The proteins can be secreted and can be obtained from
conditioned medium. Secretion is the preferred route because
proteins are more likely to fold correctly and can be produced in
conditioned medium with few contaminants. Secretion is not
required.
[0042] Proteins designed to lack N-linked glycosylation sites to
reduce potential for antigenicity of glycogroups can be used, and
so that equivalent proteins can be expressed in a wide variety of
organisms including: 1) E. coli, 2) B. subtilis, 3) P. pastoris, 4)
S. cerevisiae, and 5) mammalian cells.
[0043] Several means exist for reducing the problem of host cells
producing proteases that degrade the recombinant product.
Overexpression of the B. subtilis signal peptidase in E. coli leads
to increased expression of a heterologous fusion protein. It has
also been reported that addition of PMSF (a serine proteases
inhibitor) to the culture medium improved the yield of a fusion
protein.
[0044] Other factors that can affect production of these and other
proteins disclosed herein include: 1) codon usage (optimizing
codons for the host is preferred), 2) signal sequence, 3)
amino-acid sequence at intended processing sites, presence and
localization of processing enzymes, deletion, mutation, or
inhibition of various enzymes that might alter or degrade the
engineered product and mutations that make the host more permissive
in secretion (permissive secretion hosts are preferred).
[0045] Reference works on the general principles of recombinant DNA
technology include Watson et al., Molecular Biology of the Gene,
Volumes I and II, The Benjamin/Cummings Publishing Company, Inc.,
Menlo Park, Calif. (1987); Darnell et al., Molecular Cell Biology,
Scientific American Books, Inc., New York, N.Y. (1986); Lewin,
Genes II, John Wiley & Sons, New York, N.Y. (1985); Old, et
al., Principles of Gene Manipulation: An Introduction to Genetic
Engineering, 2d edition, University of California Press, Berkeley,
Calif. (1981); Sambrook et al., Molecular Cloning: A Laboratory
Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
(1989); and Ausubel et al, Current Protocols in Molecular Biology,
Wiley Interscience, N.Y., (1987, 1992). These references are herein
entirely incorporated by reference as are the references cited
therein.
[0046] Any suitable method can be used to test the compounds of
this invention. Scatchard (Ann NY Acad Sci (1949) 51:660-669)
described a classical method of measuring and analyzing binding
which is applicable to protein binding. This method requires
relatively pure protein and the ability to distinguish bound
protein from unbound.
[0047] A second appropriate method of measuring Kd is to measure
the inhibitory activity against the enzyme. If the Kd to be
measured is in the 1 nM to 1 .mu.M range, this method requires
chromogenic or fluorogenic substrates and tens of micrograms to
milligrams of relatively pure inhibitor. For the proteins of this
invention, having Kd in the range 5 nM to 50 pM, nanograms to
micrograms of inhibitor suffice. When using this method, the
competition between the inhibitor and the enzyme substrate can give
a measured Ki that is higher than the true Ki.
[0048] A third method of determining the affinity of a protein for
a second material is to have the protein displayed on a genetic
package, such as M13, and measure the ability of the protein to
adhere to the immobilized "second material." This method is highly
sensitive because the genetic packages can be amplified. Inhibitors
of known affinity for the protease are used to establish standard
profiles against which other phage-displayed inhibitors are judged.
Any other suitable method of measuring protein binding can also be
used.
[0049] The proteins of this invention can have a Kd for plasmin of
at most about 5 nM, at most about 300 pM, or 100 pM or less. The
binding can be inhibitory so that Ki is the same as Kd. The Ki of
QS4 for plasmin is about 2 nM. The Ki of SPI11 for plasmin is about
88 pM.
[0050] The compositions disclosed herein can be administered in
vivo in a pharmaceutically acceptable carrier. By "pharmaceutically
acceptable" is meant a material that is not biologically or
otherwise undesirable, i.e., the material may be administered to a
subject, along with the nucleic acid or vector, without causing any
undesirable biological effects or interacting in a deleterious
manner with any of the other components of the pharmaceutical
composition in which it is contained. The carrier would naturally
be selected to minimize any degradation of the active ingredient
and to minimize any adverse side effects in the subject, as would
be well known to one of skill in the art.
[0051] The compositions may be administered orally, parenterally
(e.g., intravenously), by intramuscular injection, by
intraperitoneal injection, transdermally, extracorporeally,
topically or the like, including topical intranasal administration
or administration by inhalant. As used herein, "topical intranasal
administration" means delivery of the compositions into the nose
and nasal passages through one or both of the nares and can
comprise delivery by a spraying mechanism or droplet mechanism, or
through aerosolization of the nucleic acid or vector.
Administration of the compositions by inhalant can be through the
nose or mouth via delivery by a spraying or droplet mechanism.
Delivery can also be directly to any area of the respiratory system
(e.g., lungs) via intubation. The exact amount of the compositions
required will vary from subject to subject, depending on the
species, age, weight and general condition of the subject, the
severity of the allergic disorder being treated, the particular
nucleic acid or vector used, its mode of administration and the
like. Thus, it is not possible to specify an exact amount for every
composition. However, an appropriate amount can be determined by
one of ordinary skill in the art using only routine experimentation
given the teachings herein.
[0052] Parenteral administration of the composition, if used, is
generally characterized by injection. Injectables can be prepared
in conventional forms, either as liquid solutions or suspensions,
solid forms suitable for solution of suspension in liquid prior to
injection, or as emulsions. A more recently revised approach for
parenteral administration involves use of a slow release or
sustained release system such that a constant dosage is maintained.
See, e.g., U.S. Pat. No. 3,610,795, which is incorporated by
reference herein.
[0053] The materials may be in solution, suspension (for example,
incorporated into microparticles, liposomes, or cells). These may
be targeted to a particular cell type via antibodies, receptors, or
receptor ligands. The following references are examples of the use
of this technology to target specific proteins to tumor tissue
(Senter et al., Bioconjugate Chem., 2:447-451, (1991); Bagshawe, K.
D., Br. J. Cancer, 60:275-281, (1989); Bagshawe et al., Br. J.
Cancer, 58:700-703, (1988); Senter et al., Bioconjugate Chem.,
4:3-9, (1993); Battelli et al., Cancer Immunol. Immunother.,
35:421-425, (1992); Pietersz and McKenzie, Immunolog. Reviews,
129:57-80, (1992); and Roffler et al., Biochem. Pharmacol,
42:2062-2065, (1991)). Vehicles such as "stealth" and other
antibody conjugated liposomes (including lipid mediated drug
targeting to colonic carcinoma), receptor mediated targeting of DNA
through cell specific ligands, lymphocyte directed tumor targeting,
and highly specific therapeutic retroviral targeting of murine
glioma cells in vivo. The following references are examples of the
use of this technology to target specific proteins to tumor tissue
(Hughes et al., Cancer Research, 49:6214-6220, (1989); and
Litzinger and Huang, Biochimica et Biophysica Acta, 1104:179-187,
(1992)). In general, receptors are involved in pathways of
endocytosis, either constitutive or ligand induced. These receptors
cluster in clathrin-coated pits, enter the cell via clathrin-coated
vesicles, pass through an acidified endosome in which the receptors
are sorted, and then either recycle to the cell surface, become
stored intracellularly, or are degraded in lysosomes. The
internalization pathways serve a variety of functions, such as
nutrient uptake, removal of activated proteins, clearance of
macromolecules, opportunistic entry of viruses and toxins,
dissociation and degradation of ligand, and receptor-level
regulation. Many receptors follow more than one intracellular
pathway, depending on the cell type, receptor concentration, type
of ligand, ligand valency, and ligand concentration. Molecular and
cellular mechanisms of receptor-mediated endocytosis has been
reviewed (Brown and Greene, DNA and Cell Biology 10:6, 399-409
(1991)).
[0054] The compositions disclosed herein can be used
therapeutically in combination with a pharmaceutically acceptable
carrier.
[0055] Suitable carriers and their formulations are described in
Remington: The Science and Practice of Pharmacy (19th ed.) ed. A.
R. Gennaro, Mack Publishing Company, Easton, Pa. 1995. Typically,
an appropriate amount of a pharmaceutically-acceptable salt is used
in the formulation to render the formulation isotonic. Examples of
the pharmaceutically-acceptable carrier include, but are not
limited to, saline, Ringer's solution and dextrose solution. The pH
of the solution is preferably from about 5 to about 8, and more
preferably from about 7 to about 7.5. Further carriers include
sustained release preparations such as semipermeable matrices of
solid hydrophobic polymers containing the antibody, which matrices
are in the form of shaped articles, e.g., films, liposomes or
microparticles. It will be apparent to those persons skilled in the
art that certain carriers may be more preferable depending upon,
for instance, the route of administration and concentration of
composition being administered.
[0056] Pharmaceutical carriers are known to those skilled in the
art. These most typically would be standard carriers for
administration of drugs to humans, including solutions such as
sterile water, saline, and buffered solutions at physiological pH.
