U.S. patent application number 14/542281 was filed with the patent office on 2015-05-21 for glycoengineered binding protein compositions.
This patent application is currently assigned to ABBVIE, INC.. The applicant listed for this patent is AbbVie, Inc.. Invention is credited to Georgeen Gaza-Bulseco, Tariq Ghayur, Subramanya Hedge, Sudha Krishnan, Boris Labkovsky, Pratibha Mishra.
Application Number | 20150139988 14/542281 |
Document ID | / |
Family ID | 52434932 |
Filed Date | 2015-05-21 |
United States Patent
Application |
20150139988 |
Kind Code |
A1 |
Labkovsky; Boris ; et
al. |
May 21, 2015 |
GLYCOENGINEERED BINDING PROTEIN COMPOSITIONS
Abstract
Provided are glycoengineered populations of Fc domain-containing
binding proteins with a reduced anti-drug immune response (ADA).
Also provided are methods of treating disease using such
compositions, and methods and host for making such
compositions.
Inventors: |
Labkovsky; Boris; (Wales,
MA) ; Ghayur; Tariq; (Holliston, MA) ;
Gaza-Bulseco; Georgeen; (Princeton, MA) ; Mishra;
Pratibha; (Shrewsbury, MA) ; Hedge; Subramanya;
(Shrewsbury, MA) ; Krishnan; Sudha; (Acton,
MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
AbbVie, Inc. |
North Chicago |
IL |
US |
|
|
Assignee: |
ABBVIE, INC.
North Chicago
IL
|
Family ID: |
52434932 |
Appl. No.: |
14/542281 |
Filed: |
November 14, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61904487 |
Nov 15, 2013 |
|
|
|
62051669 |
Sep 17, 2014 |
|
|
|
Current U.S.
Class: |
424/133.1 ;
435/328 |
Current CPC
Class: |
Y02A 50/386 20180101;
C07K 2317/14 20130101; C07K 2317/56 20130101; C07K 2317/41
20130101; C07K 2317/77 20130101; Y02A 50/30 20180101; C07K 2317/21
20130101; C07K 2317/52 20130101; C07K 16/241 20130101; C07K 2317/30
20130101; C07K 16/00 20130101; A61K 2039/505 20130101 |
Class at
Publication: |
424/133.1 ;
435/328 |
International
Class: |
C07K 16/24 20060101
C07K016/24 |
Claims
1. A glycoengineered binding protein composition comprising a
population of Fc domain-containing binding proteins having an G/M
ratio of at least 10:1, wherein the total percent amount of G1 and
G2 glycoforms in the population is more than 50%, wherein the total
percent amount of M3-M9 glycoforms is less than 10%, wherein Fc
domain containing binding proteins of the composition comprise the
same polypeptide sequence, and wherein the glycoengineered binding
protein composition exhibits a lower ADA response and/or a greater
serum half-life than a non-hypergalactosylated population of Fc
domain-containing binding proteins.
2. The composition of claim 1, wherein the total percent amount of
G1 and G2 glycoforms in the population is more than 80%, or more
than 99%.
3. The composition of claim 1, wherein less than 5%, or less than
1%, or less than 0.1% of the Fc domain-containing binding proteins
in the population comprise M3-M9 glycoforms.
4. The composition of claim 1, wherein the population of Fc
domain-containing binding proteins is selected from the group
consisting of: (1) a population of Fc domain-containing binding
proteins having a G1/2:M ratio of at least 10:1, at least 50:1, at
least 80:1, or at least 99:1, (2) a population of Fc
domain-containing binding proteins having a GS:M ratio of at least
10:1, at least 50:1, at least 80:1, or at least 99:1 and (3) a
population of Fc domain-containing binding proteins having a
Gtotal:M ratio of at least 10:1, at least 50:1, at least 80:1, or
at least 99:1.
5. (canceled)
6. (canceled)
7. The composition of claim 1, wherein the Fc domain-containing
binding proteins in the population comprises an antigen-binding
portion of an antibody or a non-antibody antigen binding
portion.
8. (canceled)
9. The composition of claim 7, wherein the antigen-binding portion
binds to tumor necrosis factor alpha (TNF.alpha.).
10. The composition of claim 9, wherein the population of Fc
domain-containing binding proteins comprises the polypeptide
sequence of etanercept, infliximab, adalimumab, or golimumab or the
polypeptide sequence of a variant of etanercept, infliximab,
adalimumab, or golimumab.
11. (canceled)
12. The composition of claim 11, wherein the variant of adalimumab
is selected from the group consisting of: (1) a variant of
adalimumab exhibiting pH-sensitive binding to the TNF antigen, (2)
a variant of adalimumab that is D2E7SS22 and comprises a heavy
chain variable region sequence of SEQ ID NO:1 and a light chain
variable region sequence of the light chain of SEQ ID NO:2, (3) a
variant of adalimumab comprising a variant Fc region, and (4) a
variant of adalimumab comprising a variant Fc region that is a
human IgG1 Fc region comprising the mutations T250Q and M428L
relative to a wild-type human IgG1 sequence (numbering according to
the EU convention as in Kabat).
13. (canceled)
14. (canceled)
15. (canceled)
16. The composition of claim 1, wherein the Fc binding polypeptide
is a dual variable domain immunoglobulin (DVD-Ig).
17. The composition of claim 1, wherein the composition is obtained
from a cultured mammalian host cell line.
18. The composition of claim 17, wherein the host cell line is a
CHO cell line containing a heterologous galactosyltransferase gene
or a knockdown of one or both the alleles of a Beta galactosidase
gene.
19. (canceled)
20. A composition comprising the population of Fc domain-containing
binding proteins of claim 1 and a pharmaceutically acceptable
carrier or excipient.
21. A method of reducing a subject's anti-drug antibody (ADA)
response to a first population of Fc domain-containing binding
proteins, the method comprising glycoengineering the first
population of Fc domain-containing binding proteins to obtain a
binding protein composition comprising a second population of
Fc-domain containing binding proteins having a G/M ratio of at
least 10:1, a total percent amount of G1 and G2 glycoforms of more
than 50%, and a total percent amount of M3-M9 glycoforms of less
than 10%, wherein the second population of Fc domain-containing
binding proteins has a greater serum half-life than the first
population of Fc domain-containing binding proteins.
22. The method of claim 21, wherein the total percent amount of G1
and G2 glycoforms in the second population is more than 80%, or
more than 99%.
23. The method of claim 21, wherein less than 5%, or less than 1%,
or less than 0.1% of the Fc domain-containing binding proteins in
the second population comprise M3-M9 glycoforms.
24. The method of claim 21, wherein the second population of Fc
domain-containing binding proteins is selected from the group
consisting of (1) a second population of Fc domain-containing
binding proteins having a G1/2:M ratio of at least 10:1, at least
50:1, at least 80:1, or at least 99:1, (2) a second population of
Fc domain-containing binding proteins having a GS:M ratio of at
least 10:1, at least 50:1, at least 80:1, or at least 99:1, and (4)
a second population of Fc domain-containing binding proteins having
a Gtotal:M ratio of at least 10:1, at least 50:1, at least 80:1, or
at least 99:1.
25. (canceled)
26. (canceled)
27. The method of claim 21, wherein the Fc domain-containing
binding proteins bind to tumor necrosis factor alpha
(TNF.alpha.).
28. The method of claim 27, wherein the first population of Fc
domain-containing binding proteins comprises the polypeptide
sequence of etanercept, infliximab, adalimumab, or golimumab or the
polypeptide sequence of a variant of etanercept, infliximab,
adalimumab, or golimumab.
29. (canceled)
30. The method of claim 28, wherein the variant of adalimumab is
selected from the group consisting of (1) a variant of adalimumab
that exhibits pH-sensitive binding to the TNF antigen, (2) a
variant of adalimumab that is D2E7SS22 and comprises a heavy chain
variable region sequence of SEQ ID NO: 1 and a light chain variable
region sequence of the light chain of SEQ ID NO:2. (3) a variant of
adalimumab comprising a variant Fc region, and (2) a variant of
adalimumab comprising a variant Fc region that is a human IGg1 Fc
region comprising the mutations T250Q and M428L relative to a
wild-type human IgG1 sequence (numbering according to the EU
convention as in Kabat).
31. (canceled)
32. (canceled)
33. (canceled)
34. The method of claim 21, wherein said glycoengineering comprises
expressing the Fc-domain containing binding proteins in cultured
mammalian host cell line that has been glycoengineered to produce
hypergalactosylated and/or hypomannosylated binding proteins.
35. The method of claim 34, wherein the host cell line is a CHO
cell line containing a heterologous galactosyltransferase gene or a
knockdown of one or both the alleles of a Beta galactosidase
gene.
36. (canceled)
37. A host cell that produces a glycoengineered population of Fc
domain-containing binding proteins wherein the population has one
or more of the following properties: a) the total percent amount of
G1 and G2 glycoforms in the population is more than 50%, more than
80%, or more than 99%; b) less than 10%, less than 5%, less than
1%, or less than 0.1% of the Fc domain-containing binding proteins
in the population comprise M3-M9 glycoforms; c) a G1/2:M ratio of
at least 10:1, at least 50:1, at least 80:1, or at least 99:1; d) a
GS:M ratio of at least 10:1, at least 50:1, at least 80:1, or at
least 99:1; and e) a Gtotal:M ratio of at least 10:1, at least
50:1, at least 80:1, or at least 99:1.
38. A method of treating a disorder in a subject in need thereof,
comprising administering to the subject an effective amount of the
glycoengineered composition of claim 1.
39. The method of claim 38, wherein the disorder is a TNF.alpha.
associated disorder.
Description
RELATED APPLICATIONS
[0001] This application claims priority to U.S. Provisional
Application No. 61/904,487, filed Nov. 15, 2013 and U.S.
Provisional Application No. 62/051,669, filed Sep. 17, 2014, the
contents of which are hereby incorporated by reference herein in
their entireties.
FIELD OF THE INVENTION
[0002] The present invention relates to compositions of recombinant
Fc binding proteins, e.g., recombinant antibodies, which exhibit
improved properties (e.g., a reduced anti-drug immune response) as
a result of their optimized glycosylation profile.
BACKGROUND
[0003] The use of therapeutic binding proteins has revolutionized
the treatment of many diseases, including cancer, inflammatory
bowel disease (IBD), ankylosing spondylitis, multiple sclerosis,
psoriasis and rheumatoid arthritis (RA). Despite their success in
improving the quality of life of patients, long-term treatment with
therapeutic binding proteins is often associated with the emergence
of anti-drug antibodies (ADA) against the therapeutic agent. The
development of ADA results in progressively lower serum drug levels
and a diminished treatment efficacy.
[0004] For example, a 2011 study of rheumatoid arthritis patients
treated with adalimumab revealed the development of anti-drug
antibodies resulted in significantly lower remission rates.
Two-thirds of the anti-adalimumab antibody-positive patients
developed antibodies to the drug within the first 28 weeks of
treatment. The presence of anti-adalimumab antibodies was further
shown to substantially reduce serum adalimumab concentrations.
Similar results have been reported for infliximab, adalimumab, and
natalizumab (see Bartelds et al., JAMA. 2011; 305(14):1460-1468).
Such ADA immune responses, therefore, decrease the overall efficacy
and utility of therapeutic binding proteins.
[0005] Accordingly, there is a need in the art for recombinant
protein therapeutics compositions that exhibit a reduced ADA
response relative to current therapeutic binding proteins.
SUMMARY OF THE INVENTION
[0006] The present disclosure provides novel binding protein
compositions exhibiting a surprisingly reduced anti-drug antibody
(ADA) immune response as a result of their optimized glycoprofile.
These compositions generally comprise a population of Fc
domain-containing binding proteins that are hypergalactosylated
(e.g., enriched for binding proteins with highly galactosylated
glycoforms) and/or hypomannosylated (e.g., deficient in binding
proteins with highly mannosylated glycoforms) on the Fc
glycosylation site of the binding proteins. Thus, the compositions
of the invention may be characterized as having glycan structures
with a G/M ratio (galactose content/mannose content) of greater
than 1:1, e.g., greater than 10:1, 50:1 or 99:1. Also provided are
methods of treating a disorder using these compositions, and
methods and host cells for making such compositions.
[0007] The binding protein compositions disclosed herein are
particularly advantageous in that they exhibit a longer serum
half-life than non-hypergalactosylated and/or non-hypomannosylated
Fc domain-containing binding protein compositions and, therefore,
require less frequent dosing to be efficacious.
[0008] Accordingly, in one aspect, the instant disclosure provides
a hypergalactosylated population of Fc domain-containing binding
proteins, wherein the total percent amount of G1 and G2 glycoforms
in the population is more than 50% (e.g., more than 80%, more than
90%, more than 95% or more than 99%). In certain embodiments, the
total percent amount of G1 and G2 glycoforms in the population is
more than 80%. In certain embodiments, the G1 and G2 glycoforms in
the population are fucosylated. In certain embodiments, the total
percent amount of G1, G2, G1S1, G2S1 and G2S2 glycoforms in the
population is more than 50% (e.g., more than 80%, or more than
99%). In certain embodiments, the total percent amount of G1, G2,
G1S1, G2S1 and G2S2 glycoforms in the population is more than 80%.
In certain embodiments, the G1, G2, G1S1, G2S1 and G2S2 glycoforms
in the population are fucosylated.
[0009] In other aspects, the binding protein compositions of the
invention are also hypomannosylated. For example, the binding
protein composition of the inventions may exhibit less than 10% of
highly mannosylated glycoforms (oligomannose species, e.g., M3-M9
glycoforms) in population of Fc-domain-containing binding proteins.
In certain embodiments, less than 5% (e.g., less than 1% or less
than 0.1%) of the Fc domain-containing binding proteins in the
population are highly mannosylated.
[0010] In certain embodiments, the binding protein compositions of
the invention have a G/M ratio of greater than 1:1 (e.g., at least
2:1, 5:1, 10:1, 80:1 or at least 99:1). In certain embodiments, the
population of Fc domain-containing binding proteins has a G1/2:M
ratio of at least 10:1 (e.g., at least 50:1, at least 80:1, or at
least 99:1). In certain embodiments, the population of Fc
domain-containing binding proteins has a GS:M ratio of at least
10:1 (e.g., at least 50:1, at least 80:1, or at least 99:1). In
certain embodiments, the population of Fc domain-containing binding
proteins has a Gtotal:M ratio of at least 10:1 (e.g., at least
50:1, at least 80:1, or at least 99:1).
[0011] In certain embodiments, the Fc domain-containing binding
proteins in the population comprise an antigen-binding portion of
an antibody. In certain embodiments, the antibody is selected from
the group consisting of alemtuzumab, bevacizumab, cetuximab,
edrecolomab, gemtuzumab ozogamicin, ibritumomab tiuxetan,
ofatumumab, panitumumab, rituximab, tositumomab, trastuzumab,
arcitumomab, capromab pendetide, nofetumomab, satumomab,
basiliximab, daclizumab, muromonab-cd3, infliximab, natalizumab,
adalimumab, certolizumab, golimumab, infliximab, tocilizumab,
omalizumab, abciximab, bevacizumab, ranibzumab, natalizumab,
efalizumab, ustekinumab, palivizumab, ruplizumab, denosumab,
eculizumab, alefacept, abatacept, etanercept, romiplostim,
rilonacept, aflibercept, belatacept, or rilonacept. In certain
embodiments, the Fc domain-containing binding proteins in the
population comprise a non-antibody antigen-binding portion. In
certain embodiments, the hypergalactosylated population is a
hypergalactosylated population of dual variable domain
immunoglobulins (DVD-Ig).
[0012] In certain aspects, the invention provides compositions
wherein the binding proteins in the population bind to tumor
necrosis factor alpha (TNF.alpha.). In certain embodiments, the
binding protein is selected from the group consisting of
etanercept, infliximab, adalimumab, or golimumab. In certain
exemplary embodiments, the binding protein is the anti-TNF antibody
adalimumab or a variant thereof. In certain embodiments, the
anti-TNF antibody is an Fc variant of adalimumab (D2E7) comprising
the heavy and light chain variable region sequences of adalimumab
and a variant Fc region with an amino acid substitution that
confers enhanced serum half-life. In certain exemplary embodiments,
the variant Fc region is a human IgG1 Fc region comprising the
mutations T250Q and M428L relative to a wild-type human IgG1
sequence (wherein amino acid numbering is according to the EU
numbering convention as in Kabat). In other embodiments, the
anti-TNF antibody is a variant of adalimumab which exhibits
pH-sensitive binding to the TNF antigen. In one exemplary
embodiment, the pH-sensitive variant of adalimumab is a D2E7SS22
comprising the heavy chain of SEQ ID NO: 1 and the light chain of
SEQ ID NO: 2. In another exemplary embodiment, the pH-sensitive
variant comprises the heavy and light chain variable regions of
D2E7SS2 and a variant Fc region (e.g., a human IgG1 Fc region
comprising the mutations T250Q and M428L relative to a wild-type
human IgG1 sequence).
[0013] In certain embodiments, the binding compositions of the
invention are produced in a cultured mammalian host cell line
(e.g., a CHO cell line). In certain embodiments, the host cell line
has been glycoengineered to produce the hypergalactosylated and/or
hypomannosylated binding proteins of the invention. In certain
exemplary embodiments, the binding proteins of the invention are
obtained from a glycoengineered CHO cell. In one exemplary
embodiment, the glycoengineered CHO cell contains a heterologous
galactosyltransferase gene (e.g., mouse galactosyltransferase Beta
1,4). In another exemplary embodiment, the glycoengineered CHO cell
contains a knockdown of one of the alleles of the Beta
galactosidase gene. Exemplary glycoengineered host cells include
the GALtr11 CHO cell line and the ZFN-B1 CHO cell line described in
Examples 1 and 2 herein, respectively.
[0014] In a second aspect, the instant disclosure provides a method
of reducing a subject's anti-drug antibody (ADA) response to a
population of Fc domain-containing binding proteins, the method
comprising glycoengineering (e.g., hypergalactosylating and/or
hypomannosylating) a population of Fc domain-containing binding
proteins by increasing the G/M ratio of the population of Fc
domain-containing binding proteins, such that the glycoengineered
population of Fc domain-containing binding proteins has a greater
serum half-life than the non-glycoengineered population of Fc
domain-containing binding proteins. In certain embodiments, said
glycoengineering comprises expressing the Fc domain-containing
binding proteins in a glycoengineered host cell (e.g., a CHO cell
that has been glycoengineered to express hypergalactosylated and/or
hypomannosylated binding proteins), and isolating the
hypergalactosylated and/or hypomannosylated binding proteins from
the host cell.
[0015] In certain embodiments of the second aspect, the population
is glycoengineered such that the total percent amount of G1 and G2
glycoforms in the hypergalactosylated population is more than 80%.
In certain embodiments of the second aspect, the G1 and G2
glycoforms in the hypergalactosylated population are fucosylated.
In certain embodiments of the second aspect, the total percent
amount of G1, G2, G1S1, G2S1 and G2S2 glycoforms in the
hypergalactosylated population is more than 50% (e.g., more than
80%, or more than 99%). In certain embodiments of the second
aspect, the total percent amount of G1, G2, G1S1, G2S1 and G2S2
glycoforms in the hypergalactosylated population is more than 80%.
In certain embodiments of the second aspect, the G1, G2, G1S1, G2S1
and G2S2 glycoforms in the hypergalactosylated population are
fucosylated.
[0016] In certain embodiments of the second aspect, the methods of
the invention comprise glycoengineering a population of Fc
domain-containing binding proteins such that the population
exhibits less than 10% of highly mannosylated glycoforms
(oligomannose species, e.g., M3-M9 glycoforms). In certain
embodiments of the second aspect, less than 5% of the Fc
domain-containing binding proteins in the population comprise M3-M9
glycoforms. In certain embodiments of the second aspect, less than
1% of the Fc domain-containing binding proteins in the population
comprise M3-M9 glycoforms. In certain embodiments of the second
aspect, less than 0.1% of the Fc domain-containing binding proteins
in the population comprise M3-M9 glycoforms.
[0017] In certain embodiments of the second aspect, the methods of
the invention comprise glycoengineering a population of Fc
domain-containing binding proteins such that population of Fc
domain-containing binding proteins has a G1/2:M ratio of at least
10:1 (e.g., at least 50:1, at least 80:1, or at least 99:1). In
certain embodiments of the second aspect, the population of Fc
domain-containing binding proteins has a GS:M ratio of at least
10:1 (e.g., at least 50:1, at least 80:1, or at least 99:1). In
certain embodiments of the second aspect, the population of Fc
domain-containing binding proteins has a Gtotal:M ratio of at least
10:1 (e.g., at least 50:1, at least 80:1, or at least 99:1).
[0018] In certain embodiments of the second aspect, the Fc
domain-containing binding proteins in the population comprise an
antigen-binding portion of an antibody. In certain embodiments of
the second aspect, the Fc domain-containing binding proteins in the
population comprise a non-antibody antigen-binding portion. In
certain embodiments of the second aspect, the Fc domain-containing
binding proteins in the hypergalactosylated population comprise a
dual variable domain immunoglobulin (DVD-Ig).
[0019] In certain embodiments of the second aspect, the binding
proteins of the invention are selected from the group consisting of
alemtuzumab, bevacizumab, cetuximab, edrecolomab, gemtuzumab
ozogamicin, ibritumomab tiuxetan, ofatumumab, panitumumab,
rituximab, tositumomab, trastuzumab, arcitumomab, capromab
pendetide, nofetumomab, satumomab, basiliximab, daclizumab,
muromonab-cd3, infliximab, natalizumab, adalimumab, certolizumab,
golimumab, infliximab, tocilizumab, omalizumab, abciximab,
bevacizumab, ranibzumab, natalizumab, efalizumab, ustekinumab,
palivizumab, ruplizumab, denosumab, eculizumab, alefacept,
abatacept, etanercept, romiplostim, rilonacept, aflibercept,
belatacept, or rilonacept.
[0020] In certain embodiments of the second aspect, the binding
proteins of the invention comprise an antigen-binding portion that
binds to tumor necrosis factor alpha (TNF.alpha.). In certain
embodiments, the binding portion is selected from the group
consisting etanercept, infliximab, adalimumab, or golimumab. In
certain exemplary embodiments, the binding protein is adalimumab.
In other exemplary embodiments, the binding protein is an Fc
variant of adalimumab. In other embodiments, the binding protein is
D2E7SS22 or an Fc variant thereof.
[0021] In certain embodiments, the compositions of the invention do
not exhibit an increased level of antibody-dependent cellular
cytotoxicity (ADCC) activity and/or an increased level of
complement-dependent cellular cytotoxicity (CDC) activity as
compared to a composition that is not glycoengineered according to
the methods of the invention (e.g., a composition that is not
hypergalactosylated and/or hypomannosylated).
[0022] In a third aspect, the instant disclosure provides a
glycoengineered host cell (e.g., a CHO cell) that produces a
glycoengineered population of Fc domain-containing binding proteins
having an enhanced G/M ratio of greater than 10:1 (e.g., greater
than 50:1, 90:1 or 99:1). In certain embodiments, the
glycoengineered population of Fc domain-containing binding proteins
has one or more of the following properties: the total percent
amount of G1 and G2 glycoforms in the population is more than 50%
(e.g., more than 80%, or more than 99%); the total percent amount
of G1, G2, G1S1, G2S1 or G2S2 glycoforms in the population is more
than 50% (e.g., more than 80%, or more than 99%); less than 10%
(e.g., less than 1%, or less than 0.1%) of the Fc domain-containing
binding proteins in the population comprise highly mannosylated
(e.g., M3-M9) glycoforms; a G1/2:M ratio of at least 10:1 (e.g., at
least 50:1, at least 80:1, or at least 99:1): a GS:M ratio of at
least 10:1 (e.g., at least 50:1, at least 80:1, or at least 99:1);
or a Gtotal:M ratio of at least 10:1 (e.g., at least 50:1, at least
80:1, or at least 99:1). In certain embodiments of the third
aspect, the G1, G2, G1S1, G2S1 or G2S2 glycoforms in the
hypergalactosylated population are fucosylated.
[0023] In a fourth aspect, the instant disclosure provides a method
of treating a disorder in a subject in need thereof, comprising
administering to the subject an effective amount of the
hypergalactosylated population of Fc domain-containing binding
proteins described herein. In certain embodiments of the fourth
aspect, the disorder is a TNF.alpha. associated disorder.
BRIEF DESCRIPTION OF THE DRAWINGS
[0024] The skilled artisan will understand that the drawings,
described below, are for illustration purposes only. The figures
are not intended to limit the scope of the teachings in any
way.
[0025] FIG. 1A is a schematic of the processing and maturation of
an N-glycan. The mature Dol-P-P-glycan is transferred to
Asn-X-Ser/Thr sequons during protein synthesis as proteins are
being translocated into the ER. Following transfer of the 14-sugar
Glc.sub.3Man.sub.9GlcNAc.sub.2 glycan to protein, glucosidases in
the ER remove the three glucose residues, and ER mannosidase
removes a mannose residue. These reactions are intimately
associated with the folding of the glycoprotein assisted by the
lectins calnexin and calreticulin, and they determine whether the
glycoprotein continues to the Golgi or is degraded. Another lectin,
termed EDEM (ER degradation-enhancing .alpha.-mannosidase I-like
protein), binds to mannose residues on misfolded glycoproteins and
escorts them via retrotranslocation into the cytoplasm for
degradation. For most glycoproteins, additional mannose residues
are removed in the cis compartment of the Golgi until
Man.sub.5GlcNAc.sub.2Asn is generated. The action of GlcNAcT-1 on
Man.sub.5GlcNAc.sub.2Asn in the medial-Golgi initiates the first
branch of an N-glycan. The action of .alpha.-mannosidase II
generates the substrate for GlcNAcT-II. The resulting biantennary
N-glycan is extended by the addition of fucose, galactose, and
sialic acid to generate a complex N-glycan with two branches
(reviewed in Annual Review of Biochemistry, from R. Kornfeld and S.
Kornfeld. 1985. Annu. Rev. Biochem. 54: 631-634).
[0026] FIG. 1B is a schematic of an exemplary N-Glycan structure of
an Fc region of an antibody.
[0027] FIG. 1C is a schematic depicting exemplary
non-galactosylated glycans imparting immunogenic properties to
biologics.
[0028] FIG. 1D is a schematic depicting exemplary galactosylated
glycans imparting non-immunogenic properties to biologics.
[0029] FIG. 2A shows the cloning of mouse beta1-4
galactosyltransferase into the mammalian expression vector,
pCDN3.3.
[0030] FIG. 2B shows the DNA sequence (SEQ ID NO: 1) and
corresponding amino acid sequence (SEQ ID NO: 2) of the mouse
beta1-4 galactosyltransferase.
[0031] FIG. 2C shows the percentage of individual glycoforms of
anti-human TNF.alpha. expressed in standard and High-Gal CHO cell
lines. D2E7 is adalimumab (Humira.RTM.) expressed in a standard CHO
production cell line, ZFN-B1 is adalimumab expressed in a CHO cell
line with a knockout in one of the alleles of the beta
galactosidase gene; Galtr-11 and Gal88-D2E7 are glycoengineered
adalimumab preparations obtained from CHO cell lines overexpressing
.beta.-1, 4 galactosyltransferase; SA-D2E7 is a glycoengineered
adalimumab preparation obtained from a CHO cell line with a
knockout in one of the alleles of the beta galactosidase gene and
overexpressing .beta.-1, 4 galactosyltransferase (ZFN B1 Gal-T-11)
and further subjected to in vitro sialyltransferase treatment and
ion-exchange purification; and Gal79 DVD-Ig is a glycoengineered
IL17xTNF DVD-Ig (ABT-122) obtained from a CHO cell line
overexpressing .beta.-1, 4 galactosyltransferase.
[0032] FIG. 2D shows a mass spectrometry (MALDI-TOF) analysis of
the glycoengineered Galtr-11 adalimumab preparation in FIG. 2C.
Prominent peaks indicate the presence of the G1F (50,800 Da) and
G2F (50,962 Da) glycoforms.
[0033] FIG. 2E shows a mass spectrometry (MALDI-TOF) analysis of
the glycoengineered SA-D2E7 adalimumab preparation of FIG. 2C
before (bottom panel) and after (top panel) treatment with
sialyltransferase. Prominent peaks indicate the presence of G1F
(50,800 Da), G2F (50,962 Da), G2S1F (A1F; 51,253 Da), and G2S2F
(51,544 Da) glycoforms.
[0034] FIG. 3A shows the pinocytosis by human dendritic cells of
non-glycoengineered adalimumab (D2E7/Humira.RTM.) and
glycoengineered adalimumab (ZFN-B1) produced in a CHO cell line
with a knockout of one of the alleles of the beta galactosidase
gene.
[0035] FIG. 3B shows the internalization of transmembrane
TNF.alpha. induced in dendritic cells by non-glycoengineered
adalimumab (D2E7/Humira.RTM.) and glycoengineered adalimumab
(ZFN-B1) produced in a CHO cell line with a knockout of one of the
alleles of the beta galactosidase gene.
[0036] FIG. 3C shows the pinocytosis by human dendritic cells of
non-glycoengineered adalimumab (D2E7/Humira.RTM.) and
glycoengineered adalimumab (Gal88-D2E7 and SA-D2E7).
[0037] FIG. 4 is a schematic of the anti-TNF.alpha. capture assay
employed for Drug Metabolism and Pharmacokinetics (DMPK)
Bioanalysis of the glycoengineered compositions of the
invention.
[0038] FIG. 5A shows the pharmacokinetic (PK) profile of a
glycoengineered (hypergalactosylated and hypomannosylated)
preparation of anti-TNF.alpha. mAb (ZFN-B-1; lot 2168407) Serum
Concentrations after 5 mg/kg IV Dosing in CD-1 Mice (W14-0201).
[0039] FIG. 5B shows the pharmacokinetic (PK) profile of a
non-glycoengineered preparation of anti-TNF.alpha. mAb D2E7
(HUMIRA.RTM.; lot 2158962) Serum Concentrations after 5 mg/kg IV
dosing in CD-1 Mice (W14-0203).
[0040] FIG. 5C shows the pharmacokinetic (PK) parameters of the
glycoengineered anti-TNF.alpha. High Galactose mAb ZFN-B-1 (lot
2168407) after 5 mg/kg IV Dosing in CD-1 Mice.
[0041] FIG. 6 is a schematic depicting exemplary
naturally-occurring N-glycan glycoforms. Mammalian cells have a
more diverse range of modifications than any of the other
organisms. Certain motifs extending the N-glycan arms (lactosamine
chains, terminal GalNAc, terminal sialylation, fucosylation) are
also found in mammalian 0-glycans.
[0042] FIG. 7A depicts an exemplary 2-AB HPLC quantitative analysis
of glycoengineered binding compositions of the invention. Cell line
236 is a galactosyl transferase transfected CHO cell line producing
Adalimumab (D2E7). ZFN-B1 is a CHO cell line producing Adalimumab
and containing a knockdown of the Beta galactosidase gene. ABT-122
is an IL17xTNF DVD-Ig.
[0043] FIG. 7B depicts an exemplary 2-AB HPLC quantitative analysis
of the Galtr-11 (pink trace, second from top) and SA-D2E7 (blue
trace, second from bottom) glycoengineered binding compositions of
the invention as compared to a non-glycoengineered form of
adalimumab (Humira.RTM.; top trace). The bottom trace corresponds
to sialylated glycan standards.
[0044] FIG. 7C depicts an exemplary ion exchange chromatogram
(WCX-10 HPLC) of the Galtr-11 (blue trace, second from top) and
SA-D2E7 (bottom green trace) glycoengineered binding compositions
of the invention, as compared to a non-glycoengineered form of
adalimumab (Humira.RTM.; top red trace). The addition of sialic
acid imparts a charge to the glycan resulting in earlier elution
from the ion-exchange column.
DETAILED DESCRIPTION OF THE INVENTION
[0045] The present disclosure provides novel glycoengineered
binding protein compositions exhibiting a surprisingly reduced
anti-drug antibody (ADA) immune response as a result of their
optimized glycoprofile. These compositions generally comprise a
population of Fc domain-containing binding proteins that are
hypergalactosylated (e.g., enriched for binding proteins with
highly galactosylated glycoforms) and/or hypomannosylated (e.g.,
deficient in binding proteins with highly mannosylated glycoforms)
on the Fc glycosylation site of the binding proteins. Thus, the
compositions of the invention may be characterized as having glycan
structures with a G/M ratio (galactose content/mannose content) of
greater than 1:1, e.g., greater than 10:1, 50:1 or 99:1. Also
provided are methods of treating a disorder using these
compositions, and methods and host cells for making such
compositions.
[0046] The glycoengineered binding protein compositions disclosed
herein are particularly advantageous in that they exhibit a longer
serum half-life than non-glycoengineered Fc domain-containing
binding protein compositions and, therefore, require less frequent
dosing to be efficacious.
I. DEFINITIONS
[0047] Unless otherwise defined herein, scientific and technical
terms used in connection with the present invention shall have the
meanings that are commonly understood by those of ordinary skill in
the art. The meaning and scope of the terms should be clear,
however, in the event of any latent ambiguity, definitions provided
herein take precedent over any dictionary or extrinsic definition.
Further, unless otherwise required by context, singular terms shall
include pluralities and plural terms shall include the singular.
Generally, nomenclature used in connection with, and techniques of,
cell and tissue culture, molecular biology, immunology,
microbiology, genetics and protein and nucleic acid chemistry and
hybridization described herein are those well-known and commonly
used in the art.
[0048] In order that the present invention may be more readily
understood, certain terms are first defined.
[0049] As used herein the term "Fc domain-containing binding
protein" refers to a protein that specifically binds to an antigen,
wherein the protein comprises an Fc domain, or an Fc-receptor
binding fragment thereof, comprising an N-glycan. In certain
embodiments, the N-glycan is an N-linked biantennary glycans
present in the CH2 domain of an immunoglobulin constant (Fc) region
(e.g., at EU position 297). "N-glycans" are attached at an amide
nitrogen of an asparagine or an arginine residue in a protein via
an N-acetylglucosamine residue. These "N-linked glycosylation
sites" occur in the peptide primary structure containing, for
example, the amino acid sequence asparagine-X-serine/threonine,
where X is any amino acid residue except proline and aspartic acid.
Such N-Glycans are fully described in, for example, Drickamer K,
Taylor M E (2006). Introduction to Glycobiology, 2nd ed., which is
incorporated herein by reference in its entirety.
[0050] In one embodiment, "N glycan" refers to the Asn-297 N-linked
biantennary glycans present in the CH2 domain of an immunoglobulin
constant (Fc) region. These oligosaccharides may contain terminal
mannose, N-acetyl-glucosamine, Galactose or Sialic acid (see FIGS.
1C and 1D).
[0051] As used herein, the term "glycoengineering" refers to any
art-recognized method for altering the glycoform profile of a
binding protein composition. Such methods include expressing a
binding protein composition in a genetically engineered host cell
(e.g., a CHO cell) that has been genetically engineered to express
a heterologous glycosyltransferase or glycosidase. In other
embodiments, the glycoengineering methods comprise culturing a host
cell under conditions that bias for particular glycoform
profiles.
[0052] As used herein the term "hypergalactosylated population"
refers to a population of Fc domain-containing binding proteins in
which the galactose content of the N glycan is increased as
compared to a reference population of Fc domain-containing binding
proteins having the same amino acid sequence. A hypergalactosylated
population can be expressed as having an increased number of G1 and
G2 glycoforms as compared to the reference population of Fc
domain-containing binding proteins.
[0053] As used herein, the term "hypomannosylated population"
refers to a population of Fc domain-containing binding proteins in
which the mannose content of the N glycan is decreased as compared
to a reference population of Fc domain-containing binding proteins
having the same amino acid sequence. A hypomannosylated population
can be expressed as having a decreased number of oligomannose
glycoforms (e.g., M3-M9 glycoforms) as compared to the reference
population of Fc domain-containing binding proteins. In some
embodiments, the mannose content is determined by measuring the
content of one or more of oligomannose glycoforms selected from the
group consisting of Man3, Man4, Man5, Man6, Man7, Man 8 and Man 9.
In other embodiments, the oligomannose content is determined by
measuring at least Man 5, Man 6, and Man 7. In certain embodiments,
the oligomannose content is determined by measuring all M3-M9
glycoforms.
[0054] As used herein the terms "G0 glycoform," "G1 glycoform," and
"G2 glycoform" refer to N-Glycan glycoforms that have zero, one or
two terminal galactose residues respectively, as depicted in FIGS.
1C and 1D herein. These terms include G0, G1, and G2 glycoforms
that are fucosylated (shown as G0F, G1F and G2F respectively in
FIGS. 1C and 1D) or comprise a bisecting N-acetylglucosamine
residue.
[0055] In certain embodiments, the G1 and G2 glycoforms further
comprise sialic acid residues linked to one or both of the terminal
galactose residues to form G1S1, G2S1 and G2S2 glycoforms. As used
herein the terms "G1S1 glycoform," "G2S1 glycoform," and "G252
glycoform" refer to N-Glycan glycoforms that have a sialic acid
residue linked to the sole terminal galactose residue in a G1
glycoform, one of the terminal galactose residue in a G2 glycoform,
or both of the terminal galactose residue in a G2 glycoform,
respectively (see FIG. 1D herein). These terms include G1S1, G2S1
and G2S2 glycoforms that are fucosylated or comprise a bisecting
N-acetylglucosamine residue. In certain embodiments, the sialic
residues of G1S1, G2S1 and G2S2 glycoforms are linked by
alpha-2,6-sialic acid linkages to the terminal galactose residue of
each glycoform in order to enhance the anti-inflammatory activity
of the binding molecule (see e.g., Anthony et al., PNAS 105:
19571-19578, 2008).
[0056] As used herein the terms "G1F glycoform," "G2F glycoform,"
"G1S1F glycoform," "G2S1F glycoform," and "G2S2F glycoform" refer
to "G1 glycoform," and "G2 glycoform" "G1S1 glycoform," "G2S1
glycoform," and "G252 glycoform" that are fucosylated.
[0057] As used herein, the term"M3-M9 glycoforms" refers to the
mannosylated glycoforms depicted in FIG. 1C.
[0058] As used herein, the term "G/M ratio" or "Gtotal:M ratio"
refers to the ratio of the total percent amount of all galactose
containing glycoforms in a population of Fc-domain containing
binding proteins relative to the total percent amount of
oligomannose (e.g., M3-M9) glycoforms.
[0059] As used herein, the term"G1/2:M ratio" refers to the ratio
of the total percent amount of G1 and G2 glycoforms in a population
of Fc-domain containing binding proteins relative to the total
percent amount of M3-M8 glycoforms.
[0060] As used herein, the term "GS:M ratio" refers to the ratio of
the total percent amount G1S1, G2S1 and G2S2 glycoforms in a
population of Fc-domain containing binding proteins relative to the
total percent amount of M3-M9 glycoforms.
[0061] As used herein the term "reference binding composition" or
"reference antibody" refers to a binding composition having the
substantially the same amino acid sequence as (e.g., having about
90-100% identical amino acid sequence) of a glycoengineered
antibody composition of the invention disclosed herein, e.g., a
binding composition to which it is compared. In some embodiments,
the reference composition is a FDA approved therapeutic Fc-domain
containing binding protein (e.g., antibody) or a biosimilar
thereof. In other embodiments, the reference binding composition
comprises a non-hypergalactosylated population of Fc-domain
containing binding proteins.
[0062] As used herein the term "non-hypergalactosylated population"
refers a population of Fc domain-containing binding proteins in
which the amount of G1 and/or G2 glycoforms are not enriched
relative to the G0 glycoforms, as compared to a reference
population of Fc domain-containing binding proteins having the same
amino acid sequence.
[0063] As used herein, the term "more than" means more than or
equal to, and the term "less than" means less than or equal to.
[0064] As used herein, the term "infliximab" refers to the anti-TNF
antibody marketed as REMICADE.TM., having Chemical Abstracts
Service (CAS) designation 170277-31-3.
[0065] As used herein, the term "golimumab" refers to the anti-TNF
antibody marketed as SIMPONI.TM., having Chemical Abstracts Service
(CAS) designation 476181-74-5.
[0066] As used herein, the term "adalimumab" refers to the anti-TNF
antibody marketed as HUMIRA.TM., having Chemical Abstracts Service
(CAS) designation 331731-18-1.
[0067] As used herein, the term "infliximab" refers to the anti-TNF
immunoadhesin marketed as ENBREL.TM., having Chemical Abstracts
Service (CAS) designation 1094-08-2.
[0068] The term "human TNF-alpha", as used herein, is intended to
refer to a human cytokine that exists as a 17 kD secreted form and
a 26 kD membrane associated form, the biologically active form of
which is composed of a trimer of noncovalently bound 17 kD
molecules. The structure of human TNF-alpha is described further
in, for example, Pennica, D., et al. (1984) Nature 312:724-729;
Davis, J. M., et al. (1987) Biochemistry 26:1322-1326; and Jones,
E. Y., et al. (1989) Nature 338:225-228. The term human TNF-alpha
is intended to include recombinant human TNF-alpha, which can be
prepared by standard recombinant expression methods or purchased
commercially (R & D Systems, Catalog No. 210-TA, Minneapolis,
Minn.)
[0069] The term "antibody", as used herein, broadly refers to any
immunoglobulin (Ig) molecule comprised of four polypeptide chains,
two heavy (H) chains and two light (L) chains, or any functional
fragment, mutant, variant, or derivation thereof, which retains the
essential epitope binding features of an Ig molecule. Such mutant,
variant, or derivative antibody formats are known in the art.
Non-limiting embodiments of which are discussed below.
[0070] In a full-length antibody, each heavy chain is comprised of
a heavy chain variable region (abbreviated herein as HCVR or VH)
and a heavy chain constant region. The heavy chain constant region
is comprised of three domains, CH1, CH2 and CH3. Each light chain
is comprised of a light chain variable region (abbreviated herein
as LCVR or VL) and a light chain constant region. The light chain
constant region is comprised of one domain, CL. The VH and VL
regions can be further subdivided into regions of hypervariability,
termed complementarity determining regions (CDR), interspersed with
regions that are more conserved, termed framework regions (FR).
Each VH and VL is composed of three CDRs and four FRs, arranged
from amino-terminus to carboxy-terminus in the following order:
FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4 Immunoglobulin molecules can
be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class
(e.g., IgG 1, IgG2, IgG 3, IgG4, IgA1 and IgA2) or subclass.
[0071] The term "Fc domain" is used to define the C-terminal region
of an immunoglobulin heavy chain, which may be generated by papain
digestion of an intact antibody. The Fc domain may be a native
sequence Fc domain or a variant Fc domain. The Fc domain of an
immunoglobulin generally comprises two constant domains, a CH2
domain and a CH3 domain, and optionally comprises a CH4 domain.
Replacements of amino acid residues in the Fc portion to alter
antibody effector function are known in the art (Winter, et al.
U.S. Pat. Nos. 5,648,260; 5,624,821). The Fc domain of an antibody
mediates several important effector functions e.g. cytokine
induction, ADCC, phagocytosis, complement dependent cytotoxicity
(CDC) and half-life/clearance rate of antibody and antigen-antibody
complexes. In certain embodiments, at least one amino acid residue
is altered (e.g., deleted, inserted, or replaced) in the Fc domain
of an Fc domain-containing binding protein such that effector
functions of the binding protein are altered.
[0072] The term "antigen-binding portion" of an antibody (or simply
"antibody portion"), as used herein, refers to one or more
fragments of an antibody that retain the ability to specifically
bind to an antigen. It has been shown that the antigen-binding
function of an antibody can be performed by fragments of a
full-length antibody. Such antibody embodiments may also be
bispecific, dual specific, or multi-specific formats; specifically
binding to two or more different antigens. Examples of binding
fragments encompassed within the term "antigen-binding portion" of
an antibody include (i) an Fab fragment, a monovalent fragment
consisting of the VL, VH, CL and CH1 domains; (ii) an F(ab').sub.2
fragment, a bivalent fragment comprising two Fab fragments linked
by a disulfide bridge at the hinge region; (iii) an Fd fragment
consisting of the VH and CH1 domains; (iv) an Fv fragment
consisting of the VL and VH domains of a single arm of an antibody,
(v) a dAb fragment (Ward et al., (1989) Nature 341:544-546, Winter
et al., PCT publication WO 90/05144 A1 herein incorporated by
reference), which comprises a single variable domain; and (vi) an
isolated complementarity determining region (CDR). Furthermore,
although the two domains of the Fv fragment, VL and VH, are coded
for by separate genes, they can be joined, using recombinant
methods, by a synthetic linker that enables them to be made as a
single protein chain in which the VL and VH regions pair to form
monovalent molecules (known as single chain Fv (scFv); see e.g.,
Bird et al. (1988) Science 242:423-426; and Huston et al. (1988)
Proc. Natl. Acad. Sci. USA 85:5879-5883). Such single chain
antibodies are also intended to be encompassed within the term
"antigen-binding portion" of an antibody. Other forms of single
chain antibodies, such as diabodies are also encompassed. Diabodies
are bivalent, bispecific antibodies in which VH and VL domains are
expressed on a single polypeptide chain, but using a linker that is
too short to allow for pairing between the two domains on the same
chain, thereby forcing the domains to pair with complementary
domains of another chain and creating two antigen binding sites
(see e.g., Holliger, P., et al. (1993) Proc. Natl. Acad. Sci. USA
90:6444-6448; Poljak, R. J., et al. (1994) Structure 2:1121-1123).
Such antibody binding portions are known in the art (Kontermann and
Dubel eds., Antibody Engineering (2001) Springer-Verlag. New York.
790 pp. (ISBN 3-540-41354-5). In addition single chain antibodies
also include "linear antibodies" comprising a pair of tandem Fv
segments (VH-CH1-VH-CH1) which, together with complementary light
chain polypeptides, form a pair of antigen binding regions (Zapata
et al. Protein Eng. 8(10):1057-1062 (1995); and U.S. Pat. No.
5,641,870).
[0073] As used herein, the terms "VH domain" and "VL domain" refer
to single antibody variable heavy and light domains, respectively,
comprising FR (Framework Regions) 1, 2, 3 and 4 and CDR
(Complementary Determinant Regions) 1, 2 and 3 (see Kabat et al.
(1991) Sequences of Proteins of Immunological Interest. (NIH
Publication No. 91-3242, Bethesda).
[0074] As used herein, the term "CDR" or "complementarity
determining region" means the noncontiguous antigen combining sites
found within the variable region of both heavy and light chain
polypeptides. These particular regions have been described by Kabat
et al., J. Biol. Chem. 252, 6609-6616 (1977) and Kabat et al.,
Sequences of protein of immunological interest. (1991), and by
Chothia et al., J. Mol. Biol. 196:901-917 (1987) and by MacCallum
et al., J. Mol. Biol. 262:732-745 (1996) where the definitions
include overlapping or subsets of amino acid residues when compared
against each other. The amino acid residues which encompass the
CDRs as defined by each of the above cited references are set forth
for comparison. Preferably, the term "CDR" is a CDR as defined by
Kabat, based on sequence comparisons.
[0075] As used herein the term "framework (FR) amino acid residues"
refers to those amino acids in the framework region of an
immunoglobulin chain. The term "framework region" or "FR region" as
used herein, includes the amino acid residues that are part of the
variable region, but are not part of the CDRs (e.g., using the
Kabat definition of CDRs).