The compositions can be administered intramuscularly or
subcutaneously. Other compounds will be administered according to
standard procedures used by those skilled in the art.
[0057] Pharmaceutical compositions may include carriers,
thickeners, diluents, buffers, preservatives, surface active agents
and the like in addition to the molecule of choice. Pharmaceutical
compositions may also include one or more active ingredients such
as antimicrobial agents, antiinflammatory agents, anesthetics, and
the like.
[0058] The pharmaceutical composition may be administered in a
number of ways depending on whether local or systemic treatment is
desired, and on the area to be treated. Administration may be
topically (including ophthalmically, vaginally, rectally,
intranasally), orally, by inhalation, or parenterally, for example
by intravenous drip, subcutaneous, intraperitoneal or intramuscular
injection. The disclosed antibodies can be administered
intravenously, intraperitoneally, intramuscularly, subcutaneously,
intracavity, or transdermally.
[0059] Preparations for parenteral administration include sterile
aqueous or non-aqueous solutions, suspensions, and emulsions.
Examples of non-aqueous solvents are propylene glycol, polyethylene
glycol, vegetable oils such as olive oil, and injectable organic
esters such as ethyl oleate. Aqueous carriers include water,
alcoholic/aqueous solutions, emulsions or suspensions, including
saline and buffered media. Parenteral vehicles include sodium
chloride solution, Ringer's dextrose, dextrose and sodium chloride,
lactated Ringer's, or fixed oils. Intravenous vehicles include
fluid and nutrient replenishers, electrolyte replenishers (such as
those based on Ringer's dextrose), and the like. Preservatives and
other additives may also be present such as, for example,
antimicrobials, anti-oxidants, chelating agents, and inert gases
and the like.
[0060] Formulations for topical administration may include
ointments, lotions, creams, gels, drops, suppositories, sprays,
liquids and powders. Conventional pharmaceutical carriers, aqueous,
powder or oily bases, thickeners and the like may be necessary or
desirable.
[0061] Compositions for oral administration include powders or
granules, suspensions or solutions in water or non-aqueous media,
capsules, sachets, or tablets. Thickeners, flavorings, diluents,
emulsifiers, dispersing aids or binders may be desirable.
[0062] Some of the compositions may potentially be administered as
a pharmaceutically acceptable acid- or base-addition salt, formed
by reaction with inorganic acids such as hydrochloric acid,
hydrobromic acid, perchloric acid, nitric acid, thiocyanic acid,
sulfuric acid, and phosphoric acid, and organic acids such as
formic acid, acetic acid, propionic acid, glycolic acid, lactic
acid, pyruvic acid, oxalic acid, malonic acid, succinic acid,
maleic acid, and fumaric acid, or by reaction with an inorganic
base such as sodium hydroxide, ammonium hydroxide, potassium
hydroxide, and organic bases such as mono-, di-, trialkyl and aryl
amines and substituted ethanolamines.
[0063] Effective dosages and schedules for administering the
compositions may be determined empirically, and making such
determinations is within the skill in the art. The dosage ranges
for the administration of the compositions are those large enough
to produce the desired effect in which the symptoms of the disorder
are affected. The dosage should not be so large as to cause adverse
side effects, such as unwanted cross-reactions, anaphylactic
reactions, and the like. Generally, the dosage will vary with the
age, condition, sex and extent of the disease in the patient, route
of administration, or whether other drugs are included in the
regimen, and can be determined by one of skill in the art. The
dosage can be adjusted by the individual physician in the event of
any counterindications. Dosage can vary, and can be administered in
one or more dose administrations daily, for one or several days.
Guidance can be found in the literature for appropriate dosages for
given classes of pharmaceutical products.
[0064] Proteins of this invention can be applied in vitro to any
suitable sample that might contain plasmin to measure the plasmin
present. To do so, the assay can include a Signal Producing System
(SPS) providing a detectable signal that depends on the amount of
plasmin present. The signal may be detected visually or
instrumentally. Possible signals include production of colored,
fluorescent, or luminescent products, alteration of the
characteristics of absorption or emission of radiation by an assay
component or product, and precipitation or agglutination of a
component or product.
[0065] The component of the SPS most intimately associated with the
diagnostic reagent is called the "label". A label may be, e.g., a
radioisotope, a fluorophore, an enzyme, a co-enzyme, an enzyme
substrate, an electron-dense compound, or an agglutinable particle.
A radioactive isotope can be detected by use of, for example, a
.gamma. counter or a scintillation counter or by autoradiography.
Isotopes which are particularly useful are .sup.3H, .sup.125I,
.sup.131I, .sup.35S, .sup.14C, and, preferably, .sup.125I. It is
also possible to label a compound with a fluorescent compound. When
the fluorescently labeled compound is exposed to light of the
proper wave length, its presence can be detected. Among the most
commonly used fluorescent labeling compounds are fluorescein
isothiocyanate, rhodamine, phycoerythrin, phycocyanin,
allophycocyanin, o-phthaldehyde, and fluorescamine. Alternatively,
fluorescence-emitting metals, such as 125Eu or other lanthanide,
may be attached to the binding protein using such metal chelating
groups as diethylenetriaminepentaacetic acid or
ethylenediamine-tetraacetic acid. The proteins also can be
detectably labeled by coupling to a chemiluminescent compound, such
as luminol, isolumino, theromatic acridinium ester, imidazole,
acridinium salt, and oxalate ester. Likewise, a bioluminescent
compound, such as luciferin, luciferase and aequorin, may be used
to label the binding protein. The presence of a bioluminescent
protein is determined by detecting the presence of luminescence.
Enzyme labels, such as horseradish peroxidase and alkaline
phosphatase, are preferred.
[0066] There are two basic types of assays: heterogeneous and
homogeneous. In heterogeneous assays, binding of the affinity
molecule to analyte does not affect the label; thus, to determine
the amount of analyte, bound label must be separated from free
label. In homogeneous assays, the interaction does affect the
activity of the label, and analyte can be measured without
separation.
[0067] In general, a plasmin-binding protein (PBP) may be used
diagnostically in the same way that an antiplasmin antibody is
used. Thus, depending on the assay format, it may be used to assay
plasmin, or, by competitive inhibition, other substances which bind
plasmin.
[0068] The sample will normally be a biological fluid, such as
blood, urine, lymph, semen, milk, or cerebrospinal fluid, or a
derivative thereof, or a biological tissue, e.g., a tissue section
or homogenate. The sample could be anything. If the sample is a
biological fluid or tissue, it may be taken from a human or other
mammal, vertebrate or animal, or from a plant. The preferred sample
is blood, or a fraction or derivative thereof.
[0069] In one embodiment, the plasmin-binding protein (PBP) is
immobilized, and plasmin in the sample is allowed to compete with a
known quantity of a labeled or specifically labelable plasmin
analogue. The "plasmin analogue" is a molecule capable of competing
with plasmin for binding to the PBP, which includes plasmin itself.
It may be labeled already, or it may be labeled subsequently by
specifically binding the label to a moiety differentiating the
plasmin analogue from plasmin. The phases are separated, and the
labeled plasmin analogue in one phase is quantified.
[0070] In a "sandwich assay," both an insolubilized plasmin-binding
agent (PBA), and a labeled PBA are employed. The plasmin analyte is
captured by the insolubilized PBA and is tagged by the labeled PBA,
forming a tertiary complex. The reagents may be added to the sample
in any order. The PBAs may be the same or different, and only one
PBA need be a PBP according to this invention (the other may be,
e.g., an antibody). The amount of labeled PBA in the tertiary
complex is directly proportional to the amount of plasmin in the
sample.
[0071] The two embodiments described above are both heterogeneous
assays. A homogeneous assay requires only that the label be
affected by the binding of the PBP to plasmin. The plasmin analyte
may act as its own label if a plasmin inhibitor is used as a
diagnostic reagent.
[0072] A label may be conjugated, directly or indirectly (e.g.,
through a labeled anti-PBP antibody), covalently (e.g., with SPDP)
or noncovalently, to the plasmin-binding protein, to produce a
diagnostic reagent. Similarly, the plasmin binding protein may be
conjugated to a solid phase support to form a solid phase
("capture") diagnostic reagent. Suitable supports include glass,
polystyrene, polypropylene, polyethylene, dextran, nylon, amylases,
and magnetite. The carrier can be soluble to some extent or
insoluble for the purposes of this invention. The support material
may have any structure so long as the coupled molecule is capable
of binding plasmin.
[0073] A Kunitz domain that binds very tightly to plasmin can be
used for in vivo imaging. Diagnostic imaging of disease foci was
considered one of the largest commercial opportunities for
monoclonal antibodies, but this opportunity has not been achieved.
Despite considerable effort, only two monoclonal antibody-based
imaging agents have been approved. The disappointing results
obtained with monoclonal antibodies are due in large measure to: i)
inadequate affinity and/or specificity; ii) poor penetration to
target sites; iii) slow clearance from nontarget sites; iv)
immunogenicity; and v) high production cost and poor stability.