[0076] As used herein, the term "specifically binds to" refers to
the ability of a binding protein to bind to an antigen with an
K.sub.d of at least about 1.times.10.sup.-6 M, 1.times.10.sup.-7 M,
1.times.10.sup.-8 M, 1.times.10.sup.-9 M, 1.times.10.sup.-10 M,
1.times.10.sup.-11 M, 1.times.10.sup.-12 M, or more, and/or bind to
an antigen with an affinity that is at least two-fold greater than
its affinity for a nonspecific antigen. It shall be understood,
however, that the binding protein are capable of specifically
binding to two or more antigens which are related in sequence. For
example, the binding polypeptides of the invention can specifically
bind to both human and a non-human (e.g., mouse or non-human
primate) orthologs of an antigen.
[0077] The term "polypeptide" as used herein, refers to any
polymeric chain of amino acids. The terms "peptide" and "protein"
are used interchangeably with the term polypeptide and also refer
to a polymeric chain of amino acids. The term "polypeptide"
encompasses native or artificial proteins, protein fragments and
polypeptide analogs of a protein sequence. A polypeptide may be
monomeric or polymeric.
[0078] "Pharmacokinetics" refers to the process by which a drug is
absorbed, distributed, metabolized, and excreted by an organism.
The pharmacokinetic (PK) profile of Fc containing binding proteins
can be easily determined in rodents using methods known to one
skilled in the art (U.S. Published Patent Application No.
2009/0311253).
[0079] The term "recombinant host cell" (or simply "host cell"), as
used herein, is intended to refer to a cell into which exogenous
DNA has been introduced. It should be understood that such terms
are intended to refer not only to the particular subject cell, but,
to the progeny of such a cell. Because certain modifications may
occur in succeeding generations due to either mutation or
environmental influences, such progeny may not, in fact, be
identical to the parent cell, but are still included within the
scope of the term "host cell" as used herein. Preferably host cells
include prokaryotic and eukaryotic cells selected from any of the
Kingdoms of life. Preferred eukaryotic cells include protist,
fungal, plant and animal cells. Most preferably host cells include
but are not limited to the prokaryotic cell line E. Coli; mammalian
cell lines CHO, HEK 293 and COS; the insect cell line Sf9; and the
fungal cell Saccharomyces cerevisiae. In certain embodiments, the
host cell is an engineered CHO cell, e.g., a CHO cell transformed
with a heterologous galactosyltransferase and/or a heterologous
sialyltransferase.
II. GLYCOENGINEERED BINDING PROTEIN COMPOSITIONS
[0080] In certain aspects, the invention provides a composition
comprising a population of Fc-domain containing binding proteins
that are hypergalactosylated and/or hypomannosylated. In certain
embodiments, the population of Fc domain-containing binding
proteins employed in the compositions and methods disclosed herein
has an increased amount of G1 and/or G2 glycoforms relative to the
G0 glycoforms, as compared to a reference population comprising a
reference Fc domain-containing binding protein with the same amino
acid sequence. In certain embodiments, all of the Fc-domain binding
polypeptides in the population may be directed to the same antigen
or epitope. In other embodiments, all of the Fc-domain binding
polypeptides in the population are encoded by the same nucleic acid
sequence.
[0081] In certain embodiments, the population of Fc
domain-containing binding proteins comprises less than 70%, less
than 69%, less than 68%, less than 67%, less than 66%, less than
65%, less than 64%, less than 63%, less than 62%, less than 61%,
less than 60%, less than 59%, less than 58%, less than 57%, less
than 56%, less than 55%, less than 54%, less than 53%, less than
52%, less than 51%, less than 50%, less than 49%, less than 48%,
less than 47%, less than 46%, less than 45%, less than 44%, less
than 43%, less than 42%, less than 41%, less than 40%, less than
39%, less than 38%, less than 37%, less than 36%, less than 35%,
less than 34%, less than 33%, less than 32%, less than 31%, less
than 30%, less than 29%, less than 28%, less than 27%, less than
26%, less than 25%, less than 24%, less than 23%, less than 22%,
less than 21%, less than 20%, less than 19%, less than 18%, less
than 17%, less than 16%, less than 15%, less than 14%, less than
13%, less than 12%, less than 11%, less than 10%, less than 9%,
less than 8%, less than 7%, less than 6%, less than 5%, less than
4%, less than 3%, less than 2%, or less than 1% of the G0
glycoforms.
[0082] In one embodiment, the population of Fc domain-containing
binding proteins comprises 70%, 69%, 68%, 67%, 66%, 65%, 64%, 63%,
62%, 61%, 60%, 59%, 58%, 57%, 56%, 55%, 54%, 53%, 52%, 51%, 50%,
49%, 48%, 47%, 46%, 45%, 44%, 43%, 42%, 41%, 40%, 39%, 38%, 37%,
36%, 35%, 34%, 33%, 32%, 31%, 30%, 29%, 28%, 27%, 26%, 25%, 24%,
23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%,
10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% of the G0 glycoform.
[0083] In one embodiment, the population of Fc domain-containing
binding proteins comprises more than 20%, more than 21%, more than
22%, more than 23%, more than 24%, more than 25%, more than 26%,
more than 27%, more than 28%, more than 29%, more than 30%, more
than 31%, more than 32%, more than 33%, more than 34%, more than
35%, more than 36%, more than 37%, more than 38%, more than 39%,
more than 40%, more than 41%, more than 42%, more than 43%, more
than 44%, more than 45%, more than 46%, more than 47%, more than
48%, more than 49%, more than 50%, more than 51%, more than 52%,
more than 53%, more than 54%, more than 55%, more than 56%, more
than 57%, more than 58%, more than 59%, more than 60, 61%, more
than 62%, more than 63%, more than 64%, more than 65%, more than
66%, more than 67%, more than 68%, more than 69%, more than 70%,
more than 71%, more than 72%, more than 73%, more than 74%, more
than 75%, more than 76%, more than 77%, more than 78%, more than
79%, more than 80%, more than 81%, more than 82%, more than 83%,
more than 84%, more than 85%, more than 86%, more than 87%, more
than 88%, more than 89%, more than 90%, more than 91%, more than
92%, more than 93%, more than 94%, more than 95%, more than 96%,
more than 97%, more than 98%, or more than 99% of the G1
glycoforms. In certain embodiments, the G1 glycoforms in the
hypergalactosylated population are G1F glycoforms.
[0084] In one embodiment, the population of Fc domain-containing
binding proteins comprises 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%,
28%, 29%, 30, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40, 41%,
42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50, 51%, 52%, 53%, 54%,
55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%,
68%, 69%, 70, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,
81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% of the G1 glycoform. In certain
embodiments, the G1 glycoforms in the hypergalactosylated
population are G1F glycoforms.
[0085] In one embodiment, the population of Fc domain-containing
binding proteins comprises more than 20%, more than 21%, more than
22%, more than 23%, more than 24%, more than 25%, more than 26%,
more than 27%, more than 28%, more than 29%, more than 30%, more
than 31%, more than 32%, more than 33%, more than 34%, more than
35%, more than 36%, more than 37%, more than 38%, more than 39%,
more than 40%, more than 41%, more than 42%, more than 43%, more
than 44%, more than 45%, more than 46%, more than 47%, more than
48%, more than 49%, more than 50%, more than 51%, more than 52%,
more than 53%, more than 54%, more than 55%, more than 56%, more
than 57%, more than 58%, more than 59%, more than 60%, more than
61%, more than 62%, more than 63%, more than 64%, more than 65%,
more than 66%, more than 67%, more than 68%, more than 69%, more
than 70%, more than 71%, more than 72%, more than 73%, more than
74%, more than 75%, more than 76%, more than 77%, more than 78%,
more than 79%, more than 80%, more than 81%, more than 82%, more
than 83%, more than 84%, more than 85%, more than 86%, more than
87%, more than 88%, more than 89%, more than 90%, more than 91%,
more than 92%, more than 93%, more than 94%, more than 95%, more
than 96%, more than 97%, more than 98%, or more than 99% of the G2
glycoforms. In certain embodiments, the G2 glycoforms in the
hypergalactosylated population are G2F glycoforms.
[0086] In certain embodiments, the population of Fc
domain-containing binding proteins comprises 20%, 21%, 22%, 23%,
24%, 25%, 26%, 27%, 28%, 29%, 30, 31%, 32%, 33%, 34%, 35%, 36%,
37%, 38%, 39%, 40, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%,
50%, 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%,
63%, 64%, 65%, 66%, 67%, 68%, 69%, 70, 71%, 72%, 73%, 74%, 75%,
76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% of the G2
glycoform. In certain embodiments, the G2 glycoforms in the
hypergalactosylated population are G2F glycoforms.
[0087] In certain embodiments, the total percent amount of G1 and
G2 glycoforms in the population of Fc domain-containing binding
proteins is between 20% and 99%, between 21% and 99%, between 22%
and 99%, between 23% and 99%, between 24% and 99%, between 25% and
99%, between 26% and 99%, between 27% and 99%, between 28% and 99%,
between 29% and 99%, between 30% and 99%, between 31% and 99%,
between 32% and 99%, between 33% and 99%, between 34% and 99%,
between 35% and 99%, between 36% and 99%, between 37% and 99%,
between 38% and 99%, between 39% and 99%, between 40, 41% and 99%,
between 42% and 99%, between 43% and 99%, between 44% and 99%,
between 45% and 99%, between 46% and 99%, between 47% and 99%,
between 48% and 99%, between 49% and 99%, between 50% and 99%,
between 51% and 99%, between 52% and 99%, between 53% and 99%,
between 54% and 99%, between 55% and 99%, between 56% and 99%,
between 57% and 99%, between 58% and 99%, between 59% and 99%,
between 60% and 99%, between 61% and 99%, between 62% and 99%,
between 63% and 99%, between 64% and 99%, between 65% and 99%,
between 66% and 99%, between 67% and 99%, between 68% and 99%,
between 69% and 99%, between 70% and 99%, between 71% and 99%,
between 72% and 99%, between 73% and 99%, between 74% and 99%,
between 75% and 99%, between 76% and 99%, between 77% and 99%,
between 78% and 99%, between 79% and 99%, between 80% and 99%,
between 81% and 99%, between 82% and 99%, between 83% and 99%,
between 84% and 99%, between 85% and 99%, between 86% and 99%,
between 87% and 99%, between 88% and 99%, between 89% and 99%,
between 90% and 99%, between 91% and 99%, between 92% and 99%,
between 93% and 99%, between 94% and 99%, between 95% and 99%,
between 96% and 99%, between 97% and 99%, or between 98% and 99%.
In certain embodiments, the G1 and G2 glycoforms in the population
are G1F and G2F glycoforms.
[0088] In certain embodiments, the total percent amount of G1 and
G2 glycoforms in the population of Fc domain-containing binding
proteins is between 20% and 99%, between 20% and 98%, between 20%
and 97%, between 20% and 96%, between 20% and 95%, between 20% and
94%, between 20% and 93%, between 20% and 92%, between 20% and 91%,
between 20% and 90%, between 20% and 89%, between 20% and 88%,
between 20% and 87%, between 20% and 86%, between 20% and 85%,
between 20% and 84%, between 20% and 83%, between 20% and 82%,
between 20% and 81%, between 20% and 80%, between 20% and 79%,
between 20% and 78%, between 20% and 77%, between 20% and 76%,
between 20% and 75%, between 20% and 74%, between 20% and 73%,
between 20% and 72%, between 20% and 71%, between 20% and 70%,
between 20% and 69%, between 20% and 68%, between 20% and 67%,
between 20% and 66%, between 20% and 65%, between 20% and 64%,
between 20% and 63%, between 20% and 62%, between 20% and 61%,
between 20% and 60%, between 20% and 59%, between 20% and 58%,
between 20% and 57%, between 20% and 56%, between 20% and 55%,
between 20% and 54%, between 20% and 53%, between 20% and 52%,
between 20% and 51%, between 20% and 50%, between 20% and 49%,
between 20% and 48%, between 20% and 47%, between 20% and 46%,
between 20% and 45%, between 20% and 44%, between 20% and 43%,
between 20% and 42%, between 20% and 41%, between 20% and 40%,
between 20% and 39%, between 20% and 38%, between 20% and 37%,
between 20% and 36%, between 20% and 35%, between 20% and 34%,
between 20% and 33%, between 20% and 32%, between 20% and 31%,
between 20% and 30%, between 20% and 29%, between 20% and 28%,
between 20% and 27%, between 20% and 26%, between 20% and 25%,
between 20% and 24%, between 20% and 23%, between 20% and 22%, or
between 20% and 21%. In certain embodiments, the G1 and G2
glycoforms in the population are G1F and G2F glycoforms.
[0089] In certain embodiments, the population of Fc
domain-containing binding proteins employed in the compositions and
methods disclosed herein has an increased amount of G1S1, G2S1 and
G2S2 glycoforms relative to the G0 glycoforms, as compared to a
reference population comprising a reference Fc domain-containing
binding protein with the same amino acid sequence.
[0090] In one embodiment, the population of Fc domain-containing
binding proteins comprises more than 20%, more than 21%, more than
22%, more than 23%, more than 24%, more than 25%, more than 26%,
more than 27%, more than 28%, more than 29%, more than 30%, more
than 31%, more than 32%, more than 33%, more than 34%, more than
35%, more than 36%, more than 37%, more than 38%, more than 39%,
more than 40%, more than 41%, more than 42%, more than 43%, more
than 44%, more than 45%, more than 46%, more than 47%, more than
48%, more than 49%, more than 50%, more than 51%, more than 52%,
more than 53%, more than 54%, more than 55%, more than 56%, more
than 57%, more than 58%, more than 59%, more than 60, 61%, more
than 62%, more than 63%, more than 64%, more than 65%, more than
66%, more than 67%, more than 68%, more than 69%, more than 70%,
more than 71%, more than 72%, more than 73%, more than 74%, more
than 75%, more than 76%, more than 77%, more than 78%, more than
79%, more than 80%, more than 81%, more than 82%, more than 83%,
more than 84%, more than 85%, more than 86%, more than 87%, more
than 88%, more than 89%, more than 90%, more than 91%, more than
92%, more than 93%, more than 94%, more than 95%, more than 96%,
more than 97%, more than 98%, or more than 99% of the G1S1
glycoforms. In certain embodiments, the G1S1 glycoforms in the
population are G1S1F glycoforms.
[0091] In one embodiment, the population of Fc domain-containing
binding proteins comprises 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%,
28%, 29%, 30, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40, 41%,
42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50, 51%, 52%, 53%, 54%,
55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%,
68%, 69%, 70, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,
81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% of the G1S1 glycoform. In certain
embodiments, the G1S1 glycoforms in the population are G1S1F
glycoforms.
[0092] In one embodiment, the population of Fc domain-containing
binding proteins comprises more than 20%, more than 21%, more than
22%, more than 23%, more than 24%, more than 25%, more than 26%,
more than 27%, more than 28%, more than 29%, more than 30%, more
than 31%, more than 32%, more than 33%, more than 34%, more than
35%, more than 36%, more than 37%, more than 38%, more than 39%,
more than 40%, more than 41%, more than 42%, more than 43%, more
than 44%, more than 45%, more than 46%, more than 47%, more than
48%, more than 49%, more than 50%, more than 51%, more than 52%,
more than 53%, more than 54%, more than 55%, more than 56%, more
than 57%, more than 58%, more than 59%, more than 60, 61%, more
than 62%, more than 63%, more than 64%, more than 65%, more than
66%, more than 67%, more than 68%, more than 69%, more than 70%,
more than 71%, more than 72%, more than 73%, more than 74%, more
than 75%, more than 76%, more than 77%, more than 78%, more than
79%, more than 80%, more than 81%, more than 82%, more than 83%,
more than 84%, more than 85%, more than 86%, more than 87%, more
than 88%, more than 89%, more than 90%, more than 91%, more than
92%, more than 93%, more than 94%, more than 95%, more than 96%,
more than 97%, more than 98%, or more than 99% of the G2S1
glycoforms. In certain embodiments, the G2S1 glycoforms in the
hypergalactosylated population are G2S1F glycoforms.
[0093] In one embodiment, the population of Fc domain-containing
binding proteins comprises 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%,
28%, 29%, 30, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40, 41%,
42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50, 51%, 52%, 53%, 54%,
55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%,
68%, 69%, 70, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,
81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% of the G2S1 glycoform. In certain
embodiments, the G2S1 glycoforms in the population are G2S1F
glycoforms.
[0094] In one embodiment, the population of Fc domain-containing
binding proteins comprises more than 20%, more than 21%, more than
22%, more than 23%, more than 24%, more than 25%, more than 26%,
more than 27%, more than 28%, more than 29%, more than 30%, more
than 31%, more than 32%, more than 33%, more than 34%, more than
35%, more than 36%, more than 37%, more than 38%, more than 39%,
more than 40%, more than 41%, more than 42%, more than 43%, more
than 44%, more than 45%, more than 46%, more than 47%, more than
48%, more than 49%, more than 50%, more than 51%, more than 52%,
more than 53%, more than 54%, more than 55%, more than 56%, more
than 57%, more than 58%, more than 59%, more than 60, 61%, more
than 62%, more than 63%, more than 64%, more than 65%, more than
66%, more than 67%, more than 68%, more than 69%, more than 70%,
more than 71%, more than 72%, more than 73%, more than 74%, more
than 75%, more than 76%, more than 77%, more than 78%, more than
79%, more than 80%, more than 81%, more than 82%, more than 83%,
more than 84%, more than 85%, more than 86%, more than 87%, more
than 88%, more than 89%, more than 90%, more than 91%, more than
92%, more than 93%, more than 94%, more than 95%, more than 96%,
more than 97%, more than 98%, or more than 99% of the G2S2
glycoforms. In certain embodiments, the G2S2 glycoforms in the
population are G2S2F glycoforms.
[0095] In one embodiment, the population of Fc domain-containing
binding proteins comprises 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%,
28%, 29%, 30, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40, 41%,
42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50, 51%, 52%, 53%, 54%,
55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%, 66%, 67%,
68%, 69%, 70, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,
81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%,
94%, 95%, 96%, 97%, 98%, or 99% of the G2S2 glycoform. In certain
embodiments, the G2S2 glycoforms in the population are G2S2F
glycoforms.
[0096] In certain embodiments, the total percent amount of G1S1,
G2S1 and G2S2 glycoforms in the population of Fc domain-containing
binding proteins is between 20% and 99%, between 21% and 99%,
between 22% and 99%, between 23% and 99%, between 24% and 99%,
between 25% and 99%, between 26% and 99%, between 27% and 99%,
between 28% and 99%, between 29% and 99%, between 30% and 99%,
between 31% and 99%, between 32% and 99%, between 33% and 99%,
between 34% and 99%, between 35% and 99%, between 36% and 99%,
between 37% and 99%, between 38% and 99%, between 39% and 99%,
between 40, 41% and 99%, between 42% and 99%, between 43% and 99%,
between 44% and 99%, between 45% and 99%, between 46% and 99%,
between 47% and 99%, between 48% and 99%, between 49% and 99%,
between 50% and 99%, between 51% and 99%, between 52% and 99%,
between 53% and 99%, between 54% and 99%, between 55% and 99%,
between 56% and 99%, between 57% and 99%, between 58% and 99%,
between 59% and 99%, between 60% and 99%, between 61% and 99%,
between 62% and 99%, between 63% and 99%, between 64% and 99%,
between 65% and 99%, between 66% and 99%, between 67% and 99%,
between 68% and 99%, between 69% and 99%, between 70% and 99%,
between 71% and 99%, between 72% and 99%, between 73% and 99%,
between 74% and 99%, between 75% and 99%, between 76% and 99%,
between 77% and 99%, between 78% and 99%, between 79% and 99%,
between 80% and 99%, between 81% and 99%, between 82% and 99%,
between 83% and 99%, between 84% and 99%, between 85% and 99%,
between 86% and 99%, between 87% and 99%, between 88% and 99%,
between 89% and 99%, between 90% and 99%, between 91% and 99%,
between 92% and 99%, between 93% and 99%, between 94% and 99%,
between 95% and 99%, between 96% and 99%, between 97% and 99%, or
between 98% and 99%. In certain embodiments, the G1S1, G2S1 and
G2S2 glycoforms in the population are G1S1F, G2S1F and G2S2F
glycoforms.
[0097] In certain embodiments, the total percent amount of G1S1,
G2S1 and G2S2 glycoforms in the population of Fc domain-containing
binding proteins is between 20% and 99%, between 20% and 98%,
between 20% and 97%, between 20% and 96%, between 20% and 95%,
between 20% and 94%, between 20% and 93%, between 20% and 92%,
between 20% and 91%, between 20% and 90%, between 20% and 89%,
between 20% and 88%, between 20% and 87%, between 20% and 86%,
between 20% and 85%, between 20% and 84%, between 20% and 83%,
between 20% and 82%, between 20% and 81%, between 20% and 80%,
between 20% and 79%, between 20% and 78%, between 20% and 77%,
between 20% and 76%, between 20% and 75%, between 20% and 74%,
between 20% and 73%, between 20% and 72%, between 20% and 71%,
between 20% and 70%, between 20% and 69%, between 20% and 68%,
between 20% and 67%, between 20% and 66%, between 20% and 65%,
between 20% and 64%, between 20% and 63%, between 20% and 62%,
between 20% and 61%, between 20% and 60%, between 20% and 59%,
between 20% and 58%, between 20% and 57%, between 20% and 56%,
between 20% and 55%, between 20% and 54%, between 20% and 53%,
between 20% and 52%, between 20% and 51%, between 20% and 50%,
between 20% and 49%, between 20% and 48%, between 20% and 47%,
between 20% and 46%, between 20% and 45%, between 20% and 44%,
between 20% and 43%, between 20% and 42%, between 20% and 41%,
between 20% and 40%, between 20% and 39%, between 20% and 38%,
between 20% and 37%, between 20% and 36%, between 20% and 35%,
between 20% and 34%, between 20% and 33%, between 20% and 32%,
between 20% and 31%, between 20% and 30%, between 20% and 29%,
between 20% and 28%, between 20% and 27%, between 20% and 26%,
between 20% and 25%, between 20% and 24%, between 20% and 23%,
between 20% and 22%, or between 20% and 21% of the G1S1, G1S2 and
G2S2 glycoforms. In certain embodiments, the G1S1, G2S1 and G2S2
glycoforms in the population are G1S1F, G2S1F and G2S2F
glycoforms.
[0098] In certain embodiments, the total percent amount of G1, G2,
G1S1, G2S1 and G2S2 glycoforms in the population of Fc
domain-containing binding proteins is between 20% and 99%, between
21% and 99%, between 22% and 99%, between 23% and 99%, between 24%
and 99%, between 25% and 99%, between 26% and 99%, between 27% and
99%, between 28% and 99%, between 29% and 99%, between 30% and 99%,
between 31% and 99%, between 32% and 99%, between 33% and 99%,
between 34% and 99%, between 35% and 99%, between 36% and 99%,
between 37% and 99%, between 38% and 99%, between 39% and 99%,
between 40, 41% and 99%, between 42% and 99%, between 43% and 99%,
between 44% and 99%, between 45% and 99%, between 46% and 99%,
between 47% and 99%, between 48% and 99%, between 49% and 99%,
between 50% and 99%, between 51% and 99%, between 52% and 99%,
between 53% and 99%, between 54% and 99%, between 55% and 99%,
between 56% and 99%, between 57% and 99%, between 58% and 99%,
between 59% and 99%, between 60% and 99%, between 61% and 99%,
between 62% and 99%, between 63% and 99%, between 64% and 99%,
between 65% and 99%, between 66% and 99%, between 67% and 99%,
between 68% and 99%, between 69% and 99%, between 70% and 99%,
between 71% and 99%, between 72% and 99%, between 73% and 99%,
between 74% and 99%, between 75% and 99%, between 76% and 99%,
between 77% and 99%, between 78% and 99%, between 79% and 99%,
between 80% and 99%, between 81% and 99%, between 82% and 99%,
between 83% and 99%, between 84% and 99%, between 85% and 99%,
between 86% and 99%, between 87% and 99%, between 88% and 99%,
between 89% and 99%, between 90% and 99%, between 91% and 99%,
between 92% and 99%, between 93% and 99%, between 94% and 99%,
between 95% and 99%, between 96% and 99%, between 97% and 99%, or
between 98% and 99%. In certain embodiments, the G1, G2, G1S1, G2S1
and G2S2 glycoforms in the population are G1F, G2F, G1S1F, G2S1F
and G2S2F glycoforms.