[0074] These limitations have led to the development of
peptide-based imaging agents. While potentially solving the
problems of poor penetration and slow clearance, peptide-based
imaging agents are unlikely to possess adequate affinity,
specificity and in vivo stability to be useful in most
applications.
[0075] Engineered proteins are uniquely suited to the requirements
for an imaging agent. In particular the extraordinary affinity and
specificity that is obtainable by engineering small, stable,
human-origin protein domains having known in vivo clearance rates
and mechanisms combine to provide earlier, more reliable results,
less toxicity/side effects, lower production and storage cost, and
greater convenience of label preparation. Indeed, it is possible to
achieve the goal of realtime imaging with engineered protein
imaging agents. Plasmin-binding proteins, e.g., SPI11, can be
useful for localizing sites of internal hemorrhage.
[0076] Radio-labeled binding protein may be administered to the
human or animal subject. Administration is typically by injection,
e.g., intravenous or arterial or other means of administration in a
quantity sufficient to permit subsequent dynamic and/or static
imaging using suitable radio-detecting devices. The dosage is the
smallest amount capable of providing a diagnostically effective
image, and may be determined by means conventional in the art,
using known radio-imaging agents as guides.
[0077] Typically, the imaging is carried out on the whole body of
the subject, or on that portion of the body or organ relevant to
the condition or disease under study. The radio-labeled binding
protein has accumulated. The amount of radio-labeled binding
protein accumulated at a given point in time in relevant target
organs can then be quantified.
[0078] A particularly suitable radio-detecting device is a
scintillation camera, such as a .gamma. camera. The detection
device in the camera senses and records (and optional digitizes)
the radioactive decay. Digitized information can be analyzed in any
suitable way, many of which are known in the art. For example, a
time-activity analysis can illustrate uptake through clearance of
the radio-labeled binding protein by the target organs with
time.
[0079] Various factors are taken into consideration in picking an
appropriate radioisotope. The isotope is picked: to allow good
quality resolution upon imaging, to be safe for diagnostic use in
humans and animals, and, preferably, to have a short half-life so
as to decrease the amount of radiation received by the body. The
radioisotope used should preferably be pharmacologically inert, and
the quantities administered should not have substantial
physiological effect. The binding protein may be radio-labeled with
different isotopes of iodine, for example .sup.123I, .sup.125I, or
.sup.131I (see, for example, U.S. Pat. No. 4,609,725). The amount
of labeling must be suitably monitored.
[0080] In applications to human subjects, it may be desirable to
use radioisotopes other than .sup.125I for labeling to decrease the
total dosimetry exposure of the body and to optimize the
detectability of the labeled molecule. Considering ready clinical
availability for use in humans, preferred radio-labels include:
.sup.99mTc, .sup.67Ga, 68Ga, .sup.90Y, .sup.111In, .sup.113mIn,
.sup.123I, .sup.186Re, .sup.188Re or .sup.211 At. Radio-labeled
protein may be prepared by various methods. These include
radio-halogenation by the chloramine-T or lactoperoxidase method
and subsequent purification by high pressure liquid chromatography,
for example, see Gutkowska et al in "Endocrinology and Metabolism
Clinics of America: (1987) 16 (1): 183. Other methods of
radio-labeling can be used, such as IODOBEADS.sup..TM..
[0081] A radio-labeled protein may be administered by any means
that enables the active agent to reach the agent's site of action
in a mammal. Because proteins are subject to digestion when
administered orally, parenteral administration, i.e., intravenous
subcutaneous, intramuscular, would ordinarily be used to optimize
absorption.
[0082] The plasmin-binding proteins of this invention may also be
used to purify plasmin from a fluid, e.g., blood. For this purpose,
the PBP is preferably immobilized on an insoluble support. Such
supports include those already mentioned as useful in preparing
solid phase diagnostic reagents.
[0083] Proteins can be used as molecular weight markers for
reference in the separation or purification of proteins. Proteins
may need to be denatured to serve as molecular weight markers. A
second general utility for proteins is the use of hydrolyzed
protein as a nutrient source. Proteins may also be used to increase
the viscosity of a solution.
[0084] The protein of this invention may be used for any of the
foregoing purposes, as well as for therapeutic and diagnostic
purposes as discussed further earlier in this specification.
[0085] Chemical polypeptide synthesis is known in the art, and
methods of solid phase polypeptide synthesis are well-described in
the following references, hereby entirely incorporated by
reference: (Merrifield, J Amer Chem Soc 85:2149-2154 (1963);
Merrifield, Science 232:341-347 (1986); Wade et al., Biopolymers
25:S21-S37 (1986); Fields, Int J Polypeptide Prot Res 35:161
(1990); MilliGen Report Nos. 2 and 2a, Millipore Corporation,
Bedford, Mass., 1987) Ausubel et al, supra, and Sambrook et al,
supra. Tan and Kaiser (Biochemistry, 1977, 16:1531-41) synthesized
BPTI and a homologue eighteen years ago.
[0086] As is known in the art, such methods involve blocking or
protecting reactive functional groups, such as free amino, carboxyl
and thio groups. After polypeptide bond formation, the protective
groups are removed. Thus, the addition of each amino acid residue
requires several reaction steps for protecting and deprotecting.
Current methods utilize solid phase synthesis, wherein the
C-terminal amino acid is covalently linked to insoluble resin
particles that can be filtered. Reactants are removed by washing
the resin particles with appropriate solvents using an automated
machine. Various methods, including the "tBoc" method and the
"Fmoc" method are well known in the art. See, inter alia, Atherton
et al., J Chem Soc Perkin Trans 1:538-546 (1981) and Sheppard et
al, Int J Polypeptide Prot Res 20:451-454 (1982).
[0087] C. COMPOSITIONS
[0088] Disclosed are the components to be used to prepare the
disclosed compositions as well as the compositions themselves to be
used within the methods disclosed herein. These and other materials
are disclosed herein, and it is understood that when combinations,
subsets, interactions, groups, etc. of these materials are
disclosed that, while specific reference of each various individual
and collective combinations and permutation of these compounds may
not be explicitly disclosed, each is specifically contemplated and
described herein. For example, if a particular amino acid sequence
is disclosed and discussed and a number of modifications that can
be made to a number of places within the sequence can be made are
discussed, specifically contemplated is each and every combination
and permutation of the amino acid and the modifications that are
possible unless specifically indicated to the contrary. Thus, if a
class of molecules A, B, and C are disclosed as well as a class of
molecules D, E, and F and an example of a combination molecule, A-D
is disclosed, then even if each is not individually recited each is
individually and collectively contemplated meaning combinations,
A-E, A-F, B-D, B-E, B-F, C-D, C-E, and C-F are considered
disclosed. Likewise, any subset or combination of these is also
disclosed. Thus, for example, the sub-group of A-E, B-F, and C-E
would be considered disclosed. This concept applies to all aspects
of this application including, but not limited to, steps in methods
of making and using the disclosed compositions. Thus, if there are
a variety of additional steps that can be performed it is
understood that each of these additional steps can be performed
with any specific embodiment or combination of embodiments of the
disclosed methods.
[0089] Disclosed herein is a polypeptide comprising SEQ ID NO:1
(Kuntz Type Domain 1, or KD1). SEQ ID NO: 1 is represented by the
following: DAAQEPTGNNAEICLLPLD
GPCRALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
[0090] Also disclosed are polypeptides comprising SEQ ID NO:2
(wherein the leucine at position 17 as numbered in BPTI has been
changed to arginine): DAAQEPTGNNAEICLL
PLDYGPCRARLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPK V.
[0091] Also disclosed is SEQ ID NO:3, which is a shorter
polypeptide than SEQ ID NO: 1, and also comprises the change at
position 17 (L17R): NAEICLLPLDYGPCRAR
LLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIE.
[0092] Also disclosed are polypeptides comprising SEQ ID NO:4
(wherein the leucine at position 17 as numbered in BPTI has been
changed to arginine and the alanine at position 16 has been changed
to methionine): DAAQEPTGNNAEICLLPLDYGPC
RMRLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
[0093] It has been discovered that a change from the hydrophobic
amino acid at position 17 (leucine) to a charged amino acid such as
arginine or lysine affects the anticoagulation activity of KD1
without significantly reducing plasmin inhibition. Particularly
useful are such mutant polypeptides where anticoagulation activity
is eliminated and plasmin inhibition is increased. Thus, inclusion
of a charged or polar amino acid at position 17 is specifically
contemplated herein.
[0094] The polypeptide of SEQ ID NO:1 can also comprise one or more
additional mutations. As disclosed herein, a mutation can be an
addition, deletion, or substitution of an amino acid. For example,
in addition to the change of leucine to arginine at position 17,
the amino acid sequence can also comprise the change of arginine to
lysine at position 15, the change of alanine to methionine at
position 16, or both. Examples of other changes at position 15 can
be found, for example, in U.S. Pat. No. 4,595,674, herein
incorporated by reference in its entirety.