[0099] In certain embodiments, the total percent amount of G1, G2,
G1S1, G2S1 and G2S2 glycoforms in the population of Fc
domain-containing binding proteins is between 20% and 99%, between
20% and 98%, between 20% and 97%, between 20% and 96%, between 20%
and 95%, between 20% and 94%, between 20% and 93%, between 20% and
92%, between 20% and 91%, between 20% and 90%, between 20% and 89%,
between 20% and 88%, between 20% and 87%, between 20% and 86%,
between 20% and 85%, between 20% and 84%, between 20% and 83%,
between 20% and 82%, between 20% and 81%, between 20% and 80%,
between 20% and 79%, between 20% and 78%, between 20% and 77%,
between 20% and 76%, between 20% and 75%, between 20% and 74%,
between 20% and 73%, between 20% and 72%, between 20% and 71%,
between 20% and 70%, between 20% and 69%, between 20% and 68%,
between 20% and 67%, between 20% and 66%, between 20% and 65%,
between 20% and 64%, between 20% and 63%, between 20% and 62%,
between 20% and 61%, between 20% and 60%, between 20% and 59%,
between 20% and 58%, between 20% and 57%, between 20% and 56%,
between 20% and 55%, between 20% and 54%, between 20% and 53%,
between 20% and 52%, between 20% and 51%, between 20% and 50%,
between 20% and 49%, between 20% and 48%, between 20% and 47%,
between 20% and 46%, between 20% and 45%, between 20% and 44%,
between 20% and 43%, between 20% and 42%, between 20% and 41%,
between 20% and 40%, between 20% and 39%, between 20% and 38%,
between 20% and 37%, between 20% and 36%, between 20% and 35%,
between 20% and 34%, between 20% and 33%, between 20% and 32%,
between 20% and 31%, between 20% and 30%, between 20% and 29%,
between 20% and 28%, between 20% and 27%, between 20% and 26%,
between 20% and 25%, between 20% and 24%, between 20% and 23%,
between 20% and 22%, or between 20% and 21% of the G1S1, G1S2 and
G2S2 glycoforms. In certain embodiments, the G1, G2, G1S1, G2S1 and
G2S2 glycoforms in the hypergalactosylated population are G1F, G2F,
G1S1F, G2S1F and G2S2F glycoforms.
[0100] In one embodiment, the sialylated glycoforms (e.g., G1S1,
G2S1 and G2S2 glycoforms) in the population of Fc domain-containing
binding proteins have increased levels of terminal alpha 2,6-sialic
acid linkages on their Fc glycans. In certain embodiments, more
than 20%, more than 21%, more than 22%, more than 23%, more than
24%, more than 25%, more than 26%, more than 27%, more than 28%,
more than 29%, more than 30%, more than 31%, more than 32%, more
than 33%, more than 34%, more than 35%, more than 36%, more than
37%, more than 38%, more than 39%, more than 40%, more than 41%,
more than 42%, more than 43%, more than 44%, more than 45%, more
than 46%, more than 47%, more than 48%, more than 49%, more than
50%, more than 51%, more than 52%, more than 53%, more than 54%,
more than 55%, more than 56%, more than 57%, more than 58%, more
than 59%, more than 60, 61%, more than 62%, more than 63%, more
than 64%, more than 65%, more than 66%, more than 67%, more than
68%, more than 69%, more than 70%, more than 71%, more than 72%,
more than 73%, more than 74%, more than 75%, more than 76%, more
than 77%, more than 78%, more than 79%, more than 80%, more than
81%, more than 82%, more than 83%, more than 84%, more than 85%,
more than 86%, more than 87%, more than 88%, more than 89%, more
than 90%, more than 91%, more than 92%, more than 93%, more than
94%, more than 95%, more than 96%, more than 97%, more than 98%, or
more than 99% of the sialylated glycoforms contain alpha
2,6-linkages.
[0101] In certain embodiments, the G1, G2, G1S1, G2S1 and G2S2
glycoforms in the hypergalactosylated population are G1F, G2F,
G1S1F, G2S1F and G2S2F glycoforms.
[0102] In certain embodiments, the compositions of the invention
are obtained from host cells (e.g., CHO cells or other mammalian
host cells) capable of expressing a population of hyperglycosylated
and/or hypomannosylated Fc domain-containing binding proteins when
grown in culture. In certain embodiments, the composition is
obtained from host cells that are genetically engineered for the
production of a hyperglycosylated and/or hypomannosylated binding
proteins. For example, the host cell (e.g., a CHO cell) may be
genetically engineered to overexpress a heterologous
galactosyltransferase such as human .beta. 1,
4-galactosyltransferase (E.C. 2.4.1.38; Weikert et al., Nature
Biotechnology 17, 1116-1121 (1999)) or a mammalian homolog thereof
(e.g., mouse galactosyltransferase .beta. 1, 4 (Genbank accession
number: D00314). Additionally or alternatively, the host cell is a
CHO cell having a knock out at least one of the alleles of the beta
galactosidase gene (Cricetulus griseus G1b1 (Gene ID: 100767446);
mRNA sequence: NCBI Reference Sequence: XM.sub.--007630176.1;
genomic sequence NW.sub.--003613697.1 from 2278553 to 2336708). In
other embodiments, the binding protein composition is obtained from
a host cell that is cultured under conditions such that
hypergalactosylated and/or hypomannosylated binding proteins are
produced. In some embodiments, the binding protein is expressed in
a host cell with one or more sialyltransferase enzymes, e.g., an
a2,6 sialyltransferase (e.g., ST6Gal-I).
[0103] Exemplary binding protein compositions of the invention may
be obtained from cultured mammalian (e.g., CHO) host cells have a
"high Gal/low Man" glycoform profile which provides for
unexpectedly improved properties (e.g., reduced ADA activity and/or
prolonged half-life). Notably, this glycoform profile differs from
the highly mannosylated glycoprofile of binding proteins produced
in the milk of transgenic animals (see, e.g., US 2014/0296490).
Accordingly, in certain embodiments, the glycoengineered binding
protein compositions disclosed herein are not obtained from the
milk of transgenic animals e.g., transgenic goats. Antibody
compositions with high oligomannose content are thought to promote
the ADA response and/or reduce serum half-life. By contrast,
binding protein compositions of the invention exhibit a low degree
of terminally mannosylated glycoforms (e.g., M3-M9 glycoforms). For
example, in certain embodiments, binding protein compositions of
the invention comprise a population of Fc domain-containing binding
proteins comprising less than 10%, less than 9%, less than 8%, less
than 7%, less than 6%, less than 5%, less than 4%, less than 3%,
less than 2% or less than 1% of oligomannose (e.g., M3-M9)
glycoforms.
[0104] Thus, the compositions of the invention may be characterized
as having glycan structures with a G/M ratio (galactose
content/mannose content) of greater than 1:1, e.g., greater than
10:1, 50:1 or 99:1. In certain embodiments, the population of Fc
domain-containing binding proteins has a G1/2:M ratio of at least
10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1,
21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1, 30:1, 31:1,
32:1, 33:1, 34:1, 35:1, 36:1, 37:1, 38:1, 39:1, 40:1, 41:1, 42:1,
43:1, 44:1, 45:1, 46:1, 47:1, 48:1, 49:1, 50:1, 51:1, 52:1, 53:1,
54:1, 55:1, 56:1, 57:1, 58:1, 59:1, 60:1, 61:1, 62:1, 63:1, 64:1,
65:1, 66:1, 67:1, 68:1, 69:1, 70:1, 71:1, 72:1, 73:1, 74:1, 75:1,
76:1, 77:1, 78:1, 79:1, 80:1, 81:1, 82:1, 83:1, 84:1, 85:1, 80:1,
87:1, 88:1, 89:1, 90:1, 91:1, 92:1, 93:1, 94:1, 95:1, 96:1, 97:1,
98:1, 99:1, 100:1, 200:1, 300:1, 400:1, 500:1, 600:1, 700:1, 800:1,
900:1, or 1000:1 (e.g., about 10:1, 11:1, 12:1, 13:1, 14:1, 15:1,
16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1,
27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1, 37:1,
38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1, 48:1,
49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1, 59:1,
60:1, 61:1, 62:1, 63:1, 64:1, 65:1, 66:1, 67:1, 68:1, 69:1, 70:1,
71:1, 72:1, 73:1, 74:1, 75:1, 76:1, 77:1, 78:1, 79:1, 80:1, 81:1,
82:1, 83:1, 84:1, 85:1, 80:1, 87:1, 88:1, 89:1, 90:1, 91:1, 92:1,
93:1, 94:1, 95:1, 96:1, 97:1, 98:1, 99:1, 100:1, 200:1, 300:1,
400:1, 500:1, 600:1, 700:1, 800:1, 900:1, or 1000:1).
[0105] In certain embodiments, the population of Fc
domain-containing binding proteins has a GS:M ratio of at least
10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1,
21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1, 30:1, 31:1,
32:1, 33:1, 34:1, 35:1, 36:1, 37:1, 38:1, 39:1, 40:1, 41:1, 42:1,
43:1, 44:1, 45:1, 46:1, 47:1, 48:1, 49:1, 50:1, 51:1, 52:1, 53:1,
54:1, 55:1, 56:1, 57:1, 58:1, 59:1, 60:1, 61:1, 62:1, 63:1, 64:1,
65:1, 66:1, 67:1, 68:1, 69:1, 70:1, 71:1, 72:1, 73:1, 74:1, 75:1,
76:1, 77:1, 78:1, 79:1, 80:1, 81:1, 82:1, 83:1, 84:1, 85:1, 80:1,
87:1, 88:1, 89:1, 90:1, 91:1, 92:1, 93:1, 94:1, 95:1, 96:1, 97:1,
98:1, 99:1, 100:1, 200:1, 300:1, 400:1, 500:1, 600:1, 700:1, 800:1,
900:1, or 1000:1 (e.g., about 10:1, 11:1, 12:1, 13:1, 14:1, 15:1,
16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1,
27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1, 37:1,
38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1, 48:1,
49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1, 59:1,
60:1, 61:1, 62:1, 63:1, 64:1, 65:1, 66:1, 67:1, 68:1, 69:1, 70:1,
71:1, 72:1, 73:1, 74:1, 75:1, 76:1, 77:1, 78:1, 79:1, 80:1, 81:1,
82:1, 83:1, 84:1, 85:1, 80:1, 87:1, 88:1, 89:1, 90:1, 91:1, 92:1,
93:1, 94:1, 95:1, 96:1, 97:1, 98:1, 99:1, 100:1, 200:1, 300:1,
400:1, 500:1, 600:1, 700:1, 800:1, 900:1, or 1000:1).
[0106] In certain embodiments, the population of Fc
domain-containing binding proteins has a Gtotal:M ratio of at least
10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1,
21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1, 30:1, 31:1,
32:1, 33:1, 34:1, 35:1, 36:1, 37:1, 38:1, 39:1, 40:1, 41:1, 42:1,
43:1, 44:1, 45:1, 46:1, 47:1, 48:1, 49:1, 50:1, 51:1, 52:1, 53:1,
54:1, 55:1, 56:1, 57:1, 58:1, 59:1, 60:1, 61:1, 62:1, 63:1, 64:1,
65:1, 66:1, 67:1, 68:1, 69:1, 70:1, 71:1, 72:1, 73:1, 74:1, 75:1,
76:1, 77:1, 78:1, 79:1, 80:1, 81:1, 82:1, 83:1, 84:1, 85:1, 80:1,
87:1, 88:1, 89:1, 90:1, 91:1, 92:1, 93:1, 94:1, 95:1, 96:1, 97:1,
98:1, 99:1, 100:1, 200:1, 300:1, 400:1, 500:1, 600:1, 700:1, 800:1,
900:1, or 1000:1 (e.g., about 10:1, 11:1, 12:1, 13:1, 14:1, 15:1,
16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1,
27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1, 37:1,
38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1, 48:1,
49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1, 59:1,
60:1, 61:1, 62:1, 63:1, 64:1, 65:1, 66:1, 67:1, 68:1, 69:1, 70:1,
71:1, 72:1, 73:1, 74:1, 75:1, 76:1, 77:1, 78:1, 79:1, 80:1, 81:1,
82:1, 83:1, 84:1, 85:1, 80:1, 87:1, 88:1, 89:1, 90:1, 91:1, 92:1,
93:1, 94:1, 95:1, 96:1, 97:1, 98:1, 99:1, 100:1, 200:1, 300:1,
400:1, 500:1, 600:1, 700:1, 800:1, 900:1, or 1000:1).
[0107] Glycoengineered binding compositions of the invention may
exhibit improvement in at least one biological activity as compared
to a reference binding composition. Biological activity of the
preparation can be analyzed by any known method. In some
embodiments, a binding activity of the binding composition is
improved (e.g., binding to a ligand or receptor). In some
embodiments, a therapeutic activity of the glycoengineered binding
composition is improved (e.g., an activity in decreasing severity
or symptom of a disease or condition, or in delaying appearance of
a symptom of a disease or condition). In some embodiments, a
pharmacologic activity of the glycoengineered binding composition
is improved (e.g., bioavailability, pharmacokinetics,
pharmacodynamics). Methods of analyzing bioavailability,
pharmacokinetics, and pharmacodynamics of glycoprotein therapeutics
are well known in the art.
[0108] Glycoengineered binding protein compositions of the
invention may exhibit reduced ADA activity and/or enhanced
half-life without also exhibiting enhanced complement dependent
cytotoxicity (CDC) activity and/or enhanced antibody-dependent
cellular cytotoxicity (ADCC) activity. In certain embodiments, the
glycoengineered binding protein composition of the invention
exhibit reduced ADCC and/or CDC activity relative to a reference
binding protein composition comprising the same polypeptide
sequence but is not glycoengineered (e.g., hypergalactosylated
and/or hypomannosylated) according to the methods of the invention.
In one embodiment, the reference binding protein composition is not
hypergalactosylated and hypomannosylated. In another embodiment,
the reference composition is transgenically produced in mammary
gland epithelial cells.
[0109] In certain embodiments, the ADCC and/or CDC activity of the
glycoengineered composition of the invention is at least 1.1 time
lower, at least 1.2 times lower, at least 1.3 times lower, at least
1.4 times lower, at least 1.5 times lower, at least 1.6 times
lower, at least 1.7 times lower, at least 1.8 times lower, at least
10 times lower, at least 20 times lower, at least 50 times lower or
up to 100 times lower when compared to the reference composition.
Methods for determining the level of CDC are known in the art and
are often based on determining the amount of cell lysis. Methods
for determining the level of ADCC are also known in the art and may
be based on evaluating binding to CD16. Commercial kits for
determining CDC and/or ADCC activity can be purchased for instance
from Genscript (Piscataway, N.J.) and Promega (Madison, Wis.).
[0110] In certain embodiments, the glycoengineered binding protein
compositions of the invention do not induce B-cell depletion. In
other embodiments, the glycoengineered binding protein compositions
of the invention are not produced in mammary gland epithelial
cells.
[0111] In other embodiments, the hypergalactosylated compositions
of the invention exhibit reduced ADA activity and/or enhanced
half-life relative to the reference antibody composition. In
certain embodiments, the ADA activity of the glycoengineered
composition of the invention is at least 1.1 times lower, at least
1.2 times lower, at least 1.3 times lower, at least 1.4 times
lower, at least 1.5 times lower, at least 1.6 times lower, at least
1.7 times lower, at least 1.8 times lower, at least 10 times lower,
at least 20 times lower, at least 50 times lower or up to 100 times
lower when compared to the reference composition. In other
embodiments, the serum half-life of the glycoengineered composition
of the invention is at least 6 hours, 12 hours, 1 day, 2 days, 3
days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11
days, 12 days, 13 days, 2 weeks, 3 weeks, or 4 weeks longer than
the reference composition.
[0112] In certain embodiments, the glycoengineered binding protein
compositions of the invention exhibit decreased internalization by
dendritic cells in a dendritic cell internalization (DCI) assay, as
compared to a reference binding protein composition. In an
exemplary DCI assay, the glycoengineered binding protein
compositions may be fluorescently labelled with a pH-sensitive
fluorophore (e.g., pH.sup.rodo Red) and combined with dendritic
cells and an immunostimulant (e.g., LPS). Internalization of the
fluorescently labelled antibodies may be quantified by measuring
(e.g., via FACS cell sorting) the fluorescence which occurs upon
uptake and exposure of the fluorophore-labelled antibody to the
acidic pH in the endosomal compartments of the dendritic cell.
Exemplary DCI assays are described in Example 6 herein.
Accordingly, in certain embodiments, the glycoengineered binding
protein compositions of the invention exhibit at least 10%, at
least 20%, at least 30%, at least 40%, at least 50%, at least 60%,
at least 70%, at least 80%, at least 90% or at least 100% reduction
in fluorescent intensity as compared to a reference antibody
composition comprising the same binding polypeptide sequence. In
certain embodiments, the glycoengineered binding protein
composition is a hypergalactosylated and/or hypomannosylated
preparation of adalimumab and the reference binding protein
composition is a commercially available or non-glycoengineered
preparation of adalimumab (e.g., Humira.RTM.). In another
embodiment, the reference binding protein composition is a binding
protein composition (e.g., an adalimumab composition) obtained from
the milk of a transgenic animal.
Quantification of Glycoforms
[0113] The glycosylation pattern of the compositions of the
invention can be determined by many methods known in the art. For
example, methods of analyzing carbohydrates on proteins have been
described in U.S. Patent Applications US 2006/0057638 and US
2006/0127950 and: Guile G R, et al. Anal Biochem. 1996 Sep. 5;
240(2):210-26; Packer et al., Glycoconj J. 1998 August;
15(8):737-47; Barb, Biochemistry 48:9705-9707 (2009); Anumula, J.
Immunol. Methods 382:167-176 (2012); Gilar et al., Analytical
Biochem. 417:80-88 (2011).
[0114] In some instances, glycan structure and composition as
described herein are analyzed, for example, by one or more
enzymatic methods, chromatographic methods, mass spectrometry (MS)
methods, electrophoretic methods, nuclear magnetic resonance (NMR)
methods, and combinations thereof. Exemplary enzymatic methods
include contacting a composition with one or more enzymes under
conditions and for a time sufficient to release one or more
glycan(s) (e.g., one or more exposed glycan(s)). In some instances,
the one or more enzymes include(s) PNGase F. Exemplary
chromatographic methods include, but are not limited to, Strong
Anion Exchange chromatography using Pulsed Amperometric Detection
(SAX-PAD), Weak Anion Exchange chromatography, liquid
chromatography (LC), high performance liquid chromatography (HPLC),
ultra performance liquid chromatography (UPLC), thin layer
chromatography (TLC), amide column chromatography, and combinations
thereof. Exemplary mass spectrometry (MS) methods include, but are
not limited to, tandem MS, LC-MS, LC-MS/MS, matrix assisted laser
desorption ionisation mass spectrometry (MALDI-MS), Fourier
transform mass spectrometry (FTMS), ion mobility separation with
mass spectrometry (IMS-MS), electron transfer dissociation
(ETD-MS), and combinations thereof. Exemplary electrophoretic
methods include, but are not limited to, capillary electrophoresis
(CE), CE-MS, gel electrophoresis, agarose gel electrophoresis,
acrylamide gel electrophoresis, SDS-polyacrylamide gel
electrophoresis (SDS-PAGE) followed by Western blotting using
antibodies that recognize specific glycan structures, and
combinations thereof. Exemplary nuclear magnetic resonance (NMR)
methods include, but are not limited to, one-dimensional NMR (1
D-NMR), two-dimensional NMR (2D-NMR), correlation spectroscopy
magnetic-angle spinning NMR (COSY-NMR), total correlated
spectroscopy NMR (TOCSY-NMR), heteronuclear single-quantum
coherence NMR (HSQC-NMR), heteronuclear multiple quantum coherence
(HMQC-NMR), rotational nuclear overhauser effect spectroscopy NMR
(ROESY-NMR), nuclear overhauser effect spectroscopy (NOESY-NMR),
and combinations thereof. Additional techniques for the detection,
analysis, and/or isolation of particular glycans are described in
WO2008/128216; WO2008/128220; WO2008/128218; WO2008/130926;
WO2008/128225; WO2008/130924; WO2008/128221; WO2008/128228;
WO2008/128227; WO2008/128230; WO2008/128219; WO2008/128222;
WO2010/071817; WO2010/071824; WO2010/085251; WO2011/069056; and
WO2011/127322, each of which is incorporated herein by reference in
its entirety). For example, in some instances, glycans are
characterized using one or more of chromatographic methods,
electrophoretic methods, nuclear magnetic resonance methods, and
combinations thereof.
[0115] In exemplary embodiments, the compositions of the invention
are analyzed using the art-recognized 2-AB labelling methodology
(see U.S. Pat. No. 5,747,347 and Bigge et al., Anal. Biochem., 230:
229-238 (1995) which are incorporated by reference herein in their
entireties). 2-AB labelling kits are commercially available (see,
e.g., GlycoProfile.TM. 2-AB Labeling from Sigma Aldrich, St. Louis,
Mo.). 2-AB labeling technology employs the fluorophores 2-AB
(2-aminobenzamide) or 2-AA (anthranilic acid or 2-aminbenzoic acid)
to label the free reducing sugars of a glycoform. Glycans with a
free reducing sugar exist in equilibrium between the cyclic (closed
ring) and acyclic (open ring) structure. A stable Schiff's base is
formed when the carbonyl atom of an acyclic reducing sugar is
linked to the amine moiety of the fluorophore in a nucleophilic
matter. Following formation of the Schiff's base, the resulting
imine group is reduced using sodium cyanoborohydride, resulting in
a stable labeled glycan. The 2-AB reagent has an excitation range
of 200-450 nm, with an excitation peak at 330 nm, and an emission
range of 300-750 nm, with an emission peak at 420 nm.
[0116] Prior to labeling, N-glycan samples may be prepared by
enzymatic (e.g., PNGase F) or chemical deglycosylation (e.g.,
hydrazinolysis) of an antibody composition in order to release the
N-glycans from the antibodies, and removing any contaminating
protein, peptides, salts, detergents, and any additional
contaminating substances. Once the N-glycan samples have been
labeled, a variety of methods exist to analyze them, including, for
example, HPLC, separation by ion exchange chromatography (e.g.,
high-performance anion exchange), normal phase HPLC, and size
exclusion chromatography. Labeled glycans can also be detected
using SDS-PAGE and mass spectrometry (e.g., electrospray ionization
(ESI) or matrix assisted laser absorption ionization
(MALDI-TOF).
[0117] The percent content of each labeled glycoform can be
quantified using art-recognized methods. For example, the
glycoforms can be quantified based on the N-glycan peaks of a
chromatogram, such as a NP HPLC spectrum. Exemplary chromatograms
of binding protein composition of the invention are depicted in
FIG. 7. Thus, the glycoform profile in a population of
Fc-containing binding proteins can be determined by releasing the
N-glycans from the binding proteins, resolving the N-glycans on a
chromatogram, identifying the N-glycan that corresponds to a
specific peak, determining the peak intensity and applying the data
to a quantitative formula.
[0118] For example, the galactosylation state of a particular
binding protein composition can be quantified according to the
following formula:
? ? [ number of A ] * [ % relative Area ] * 100 ##EQU00001## ?
indicates text missing or illegible when filed ##EQU00001.2##
[0119] wherein:
[0120] n represents the number of analyzed N-glycan peaks of the
chromatogram,
[0121] "number of Gal" represents the number of Galactose motifs on
the antennae of the glycan corresponding to the peak;
[0122] "number of A" corresponds to the number of antennae of the
glycan form corresponding to the peak; and
[0123] "% relative Area" corresponds to % of the Area under the
corresponding peak.