[0095] Also disclosed herein is a polypeptide comprising SEQ ID
NO:1, wherein tyrosine is changed to glutamic acid at position 46.
In another embodiment, tyrosine can be changed to threonine at
position 11. In another embodiment, aspartic acid can be changed to
tyrosine or glutamic acid at position 10. These polypeptides can
also comprise one or more additional mutations, such as those
discussed above. To summarize, examples of amino acid changes to
SEQ ID NO:1 can be found in Table 1. These are only examples, and
one of skill in the art would understand that any of these
mutations could be used alone or in combination with the other
mutations listed herein, or with others not listed, in any
permutation or combination possible.
TABLE-US-00001 TABLE 1 Mutations of SEQ ID NO: 1 R15K L17R L17K
D10Y D10E Y11T Y46E A16G A16M A16S
[0096] Also disclosed are compositions and nucleic acids
corresponding to the polypeptides discussed herein. A discussion of
nucleic acids, compositions, and methods of administration is
below. Also disclosed are nucleic acids encoding the polypeptides
disclosed herein.
[0097] Disclosed herein are polypeptides and their corresponding
nucleic acids. It is understood that one way to define any known
variants and derivatives or those that might arise of the disclosed
nucleic acids and proteins herein is through defining the variants
and derivatives in terms of homology to specific known sequences.
For example SEQ ID NO:1 sets forth a particular sequence of KD1,
and SEQ ID NO:2 sets forth a particular sequence of KD1 containing
a mutation. One of ordinary skill in the art at the time of the
invention would have understood that other mutations can occur in
both the nucleic acid and the protein of the wild type. Some
mutations thereof that would not affect its functionality, while
others can affect the functionality in a positive way, and are
therefore selected for. Specifically disclosed are variants of
these and other genes and proteins herein disclosed which have at
least, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84,
85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 percent
homology to the stated sequence. Those of skill in the art readily
understand how to determine the homology of two proteins or nucleic
acids, such as genes. For example, the homology can be calculated
after aligning the two sequences so that the homology is at its
highest level.
[0098] Another way of calculating homology can be performed by
published algorithms. Optimal alignment of sequences for comparison
may be conducted by the local homology algorithm of Smith and
Waterman Adv. Appl. Math. 2: 482 (1981), by the homology alignment
algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443 (1970), by
the search for similarity method of Pearson and Lipman, Proc. Natl.
Acad. Sci. U.S.A. 85: 2444 (1988), by computerized implementations
of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the
Wisconsin Genetics Software Package, Genetics Computer Group, 575
Science Dr., Madison, Wis.), or by inspection.
[0099] The same types of homology can be obtained for nucleic acids
by for example the algorithms disclosed in Zuker, M. Science
244:48-52, 1989, Jaeger et al. Proc. Natl. Acad. Sci. USA
86:7706-7710, 1989, Jaeger et al. Methods Enzymol. 183:281-306,
1989 which are herein incorporated by reference for at least
material related to nucleic acid alignment.
[0100] There are molecules disclosed herein that are nucleic acid
based, including for example the nucleic acids that encode, for
example, KD1 as well as any other proteins disclosed herein, as
well as various functional nucleic acids. The disclosed nucleic
acids are made up of for example, nucleotides, nucleotide analogs,
or nucleotide substitutes. Non-limiting examples of these and other
molecules are discussed herein. It is understood that for example,
when a vector is expressed in a cell, that the expressed mRNA will
typically be made up of A, C, G, and U.
[0101] A nucleotide is a molecule that contains a base moiety, a
sugar moiety and a phosphate moiety. Nucleotides can be linked
together through their phosphate moieties and sugar moieties
creating an internucleoside linkage. The base moiety of a
nucleotide can be adenin-9-yl (A), cytosin-1-yl (C), guanin-9-yl
(G), uracil-1-yl (U), and thymin-1-yl (T). The sugar moiety of a
nucleotide is a ribose or a deoxyribose. The phosphate moiety of a
nucleotide is pentavalent phosphate. An non-limiting example of a
nucleotide would be 3'-AMP (3'-adenosine monophosphate) or 5'-GMP
(5'-guanosine monophosphate).
[0102] A nucleotide analog is a nucleotide which contains some type
of modification to either the base, sugar, or phosphate moieties.
Modifications to nucleotides are well known in the art and would
include for example, 5-methylcytosine (5-me-C), 5-hydroxymethyl
cytosine, xanthine, hypoxanthine, and 2-aminoadenine as well as
modifications at the sugar or phosphate moieties.
[0103] Nucleotide substitutes are molecules having similar
functional properties to nucleotides, but which do not contain a
phosphate moiety, such as peptide nucleic acid (PNA). Nucleotide
substitutes are molecules that will recognize nucleic acids in a
Watson-Crick or Hoogsteen manner, but which are linked together
through a moiety other than a phosphate moiety. Nucleotide
substitutes are able to conform to a double helix type structure
when interacting with the appropriate target nucleic acid. It is
also possible to link other types of molecules (conjugates) to
nucleotides or nucleotide analogs to enhance for example, cellular
uptake. Conjugates can be chemically linked to the nucleotide or
nucleotide analogs. Such conjugates include but are not limited to
lipid moieties such as a cholesterol moiety. (Letsinger et al.,
Proc. Natl. Acad. Sci. USA, 1989, 86, 6553-6556).
[0104] A Watson-Crick interaction is at least one interaction with
the Watson-Crick face of a nucleotide, nucleotide analog, or
nucleotide substitute. The Watson-Crick face of a nucleotide,
nucleotide analog, or nucleotide substitute includes the C2, N1,
and C6 positions of a purine based nucleotide, nucleotide analog,
or nucleotide substitute and the C2, N3, C4 positions of a
pyrimidine based nucleotide, nucleotide analog, or nucleotide
substitute.
[0105] A Hoogsteen interaction is the interaction that takes place
on the Hoogsteen face of a nucleotide or nucleotide analog, which
is exposed in the major groove of duplex DNA. The Hoogsteen face
includes the N7 position and reactive groups (NH2 or O) at the C6
position of purine nucleotides.
[0106] There are a variety of sequences related to, for example,
KD1 and mutations thereof, as well as any other protein disclosed
herein that are disclosed on Genbank, and these sequences and
others are herein incorporated by reference in their entireties as
well as for individual subsequences contained therein.
[0107] A variety of sequences are provided herein and these and
others can be found in Genbank, at www.pubmed.gov. Those of skill
in the art understand how to resolve sequence discrepancies and
differences and to adjust the compositions and methods relating to
a particular sequence to other related sequences. Primers and/or
probes can be designed for any sequence given the information
disclosed herein and known in the art.
[0108] Disclosed are compositions including primers and probes,
which are capable of interacting with the genes disclosed herein.
In certain embodiments the primers are used to support DNA
amplification reactions. Typically the primers will be capable of
being extended in a sequence specific manner. Extension of a primer
in a sequence specific manner includes any methods wherein the
sequence and/or composition of the nucleic acid molecule to which
the primer is hybridized or otherwise associated directs or
influences the composition or sequence of the product produced by
the extension of the primer. Extension of the primer in a sequence
specific manner therefore includes, but is not limited to, PCR, DNA
sequencing, DNA extension, DNA polymerization, RNA transcription,
or reverse transcription. Techniques and conditions that amplify
the primer in a sequence specific manner are preferred. In certain
embodiments the primers are used for the DNA amplification
reactions, such as PCR or direct sequencing. It is understood that
in certain embodiments the primers can also be extended using
non-enzymatic techniques, where for example, the nucleotides or
oligonucleotides used to extend the primer are modified such that
they will chemically react to extend the primer in a sequence
specific manner. Typically the disclosed primers hybridize with the
nucleic acid or region of the nucleic acid or they hybridize with
the complement of the nucleic acid or complement of a region of the
nucleic acid.
[0109] Disclosed herein are methods of treating a subject
comprising administering to the subject in need thereof a nucleic
acid. For example, disclosed herein are methods of delivering a
nucleic acid encoding a mutant of KD1, such as those disclosed
herein. These methods include the administration and uptake of
exogenous DNA into the cells of a subject (i.e., gene transduction
or transfection). The disclosed nucleic acids can be in the form of
naked DNA or RNA, or the nucleic acids can be in a vector for
delivering the nucleic acids to the cells, whereby the
antibody-encoding DNA fragment is under the transcriptional
regulation of a promoter, as would be well understood by one of
ordinary skill in the art. The vector can be a commercially
available preparation, such as an adenovirus vector (Quantum
Biotechnologies, Inc. (Laval, Quebec, Canada). Delivery of the
nucleic acid or vector to cells can be via a variety of mechanisms.
As one example, delivery can be via a liposome, using commercially
available liposome preparations such as LIPOFECTIN.RTM.,
LIPOFECTAMINE.RTM. (GIBCO-BRL, Inc., Gaithersburg, Md.),
SUPERFECT.RTM. (Qiagen, Inc. Hilden, Germany) and TRANSFECTAM.RTM.
(Promega Biotec, Inc., Madison, Wis.), as well as other liposomes
developed according to procedures standard in the art. In addition,
the disclosed nucleic acid or vector can be delivered in vivo by
electroporation, the technology for which is available from
Genetronics, Inc. (San Diego, Calif.) as well as by means of a
SONOPORATION.TM. machine (ImaRx Pharmaceutical Corp., Tucson,
Ariz.).
[0110] As one example, vector delivery can be via a viral system,
such as a retroviral vector system which can package a recombinant
retroviral genome (see e.g., Pastan et al., Proc. Natl. Acad. Sci.
U.S.A. 85:4486, 1988; Miller et al., Mol. Cell. Biol. 6:2895,
1986). The recombinant retrovirus can then be used to infect and
thereby deliver to the infected cells nucleic acid encoding a
broadly neutralizing antibody (or active fragment thereof). The
exact method of introducing the altered nucleic acid into mammalian
cells is, of course, not limited to the use of retroviral vectors.
Other techniques are widely available for this procedure including
the use of adenoviral vectors (Mitani et al., Hum. Gene Ther.
5:941-948, 1994), adeno-associated viral (AAV) vectors (Goodman et
al., Blood 84:1492-1500, 1994), lentiviral vectors (Naidini et al.,
Science 272:263-267, 1996), pseudotyped retroviral vectors (Agrawal
et al., Exper. Hematol. 24:738-747, 1996). Physical transduction
techniques can also be used, such as liposome delivery and
receptor-mediated and other endocytosis mechanisms (see, for
example, Schwartzenberger et al., Blood 87:472-478, 1996). This
disclosed compositions and methods can be used in conjunction with
any of these or other commonly used gene transfer methods.
[0111] As one example, if the antibody-encoding nucleic acid is
delivered to the cells of a subject in an adenovirus vector, the
dosage for administration of adenovirus to humans can range from
about 107 to 109 plaque forming units (pfu) per injection but can
be as high as 1012 pfu per injection (Crystal, Hum. Gene Ther.
8:985-1001, 1997; Alvarez and Curiel, Hum. Gene Ther. 8:597-613,
1997). A subject can receive a single injection, or, if additional
injections are necessary, they can be repeated at six month
intervals (or other appropriate time intervals, as determined by
the skilled practitioner) for an indefinite period and/or until the
efficacy of the treatment has been established.
[0112] Parenteral administration of the nucleic acid or vector, if
used, is generally characterized by injection. Injectables can be
prepared in conventional forms, either as liquid solutions or
suspensions, solid forms suitable for solution of suspension in
liquid prior to injection, or as emulsions. A more recently revised
approach for parenteral administration involves use of a slow
release or sustained release system such that a constant dosage is
maintained. See, e.g., U.S. Pat. No. 3,610,795, which is
incorporated by reference herein. For additional discussion of
suitable formulations and various routes of administration of
therapeutic compounds, see, e.g., Remington: The Science and
Practice of Pharmacy (19th ed.) ed. A. R. Gennaro, Mack Publishing
Company, Easton, Pa. 1995.
[0113] As discussed herein there are numerous variants of the KD1
protein that are known and herein contemplated. Specifically,
disclosed are mutations of KD1 that are preferable in view of the
wild type, such as SEQ ID NO:2. In addition to the functional KD1
variants disclosed herein, there are derivatives of the KD1 protein
which also function with those disclosed herein, and are herein
contemplated. Protein variants and derivatives are well understood
to those of skill in the art and in can involve amino acid sequence
modifications. For example, amino acid sequence modifications
typically fall into one or more of three classes: substitutional,
insertional or deletional variants. Insertions include amino and/or
carboxyl terminal fusions as well as intrasequence insertions of
single or multiple amino acid residues. Insertions ordinarily will
be smaller insertions than those of amino or carboxyl terminal
fusions, for example, on the order of one to four residues.
Immunogenic fusion protein derivatives, such as those described in
the examples, are made by fusing a polypeptide sufficiently large
to confer immunogenicity to the target sequence by cross-linking in
vitro or by recombinant cell culture transformed with DNA encoding
the fusion. Deletions are characterized by the removal of one or
more amino acid residues from the protein sequence. Typically, no
more than about from 2 to 6 residues are deleted at any one site
within the protein molecule. These variants ordinarily are prepared
by site specific mutagenesis of nucleotides in the DNA encoding the
protein, thereby producing DNA encoding the variant, and thereafter
expressing the DNA in recombinant cell culture. Techniques for
making substitution mutations at predetermined sites in DNA having
a known sequence are well known, for example M13 primer mutagenesis
and PCR mutagenesis. Amino acid substitutions are typically of
single residues, but can occur at a number of different locations
at once; insertions usually will be on the order of about from 1 to
10 amino acid residues; and deletions will range about from 1 to 30
residues. Deletions or insertions preferably are made in adjacent
pairs, i.e. a deletion of 2 residues or insertion of 2 residues.
Substitutions, deletions, insertions or any combination thereof may
be combined to arrive at a final construct. The mutations must not
place the sequence out of reading frame and preferably will not
create complementary regions that could produce secondary mRNA
structure. Substitutional variants are those in which at least one
residue has been removed and a different residue inserted in its
place. Such substitutions generally are made in accordance with the
following Table and are referred to as conservative
substitutions.
TABLE-US-00002 TABLE 2 Amino Acid Substitutions Original Residue
Exemplary Conservative Substitutions, others are known in the art.
Ala; ser Arg; lys, gln Asn; gln; his Asp; glu Cys; ser Gln; asn,
lys Glu; asp Gly; pro His; asn; gln Ile; leu; val Leu; ile; val
Lys; arg; gln Met; leu; ile Phe; met; leu; tyr Ser; thr Thr; ser
Trp; tyr Tyr; trp; phe Val; ile; leu
[0114] Substantial changes in function or immunological identity
are made by selecting substitutions that are less conservative than
those in Table 2, i.e., selecting residues that differ more
significantly in their effect on maintaining (a) the structure of
the polypeptide backbone in the area of the substitution, for
example as a sheet or helical conformation, (b) the charge or
hydrophobicity of the molecule at the target site or (c) the bulk
of the side chain. The substitutions which in general are expected
to produce the greatest changes in the protein properties will be
those in which (a) a hydrophilic residue, e.g. seryl or threonyl,
is substituted for (or by) a hydrophobic residue, e.g. leucyl,
isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline
is substituted for (or by) any other residue; (c) a residue having
an electropositive side chain, e.g., lysyl, arginyl, or histidyl,
is substituted for (or by) an electronegative residue, e.g.,
glutamyl or aspartyl; or (d) a residue having a bulky side chain,
e.g., phenylalanine, is substituted for (or by) one not having a
side chain, e.g., glycine, in this case, (e) by increasing the
number of sites for sulfation and/or glycosylation.
[0115] For example, the replacement of one amino acid residue with
another that is biologically and/or chemically similar is known to
those skilled in the art as a conservative substitution. For
example, a conservative substitution would be replacing one
hydrophobic residue for another, or one polar residue for another.
The substitutions include combinations such as, for example, Gly,
Ala; Val, Ile, Leu; Asp, Glu; Asn, Gln; Ser, Thr; Lys, Arg; and
Phe, Tyr. Such conservatively substituted variations of each
explicitly disclosed sequence are included within the mosaic
polypeptides provided herein.
[0116] Substitutional or deletional mutagenesis can be employed to
insert sites for N-glycosylation (Asn-X-Thr/Ser) or O-glycosylation
(Ser or Thr). Deletions of cysteine or other labile residues also
may be desirable. Deletions or substitutions of potential
proteolysis sites, e.g. Arg, is accomplished for example by
deleting one of the basic residues or substituting one by
glutaminyl or histidyl residues.
[0117] Certain post-translational derivatizations are the result of
the action of recombinant host cells on the expressed polypeptide.
Glutaminyl and asparaginyl residues are frequently
post-translationally deamidated to the corresponding glutamyl and
asparyl residues. Alternatively, these residues are deamidated
under mildly acidic conditions. Other post-translational
modifications include hydroxylation of proline and lysine,
phosphorylation of hydroxyl groups of seryl or threonyl residues,
methylation of the o-amino groups of lysine, arginine, and
histidine side chains (T. E. Creighton, Proteins: Structure and
Molecular Properties, W. H. Freeman & Co., San Francisco pp
79-86 [1983]), acetylation of the N-terminal amine and, in some
instances, amidation of the C-terminal carboxyl.
[0118] It is understood that one way to define the variants and
derivatives of the disclosed proteins herein is through defining
the variants and derivatives in terms of homology/identity to
specific known sequences. For example, SEQ ID NO:1 sets forth a
particular sequence of KD1, and SEQ ID NO:2 sets forth a particular
sequence of a mutant thereof Specifically disclosed are variants of
these and other proteins herein disclosed which have at least 70%
or 75% or 80% or 85% or 90% or 95% homology to the stated sequence.