[0124] Similarly, the mannosylation state of a particular binding
protein composition can be determined according to the same
formula, but where the "number of Gal" is substituted for "number
of Man". "Number of Man" represents that number of Mannose motifs
on the antennae of the glycan corresponding to the peak.
III. BINDING PROTEINS
[0125] In one aspect, the invention provides a population of Fc
domain-containing binding proteins (e.g., TNF binding proteins)
with a reduced anti-drug immune response.
[0126] Any Fc domain-containing binding protein known in the art
that comprises an N-Glycan structure is suitable for use in the
compositions disclosed herein. In certain embodiments, the binding
proteins are therapeutic antibodies or immunoadhesin molecules. In
certain embodiments, the binding proteins are FDA approved
therapeutic binding proteins. In certain embodiments, the binding
proteins are antibodies (e.g., monoclonal antibodies). For example,
the binding protein may be selected from the group consisting of
alemtuzumab, bevacizumab, cetuximab, edrecolomab, gemtuzumab
ozogamicin, ibritumomab tiuxetan, ofatumumab, panitumumab,
rituximab, tositumomab, trastuzumab, arcitumomab, capromab
pendetide, nofetumomab, satumomab, basiliximab, daclizumab,
muromonab-cd3, infliximab, natalizumab, adalimumab, certolizumab,
golimumab, infliximab, tocilizumab, omalizumab, abciximab,
bevacizumab, ranibzumab, natalizumab, efalizumab, ustekinumab,
palivizumab, ruplizumab, denosumab, eculizumab, alefacept,
abatacept, etanercept, romiplostim, rilonacept, aflibercept,
belatacept, and rilonacept.
[0127] In certain embodiments, the Fc domain-containing binding
proteins bind to human TNF. Exemplary binding proteins which bind
to human TNF include etanercept, infliximab, adalimumab, and
golimumab.
[0128] In certain exemplary embodiments, the binding protein is the
anti-TNF antibody adalimumab or a variant thereof. In certain
embodiments, the anti-TNF antibody is an Fc variant of adalimumab
(D2E7) comprising the heavy and light chain variable region
sequences of adalimumab (see, e.g., U.S. Pat. No. 6,090,382) and a
variant Fc region with an amino acid substitution that confers
enhanced serum half-life. In certain exemplary embodiments, the
variant Fc region is a human IgG1 Fc region comprising the
mutations T250Q and M428L relative to a wild-type human IgG1
sequence (wherein amino acid numbering is according to the EU
numbering convention as in Kabat). In other embodiments, the
anti-TNF antibody is a variant of adalimumab which exhibits
pH-sensitive binding to the TNF antigen. PH-sensitive variants may
exhibit reduced binding of the TNF-antigen at an acidic pH, thereby
promoting release from the endosomal compartment and prolonging
serum half-life. For example, pH-sensitive variants comprise
histidine mutations within the CDRs of heavy or light chain
variable regions of adalimumab. Exemplary pH-sensitive variants of
Adalimumab include D2E7SS22.
[0129] The heavy chain of D2E7SS22 is provided in SEQ ID NO: 1
(variant Histidine bolded and underlined; C-terminal lysine in
parentheses may be present or absent):
TABLE-US-00001
EVQLVESGGGLVQPGRSLRLSCAASGFTFDHYAMHWVRQAPGKGLEWVSAITWNSGHIDYAD
SVEGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL
SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP
PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE
ALHNHYTQKSLSLSPG(K)
[0130] The light chain of D2E7SS22 is provided in SEQ ID NO:2
(variant Histidine bolded and underlined):
TABLE-US-00002
DIQMTQSPSSLSASVGDRVTITCRASHSIRNYLSWYQQKPGKAPKLLIYAASTLQSGVPSRF
SGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQ
LKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADY
EKHKVYACEVTHQGLSSPVTKSFNRGEC
[0131] In another exemplary embodiment, the pH-sensitive variant
comprises the heavy and light chain variable regions of D2E7SS22
and a variant Fc region (e.g., a human IgG1 Fc region comprising
the mutations T250Q and M428L relative to a wild-type human IgG1
sequence).
[0132] In certain embodiments, the binding proteins comprise an
antigen binding fragment of an antibody. In exemplary embodiments,
the binding protein comprises a single chain variable region
sequence (ScFv). Single chain variable region sequences comprise a
single polypeptide having one or more antigen binding sites, e.g.,
a VL domain linked by a flexible linker to a VH domain. ScFv
molecules can be constructed in a VH-linker-VL orientation or
VL-linker-VH orientation. The flexible hinge that links the VL and
VH domains that make up the antigen binding site preferably
comprises from about 10 to about 50 amino acid residues. Connecting
peptides are known in the art. Binding proteins of the invention
may comprise at least one scFv and/or at least one constant
region.
[0133] In certain embodiments, the binding proteins are multivalent
(e.g., tetravalent) antibodies which are produced by fusing a DNA
sequence encoding an antibody with a ScFv molecule (e.g., an
altered ScFv molecule). For example, in one embodiment, these
sequences are combined such that the ScFv molecule (e.g., an
altered ScFv molecule) is linked at its N-terminus or C-terminus to
an Fc fragment of an antibody via a flexible linker (e.g., a
gly/ser linker). In another embodiment a tetravalent antibody of
the current disclosure can be made by fusing an ScFv molecule to a
connecting peptide, which is fused to a CH1 domain.
[0134] In certain embodiments, the binding proteins comprise an
altered minibody. Altered minibodies of the current disclosure are
dimeric molecules made up of two polypeptide chains each comprising
an ScFv molecule (e.g., an altered ScFv molecule comprising an
altered VH domain described supra) which is fused to a CII3 domain
or portion thereof via a connecting peptide. Minibodies can be made
by constructing an ScFv component and connecting peptide-CH3
component using methods described in the art (see, e.g., U.S. Pat.
No. 5,837,821 or WO 94/09817A1). In another embodiment, a
tetravalent minibody can be constructed. Tetravalent minibodies can
be constructed in the same manner as minibodies, except that two
ScFv molecules are linked using a flexible linker. The linked
scFv-scFv construct is then joined to a CH3 domain.
[0135] In certain embodiments, the binding proteins comprise a
diabody. Diabodies are dimeric, tetravalent molecules each having a
polypeptide similar to scFv molecules, but usually having a short
(less than 10 and preferably 1-5) amino acid residue linkers
connecting both variable domains, such that the VL and VH domains
on the same polypeptide chain cannot interact. Instead, the VL and
VH domain of one polypeptide chain interact with the VH and VL
domain (respectively) on a second polypeptide chain (see, for
example, WO 02/02781). Diabodies of the current disclosure comprise
an scFv molecule fused to a CH3 domain.
[0136] In certain embodiments, the binding proteins comprise
multispecific or multivalent antibodies comprising one or more
variable domain in series on the same polypeptide chain, e.g.,
tandem variable domain (TVD) polypeptides. Exemplary TVD
polypeptides include the "double head" or "Dual-Fv" configuration
described in U.S. Pat. No. 5,989,830. In the Dual-Fv configuration,
the variable domains of two different antibodies are expressed in a
tandem orientation on two separate chains (one heavy chain and one
light chain), wherein one polypeptide chain has two times a VH in
series separated by a peptide linker (VH1-linker-VH2) and the other
polypeptide chain consists of complementary VL domains connected in
series by a peptide linker (VL1-linker-VL2). In the cross-over
double head configuration, the variable domains of two different
antibodies are expressed in a tandem orientation on two separate
polypeptide chains (one heavy chain and one light chain), wherein
one polypeptide chain has two VH in series separated by a peptide
linker (VH1-linker-VH2) and the other polypeptide chain consists of
complementary VL domains connected in series by a peptide linker in
the opposite orientation (VL2-linker-VL1). Additional antibody
variants based on the "Dual-Fv" format include the
Dual-Variable-Domain IgG (DVD-IgG) bispecific antibody (see U.S.
Pat. No. 7,612,181 and the TBTI format (see US 2010/0226923 A1).
The addition of constant domains to respective chains of the
Dual-Fv (CH1-Fc to the heavy chain and kappa or lambda constant
domain to the light chain) leads to functional bispecific
antibodies without any need for additional modifications (i.e.,
obvious addition of constant domains to enhance stability).
[0137] In certain embodiments, the binding proteins comprise a
cross-over dual variable domain IgG (CODV-IgG) bispecific antibody
based on a "double head" configuration (see US20120251541 A1, which
is incorporated by reference herein in its entirety). CODV-IgG
antibody variants generally have one polypeptide chain with VL
domains connected in series to a CL domain (VL1-L1-VL2-L2-CL) and a
second polypeptide chain with complementary VH domains connected in
series in the opposite orientation to a CH1 domain
(VH2-L3-VH1-L4-CH1), where the polypeptide chains form a cross-over
light chain-heavy chain pair. In certain embodiment, the second
polypeptide may be further connected to an Fc domain
(VH2-L3-VH1-L4-CH1-Fc).
[0138] In certain embodiments, the binding proteins comprise an
immunoadhesin molecule comprising a non-antibody binding region
(e.g., a receptor, ligand, or cell-adhesion molecule) fused to an
antibody constant region (see e.g., Ashkenazi et al., Methods, 1995
8(2), 104-115, which is incorporated by reference herein in its
entirety).
[0139] In certain embodiments, the binding proteins comprise an
immunoglobulin-like domain. Suitable immunoglobulin-like domains
include, without limitation, fibronectin domains (see, for example,
Koide et al. (2007), Methods Mol. Biol. 352: 95-109, which is
incorporated by reference herein in its entirety), DARPin (see, for
example, Stumpp et al. (2008) Drug Discov. Today 13 (15-16):
695-701, which is incorporated by reference herein in its
entirety), Z domains of protein A (see, Nygren et al. (2008) FEBS
J. 275 (11): 2668-76, which is incorporated by reference herein in
its entirety), lipocalins (see, for example, Skerra et al. (2008)
FEBS J. 275 (11): 2677-83, which is incorporated by reference
herein in its entirety), Affilins (see, for example, Ebersbach et
al. (2007) J. Mol. Biol. 372 (1): 172-85, which is incorporated by
reference herein in its entirety), Affitins (see, for example,
Krehenbrink et al. (2008). J. Mol. Biol. 383 (5): 1058-68, which is
incorporated by reference herein in its entirety), Avimers (see,
for example, Silverman et al. (2005) Nat. Biotechnol. 23 (12):
1556-61, which is incorporated by reference herein in its
entirety), Fynomers, (see, for example, Grabulovski et al. (2007) J
Biol Chem 282 (5): 3196-3204, which is incorporated by reference
herein in its entirety), and Kunitz domain peptides (see, for
example, Nixon et al. (2006) Curr Opin Drug Discov Devel 9 (2):
261-8, which is incorporated by reference herein in its
entirety).
[0140] In certain embodiments, the Fc domain-containing binding
proteins of the invention are capable of binding one or more
targets selected from the group consisting of ABCF1; ACVR1; ACVR1B;
ACVR2; ACVR2B; ACVRL1; ADORA2A; Aggrecan; AGR2; AICDA; AIF1; AIG1;
AKAP1; AKAP2; AMH; AMHR2; ANGPT1; ANGPT2; ANGPTL3; ANGPTL4; ANPEP;
APC; APOC1; AR; AZGP1 (zinc-a-glycoprotein); B7.1; B7.2; BAD; BAFF;
BAG1; BAH; BCL2; BCL6; BDNF; BLNK; BLR1 (MDR15); BlyS; BMP1; BMP2;
BMP3B (GDF10); BMP4; BMP6; BMP8; BMPRIA; BMPR1B; BMPR2; BPAG1
(plectin); BRCA1; C19orf10 (IL27w); C3; C4A; C5; C5R1; CANT1;
CASP1; CASP4; CAV1; CCBP2 (D6/JAB61); CCL1 (1-309); CCL11
(eotaxin); CCL13 (MCP-4); CCL15 (MIP-1d); CCL16 (HCC-4); CCL17
(TARC); CCL18 (PARC); CCL19 (MIP-3b); CCL2 (MCP-1); MCAF; CCL20
(MIP-3a); CCL21 (MIP-2); SLC; exodus-2; CCL22 (MDC/STC-1); CCL23
(MPIF-1); CCL24 (MPIF-2/eotaxin-2); CCL25 (TECK); CCL26
(eotaxin-3); CCL27 (CTACK/ILC); CCL28; CCL3 (MIP-1a); CCL4
(MIP-1b); CCL5 (RANTES); CCL7 (MCP-3); CCL8 (mcp-2); CCNA1; CCNA2;
CCND1; CCNE1; CCNE2; CCR1 (CKR1/HM 145); CCR2 (mcp-1RB/RA); CCR3
(CKR3/CMKBR3); CCR4; CCR5 (CMKBR5/ChemR13); CCR6
(CMKBR6/CKR-L3/STRL22/DRY6); CCR7 (CKR7/EB11); CCR8
(CMKBR8/TER1/CKR-L1); CCR9 (GPR-9-6); CCRL1 (VSHK1); CCRL2 (L-CCR);
CD164; CD19; CD1C; CD20; CD200; CD-22; CD24; CD28; CD3; CD37; CD38;
CD3E; CD3G; CD3Z; CD4; CD40; CD40L; CD44; CD45RB; CD52; CD69; CD72;
CD74; CD79A; CD79B; CD8; CD80; CD81; CD83; CD86; CDH1 (E-cadherin);
CDH10; CDH12; CDH13; CDH18; CDH19; CDH20; CDH5; CDH7; CDH8; CDH9;
CDK2; CDK3; CDK4; CDK5; CDK6; CDK7; CDK9; CDKN1A (p21Wap1/Cip1);
CDKN1B (p27Kipl); CDKN1C; CDKN2A (p161NK4a); CDKN2B; CDKN2C; CDKN3;
CEBPB; CER1; CHGA; CHGB; Chitinase; CHST10; CKLFSF2; CKLFSF3;
CKLFSF4; CKLFSF5; CKLFSF6; CKLFSF7; CKLFSF8; CLDN3; CLDN7
(claudin-7); CLN3; CLU (clusterin); CMKLR1; CMKOR1 (RDC1); CNR1;
COL18A1; COL1A1; COL4A3; COL6A1; CR2; CRP; CSF1 (M-CSF); CSF2
(GM-CSF); CSF3 (GCSF); CTLA4; CTNNB1 (b-catenin); CTSB (cathepsin
B); CX3CL1 (SCYD1); CX3CR1 (V28); CXCL1 (GRO1); CXCL10 (IP-10);
CXCL11 (1-TAC/IP-9); CXCL12 (SDF1); CXCL13; CXCL14; CXCL16; CXCL2
(GRO2); CXCL3 (GRO3); CXCL5 (ENA-78/LIX); CXCL6 (GCP-2); CXCL9
(MIG); CXCR3 (GPR9/CKR-L2); CXCR4; CXCR6 (TYMSTR/STRL33/Bonzo);
CYBS; CYC1; CYSLTR1; DAB2IP; DES; DKFZp451J0118; DNCL1; DPP4; E2F1;
ECGF1; EDG1; EFNA1; EFNA3; EFNB2; EGF; EGFR; ELAC2; ENG; ENO1;
ENO2; ENO3; EPHB4; EPO; ERBB2 (Her-2); EREG; ERK8; ESR1; ESR2; F3
(TF); FADD; FasL; FASN; FCER1A; FCER2; FCGR3A; FGF; FGF1 (aFGF);
FGF10; FGF11; FGF12; FGF12B; FGF13; FGF14; FGF16; FGF17; FGF18;
FGF19; FGF2 (bFGF); FGF20; FGF21; FGF22; FGF23; FGF3 (int-2); FGF4
(HST); FGF5; FGF6 (HST-2); FGF7 (KGF); FGF8; FGF9; FGFR3; FIGF
(VEGFD); FIL1 (EPSILON); FIL1 (ZETA); FLJ12584; FLJ25530; FLRT1
(fibronectin); FLT1; FOS; FOSL1 (FRA-1); FY (DARC); GABRP (GABAa);
GAGEB1; GAGEC1; GALNAC4S-6ST; GATA3; GDF5; GFI1; GGT1; GM-CSF;
GNAS1; GNRH1; GPR2 (CCR10); GPR31; GPR44; GPR81 (FKSG80); GRCC10
(C10); GRP; GSN (Gelsolin); GSTP1; HAVCR2; HDAC4; HDAC5; HDAC7A;
HDAC9; HGF; HIF1A; HIP1; histamine and histamine receptors; HLA-A;
HLA-DRA; HM74; HMOX1; HUMCYT2A; ICEBERG; ICOSL; ID2; IFN-a; IFNA1;
IFNA2; IFNA4; IFNA5; IFNA6; IFNA7; IFNB1; IFNgamma; IFNW1; IGBP1;
IGF1; IGF1R; IGF2; IGFBP2; IGFBP3; IGFBP6; IL-1; IL10; IL10RA;
IL10RB; IL11; IL11RA; IL-12; IL12A; IL12B; IL12RB1; IL12RB2; IL13;
IL13RA1; IL13RA2; IL14; IL15; IL15RA; IL16; IL17; IL17B; IL17C;
IL17R; IL18; IL18BP; IL18R1; IL18RAP; IL19; IL1A; IL1B; IL1F10;
IL1F5; IL1F6; IL1F7; IL1F8; IL1F9; IL1HY1; IL1R1; IL1R2; IL1RAP;
IL1RAPL1; IL1RAPL2; IL1RL1; IL1RL2 IL1RN; IL2; IL20; IL20RA; IL21R;
IL22; IL22R; IL22RA2; IL23; IL24; IL25; IL26; IL27; IL28A; IL28B;
IL29; IL2RA; IL2RB; IL2RG; IL3; IL30; IL3RA; IL4; IL4R; IL5; IL5RA;
IL6; IL6R; IL6ST (glycoprotein 130); IL7; IL7R; IL8; IL8RA; IL8RB;
IL8RB; IL9; IL9R; ILK; INHA; INHBA; INSL3; INSL4; IRAK1; IRAK2;
ITGA1; ITGA2; ITGA3; ITGA6 (a6 integrin); ITGAV; ITGB3; ITGB4 (b 4
integrin); JAG1; JAK1; JAK3; JUN; K6HF; KAI1; KDR; KITLG; KLF5 (GC
Box BP); KLF6; KLK10; KLK12; KLK13; KLK14; KLK15; KLK3; KLK4; KLK5;
KLK6; KLK9; KRT1; KRT19 (Keratin 19); KRT2A; KRTHB6 (hair-specific
type II keratin); LAMAS; LEP (leptin); Lingo-p75; Lingo-Troy; LPS;
LTA (TNF-b); LTB; LTB4R (GPR16); LTB4R2; LTBR; MACMARCKS; MAG or
Omgp; MAP2K7 (c-Jun); MDK; MIB1; midkine; MIF; MIP-2; MKI67
(Ki-67); MMP2; MMP9; MS4A1; MSMB; MT3 (metallothionectin-III);
MTSS1; MUC1 (mucin); MYC; MYD88; NCK2; neurocan; NFKB1; NFKB2; NGFB
(NGF); NGFR; NgR-Lingo; NgR-Nogo66 (Nogo); NgR-p75; NgR-Troy; NME1
(NM23A); NOX5; NPPB; NROB1; NROB2; NR1D1; NR1D2; NR1H2; NR1H3;
NR1H4; NR1I2; NR1I3; NR2C1; NR2C2; NR2E1; NR2E3; NR2F1; NR2F2;
NR2F6; NR3C1; NR3C2; NR4A1; NR4A2; NR4A3; NR5A1; NR5A2; NR6A1;
NRP1; NRP2; NT5E; NTN4; ODZ1; OPRD1; P2Rx7; PAP; PART1; PATE; PAWR;
PCA3; PCNA; PDGFA; PDGFB; PECAM1; PF4 (CXCL4); PGF; PGR;
phosphacan; PIAS2; PIK3CG; PLAU (uPA); PLG; PLXDC1; PPBP (CXCL7);
PPID; PR1; PRKCQ; PRKD1; PRL; PROC; PROK2; PSAP; PSCA; PTAFR; PTEN;
PTGS2 (COX-2); PTN; RAC2 (p21Rac2); RARB; RGS1; RGS13; RGS3; RNF110
(ZNF144); ROB02; S100A2; SCGB1D2 (lipophilin B); SCGB2A1
(mammaglobin 2); SCGB2A2 (mammaglobin 1); SCYE1 (endothelial
Monocyte-activating cytokine); SDF2; SERPINA1; SERPINA3; SERPINB5
(maspin); SERPINE1 (PAI-1); SERPINF1; SHBG; SLA2; SLC2A2; SLC33A1;
SLC43A1; SLIT2; SPP1; SPRR1B (Sprl); ST6GAL1; STAB1; STAT6; STEAP;
STEAP2; TB4R2; TBX21; TCP10; TDGF1; TEK; TGFA; TGFB1; TGFB11;
TGFB2; TGFB3; TGFB1; TGFBR1; TGFBR2; TGFBR3; TH1L; THBS1
(thrombospondin-1); THBS2; THBS4; THPO; TIE (Tie-1); TIMP3; tissue
factor; TLR10; TLR2; TLR3; TLR4; TLR5; TLR6; TLR7; TLR8; TLR9; TNF;
TNF-.alpha.; TNFAIP2 (B94); TNFAIP3; TNFRSF1A; TNFRSF1A; TNFRSF1B;
TNFRSF21; TNFRSF5; TNFRSF6 (Fas); TNFRSF7; TNFRSF8; TNFRSF9;
TNFSF10 (TRAIL); TNFSF11 (TRANCE); TNFSF12 (APO3L); TNFSF13
(April); TNFSF13B; TNFSF14 (HVEM-L); TNFSF15 (VEGI); TNFSF18;
TNFSF4 (OX40 ligand); TNFSF5 (CD40 ligand); TNFSF6 (FasL); TNFSF7
(CD27 ligand); TNFSF8 (CD30 ligand); TNFSF9 (4-IBB ligand); TOLLIP;
Toll-like receptors; TOP2A (topoisomerase Iia); TP53; TPM1; TPM2;
TRADD; TRAF1; TRAF2; TRAF3; TRAF4; TRAF5; TRAF6; TREM1; TREM2;
TRPC6; TSLP; TWEAK; VEGF; VEGFB; VEGFC; versican; VIIL C5; VLA-4;
XCL1 (lymphotactin); XCL2 (SCM-1b); XCR1 (GPR5/CCXCR1); YY1; and
ZFPM2.
IV. ENGINEERED BINDING PROTEINS
[0141] In certain preferred embodiments, the binding proteins
produced using the methods and compositions disclosed herein
exhibit improved properties (e.g., affinity or stability) with
respect to a corresponding parental reference binding protein. For
example, the engineered binding protein may dissociate from its
target antigen with a k.sub.off rate constant of about 0.1 s.sup.-1
or less, as determined by surface plasmon resonance, or inhibit the
activity of the target antigen with an IC.sub.50 of about
1.times.10.sup.-6M or less. Alternatively, the binding protein may
dissociate from the target antigen with a k.sub.off rate constant
of about 1.times.10.sup.-2 s.sup.-1 or less, as determined by
surface plasmon resonance, or may inhibit activity of the target
antigen with an IC.sub.50 of about 1.times.10.sup.-7M or less.
Alternatively, the binding protein may dissociate from the target
with a k.sub.off rate constant of about 1.times.10.sup.-3 s.sup.-1
or less, as determined by surface plasmon resonance, or may inhibit
the target with an IC.sub.50 of about 1.times.10.sup.-8M or less.
Alternatively, binding protein may dissociate from the target with
a k.sub.off rate constant of about 1.times.10.sup.-4 s.sup.-1 or
less, as determined by surface plasmon resonance, or may inhibit
its activity with an IC.sub.50 of about 1.times.10.sup.-9M or less.
Alternatively, binding protein may dissociate from the target with
a k.sub.off rate constant of about 1.times.10.sup.-5 s.sup.-1 or
less, as determined by surface plasmon resonance, or inhibit its
activity with an IC.sub.50 of about 1.times.10.sup.-.sub.10M or
less. Alternatively, binding protein may dissociate from the target
with a k.sub.off rate constant of about 1.times.10.sup.-5 s.sup.-1
or less, as determined by surface plasmon resonance, or may inhibit
its activity with an IC.sub.50 of about 1.times.10.sup.-11 M or
less.
[0142] In certain embodiments, the engineered binding protein
comprises a heavy chain constant region, such as an IgG1, IgG2,
IgG3, IgG4, IgA, IgE, IgM or IgD constant region. Preferably, the
heavy chain constant region is an IgG1 heavy chain constant region
or an IgG4 heavy chain constant region. Furthermore, the binding
protein can comprise a light chain constant region, either a kappa
light chain constant region or a lambda light chain constant
region. The binding protein comprises a kappa light chain constant
region. Alternatively, the binding protein portion can be, for
example, a Fab fragment or a single chain Fv fragment.
[0143] In certain embodiments, the engineered binding protein
comprises an engineered effector function known in the art (see,
e.g., Winter, et al. U.S. Pat. Nos. 5,648,260; 5,624,821). The Fc
portion of a binding protein mediates several important effector
functions e.g. cytokine induction, ADCC, phagocytosis, complement
dependent cytotoxicity (CDC) and half-life/clearance rate of
binding protein and antigen-binding protein complexes. In some
cases these effector functions are desirable for therapeutic
binding protein but in other cases might be unnecessary or even
deleterious, depending on the therapeutic objectives. Certain human
IgG isotypes, particularly IgG1 and IgG3, mediate ADCC and CDC via
binding to Fc.gamma.Rs and complement Clq, respectively. Neonatal
Fc receptors (FcRn) are the critical components determining the
circulating half-life of binding proteins. In still another
embodiment at least one amino acid residue is replaced in the
constant region of the binding protein, for example the Fc region
of the binding protein, such that effector functions of the binding
protein are altered.
[0144] In certain embodiments, the engineered binding protein is
derivatized or linked to another functional molecule (e.g., another
peptide or protein). For example, a labeled binding protein of the
invention can be derived by functionally linking a binding protein
or binding protein portion of the invention (by chemical coupling,
genetic fusion, noncovalent association or otherwise) to one or
more other molecular entities, such as another binding protein
(e.g., a bispecific binding protein or a diabody), a detectable
agent, a cytotoxic agent, a pharmaceutical agent, and/or a protein
or peptide that can mediate associate of the binding protein with
another molecule (such as a streptavidin core region or a
polyhistidine tag).
[0145] Useful detectable agents with which a binding protein or
binding protein portion of the invention may be derivatized include
fluorescent compounds. Exemplary fluorescent detectable agents
include fluorescein, fluorescein isothiocyanate, rhodamine,
5-dimethylamine-1-napthalenesulfonyl chloride, phycoerythrin and
the like. A binding protein may also be derivatized with detectable
enzymes, such as alkaline phosphatase, horseradish peroxidase,
glucose oxidase and the like. When a binding protein is derivatized
with a detectable enzyme, it is detected by adding additional
reagents that the enzyme uses to produce a detectable reaction
product. For example, when the detectable agent horseradish
peroxidase is present, the addition of hydrogen peroxide and
diaminobenzidine leads to a colored reaction product, which is
detectable. A binding protein may also be derivatized with biotin,
and detected through indirect measurement of avidin or streptavidin
binding.
[0146] In other embodiment, the engineered binding protein is
further modified to generate glycosylation site mutants in which
the O- or N-linked glycosylation site of the binding protein has
been mutated. One skilled in the art can generate such mutants
using standard well-known technologies. Glycosylation site mutants
that retain the biological activity, but have increased or
decreased binding activity, are another object of the present
invention.
[0147] Additionally or alternatively, an engineered binding protein
of the invention can be further modified with an altered type of
glycosylation, such as a hypofucosylated binding protein having
reduced amounts of fucosyl residues or a binding protein having
increased bisecting GlcNAc structures. Such altered glycosylation
patterns have been demonstrated to increase the ADCC ability of
binding proteins. Such carbohydrate modifications can be
accomplished by, for example, expressing the binding protein in a
host cell with altered glycosylation machinery. Cells with altered
glycosylation machinery have been described in the art and can be
used as host cells in which to express recombinant binding proteins
of the invention to thereby produce a binding protein with altered
glycosylation. See, for example, Shields, R. L. et al. (2002) J.
Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech.
17:176-1, as well as, European Patent No: EP 1,176,195; PCT
Publications WO 03/035835; WO 99/54342 80, each of which is
incorporated herein by reference in its entirety. Using techniques
known in the art a practitioner may generate binding proteins
exhibiting human protein glycosylation. For example, yeast strains
have been genetically modified to express non-naturally occurring
glycosylation enzymes such that glycosylated proteins
(glycoproteins) produced in these yeast strains exhibit protein
glycosylation identical to that of animal cells, especially human
cells (U.S. patent Publication Nos. 20040018590 and 20020137134 and
PCT publication WO2005100584 A2).
V. PRODUCTION OF GLYCOENGINEERED BINDING PROTEINS
[0148] Binding proteins of the present invention may be produced by
any of a number of techniques known in the art. For example,
expression from host cells, wherein expression vector(s) encoding
the heavy and light chains is (are) transfected into a host cell by
standard techniques. The various forms of the term "transfection"
are intended to encompass a wide variety of techniques commonly
used for the introduction of exogenous DNA into a prokaryotic or
eukaryotic host cell, e.g., electroporation, calcium-phosphate
precipitation, DEAE-dextran transfection and the like. Although it
is possible to express the binding proteins of the invention in
either prokaryotic or eukaryotic host cells, expression of binding
proteins in eukaryotic cells is preferable, and most preferable in
mammalian host cells, because such eukaryotic cells (and in
particular mammalian cells) are more likely than prokaryotic cells
to assemble and secrete a properly folded and immunologically
active binding protein.
[0149] Preferred mammalian host cells for expressing the
recombinant binding proteins of the invention include Chinese
Hamster Ovary (CHO cells) (including dhfr-CHO cells, described in
Urlaub and Chasin, (1980) Proc. Natl. Acad. Sci. USA 77:4216-4220,
used with a DHFR selectable marker, e.g., as described in R. J.
Kaufman and P. A. Sharp (1982) Mol. Biol. 159:601621), NS0 myeloma
cells, COS cells and SP2 cells. When recombinant expression vectors
encoding binding protein genes are introduced into mammalian host
cells, the binding proteins are produced by culturing the host
cells for a period of time sufficient to allow for expression of
the binding protein in the host cells or, more preferably,
secretion of the binding protein into the culture medium in which
the host cells are grown. Binding proteins can be recovered from
the culture medium using standard protein purification methods.
Additional methods of culturing antibody-producing mammalian cells
are also taught, for example, in U.S. Pat. No. 8,663,945 which is
incorporated herein in its entirety.
[0150] Host cells can also be used to produce functional binding
protein fragments, such as Fab fragments or scFv molecules. It will
be understood that variations on the above procedure are within the
scope of the present invention. For example, it may be desirable to
transfect a host cell with DNA encoding functional fragments of
either the light chain and/or the heavy chain of a binding protein
of this invention. Recombinant DNA technology may also be used to
remove some, or all, of the DNA encoding either or both of the
light and heavy chains that is not necessary for binding to the
antigens of interest. The molecules expressed from such truncated
DNA molecules are also encompassed by the binding proteins of the
invention. In addition, bifunctional binding proteins may be
produced in which one heavy and one light chain are a binding
protein of the invention and the other heavy and light chain are
specific for an antigen other than the antigens of interest by
crosslinking a binding protein of the invention to a second binding
protein by standard chemical crosslinking methods.
[0151] In a preferred system for recombinant expression of a
binding protein, or antigen-binding portion thereof, of the
invention, a recombinant expression vector encoding both the
binding protein heavy chain and the binding protein light chain is
introduced into DHFR-CHO cells by calcium phosphate-mediated
transfection. Within the recombinant expression vector, the binding
protein heavy and light chain genes are each operatively linked to
CMV enhancer/AdMLP promoter regulatory elements to drive high
levels of transcription of the genes. The recombinant expression
vector also carries a DHFR gene, which allows for selection of CHO
cells that have been transfected with the vector using methotrexate
selection/amplification. The selected transformant host cells are
cultured to allow for expression of the binding protein heavy and
light chains and intact binding protein is recovered from the
culture medium. Standard molecular biology techniques are used to
prepare the recombinant expression vector, transfect the host
cells, select for transformants, culture the host cells and recover
the binding protein from the culture medium. Still further the
invention provides a method of synthesizing a recombinant binding
protein of the invention by culturing a host cell of the invention
in a suitable culture medium until a recombinant binding protein of
the invention is synthesized. The method can further comprise
isolating the recombinant binding protein from the culture
medium.
[0152] Glycoengineering of the binding proteins of the invention
can be achieved by any methods known in the art. Suitable methods
include: (1) glycosylation of purified binding proteins can be
modified enzymatically in vitro, (2) the cell culture and
production conditions can be modified to bias a defined
glycosylation profile of recombinant proteins expressed in the
cultured cells, (3) the protein can be engineered to add or
eliminate sites for the attachment of glycans or (4) a cell line
can be genetically engineered for production of biotherapeutics
with a modified glycosylation profile. Exemplary methods of making
glycoengineered Fc domain containing binding proteins can be found
in the Examples herein.
[0153] In certain embodiments, glycoengineering of recombinant
binding proteins is achieved by expression of Fc domain-containing
binding proteins in cells capable of N-linked glycosylation under
specific culture conditions. For example, growing CHO cells
expressing recombinant antibodies in chemically defined culture
media supplemented with metal ions such as manganese or ferric
nitrate increases the G1F and G2F glycoforms of the expressed
recombinant antibodies by at least 25-30% (see published U.S.
Patent Application No. 2012/0276631, the contents of which are
incorporated herein in their entirety and Example 1). In one
embodiment, the Fc containing binding proteins are
hypergalactosylated and/or hypomannosylated by expression in a host
cell with a knock down or knock out of its beta galactosidase gene,
for example, using beta galactosidase gene-specific RNAi,
homologous recombination or Zn finger nuclease inactivation of the
beta galactosidase gene (see Examples). In another embodiment, the
Fc containing binding proteins are hypergalactosylated and/or
hypomannosylated by expression in a host cell that overexpresses a
galactosyl transferase. In other embodiments, the glycosylation of
purified recombinant binding proteins is modified through enzymatic
means, in vitro. For example, one or more glycosyltransferases may
be employed to add specific saccharide residues to N-Glycans, and
one or more glycosidases may be employed to remove unwanted
saccharides from the N-linked glycan. Such enzymatic means are well
known in the art (see. e.g., WO/2007/005786, which is incorporated
herein by reference in its entirety). For example, purified
recombinant antibodies can be hypergalactosylated in vitro in the
presence of galactosyltransferase (see Warnock D. et al. (2005) In
vitro galactosylation of human IgG at 1 kg scale using recombinant
galactosyltransferase. Biotechnol. Bioeng. 92,831-842). In Vitro
Galactosylation and Sialylation of Glycoproteins with Terminal
N-Acetylglucosamine and Galactose Residues has also been reported
(Raju et al. Biochemistry, 2001, 40 (30), pp 8868-8876).
[0154] In other embodiments, mammalian cell lines are genetically
engineered to modify the glycosylation profile of expressed
recombinant binding proteins. For example, cells can be genetically
engineered to overexpress human .beta. 1, 4-galactosyltransferase
(E.C. 2.4.1.38; Weikert et al., Nature Biotechnology 17, 1116-1121
(1999)) or knock-out/knock down of .beta.-galactosidase proteins.
In other embodiments, the host cell is genetically engineered with
one or more sialyltransferase enzymes, e.g., an a2,6
sialyltransferase (e.g., ST6Gal-1). Any natural or engineered cell
(e.g., prokaryotic or eukaryotic) can be employed. In general,
mammalian cells are employed to effect glycosylation. The N-glycans
that are produced in mammalian cells are commonly referred to as
complex N-glycans (see e.g., Drickamer K, Taylor M E (2006).
Introduction to Glycobiology, 2nd ed., which is incorporated herein
by reference in its entirety).
[0155] The glycoengineered binding polypeptides may be recovered
from the culture supernatant of a glycoengineered host cell and
subjected to one or more purification steps, such as, for example,
ion-exchange or affinity chromatography, to further increase the
G/M ratio of the binding composition. Suitable methods of
purification will be apparent to a person of ordinary skill in the
art. A person of ordinary skill in the art will appreciate that
different combinations of purification methods, disclosed above,
can lead to production of the polypeptide compositions with
extremely high levels of galactosylation and extremely low levels
of mannosylation. For example, the hypergalactosylated and/or
hypomannosylated binding protein compositions obtained from
glycoengineered host cells can be further glycoengineered using in
vitro techniques. For example, the G/M ratio of said composition
can be further increased by subjecting the composition to treatment
with galactosyltransferases in vitro. Galactosyltransferases are
commercially available (Sigma Chemical Co, St. Louis, Mo.;
Boehringer Mannheim, Indianapolis, Ind. and Genzyme, Cambridge
Mass.).
[0156] Additionally or alternatively, compositions of the present
invention can be further purified or modified so that they have an
increased amount of sialic acid compared to reference antibody
composition. The addition of charged sialic acid residue can help
facilitate separation of the sialylated glycoforms by ion exchange
chromatography (see e.g., FIG. 7C). For example, the sialylation
levels of the composition can be increased for instance by
subjecting the composition to treatment with sialyltransferases
(e.g., an alpha 2,6 sialyltransferase). For example,
hypergalactosylated and/or hypomannosylated binding protein
compositions produced in CHO cells can be sialylated in vitro by
subjecting the purified or partially purified binding protein
composition to a sialyltransferase and the appropriate saccharide
based substrate. Further, one may employ an enzymatic reaction with
a sialyltransferase and a donor of sialic acid as described, for
example, in the U.S. Pat. No. 7,473,680, which is incorporated
herein by reference. Sialyltransferase enzymes are known in the art
and are commercially available. Methods and compositions described
herein include the use of a sialyltransferase enzyme, e.g., an a2,6
sialyltransferase (e.g., ST6Gal-1). A number of ST6Gal
sialyltransferases are known in the art and are commercially
available (see, e.g., Takashima, Biosci. Biotechnol. Biochem. 72:1
155-1 167 (2008); Weinstein et al., J. Biol. Chem. 262:17735-17743
(1987)). ST6Gal-1 catalyzes the transfer of sialic acid from a
sialic acid donor (e.g., cytidine 5'-monophospho-N-acetyl
neuraminic acid) to a terminal galactose residue of glycans through
an a2,6 linkage. Accordingly, a purified or partially purified
binding protein composition may contacted with an ST6Gal
sialyltransferase (e.g., a recombinantly expressed and purified
ST6Gal sialyltransferase) in the presence of a sialic acid donor,
e.g., cytidine 5'-monophospho-N-acetyl neuraminic acid, manganese,
and/or other divalent metal ions.
[0157] Additionally or alternatively, the composition can be
sialylated in vivo by expressing the binding protein in a CHO cell
that has been glycoengineered to express a sialyltransferase.
Suitable non-limiting examples of sialyltransferase enzymes useful
in the claimed methods are ST3Gal III, which is also referred to as
alpha-(2,3)sialyltransferase (EC 2.4.99.6), and
alpha-(2,6)sialyltransferase (EC 2.4.99.1). The
alpha-2,3-sialyltransferase may be the human
alpha-2,3-sialyltransferase, known as SIAT4C or STZ (GenBank
accession number L23767), and described, for example, in the U.S.
Patent Publication No. 20050181359. In yet other embodiments, the
binding protein composition can be passed through a column having a
lectin which is known to bind sialic acid in order to enrich for
sialylated glycoforms. A person of the ordinary skill in the art
will appreciate that different lectins display different affinities
for alpha 2,6 versus alpha 2,3 linkages between galactose and
sialic acid. Thus, selecting a specific lectin will allow
enrichment of antibodies with the desired type of linkage between
the sialic acid and the galactose. In one embodiment, the lectin is
isolated from Sambuccus nigra. A person of the ordinary skill in
the art will appreciate that the Sambuccus nigra agglutinin (SNA)
is specific for sialic acids linked to galactose or
N-acetylgalactosamine by alpha (2-6) linkages. Shibuya et al, J.
Biol. Chem., 262: 1596-1601 (1987). In contrast, the Maakia
amurensis ("MAA") lectin binds to sialic acid linked to galactose
by a(2-3) linkages. Wang et al, J Biol. Chem., 263: 4576-4585
(1988). Thus, a fraction of the polypeptides containing at least
one IgG Fc region having a desired linkage between the galactose
and the sialic acid will be retained in the column while a fraction
lacking such linkage will pass through. The sialylated fraction of
the polypeptides containing at least one IgG Fc region can be
eluted by another wash with a different stringency conditions.
Thus, it is possible to obtain a preparation of the polypeptide of
the present invention wherein the content of sialic acid is
increased compared to the normal content.
[0158] In addition, a person of average skill in the art will
appreciate that cell culture conditions can be manipulated to
change the sialylation content. For example, to increase the sialic
acid content, production rate is decreased and osmolality is
generally maintained within a lower margin suitable for the
particular host cell being cultured. Osmolality in the range from
about 250 mOsm to about 450 mOsm is appropriate for increased
sialic acid content. This and other suitable cell culture
conditions are described in, e.g., U.S. Pat. No. 6,656,466. Patel
et al., Biochem J, 285, 839-845 (1992) have reported that the
content of sialic acid in antibody linked sugar side chains differs
significantly if antibodies were produced as ascites or in
serum-free or serum containing culture media. Moreover, Kunkel et
al., Biotechnol. Prog., 16, 462-470 (2000) have shown that the use
of different bioreactors for cell growth and the amount of
dissolved oxygen in the medium influenced the amount of galactose
and sialic acid in antibody linked sugar moieties.
VII. PURIFICATION OF GLYCOENGINEERED BINDING PROTEINS
[0159] Also provided is a process for manufacturing a
glycoengineered binding composition of the invention by performing
additional purification. In an embodiment, a process for
manufacturing a composition of the invention is provided,
comprising the following steps: i) recombinantly expressing the
glycoengineered of interest in a host cell (e.g., a glycoengineered
CHO cell of the invention) and; ii) purifying the binding protein
of interest by subjecting a liquid containing said binding
composition to one or more chromatographic steps. The respective
manufacturing process leads to the production homogenous
glycoprotein compositions which are in particular suitable for use
in pharmaceutical formulations.
[0160] Accordingly, the compositions can be subjected to further
chromatographic purification including, for example, ion exchange
chromatography such anion exchange chromatography or cation
exchange chromatography. Additional chromatography steps may
include any of the following: a) reverse phase chromatography
(RPC); b) size exclusion chromatography (SEC); and c) hydrophobic
interaction chromatography (HIC); (d) affinity chromatography such
as dye affinity chromatography, immune affinity chromatography,
lectin affinity chromatography or perborate affinity
chromatography, (e) filtration such as diafiltration,
ultrafiltration or nanofiltration, and/or (f) at least one virus
inactivation step. In an exemplary embodiment the process of the
present invention includes an anion exchange chromatography (AEX)
as a chromatography step. In another embodiment, AEX chromatography
is performed subsequent to SEC chromatography and prior to HIC
chromatography. Additional steps may be performed in addition to
and also between the steps.
[0161] The purification methods may provide glycoengineered binding
protein compositions in high purity, which may then be formulated
as a pharmaceutical composition. For example, the purity may be
above 90% hypergalactosylated binding protein, preferably >95%
w/w, more preferably >99% w/w, even more preferably >99.5%
w/w, based on total protein. In exemplary embodiments, the level of
mannosylated species (e.g., M3-M9) is less than 10%, preferably
<5% w/w, more preferably <1% w/w, even more preferably
<0.5% w/w, based on total protein. In certain embodiments, the
glycoprotein composition comprises only trace amounts of
oligomannose glycoforms.
[0162] The binding protein compositions which form the starting
material for the purification process may be provided in or
obtained by recombinant techniques such as, e.g., in cell culture
harvests of glycoengineered host cells of the invention. Typically,
the starting material as obtained from a cell harvest, is clarified
first (e.g. by filtration) and then optionally concentrated (e.g.
by using ultrafiltration) and/or buffer exchanged (e.g. through a
diafiltration step) prior to being captured by the first
chromatographic step. In the steps of chromatography typically
commercially available resins are used, preferably polymer-based
resins or agarose-based resins. It is also possible to use membrane
chromatography in which the resin is replaced by a functionalized
membrane such as SARTOBIND.RTM. membranes (Sartorius) or
CHROMASORB.RTM. (Millipore).
Anion Exchange (AEX) Chromatography
[0163] In certain embodiments, the glycoengineered binding
compositions of the invention are subjected to an anion exchange
(AEX) chromatography step. The anion exchange chromatography is
usually performed by equilibrating and loading the column, followed
by a wash and subsequent elution. The anion exchange chromatography
is carried out, e.g., with a quaternary ammonium resin, such as
CAPTOQ.RTM. (obtainable from GE Healthcare), or a resin having
similar characteristics such as TOYOPEARL QEA.RTM. (obtainable from
Tosoh), or FRACTOGEL EMD.RTM., FRACTOGEL TMAE.RTM. or FRACTOGEL
HICAP.RTM. (obtainable from Merck KGaA, Darmstadt Germany). Other
exemplary anion exchange resins (i.e., the stationary phase)
include, but are not limited to, quaternary amine resins or
"Q-resins" (e.g., Q-Sepharose.RTM., QAE Sephadex.RTM.);
diethylaminoethane (DEAE) resins (e.g., DEAE-Trisacryl.RTM., DEAE
Sepharose.RTM., benzoylated naphthoylated DEAE, diethylaminoethyl
Sephacel.RTM.); Amberjet.RTM. resins; Amberlyst.RTM. resins;
Amberlite.RTM. resins (e.g., Amberlite.RTM. IRA-67, Amberlite.RTM.
strongly basic, Amberlite.RTM. weakly basic), cholestyramine resin,
ProPac.RTM. resins (e.g., ProPac.RTM. SAX-10, ProPac.RTM. WAX-10,
ProPac.RTM. WCX-10); TSK-GEL.RTM. resins (e.g., TSKgel DEAE-NPR;
TSKgel DEAE-5PW); and Acclaim.RTM. resins. In certain embodiments,
the anion exchange resin is a Q resin. In certain embodiments, the
anion exchange resin is a DEAE resin. In certain embodiments, the
DEAE resin is a TSK-GEL.RTM. DEAE resin.
[0164] Typical mobile phases for anionic exchange chromatography
include relatively polar solutions, such as water and polar organic
solvents (e.g., acetonitrile and organic alcohols such as methanol,
ethanol, and isopropanol). Thus, in certain embodiments, the mobile
phase comprises about 0%, 1%, 2%, 4%, 6%, 8%, 10%, 12%, 14%, 16%,
18%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or about 100% acetonitrile. In certain
embodiments, the mobile phase comprises between about 1% to about
100%, about 5% to about 95%, about 10% to about 90%, about 20% to
about 80%, about 30% to about 70%, or about 40% to about 60%
acetonitrile at any given time during the course of the
separation.
[0165] In certain embodiments, the mobile phase is buffered. In
certain embodiments, the mobile phase is not buffered. In certain
embodiments, the mobile phase is buffered to a pH between about 7
to about 14. In certain embodiments, the mobile phase is buffered
to a pH between about 7 to about 10. In certain embodiments, the
mobile phase is buffered to a pH between about 7 to about 8. In
certain embodiments, the mobile phase is buffered to a pH of about
7. Exemplary buffers for anion exchange chromatography are included
in Table 1.