Those of skill in the art readily understand how to determine the
homology of two proteins. For example, the homology can be
calculated after aligning the two sequences so that the homology is
at its highest level. Another way of calculating homology can be
performed by published algorithms. Optimal alignment of sequences
for comparison may be conducted by the local homology algorithm of
Smith and Waterman Adv. Appl. Math. 2: 482 (1981), by the homology
alignment algorithm of Needleman and Wunsch, J. MoL Biol. 48: 443
(1970), by the search for similarity method of Pearson and Lipman,
Proc. Natl. Acad. Sci. U.S.A. 85: 2444 (1988), by computerized
implementations of these algorithms (GAP, BESTFIT, FASTA, and
TFASTA in the Wisconsin Genetics Software Package, Genetics
Computer Group, 575 Science Dr., Madison, Wis.), or by
inspection.
[0119] The same types of homology can be obtained for nucleic acids
by for example the algorithms disclosed in Zuker, M. Science
244:48-52, 1989, Jaeger et al. Proc. Natl. Acad. Sci. USA
86:7706-7710, 1989, Jaeger et al. Methods Enzymol. 183:281-306,
1989 which are herein incorporated by reference for at least
material related to nucleic acid alignment.
[0120] It is understood that the description of conservative
mutations and homology can be combined together in any combination,
such as embodiments that have at least 70% homology to a particular
sequence wherein the variants are conservative mutations.
[0121] As this specification discusses various proteins and protein
sequences it is understood that the nucleic acids that can encode
those protein sequences are also disclosed. This would include all
degenerate sequences related to a specific protein sequence, i.e.
all nucleic acids having a sequence that encodes one particular
protein sequence as well as all nucleic acids, including degenerate
nucleic acids, encoding the disclosed variants and derivatives of
the protein sequences. Thus, while each particular nucleic acid
sequence may not be written out herein, it is understood that each
and every sequence is in fact disclosed and described herein
through the disclosed protein sequence. It is also understood that
while no amino acid sequence indicates what particular DNA sequence
encodes that protein within an organism, where particular variants
of a disclosed protein are disclosed herein, the known nucleic acid
sequence that encodes that protein in the particular region from
which that protein arises is also known and herein disclosed and
described.
[0122] It is understood that there are numerous amino acid and
peptide analogs which can be incorporated into the disclosed
compositions. For example, there are numerous D amino acids or
amino acids which have a different functional substituent than
those shown in Table 2. The opposite stereo isomers of naturally
occurring peptides are disclosed, as well as the stereo isomers of
peptide analogs. These amino acids can readily be incorporated into
polypeptide chains by charging tRNA molecules with the amino acid
of choice and engineering genetic constructs that utilize, for
example, amber codons, to insert the analog amino acid into a
peptide chain in a site specific way. See, for example, (Thorson et
al., Methods in Molec. Biol. 77:43-73 (1991), Zoller, Current
Opinion in Biotechnology, 3:348-354 (1992); Ibba, Biotechnology
& Genetic Engineering Reviews 13:197-216 (1995), Cahill et al.,
TIBS, 14 (10):400-403 (1989); Benner, TIB Tech, 12:158-163 (1994);
Ibba and Hennecke, Bio/technology, 12:678-682 (1994) all of which
are herein incorporated by reference at least for material related
to amino acid analogs).
[0123] Molecules can be produced that resemble peptides, but which
are not connected via a natural peptide linkage. For example,
linkages for amino acids or amino acid analogs can include CH2NH--,
--CH2S--, --CH2--CH2--, --CH.dbd.CH-- (cis and trans), --COCH2--,
--CH(OH)CH2--, and --CHH2SO-- (These and others can be found in
Spatola, A. F. in Chemistry and Biochemistry of Amino Acids,
Peptides, and Proteins, B. Weinstein, eds., Marcel Dekker, New
York, p. 267 (1983); Spatola, A. F., Vega Data (March 1983), Vol.
1, Issue 3, Peptide Backbone Modifications (general review);
Morley, Trends Pharm Sci (1980) pp. 463-468; Hudson, D. et al., Int
J Pept Prot Res 14:177-185 (1979) (--CH2NH--, CH2CH2--); Spatola et
al. Life Sci 38:1243-1249 (1986) (--CH H2--S); Hann J. Chem. Soc
Perkin Trans. I 307-314 (1982) (--CH--CH--, cis and trans);
Almquist et al. J. Med. Chem. 23:1392-1398 (1980) (--COCH2--);
Jennings-White et al. Tetrahedron Lett 23:2533 (1982) (--COCH2--);
Szelke et al. European Appln, EP 45665 CA (1982): 97:39405 (1982)
(--CH(OH)CH2--); Holladay et al. Tetrahedron. Lett 24:4401-4404
(1983) (--C(OH)CH2--); and Hruby Life Sci 31:189-199 (1982)
(--CH2--S--); each of which is incorporated herein by reference. A
particularly preferred non-peptide linkage is --CH2NH--. It is
understood that peptide analogs can have more than one atom between
the bond atoms, such as b-alanine, g-aminobutyric acid, and the
like.
[0124] Amino acid analogs and analogs and peptide analogs often
have enhanced or desirable properties, such as, more economical
production, greater chemical stability, enhanced pharmacological
properties (half-life, absorption, potency, efficacy, etc.),
altered specificity (e.g., a broad-spectrum of biological
activities), reduced antigenicity, and others.
[0125] D-amino acids can be used to generate more stable peptides,
because D amino acids are not recognized by peptidases and such.
Systematic substitution of one or more amino acids of a consensus
sequence with a D-amino acid of the same type (e.g., D-lysine in
place of L-lysine) can be used to generate more stable peptides.
Cysteine residues can be used to cyclize or attach two or more
peptides together. This can be beneficial to constrain peptides
into particular conformations. (Rizo and Gierasch Ann. Rev.
Biochem. 61:387 (1992), incorporated herein by reference).
[0126] Disclosed are methods of making a transgenic organism
comprising administering the disclosed nucleic acids, vectors
and/or cells.
[0127] The present invention is more particularly described in the
following examples, which are intended as illustrative only since
numerous modifications and variations therein will be apparent to
those skilled in the art.
[0128] Although the present process has been described with
reference to specific details of certain embodiments thereof, it is
not intended that such details should be regarded as limitations
upon the scope of the invention except as and to the extent that
they are included in the accompanying claims.
[0129] The following examples are put forth so as to provide those
of ordinary skill in the art with a complete disclosure and
description of how the compounds, compositions, articles, devices
and/or methods claimed herein are made and evaluated, and are
intended to be purely exemplary of the invention and are not
intended to limit the scope of what the inventors regard as their
invention. Efforts have been made to ensure accuracy with respect
to numbers (e.g., amounts, temperature, etc.), but some errors and
deviations should be accounted for. Unless indicated otherwise,
parts are parts by weight, temperature is in .degree. C. or is at
ambient temperature, and pressure is at or near atmospheric.
D. EXAMPLES
1. Example 1
[0130] Materials and methods: The chromogenic substrates
H-D-Val-Leu-Lys-p-nitroanilide (S-2251) was purchased from
DiaPharma Group Inc. (West Chester, Ohio). Human plasmin was
purchased from Enzyme research laborotories. Bovine aprotinin
(BPTI) was used from Zymogenetics. Escherichia coli strain BL21
(DE3) pLys and pET28a expression vector were products of Novagen
Inc. (Madison, Wis.). The QuikChange.RTM. site-directed mutagenesis
kit was obtained from Stratagene (La Jolla, Calif.).
[0131] Expression and Purification of Wild type and Mutant
Proteins. The first Kunitz-type proteinase inhibitor domain of
human TFPI-2 (KD1) was cloned into pET28a vector containing a His
tag. The mutants were obtained by site directed mutagenesis. The
proteins were overexpressed as N-terminal His-tagged fusion
proteins in E. coli strain BL21 (DE3) pLys S. using the T7 promoter
system. The overexpressed proteins were recovered as inclusion
bodies and proteins were folded and purified free of his Tag (27).
The concentrations were determined by UV spectroscopy.
[0132] Plasmin Inhibition Assays. Plasmin inhibition assays were
performed by incubating plasmin with various concentrations of
inhibitor preparations (BPTI, KD1WT, KD1 mutants R24K, L26R or
R24K/L26R) in 50 mM Tris-HCl, pH 7.5 containing 100 mM NaCl, 0.1
mg/mL BSA, 5 mM CaCl.sub.2 for 1 hr at 37.degree. C. in a 96-well
microtitre plate. The chromogenic substrate S-2251 was then added,
and residual amidolytic activity was measured in a Molecular
Devices UVmax kinetic microplate reader at different end points
(0.5 and 1 hr) and S2251 (0.5 and 1 mM) concentrations. Plasmin
inhibitory data were analyzed according to the quadratic binding
expression.