[0166] The anion exchange chromatography resin may be equilibrated,
loaded and washed by using a buffer having a mildly alkaline pH,
e.g. at or about 7.2 to at or about 9.0. Suitable buffers include,
for example borate buffer, triethanolamine/iminodiacetic acid, Tris
(2-Amino-2-hydroxymethyl-propane-1,3-diol), sodium phosphate,
ammonium acetate, tricine (N-(Tri(hydroxymethyl)methyl)glycine),
bicine (2-(bis(2-hydroxyethyl)amino)ethanoic acid), TES, HEPES,
TAPS(N-Tris(hydroxymethyl)methyl-3-aminopropanesulfonic acid).
Elution from the ion-exchange resin is achieved by increasing the
conductivity of the mobile phase through the addition of salt,
preferably NaCl. Suitable buffers include, for example borate
buffer, triethanolamine/iminodiacetic acid Tris, ammonium acetate,
tricine, bicine, TES, HEPES, TAPS. Preferred is ammonium
acetate.
[0167] In certain exemplary embodiments, the anion exchange
chromatography can be utilized to selectively elute different
charged glycoforms mainly originating from different sialylation
levels. For the selective elution of differently charged
glycoforms, such as differently sialylated glycoforms, one may use
two or more, preferably two elution buffers A and B which differ in
pH and/or salt content, each of them being based on e.g. ammonium
acetate, borate buffer, triethanolamine/iminodiacetic acid, Tris,
sodium phosphate, ammonium acetate, tricine, bicine, TES, HEPES or
TAPS, preferred is ammonium acetate. Using different elution
buffers, elution can be performed in a stepwise fashion, first
using one elution buffer and then using the other elution buffer,
optionally also using one or more intermediate elution steps with
different mixtures of the elution buffers. Alternatively or
additionally, elution can be performed using a gradient, starting
with a first mixing ratio of the elution buffers (e.g. 100% of the
first elution buffer) and gradually changing to a second mixing
ratio of the elution buffers (e.g. 100% of the second elution
buffer). The elution buffer used first (buffer A) in general can be
a) a mildly acidic buffer which is salt-free, or b) a neutral or
mildly basic buffer with low salt content such as NaCl (preferably
between 20 and 200 mM). Buffer A can be used to elute glycoforms of
low charge, e.g., low degree of sialylation. In variant a) buffer A
has a pH e.g. at or about 3.0 to at or about 6.5, or at or about
4.0 to at or about 6.0, most preferably at or about 5. In variant
b) buffer A has a pH e.g. at or about 7.0 to 9.0, preferably 8.5.
The elution buffer used second (buffer B) in general is a
salt-containing mildly alkaline buffer of a higher salt content
than buffer A which can be used to elute glycoprotein of high
charge, e.g. high degree of sialylation. Buffer B has a pH e.g. at
or about 7.0 to at or about 9.0, or at or about 8.0 to at or about
9.0, most preferably at or about 8.5. The salt is preferably NaCl.
The salt content in buffer B is preferably from 200 mM to 1M. In
certain exemplary embodiments, buffer A is 10 mM sodium phosphate,
pH 7.5 and buffer B is 10 mM sodium phosphate/500 mM sodium
chloride, pH 5.5.
[0168] Using different elution buffers and a gradient or stepwise
elution, the different glycoforms loaded onto the anion exchange
chromatography column will elute in different fractions depending
on their charge. For example, the glycoprotein to be purified may
be present in the fractions of the flow-through, i.e. it binds to
the anion exchange chromatography column only weakly or not at all,
it may be eluted with the first elution buffer, at a specific
mixing ratio of the first and second elution buffer, or with the
second elution buffer. The glycoprotein fractions which are used
for the further purification steps and thus, the glycoforms which
are to be purified, mainly depend on the desired applications of
the glycoprotein. The other glycoforms which are not of interest
can be removed using the anion exchange chromatography step.
[0169] As an alternative or additionally to standard anion exchange
chromatography, chromatofocusing can be performed. Chromatofocusing
is a chromatography technique that separates glycoforms according
to differences in their isoelectric point (pI). In particular, a
charged stationary phase can be used and the proteins loaded onto
the chromatofocusing column can be eluted using a pH gradient. For
example, the stationary phase may be positively charged and the pH
gradient may develop from a first pH to a second, lower pH, for
example from about pH 9 to about pH 6 or from about pH 7 to about
pH 4. Due to the specific conditions of the chromatofocusing,
glycoforms elute in order of their isoelectric points and
preferably proteins of a specific pI are focused into narrow bands.
Thus, as glycoforms at a pH higher than their pI are negatively
charged and attach to the positively charged stationary phase,
thereby being slowed down. When the pH in the elution gradient
reaches the pI of the glycoform, it is overall neutral in charge
and thus migrates with the flow of the mobile phase. At a pH lower
than the pI of the protein, the glycoform is repulsed by the
stationary phase due to its positive charge, thus accelerating it.
Thereby glycoforms at the rear of a zone will migrate more rapidly
than those at the front. In this setting, the glycoform with the
highest pI elutes first and the glycoform with the lowest pI will
elute last.
[0170] Suitable stationary phases are, for example, media
substituted with charged, buffering amines such as MONO P
(obtainable from GE Healthcare) or other anion exchange
chromatography material. For forming the pH gradient for elution,
suitable buffing systems such as POLYBUFFER 74.RTM. or POLYBUFFER
76.RTM. (obtainable from GE Healthcare) can be used. Equilibration,
loading and washing of the column can be done using any condition
where the glycoprotein of interest and/or any impurities bind to
the column material. For example, conditions as described above for
the anion exchange chromatography can be used.
[0171] When using a decreasing pH gradient, preferably a buffer
having a pH equal to or higher than the starting pH of the elution
gradient is used for equilibration, loading and/or washing. When
using an increasing pH gradient, preferably a buffer having a pH
equal to or lower than the starting pH of the elution gradient is
used for equilibration, loading and/or washing.
Reverse Phase Chromatography
[0172] Reverse phase chromatography refers to a chromatography step
wherein a non-polar stationary phase and preferably a polar mobile
phase are used. In reverse phase chromatography, normally polar
compounds are eluted first while non-polar compounds are retained.
The reverse phase chromatography is usually performed by
equilibrating and loading the column, followed by a wash and
subsequent elution, each with a buffer preferably containing an
organic solvent such as acetonitrile or isopropanol. The organic
solvent such as isopropanol can be used for virus inactivation
subsequent to elution. Preferably the organic solvent is a water
miscible organic solvent such as acetonitrile or an alcohol (such
as methanol, ethanol, etc./). Reversed phase column material is
made of a resin to which a hydrophobic material may be attached.
Typical column materials are silica and polystyrene; hydrophobic
ligands may optionally be attached. In case of substituted resins,
the resin is substituted with a hydrophobic ligand, typically
selected from (but not limited to) aliphates, such as C.sub.2,
C.sub.4, C.sub.6, C.sub.8, C.sub.10, C.sub.12, C.sub.14, C.sub.16,
or C.sub.18 or derivatives of these, e.g. cyanopropyl (CN-propyl),
or branched aliphates, or benzene-based aromates, such as phenyl,
or other polar or non-polar ligands. The ligand may be a mixture of
two or more of these ligands. Suitable polystyrene based resins
include, without limitation, resins supplied by Rohm Haas (e.g.
Amberlite XAD.RTM. or Amberchrom CG.RTM.), Polymer Labs (e.g.
PLRP-S.RTM.), GE Healthcare (e.g. Source RPC.RTM.), Applied
Biosystems (e.g. Poros R.RTM.). A particularly preferred resin is
Source 30 RPC.RTM. (GE Healthcare).
Viral Inactivation
[0173] In certain embodiments, the purification process can include
a virus inactivation step. Virus inactivation may be achieved by
incubating the protein loaded onto, bound to or eluted from the
column in the presence of an organic solvent, preferably
isopropanol or ethanol. The incubation time and incubation
temperature preferably are chosen so as to affect a desired degree
of virus inactivation and in particular depend on the concentration
and nature of the organic solvent used. Furthermore, these
parameters should also be adjusted depending on the stability of
the binding protein composition to be purified. For example, the
protein is incubated for at least 15 min, preferably for at least
30 min, at least 45 min, at least 1 h, at least 2 h, at least 3 h
or at least 6 h. The incubation can be performed at low temperature
such as at or below 4.degree. C. or at or below 10.degree. C., or
it can be performed at about room temperature. The incubation can
be performed directly after the sample has been loaded onto the
column, during or after the washing step, after applying the
elution buffer but prior to elution of the glycoprotein, or after
elution of the binding protein. If isopropanol is used as the
organic solvent, virus inactivation is preferably done at an
isopropanol concentration of at least 15% (v/v), preferably at
about 18% (v/v). In this case, the binding protein is preferably
incubated for about 2 h, preferably at room temperature.
Preferably, the virus inactivation is performed after elution of
the glycoprotein from the reverse phase chromatography column,
preferably in the elution buffer used. However, optionally further
components may be added to the glycoprotein solution after elution
from the column, in particular for enhancing the virus inactivation
and/or the binding protein stability.
Size Exclusion Chromatography
[0174] The purification process may include a step of size
exclusion chromatography, e.g. for further purifying and/or
re-buffering of the binding protein composition. Size exclusion
chromatography comprises the step of equilibrating and loading the
eluate of the previous chromatography step to a gel filtration
matrix equilibrated with a buffer having a composition which is
desired for storage or further processing of the glycoprotein at a
pH of typically between 6.5 and 9. For performing size exclusion
chromatography, the gel is typically selected from the groups of
polymeric gels including, but not limited to dextra-based gels such
as SEPHADEX.RTM. (e.g. SEPHADEX G-25.RTM.) or polyacrylamide gels
such as SEPHACRYL.RTM. (e.g. SEPHACRYL-5400.RTM.), agarose-based
gels such as SUPEROSE.RTM. or SEPHAROSE.RTM. (e.g. SEPHAROSE
CL-4B.RTM.), and composite gels prepared from two kinds of gels
such as SUPERDEX 200.RTM. combining DEXTRAN.RTM. (SEPHADEX.RTM.)
and crosslinked Agarose (SUPEROSE.RTM.) gels. Buffers may be
selected from the group consisting sodium phosphate, ammonium
acetate, MES (2-(N-morpholino)ethanesulfonic acid), Bis-Tris
(2-bis(2-hydroxyethyl)amino-2-(hydroxymethyl)-1,3-propanediol), ADA
(N-(2-Acetamido) iminodiacetic acid), PIPES
(piperazine-N,N'-bis(2-ethanesulfonic acid), ACES
(N-(2-Acetamido)-2-aminoethanesulfonic acid), BES
(N,N-Bis(2-hydroxyethyl)-2-aminoethane-sulfonic acid), MOPS
(3-(N-morpholino) propanesulfonic acid), TES
(N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid), HEPES
(N-2-Hydroxyethyl-piperazine-N-2-ethanesulfonic acid), sodium
phosphate or ammonium acetate. Said buffer may additionally
comprise an inorganic salt, e.g., a halide of an alkaline metal,
e.g., potassium chloride or sodium chloride and/or an antioxidant,
such as L-methionine, t-butyl-4-methoxyphenol,
2,6-bis(1,1-dimethylethyl)-4-methyl phenol; potassium or sodium
bimetabisulfite, sodium bisulfite. The size exclusion
chromatography may further comprise the step of eluting the binding
protein from said gel filtration matrix by isocratic elution, i.e.
the elution buffer has about the same, preferably the same
composition as the buffer used for equilibration and/or loading.
The flow through may be recorded by UV absorption at 280 nm and the
fraction containing the glycoprotein is collected.
Hydrophobic Interaction Chromatography (HIC)
[0175] HIC is a separation method that takes advantage of the
hydrophobic properties of the proteins. The adsorption is promoted
by the hydrophobic interactions between non-polar regions on the
protein and immobilized hydrophobic ligands on a solid support.
Adsorption is achieved at high salt concentrations in the aqueous
mobile phase and elution is facilitated by decreasing the salt
concentration. The hydrophobic interaction chromatography material
is a matrix substituted with hydrophobic ligands such as ethyl-,
butyl-, phenyl- or hexyl-groups. Preferred material is a matrix
substituted with a butyl or a phenyl ligand. Hydrophobic
Interaction Chromatography (HIC) resins are known in the art and
include resins such as BUTYL SEPHAROSE.RTM. (GE Healthcare), PHENYL
SEPHAROSE.RTM. (low and high substitution), OCTYL SEPHAROSE.RTM.
and ALKYL SEPHAROSE.RTM. (all of GE Healthcare; other sources of
HIC resins include Biosepra, France; E. Merck, Germany; BioRad
USA). Alternative resins that may be used are as follows: TOYOPEARL
BUTYL 650M.RTM. (obtainable from Tosoh Biosep Inc.), PHENYL
SEPHAROSE 6 FAST FLOW.RTM. (low sub); PHENYL SEPHAROSE 6 FAST
FLOW.RTM. (high sub); BUTYL SEPAROSE 4 FAST FLOW.RTM. OCTYL
SEPHAROSE 4 FAST FLOW.RTM. PHENYL SEPHAROSE HIGH PERFORMANCE.RTM.
SOURCE 15ETH.RTM.; SOURCE 15ISO.RTM.; SOURCE 15PHE.RTM. all from GE
Biosciences (800) 526-3593. Still further resins are:
HYDROCELL.RTM. C3 or C4; HYDROCELL PHENYL.RTM. from BioChrom Labs
Inc. (812) 234-2558. Equilibration, loading, wash and elution
buffers may be selected from the group consisting of sodium
phosphate, MES, Bis-Tris, ADA, PIPES, ACES, BES, MOPS, TES, HEPES.
Binding on the HIC resin is in general achieved by using an
equilibration and loading buffer with a high conductivity, obtained
e.g. through the addition of salt such as NaCl, (NH4)2504 or
Na2SO4, preferably ammonium sulfate. Exemplary salt concentrations
are 1 to 2M. The wash generally uses the loading buffer. Elution in
the step of hydrophobic interaction chromatography is preferably
carried out by reducing the conductivity of the mobile phase
(reducing salt concentration). The reduction can be achieved in a
linear way or step-wise.
Other Purification Steps
[0176] Prior to the first chromatography step, it may be desirable
to carry out a step of ultrafiltration, in order to concentrate the
crude binding protein. Furthermore, additionally a step of
diafiltration may be performed prior to the first chromatography
step in order to perform a buffer exchange. The ultrafiltration
step and the diafiltration step may be performed simultaneously or
sequentially. The ultrafiltration and/or diafiltration is
preferably carried out using a membrane having a cut-off of at or
about 3-30 kD, most preferably at or about 10 kD. It is preferred
to perform during ultrafiltration and/or diafiltration a buffer
exchange to a pre-formulation buffer, e.g. selected from the group
consisting of sodium phosphate, sodium citrate, MES, Bis-Tris, ADA,
PIPES, ACES, BES, MOPS, TES, HEPES, preferably sodium phosphate,
preferably sodium-phosphate containing stabilizers e.g. sucrose and
antioxidants like L-methionine. The pH preferably is in the range
of 6.5 to 7.5, more preferably about 7.0 to 7.1.
[0177] Further optional steps which can be performed in the
purification process according to the invention include one or more
sterile filtration steps. These steps can be used to remove
biological contaminations such as eukaryotic and/or prokaryotic
cells, in particular bacteria, and/or viruses. Preferably, these
steps are performed at or near the end of the purification process
to prevent a further contamination after the sterile filtration
step. For removal of bacteria or other cells, the filter used for
sterile filtration preferably has a pore size of 0.22 .mu.m or
less, preferably 0.1 .mu.m or less. For removal of viruses or
virus-like particles, a nanofiltration step may also be
performed.
Storage/Lyophilisation
[0178] The binding protein composition resulting from the
purification process as described above and containing purified
glycoprotein may be frozen for storage as is, or after
purification, the eluate may be subjected to lyophilisation
("freeze-drying") to remove solvent.
VIII. PHARMACEUTICAL COMPOSITIONS
[0179] In one aspect, pharmaceutical compositions comprising one or
more population of binding proteins, either alone or in combination
with prophylactic agents, therapeutic agents, and/or
pharmaceutically acceptable carriers are provided. The
pharmaceutical compositions provided herein are for use in, but not
limited to, diagnosing, detecting, or monitoring a disorder, in
preventing, treating, managing, or ameliorating a disorder or one
or more symptoms thereof, and/or in research. The formulation of
pharmaceutical compositions, either alone or in combination with
prophylactic agents, therapeutic agents, and/or pharmaceutically
acceptable carriers, is known to one skilled in the art (US Patent
Publication No. 20090311253 A1).
[0180] In another aspect, the pharmaceutical composition is
formulated together, or co-administered with, at least one
additional agent. For example, the additional agent may be selected
from the group consisting of: therapeutic agent, imaging agent,
cytotoxic agent, angiogenesis inhibitors; kinase inhibitors;
co-stimulation molecule blockers; adhesion molecule blockers;
anti-cytokine antibody or functional fragment thereof; detectable
label or reporter; a TNF antagonist; an anti-rheumatic; a muscle
relaxant, a narcotic, a non-steroid anti-inflammatory drug (NSAID),
an analgesic, an anesthetic, a sedative, a local anesthetic, a
neuromuscular blocker, an antimicrobial, an antipsoriatic, a
corticosteriod, an anabolic steroid, an erythropoietin, an
immunoglobulin, an immunosuppressive, a growth hormone, a hormone
replacement drug, a radiopharmaceutical, an antidepressant, an
antipsychotic, a stimulant, an asthma medication, a beta agonist,
an inhaled steroid, an oral steroid, an epinephrine or analog, a
cytokine, and a cytokine antagonist.
[0181] In certain exemplary embodiments, the binding protein
compositions of the invention are formulated together with, or
co-administered with, an immunosuppressive or anergy-inducing
agent. Exemplary such agents include Rapamycin (also known as
Sirolimus) or analogs thereof, e.g., CCI-779, or FK-506 (also known
as Tacrolimus) or analogs thereof. The agents may be formulated in
a nanoparticle (e.g., a polymeric nanoparticle), optionally
together with the binding protein composition. Biocompatible
materials useful for making the nanoparticles include, but are not
limited to, bio-degradable polymeric materials including, but not
limited to, hydrogel, collagen, alginate, poly(glycolide) (PGA),
poly(L-lactide) (PLA), poly(lactide-co-glycolide) (PLGA),
polyethylene glycol (PEG), polyesters, polyanhydrides,
polyorthoesters, polyamides; non-polymeric biodegradable ceramic
materials including, but not limited to, calcium phosphate,
hydroxyapatite, tricalcium phosphate; or a combination thereof. In
a preferred embodiment, the nanoparticles are fabricated from
poly(lactic-co-glycolic acid) (PLGA), which is FDA approved for
delivery of therapeutics. In certain embodiments, the nanoparticles
have a diameter ranging from 10-1000 nm, or any values
therebetween, such as 50-900 nm, 100-800 nm, 200-500 nm, 300-400
nm, etc. In preferred embodiments, the nanoparticles have a
diameter from 300 nm to 500 nm, or any values therebetween, such as
300-450 nm, 300-400 nm, 330-480 nm, 350-450 nm, 350-400 nm, etc.
Exemplary immunosupressant-containing nanoparticles are described
in WO2012149255 and WO2012149259, the contents of each of which are
hereby incorporated by reference in their entirety. Methods of
making and administering immunosupressant-containing nanoparticle
compositions are known in the art (see e.g., Das et al, J Biomed
Mater Res A. 2008 Mar. 15; 84(4):885-98, and Haddadi et al., J
Biomed Mater Res A. 2008 Jun. 15; 85(4):983-92, the contents of
each of which are hereby incorporated by reference in their
entirety).
[0182] Methods of administering a prophylactic or therapeutic agent
provided herein include, but are not limited to, parenteral
administration (e.g., intradermal, intramuscular, intraperitoneal,
intravenous and subcutaneous), epidural administration,
intratumoral administration, mucosal administration (e.g.,
intranasal and oral routes) and pulmonary administration (e.g.,
aerosolized compounds administered with an inhaler or nebulizer).
The formulation of pharmaceutical compositions for specific routes
of administration, and the materials and techniques necessary for
the various methods of administration are available and known to
one skilled in the art (US Patent Publication No. 20090311253
A1).
[0183] Dosage regimens may be adjusted to provide the optimum
desired response (e.g., a therapeutic or prophylactic response).
For example, a single bolus may be administered, several divided
doses may be administered over time or the dose may be
proportionally reduced or increased as indicated by the exigencies
of the therapeutic situation. It is especially advantageous to
formulate parenteral compositions in dosage unit form for ease of
administration and uniformity of dosage. The term "dosage unit
form" refers to physically discrete units suited as unitary dosages
for the mammalian subjects to be treated; each unit containing a
predetermined quantity of active compound calculated to produce the
desired therapeutic effect in association with the required
pharmaceutical carrier. The specification for the dosage unit forms
provided herein are dictated by and directly dependent on (a) the
unique characteristics of the active compound and the particular
therapeutic or prophylactic effect to be achieved, and (b) the
limitations inherent in the art of compounding such an active
compound for the treatment of sensitivity in individuals.
[0184] An exemplary, non-limiting range for a therapeutically or
prophylactically effective amount of a binding protein provided
herein is 0.1-20 mg/kg, for example, 1-10 mg/kg. It is to be noted
that dosage values may vary with the type and severity of the
condition to be alleviated. It is to be further understood that for
any particular subject, specific dosage regimens may be adjusted
over time according to the individual need and the professional
judgment of the person administering or supervising the
administration of the compositions, and that dosage ranges set
forth herein are exemplary only and are not intended to limit the
scope or practice of the claimed composition.
IX. METHODS OF TREATMENT USING TNF BINDING MOLECULES
[0185] In one aspect, provided herein are methods of treating a
TNF-associated disorder in a subject by administering to the
individual in need of such treatment a therapeutically effective
amount of a composition comprising a glycoengineered population of
TNF binding proteins disclosed herein. Such methods can be used to
treat any TNF-associated disorder including, without
limitation:
[0186] 1) Sepsis
[0187] Tumor necrosis factor has an established role in the
pathophysiology of sepsis, with biological effects that include
hypotension, myocardial suppression, vascular leakage syndrome,
organ necrosis, stimulation of the release of toxic secondary
mediators and activation of the clotting cascade (see e.g.,
Moeller, A., et al. (1990) Cytokine 2:162-169; U.S. Pat. No.
5,231,024 to Moeller et al.; European Patent Publication No. 260
610 B1 by Moeller, A.; Tracey, K. J. and Cerami, A. (1994) Annu.
Rev. Med. 45:491-503; Russell, D and Thompson, R. C. (1993) Curr.
Opin. Biotech. 4:714-721). Accordingly, a TNF binding proteins of
the invention can be used to treat sepsis in any of its clinical
settings, including septic shock, endotoxic shock, gram negative
sepsis and toxic shock syndrome.
[0188] Furthermore, to treat sepsis, a combination of the invention
can be coadministered with one or more additional therapeutic
agents that may further alleviate sepsis, such as an interleukin-1
inhibitor (such as those described in PCT Publication Nos. WO
92/16221 and WO 92/17583), the cytokine interleukin-6 (see e.g.,
PCT Publication No. WO 93/11793) or an antagonist of platelet
activating factor (see e.g., European Patent Application
Publication No. EP 374 510). Other combination therapies for the
treatment of sepsis are discussed further in herein.
[0189] Additionally, in certain embodiments, a TNF binding proteins
of the invention is administered to a human subject within a
subgroup of sepsis patients having a serum or plasma concentration
of IL-6 above 500 pg/ml (e.g., above 1000 pg/ml) at the time of
treatment (see PCT Publication No. WO 95/20978 by Daum, L., et
al.).
[0190] 2) Autoimmune Diseases
[0191] Tumor necrosis factor has been implicated in playing a role
in the pathophysiology of a variety of autoimmune diseases. For
example, TNF-alpha has been implicated in activating tissue
inflammation and causing joint destruction in rheumatoid arthritis
(see e.g., Moeller, A., et al. (1990) Cytokine 2:162-169; U.S. Pat.