[0133] In control experiments, it was first studied if there was
any substrate-induced displacement of bound inhibitor by increasing
substrate concentrations. Both BPTI (FIG. 2) and WTKD1 (FIG. 3)
were assayed and our results show that there is apparently no
displacement of bound inhibitor by increasing substrate
concentrations. It was also tested whether or not increased time of
incubation of inhibitor with plasmin would result in enhanced
inhibition. This was not the case either (FIG. 2 and FIG. 3). These
results validate the results presented in FIG. 4. The results
obtained from the plasmin inhibitory studies show that the mutant
R15K/L17R is a potent inhibitor of plasmin and inhibits plasmin
manifold strongly than either the wild type KD1 or the R24K mutant
(FIG. 4). Ki* (inhibitory constant) values of 22 nM for WT, 10 nM
for R15K, 6 nM for L26R and 3 nM for the R15K/L17R were obtained.
Thus L17R change is very important. The L17R change was made based
upon molecular modeling. The R15K/L17R mutant binds much strongly
to plasmin than WTKDI (7-fold) or the R15K (.about.2-fold) mutant.
The L17R mutants binds plasmin approximately 4-fold stronger than
the WT KD1 Thus, L26R or R15K/L17R can replace BPTI in clinical
therapeutics.
[0134] Throughout this application, various publications are
referenced. The disclosures of these publications in their
entireties are hereby incorporated by reference into this
application in order to more fully describe the state of the art to
which this invention pertains.
2. Example 2
Abolishing the Intrinsic Coagulation Inhibitor Activity of Kunitz
Domain 1 (KD1) of TFPI-2
[0135] Nomenclature Information
[0136] R24 (also known as R15) is P1
[0137] A25 (also known as A16) is P1'
[0138] L26 (also known as L17) is P2'
[0139] TFPI-2 inhibits intrinsic coagulation presumably through the
inhibition of factor XIa (Petersen et al. Biochemistry. 1996 Jan.
9; 35 (1):266-272). Like all serine proteases, factor XIa cleaves
between P1-P1' residues TRAE or TRVV (P2-P1-P1'-P2'). Thus KD1 WT
having Leu (hydrophobic residue like Val) at P2' position should
inhibit factor XIa. Thus changing Leu to Arg at P2' position should
reduce/abrogate this inhibition.
[0140] A common procedure to test inhibition of clotting is to
examine the aPTT (activated partial thromboplastin time) of normal
plasma. In this test, surface activator plus phospholipid was mixed
with normal plasma in equal amounts (75 microliter). Ten microliter
of buffer containing inhibitor (KD1 wt, KD1 L26R or BPTI) was added
and the sample incubated for five minutes at 37.degree. C.
Seventy-five microliter of 25 mM CaCl.sub.2 prewarmed to 37.degree.
C. was then added and the time needed to form the clot was noted.
The data are shown in FIG. 5. In the aPTT system, coagulation is
initiated by the activation of factor XII to Factor XIIa by contact
phase involving the kallikrein system. Factor XIIa then activates
factor XI to factor XIa in the coagulation cascade.
[0141] BPTI inhibits kallikrein whereas KD1 WT inhibits both
kallikrein and factor XIa (Petersen et al 1996). This can result in
the prolongation of the aPTT by BPTI and KD1 WT whereas L26R Mutant
of KD1 is expected to inhibit neither as indicated by no inhibition
(prolongation) of aPTT (FIG. 5). This observation makes the L26R
KD1 a specific inhibitor of plasmin. It also increases its
inhibitory potency towards plasmin as well. Thus, L26R KD1 has no
effect on clotting and is a more potent inhibitor than the Wt
KD1.
[0142] The mutant protein L26R loses activity as an anticoagulant
and becomes specific as an antifibrinolytic agent. So the mutant is
more active as an antifibrinoltic agent but it also is no longer an
anticoagulant. This property makes it useful in preventing
bleeding.
3. Example 3
Mouse Plasmin Inhibition Data
[0143] Both WT KD1 and L26R inhibited mouse plasmin effectively.
This is shown in FIG. 6. Clearly the WT KD1 and the L26R mutant are
quite effective in inhibiting mouse plasmin with an apparent Kd
value of .about.80 nM. Complete inhibition was obtained at 1 .mu.M
for both WT and L26R KD1(Masci et al. Blood Coagulation and
Fibrinolysis 2000, Vol 11, No 4, pages 385-393, reference herein
incorporated in its entirety and for its teachings regarding in
vivo plasmin inhibition). Since both the wild-type and the mutant
inhibit mouse plasmin, one can use the mutant to show efficacy in
vivo in an animal model of bleeding.
[0144] A mouse tail vein bleeding model has been described to study
the efficacy of a snake plasmin inhibitor (Masci et al; Blood
Coagulation and Fibrinolysis 2000, Vol 11, pages 385-393). Using
this mouse tail vein bleeding model, compared to saline control, a
67-70% reduction in blood loss was observed when either Aprotinin,
WT KD1 or the mutant L26R was administered intravenously at about
100 microgram/mouse. The doses of the plasmin inhibitors used in
these experiments were similar to that used during human CPB
(cardiopulmonary bypass) surgery, adjusted to the mouse weight. The
Animal Ethics Committee of UCLA approved all mice experiments and
the dose used in human surgery adjusted to mouse weight was a
realistic basis for these initial studies. The serum BUN/Creatinine
levels were normal after two days and seven days following
administration of the drug. The microscopic examination of tissues
revealed no injury to major organs such as kidney, heart and brain.
KD1 WT and KD1 L26R reduced blood loss nearly as effectively as
Aprotinin. However, this is expected since the dose used may be
high enough to not see differences between the different inhibitors
(aprotinin, WT KD1 or the L26R mutant). Further the human KD1 L26R
could have a better efficacy in humans because it inhibits human
plasmin more selectively and does not inhibit coagulation.
REFERENCES
[0145] 1. Gans H, Castaneda A R, Subramanian V, John S, Lillehei C
W. Problems in hemostasis during open heart surgery. IX. Changes
observed in the plasminogen-plasmin system and their significance
for therapy. Ann Surg 166: 980-986, 1967.
[0146] 2. Shahian D M, and Levine J D. Open-heart surgery in a
patient with heterozygous alpha 2-antiplasmin deficiency.
Perioperative strategies in the first reported case. Chest
97:1488-1490, 1990.
[0147] 3. Taggart D P, Diapardy V, Naik M, and Davies A. A
randomized trial of aprotinin (Trasylol) on blood loss, blood
product requirement, and myocardial injury in total arterial
grafting. J Thorac Cardiovasc Surg 126: 1087-94, 2003.
[0148] 4. Sievert A, McCall M, Blackwell M, and Bradley S. Effects
of topical applications of aprotinin and tranexamic acid on blood
loss after open heart surgery. Anadolu Kardiyol Derg. 5:36-40,
2005
[0149] 5. Kokoszka A, Kuflik P, Bitan F, Casden A, Neuwirth M.
Evidence-based review of the role of aprotinin in blood
conservation during orthopaedic surgery. J Bone Joint Surg Am
87:1129-36, 2005
[0150] 6. Li J, Ny A, Leonardsson, G, Nandakumar K S, Holmdahl R,
and Ny T. The plasminogen activator/plasmin system is essential for
development of the joint inflammatory phase of collagen type
II-induced arthritis. Am J Pathol 166: 783-92, 2005.
[0151] 7. Judex M O, and Mueller B M. Plasminogen
activation/plasmin in rheumatoid arthritis: matrix degradation and
more. Am J Pathol 166: 645-647, 2005
[0152] 8. Lijnen H R. Pleiotropic functions of plasminogen
activator inhibitor-1. J Thromb Haemost 1:35-45, 2005
[0153] 9. Hilal G, Martel-Pelletier J, Pelletier J P, Ranger P, and
Lajeunesse D., Osteoblast-like cells from human subchondral
osteoarthritic bone demonstrate analtered phenotype in vitro.
Possible role in subchondral bone sclerosis. Arthritis Rheum
41:891-899, 1998
[0154] 10. Ronday H K, Smits H H, Quax P H, van der Pluijm G, Lowik
C W, Breedveld F C, and Verheijen J H. Bone matrix degradation by
the plasminogen activation system. Possible mechanism of bone
destruction in arthritis. Br J Rheumatol 36:9-15, 1997.
[0155] 11. Novak J F, Hayes J D, Nishimoto S K. Plasmin-mediated
proteolysis of osteocalcin. J Bone Miner Res 12:1035-1042,
1997.
[0156] 12. Daci E, Udagava N, Martin T J, Bouillon R, and Carmeliet
G. The role of the plasminogen system in bone resorption in vitro.
J Bone Miner Res 14:946-52, 1999
[0157] 13. Sakamaki H, Ogura N, Kujiraoka H, Akiba, M, Abikao Y,
and Nagura H. Activities of plasminogen activator, plasmin and
kallikrein in synovial fluid from patients with temporomandibular
joint disorders. Int J Oral Maxillofac Surg 30:323-328, 2001
[0158] 14. Roy M E, Nishimoto S K. Matrix Gla protein binding to
hydroxyapatite is dependent on the ionic environment: calcium
enhances binding affinity but phosphate and magnesium decrease
affinity. Bone 31:296-302, 2002.
[0159] 15. Daci E. Everts V, Torrekens S, Van Herck E,
Tigchelaar-Gutterr W, Bouillon R, and Carmeliet G. Increased bone
formation in mice lacking plasminogen activators. J MinerRes Bone
18:1167-76, 2003.
[0160] 16. Choong P F, and Nadesapillai. Urokinase plasminogen
activator system: a multifunctional role in tumor progression and
metastasis. Clin Orthop Relat Res 415:S46-S58, 2003 (Suppl)
[0161] 17. Castellino F J, and Ploplis V A. Structure and function
of the plasminogen/plasmin system. Thromb Haemost 93:647-54,
2005
[0162] 18. Sprecher C A, Kisiel W, Mathewes S, and Foster D C.
Molecular cloning, expression, and partial characterization of a
second human tissue factor pathway inhibitor. Proc Natl Acad Sci
USA 91:3353-7, 1994
[0163] 19. Miyagi Y, Koshikawa N, Yasumitsu H, Miyagi E, Hirahara
F, Aoki I, Misugi K, Umeda M, and Miyazaki K. cDNA cloning and mRNA
expression of a serine proteinase inhibitor secreted by cancer
cells: identification as placental protein 5 and tissue factor
pathway inhibitor-2. J Biochem (Tokyo) 116:939-42, 1994
[0164] 20. Rao C N, Peavey C L, Liu Y Y, Lapiere J C, and Woodley D
T. Partial characterization of matrix-associated serine protease
inhibitors from human skin cells J Invest. Dermatol. 104, 379-383,
1995
[0165] 21. Udagawa K, Miyagi Y, Hirahara F, Miyagi E, Nagashima, Y,
Minaguchi H, Misugi K, Yasumitsu H, and Miyazaki K. Specific
expression of PP5/TFPI2 mRNA by syncytiotrophoblasts in human
placenta as revealed by in situ hybridization Placenta 19, 217-223,
1998
[0166] 22. Sugiyama T, Ishii S, Yamamoto J, Irie R, Saito K, Otuki
T, Wakamatsu A, Suzuki Y, Hio Y, Ota T, Nishikawa T, Sugano S,
Masuho Y, Isogai T. cDNA macroarray analysis of gene expression in
synoviocytes stimulated with TNFalpha FEBS Lett. 517, 121-128,
2002
[0167] 23. Iino M, Foster D C, Kisiel W. Quantification and
characterization of human endothelial cell-derived tissue factor
pathway inhibitor-2. Arterioscler. Thromb. Vasc. Biol. 18, 40-46,
1998
[0168] 24. Rao C N, Reddy P, Liu Y Y, O'Toole E A O, Reeder D J,
Foster D C, Kisiel W, and Woodley, D T. Extracellular
matrix-associated serine protease inhibitors (Mr 33,000, 31,000,
and 27,000) are single-gene products with differential
glycosylation: cDNA cloning of the 33-kDa inhibitor reveals its
identity to tissue factor pathway inhibitor-2. Arch. Biochem.
Biophys. 335, 45-52, 1996
[0169] 25. Chand, H. S., Schmidt, A. E., Bajaj, S. P., and Kisiel,
W. Structure-function analysis of the reactive site in the first
Kunitz-type domain of human tissue factor pathway inhibitor-2. J
Biol Chem 279:17500-17507, 2004
[0170] 26. Huber R, Kukla D, Bode W, Schwager P, Bartels K,
Deisenhofer J, Steigemann W. Structure of the complex formed by
bovine trypsin and bovine pancreatic trypsin inhibitor. II.
Crystallographic refinement at 1.9 A resolution. J Mol Biol.
89:73-101, 1974
[0171] 27. Schmidt A E, Chand H S, Cascio D, Kisiel W, Bajaj S P.
Crystal Structure of Kunitz Domain 1 (KD1) of Tissue Factor Pathway
Inhibitor-2 in Complex with Trypsin: Implications for KD1
Specificity of Inhibition. J Biol Chem. 280:27832-27838, 2005
[0172] 28. Wang, X., Lin, X., Loy, J. A., Tang, J., and Zhang, X.
C. Crystal structure of the catalytic domain of human plasmin
complexed with streptokinase Science 281, 1662-1665, 1998.
[0173] 29. Bajaj, M. S., Birktoft, J. J., Steer, S. A., and Bajaj,
S. P. Structure and biology of tissue factor pathway inhibitor.
Thromb. Haemost. 86, 959-972, 2001.
[0174] 30. Beierlein W, Scheule A M, Dietrich W, Ziemer G. Forty
years of clinical aprotinin use: a review of 124 hypersensitivity
reactions. Ann Thorac Surg. 79:741-748, 2005.
Sequence CWU 1
1
6173PRTArtificial SequenceSynthetic Construct 1Asp Ala Ala Gln Glu
Pro Thr Gly Asn Asn Ala Glu Ile Cys Leu Leu1 5 10 15Pro Leu Asp Tyr
Gly Pro Cys Arg Ala Leu Leu Leu Arg Tyr Tyr Tyr 20 25 30Asp Arg Tyr
Thr Gln Ser Cys Arg Gln Phe Leu Tyr Gly Gly Cys Glu 35 40 45Gly Asn
Ala Asn Asn Phe Tyr Thr Trp Glu Ala Cys Asp Asp Ala Cys 50 55 60Trp
Arg Ile Glu Lys Val Pro Lys Val65 70273PRTArtificial
SequenceSynthetic Construct 2Asp Ala Ala Gln Glu Pro Thr Gly Asn
Asn Ala Glu Ile Cys Leu Leu1 5 10 15Pro Leu Asp Tyr Gly Pro Cys Arg
Ala Arg Leu Leu Arg Tyr Tyr Tyr 20 25 30Asp Arg Tyr Thr Gln Ser Cys
Arg Gln Phe Leu Tyr Gly Gly Cys Glu 35 40 45Gly Asn Ala Asn Asn Phe
Tyr Thr Trp Glu Ala Cys Asp Asp Ala Cys 50 55 60Trp Arg Ile Glu Lys
Val Pro Lys Val65 70359PRTArtificial SequenceSynthetic Construct
3Asn Ala Glu Ile Cys Leu Leu Pro Leu Asp Tyr Gly Pro Cys Arg Ala1 5
10 15Arg Leu Leu Arg Tyr Tyr Tyr Asp Arg Tyr Thr Gln Ser Cys Arg
Gln 20 25 30Phe Leu Tyr Gly Gly Cys Glu Gly Asn Ala Asn Asn Phe Tyr
Thr Trp 35 40 45Glu Ala Cys Asp Asp Ala Cys Trp Arg Ile Glu 50
55473PRTArtificial SequenceSynthetic Construct 4Asp Ala Ala Gln Glu
Pro Thr Gly Asn Asn Ala Glu Ile Cys Leu Leu1 5 10 15Pro Leu Asp Tyr
Gly Pro Cys Arg Met Arg Leu Leu Arg Tyr Tyr Tyr 20 25 30Asp Arg Tyr
Thr Gln Ser Cys Arg Gln Phe Leu Tyr Gly Gly Cys Glu 35 40 45Gly Asn
Ala Asn Asn Phe Tyr Thr Trp Glu Ala Cys Asp Asp Ala Cys 50 55 60Trp
Arg Ile Glu Lys Val Pro Lys Val65 70558PRTArtificial
SequenceSynthetic Construct 5Arg Pro Asp Phe Cys Leu Glu Pro Pro
Tyr Thr Gly Pro Cys Lys Ala1 5 10 15Arg Ile Ile Arg Tyr Phe Tyr Asn
Ala Lys Ala Gly Leu Cys Gln Thr 20 25 30Phe Val Tyr Gly Gly Cys Arg
Ala Lys Arg Asn Asn Phe Lys Ser Ala 35 40 45Glu Asp Cys Met Arg Thr
Cys Gly Gly Ala 50 55658PRTArtificial SequenceSynthetic construct
6Asn Ala Glu Ile Cys Leu Leu Pro Leu Asp Tyr Gly Pro Cys Arg Ala1 5
10 15Leu Leu Leu Arg Tyr Tyr Tyr Asp Arg Tyr Thr Gln Ser Cys Arg
Gln 20 25 30Phe Leu Tyr Gly Gly Cys Glu Gly Asn Ala Asn Asn Phe Tyr
Thr Trp 35 40 45Glu Ala Cys Asp Asp Ala Cys Trp Arg Ile 50 55
* * * * *
References