No. 5,231,024 to Moeller et al.; European Patent Publication No.
260 610 B1 by Moeller, A.; Tracey and Cerami, supra; Arend, W. P.
and Dayer, J-M. (1995) Arth. Rheum. 38:151-160; Fava, R. A., et al.
(1993) Clin. Exp. Immunol. 94:261266). TNF-alpha also has been
implicated in promoting the death of islet cells and in mediating
insulin resistance in diabetes (see e.g., Tracey and Cerami, supra;
PCT Publication No. WO 94/08609). TNF-alpha also has been
implicated in mediating cytotoxicity to oligodendrocytes and
induction of inflammatory plaques in multiple sclerosis (see e.g.,
Tracey and Cerami, supra) Chimeric and humanized murine
anti-hTNF-alpha antibodies have undergone clinical testing for
treatment of rheumatoid arthritis (see e.g., Elliott, M. J., et al.
(1994) Lancet 344:1125-1127; Elliot, M. J., et al. (1994) Lancet
344:1105-1110; Rankin, E. C., et al. (1995) Br. J. Rheumatol.
34:334-342).
[0192] Compositions of the invention can be used to treat
autoimmune diseases, in particular those associated with
inflammation, including rheumatoid arthritis, rheumatoid
spondylitis, osteoarthritis and gouty arthritis, allergy, multiple
sclerosis, autoimmune diabetes, autoimmune uveitis and nephrotic
syndrome. Typically, the combination is administered systemically,
although for certain disorders, local administration of the
anti-TNF and/or JAK inhibitor at a site of inflammation may be
beneficial (e.g., local administration in the joints in rheumatoid
arthritis or topical application to diabetic ulcers, alone or in
combination with a cyclohexane-ylidene derivative as described in
PCT Publication No. WO 93/19751). Compositions of the invention
also can be administered with one or more additional therapeutic
agents useful in the treatment of autoimmune diseases, as discussed
further herein.
[0193] 3) Infectious Diseases
[0194] Tumor necrosis factor has been implicated in mediating
biological effects observed in a variety of infectious diseases.
For example, TNF-alpha has been implicated in mediating brain
inflammation and capillary thrombosis and infarction in malaria.
TNF-alpha also has been implicated in mediating brain inflammation,
inducing breakdown of the blood-brain bather, triggering septic
shock syndrome and activating venous infarction in meningitis.
TNF-alpha also has been implicated in inducing cachexia,
stimulating viral proliferation and mediating central nervous
system injury in acquired immune deficiency syndrome (AIDS).
Accordingly, the compositions of the invention, can be used in the
treatment of infectious diseases, including bacterial meningitis
(see e.g., European Patent Application Publication No. EP 585 705),
cerebral malaria, AIDS and AIDS-related complex (ARC) (see e.g.,
European Patent Application Publication No. EP 230 574), as well as
cytomegalovirus infection secondary to transplantation (see e.g.,
Fietze, E., et al. (1994) Transplantation 58:675-680). Compositions
of the invention, also can be used to alleviate symptoms associated
with infectious diseases, including fever and myalgias due to
infection (such as influenza) and cachexia secondary to infection
(e.g., secondary to AIDS or ARC).
[0195] 4) Transplantation
[0196] Tumor necrosis factor has been implicated as a key mediator
of allograft rejection and graft versus host disease (GVHD) and in
mediating an adverse reaction that has been observed when the rat
antibody OKT3, directed against the T cell receptor CD3 complex, is
used to inhibit rejection of renal transplants (see e.g., Eason, J.
D., et al. (1995) Transplantation 59:300-305; Suthanthiran, M. and
Strom, T. B. (1994) New Engl. J. Med. 331:365-375). Accordingly,
compositions of the invention, can be used to inhibit transplant
rejection, including rejections of allografts and xenografts and to
inhibit GVHD. Although the combination may be used alone, it can be
used in combination with one or more other agents that inhibit the
immune response against the allograft or inhibit GVHD. For example,
in one embodiment, a TNF binding protein is used in combination
with OKT3 to inhibit OKT3-induced reactions. In another embodiment,
a TNF binding protein is used in combination with one or more
antibodies directed at other targets involved in regulating immune
responses, such as the cell surface molecules CD25 (interleukin-2
receptor-.alpha.), CD11a (LFA-1), CD54 (ICAM-1), CD4, CD45,
CD28/CTLA4, CD80 (B7-1) and/or CD86 (B7-2). In yet another
embodiment, a TNF binding protein of the invention is used in
combination with one or more general immunosuppressive agents, such
as cyclosporin A or FK506.
[0197] 5) Malignancy
[0198] Tumor necrosis factor has been implicated in inducing
cachexia, stimulating tumor growth, enhancing metastatic potential
and mediating cytotoxicity in malignancies. Accordingly, a TNF
binding protein of the invention can be used in the treatment of
malignancies, to inhibit tumor growth or metastasis and/or to
alleviate cachexia secondary to malignancy. The compositions may be
administered systemically or locally to the tumor site.
[0199] 6) Pulmonary Disorders
[0200] Tumor necrosis factor has been implicated in the
pathophysiology of adult respiratory distress syndrome (ARDS),
including stimulating leukocyte-endothelial activation, directing
cytotoxicity to pneumocytes and inducing vascular leakage syndrome.
Accordingly, a TNF binding protein of the invention, can be used to
treat various pulmonary disorders, including adult respiratory
distress syndrome (see e.g., PCT Publication No. WO 91/04054),
shock lung, chronic pulmonary inflammatory disease, pulmonary
sarcoidosis, pulmonary fibrosis and silicosis. The compositions may
be administered systemically or locally to the lung surface, for
example as an aerosol. A composition of the invention also can be
administered with one or more additional therapeutic agents useful
in the treatment of pulmonary disorders, as discussed further in
herein.
[0201] 7) Intestinal Disorders
[0202] Tumor necrosis factor has been implicated in the
pathophysiology of inflammatory bowel disorders (see e.g., Tracy,
K. J., et al. (1986) Science 234:470-474; Sun, X-M., et al. (1988)
J. Clin. Invest. 81:1328-1331; MacDonald, T. T., et al. (1990)
Clin. Exp. Immunol. 81:301-305) Chimeric murine anti-hTNF-alpha
antibodies have undergone clinical testing for treatment of Crohn's
disease (van Dullemen, H. M., et al. (1995) Gastroenterology
109:129-135). The compositions of the invention, also can be used
to treat intestinal disorders, such as idiopathic inflammatory
bowel disease, which includes two syndromes, Crohn's disease and
ulcerative colitis. A composition of the invention also can be
administered with one or more additional therapeutic agents useful
in the treatment of intestinal disorders, as discussed further in
herein.
[0203] 8) Cardiac Disorders
[0204] The compositions of the invention, also can be used to treat
various cardiac disorders, including ischemia of the heart (see
e.g., European Patent Application Publication No. EP 453 898) and
heart insufficiency (weakness of the heart muscle) (see e.g., PCT
Publication No. WO 94/20139).
[0205] 9) Other Disorders
[0206] The compositions of the invention, also can be used to treat
various other disorders in which TNF-alpha activity is detrimental.
Examples of other diseases and disorders in which TNF-alpha
activity has been implicated in the pathophysiology, and thus which
can be treated using a TNF binding protein of the invention,
include inflammatory bone disorders and bone resorption disease
(see e.g., Bertolini, D. R., et al. (1986) Nature 319:516-518;
Konig, A., et al. (1988) J. Bone Miner. Res. 3:621-627; Lerner, U.
H. and Ohlin, A. (1993) J. Bone Miner. Res. 8:147-155; and Shankar,
G. and Stern, P. H. (1993) Bone 14:871-876); hepatitis, including
alcoholic hepatitis (see e.g., McClain, C. J. and Cohen, D. A.
(1989) Hepatology 9:349-351; Felver, M. E., et al. (1990) Alcohol.
Clin. Exp. Res. 14:255-259; and Hansen, J., et al. (1994)
Hepatology 20:461-474), viral hepatitis (Sheron, N., et al. (1991)
J. Hepatol. 12:241-245; and Hussain, M. J., et al. (1994) J. Clin.
Pathol. 47:1112-1115), and fulminant hepatitis; coagulation
disturbances (see e.g., van der Poll, T., et al. (1990) N. Engl. J.
Med. 322:1622-1627; and van der Poll, T., et al. (1991) Prog. Clin.
Biol. Res. 367:55-60); burns (see e.g., Giroir, B. P., et al.
(1994) Am. J. Physiol. 267:H118-124; and Liu, X. S., et al. (1994)
Burns 20:40-44); reperfusion injury (see e.g., Scales, W. E., et
al. (1994) Am. J. Physiol. 267:G1122-1127; Serrick, C., et al.
(1994) Transplantation 58:1158-1162; and Yao, Y. M., et al. (1995)
Resuscitation 29:157-168); keloid formation (see e.g., McCauley, R.
L., et al. (1992) J. Clin. Immunol. 12:300-308), scar tissue
formation; pyrexia; periodontal disease; obesity; and radiation
toxicity.
[0207] In certain embodiments, an compositions of the invention is
used for the treatment of a TNF-associated disorder selected from
the group consisting of osteoarthritis, rheumatoid arthritis,
juvenile chronic arthritis, septic arthritis, Lyme arthritis,
psoriatic arthritis, reactive arthritis, spondyloarthropathy,
systemic lupus erythematosus, Crohn's disease, ulcerative colitis,
inflammatory bowel disease, insulin dependent diabetes mellitus,
thyroiditis, asthma, allergic diseases, psoriasis, dermatitis,
scleroderma, graft versus host disease, organ transplant rejection,
acute or chronic immune disease associated with organ
transplantation, sarcoidosis, atherosclerosis, disseminated
intravascular coagulation, Kawasaki's disease, Grave's disease,
nephrotic syndrome, chronic fatigue syndrome, Wegener's
granulomatosis, Henoch-Schoenlein purpurea, microscopic vasculitis
of the kidneys, chronic active hepatitis, uveitis, septic shock,
toxic shock syndrome, sepsis syndrome, cachexia, infectious
diseases, parasitic diseases, acute transverse myelitis,
Huntington's chorea, Parkinson's disease, Alzheimer's disease,
stroke, primary biliary cirrhosis, hemolytic anemia, malignancies,
heart failure, myocardial infarction, Addison's disease, sporadic
polyglandular deficiency type I, polyglandular deficiency type II
(Schmidt's syndrome), adult (acute) respiratory distress syndrome,
alopecia, alopecia greata, seronegative arthropathy, arthropathy,
Reiter's disease, psoriatic arthropathy, ulcerative colitic
arthropathy, enteropathic synovitis, Chlamydia-associated
arthropathy, Yersinia-associated arthropathy, Salmonella-associated
arthropathy, spondyloarthropathy, atheromatous
disease/arteriosclerosis, atopic allergy, autoimmune bullous
disease, pemphigus vulgaris, pemphigus foliaceus, pemphigoid,
linear IgA disease, autoimmune haemolytic anaemia, Coombs positive
haemolytic anaemia, acquired pernicious anaemia, juvenile
pernicious anaemia, myalgic encephalitis/Royal Free disease,
chronic mucocutaneous candidiasis, giant cell arteritis, primary
sclerosing hepatitis, cryptogenic autoimmune hepatitis, acquired
immunodeficiency syndrome, acquired immunodeficiency related
diseases, hepatitis B, hepatitis C, common varied immunodeficiency
(common variable hypogammaglobulinaemia), dilated cardiomyopathy,
female infertility, ovarian failure, premature ovarian failure,
fibrotic lung disease, cryptogenic fibrosing alveolitis,
post-inflammatory interstitial lung disease, interstitial
pneumonitis, connective tissue disease associated interstitial lung
disease, mixed connective tissue disease associated lung disease,
systemic sclerosis associated interstitial lung disease, rheumatoid
arthritis associated interstitial lung disease, systemic lupus
erythematosus associated lung disease, dermatomyositis/polymyositis
associated lung disease, Sjogren's disease associated lung disease,
ankylosing spondylitis associated lung disease, vasculitic diffuse
lung disease, haemosiderosis associated lung disease, drug-induced
interstitial lung disease, fibrosis, radiation fibrosis,
bronchiolitis obliterans, chronic eosinophilic pneumonia,
lymphocytic infiltrative lung disease, postinfectious interstitial
lung disease, gouty arthritis, autoimmune hepatitis, type-1
autoimmune hepatitis (classical autoimmune or lupoid hepatitis),
type-2 autoimmune hepatitis (anti-LKM antibody hepatitis),
autoimmune mediated hypoglycemia, type B insulin resistance with
acanthosis nigricans, hypoparathyroidism, acute immune disease
associated with organ transplantation, chronic immune disease
associated with organ transplantation, osteoarthrosis, primary
sclerosing cholangitis, psoriasis type 1, psoriasis type 2,
idiopathic leucopaenia, autoimmune neutropaenia, renal disease NOS,
glomerulonephritides, microscopic vasculitis of the kidneys, Lyme
disease, discoid lupus erythematosus, male infertility idiopathic
or NOS, sperm autoimmunity, multiple sclerosis (all subtypes),
sympathetic ophthalmia, pulmonary hypertension secondary to
connective tissue disease, Goodpasture's syndrome, pulmonary
manifestation of polyarteritis nodosa, acute rheumatic fever,
rheumatoid spondylitis, Still's disease, systemic sclerosis,
Sjorgren's syndrome, Takayasu's disease/arteritis, autoimmune
thrombocytopaenia, idiopathic thrombocytopaenia, autoimmune thyroid
disease, hyperthyroidism, goitrous autoimmune hypothyroidism
(Hashimoto's disease), atrophic autoimmune hypothyroidism, primary
myxoedema, phacogenic uveitis, primary vasculitis, vitiligo, acute
liver disease, chronic liver diseases, alcoholic cirrhosis,
alcohol-induced liver injury, cholestasis, idiosyncratic liver
disease, drug-induced hepatitis, non-alcoholic steatohepatitis,
allergy, group B streptococci (GBS) infection, mental disorders
(e.g., depression and schizophrenia), Th2 Type and Th1 Type
mediated diseases, acute and chronic pain (different forms of
pain), cancers such as lung, breast, stomach, bladder, colon,
pancreas, ovarian, prostate and rectal cancer and hematopoietic
malignancies (leukemia and lymphoma), abetalipoproteinemia,
acrocyanosis, acute and chronic parasitic or infectious processes,
acute leukemia, acute lymphoblastic leukemia (ALL), acute myeloid
leukemia (AML), acute or chronic bacterial infection, acute
pancreatitis, acute renal failure, adenocarcinomas, atrial ectopic
beats, AIDS dementia complex, alcohol-induced hepatitis, allergic
conjunctivitis, allergic contact dermatitis, allergic rhinitis,
allograft rejection, alpha-1-antitrypsin deficiency, amyotrophic
lateral sclerosis, anemia, angina pectoris, anterior horn cell
degeneration, antiphospholipid syndrome, anti-receptor
hypersensitivity reactions, aortic and peripheral aneurysms, aortic
dissection, arterial hypertension, arteriosclerosis, arteriovenous
fistula, ataxia, atrial fibrillation (sustained or paroxysmal),
atrial flutter, atrioventricular block, B cell lymphoma, bone graft
rejection, bone marrow transplant (BMT) rejection, bundle branch
block, Burkitt's lymphoma, burns, cardiac arrhythmias, cardiac stun
syndrome, cardiac tumors, cardiomyopathy, cardiopulmonary bypass
inflammation response, cartilage transplant rejection, cerebellar
cortical degenerations, cerebellar disorders, chaotic or multifocal
atrial tachycardia, chemotherapy associated disorders, chronic
myelocytic leukemia (CML), chronic alcoholism, chronic inflammatory
pathologies, chronic lymphocytic leukemia (CLL), chronic
obstructive pulmonary disease (COPD), chronic salicylate
intoxication, colorectal carcinoma, congestive heart failure,
conjunctivitis, contact dermatitis, cor pulmonale, coronary artery
disease, Creutzfeldt-Jakob disease, culture negative sepsis, cystic
fibrosis, cytokine therapy associated disorders, dementia
pugilistica, demyelinating diseases, dengue hemorrhagic fever,
dermatitis, dermatologic conditions, diabetes, diabetic
arteriosclerotic disease, diffuse Lewy body disease, dilated
congestive cardiomyopathy, disorders of the basal ganglia, Down's
syndrome in middle age, drug-induced movement disorders induced by
drugs which block CNS dopamine receptors, drug sensitivity, eczema,
encephalomyelitis, endocarditis, endocrinopathy, epiglottitis,
Epstein-Barr virus infection, erythromelalgia, extrapyramidal and
cerebellar disorders, familial hemophagocytic lymphohistiocytosis,
fetal thymus implant rejection, Friedreich's ataxia, functional
peripheral arterial disorders, fungal sepsis, gas gangrene, gastric
ulcer, glomerular nephritis, graft rejection of any organ or
tissue, gram negative sepsis, gram positive sepsis, granulomas due
to intracellular organisms, hairy cell leukemia, Hallervorden-Spatz
disease, Hashimoto's thyroiditis, hay fever, heart transplant
rejection, hemochromatosis, hemodialysis, hemolytic uremic
syndrome/thrombolytic thrombocytopenic purpura, hemorrhage,
hepatitis A, His bundle arrhythmias, HIV infection/HIV neuropathy,
Hodgkin's disease, hyperkinetic movement disorders,
hypersensitivity reactions, hypersensitivity pneumonitis,
hypertension, hypokinetic movement disorders,
hypothalamic-pituitary-adrenal axis evaluation, idiopathic
Addison's disease, idiopathic pulmonary fibrosis, antibody mediated
cytotoxicity, asthenia, infantile spinal muscular atrophy,
inflammation of the aorta, influenza A, ionizing radiation
exposure, iridocyclitis/uveitis/optic neuritis,
ischemia-reperfusion injury, ischemic stroke, juvenile rheumatoid
arthritis, juvenile spinal muscular atrophy, Kaposi's sarcoma,
kidney transplant rejection, legionella, leishmaniasis, leprosy,
lesions of the corticospinal system, lipedema, liver transplant
rejection, lymphedema, malaria, malignant lymphoma, malignant
histiocytosis, malignant melanoma, meningitis, meningococcemia,
metabolic migraine headache, idiopathic migraine headache,
mitochondrial multisystem disorder, mixed connective tissue
disease, monoclonal gammopathy, multiple myeloma, multiple systems
degenerations (Menzel, Dejerine-Thomas, Shy-Drager, and
Machado-Joseph), myasthenia gravis, mycobacterium avium
intracellulare, mycobacterium tuberculosis, myelodysplastic
syndrome, myocardial infarction, myocardial ischemic disorders,
nasopharyngeal carcinoma, neonatal chronic lung disease, nephritis,
nephrosis, neurodegenerative diseases, neurogenic muscular
atrophies, neutropenic fever, non-Hodgkin's lymphoma, occlusion of
the abdominal aorta and its branches, occlusive arterial disorders,
orchitis/epididymitis, orchitis/vasectomy reversal procedures,
organomegaly, osteoporosis, pancreas transplant rejection,
pancreatic carcinoma, paraneoplastic syndrome/hypercalcemia of
malignancy, parathyroid transplant rejection, pelvic inflammatory
disease, perennial rhinitis, pericardial disease, peripheral
atherosclerotic disease, peripheral vascular disorders,
peritonitis, pernicious anemia, pneumocystis carinii pneumonia,
pneumonia, POEMS syndrome (polyneuropathy, organomegaly,
endocrinopathy, monoclonal gammopathy, and skin changes syndrome),
post perfusion syndrome, post pump syndrome, post-MI cardiotomy
syndrome, preeclampsia, progressive supranucleo palsy, primary
pulmonary hypertension, radiation therapy, Raynaud's phenomenon,
Raynaud's disease, Refsum's disease, regular narrow QRS
tachycardia, renovascular hypertension, reperfusion injury,
restrictive cardiomyopathy, sarcomas, senile chorea, senile
dementia of Lewy body type, seronegative arthropathies, shock,
sickle cell anemia, skin allograft rejection, skin changes
syndrome, small bowel transplant rejection, solid tumors, specific
arrhythmias, spinal ataxia, spinocerebellar degenerations,
streptococcal myositis, structural lesions of the cerebellum,
subacute sclerosing panencephalitis, syncope, syphilis of the
cardiovascular system, systemic anaphylaxis, systemic inflammatory
response syndrome, systemic onset juvenile rheumatoid arthritis,
telangiectasia, thromboangiitis obliterans, thrombocytopenia,
toxicity, transplants, trauma/hemorrhage, type III hypersensitivity
reactions, type IV hypersensitivity, unstable angina, uremia,
urosepsis, urticaria, valvular heart diseases, varicose veins,
vasculitis, venous diseases, venous thrombosis, ventricular
fibrillation, viral and fungal infections, viral
encephalitis/aseptic meningitis, viral-associated hemophagocytic
syndrome, Wernicke-Korsakoff syndrome, Wilson's disease, xenograft
rejection of any organ or tissue, acute coronary syndromes, acute
idiopathic polyneuritis, acute inflammatory demyelinating
polyradiculoneuropathy, acute ischemia, adult Still's disease,
alopecia greata, anaphylaxis, anti-phospholipid antibody syndrome,
aplastic anemia, arteriosclerosis, atopic eczema, atopic
dermatitis, autoimmune dermatitis, autoimmune disorder associated
with streptococcus infection, autoimmune enteropathy, autoimmune
hearing loss, autoimmune lymphoproliferative syndrome (ALPS),
autoimmune myocarditis, autoimmune premature ovarian failure,
blepharitis, bronchiectasis, bullous pemphigoid, cardiovascular
disease, catastrophic antiphospholipid syndrome, celiac disease,
cervical spondylosis, chronic ischemia, cicatricial pemphigoid,
clinically isolated syndrome (CIS) with risk for multiple
sclerosis, childhood onset psychiatric disorder, chronic
obstructive pulmonary disease (COPD), dacryocystitis,
dermatomyositis, diabetic retinopathy, disk herniation, disk
prolapse, drug induced immune hemolytic anemia, endocarditis,
endometriosis, endophthalmitis, episcleritis, erythema multiforme,
erythema multiforme major, gestational pemphigoid, Guillain-Barre
syndrome (GBS), hay fever, Hughes syndrome, idiopathic Parkinson's
disease, idiopathic interstitial pneumonia, IgE-mediated allergy,
immune hemolytic anemia, inclusion body myositis, infectious ocular
inflammatory disease, inflammatory demyelinating disease,
inflammatory heart disease, inflammatory kidney disease, IPF/UIP,
iritis, keratitis, keratojunctivitis sicca, Kussmaul disease or
Kussmaul-Meier disease, Landry's paralysis, Langerhan's cell
histiocytosis, livedo reticularis, macular degeneration,
microscopic polyangiitis, Morbus Bechterev, motor neuron disorders,
mucous membrane pemphigoid, multiple organ failure, myasthenia
gravis, myelodysplastic syndrome, myocarditis, nerve root
disorders, neuropathy, non-A non-B hepatitis, optic neuritis,
osteolysis, ovarian cancer, pauciarticular JRA, peripheral artery
occlusive disease (PAOD), peripheral vascular disease (PVD),
peripheral artery disease (PAD), phlebitis, polyarteritis nodosa
(or periarteritis nodosa), polychondritis, polymyalgia rheumatica,
poliosis, polyarticular JRA, polyendocrine deficiency syndrome,
polymyositis, polymyalgia rheumatica (PMR), post-pump syndrome,
primary Parkinsonism, prostate and rectal cancer and hematopoietic
malignancies (leukemia and lymphoma), prostatitis, pure red cell
aplasia, primary adrenal insufficiency, recurrent neuromyelitis
optica, restenosis, rheumatic heart disease, SAPHO (synovitis,
acne, pustulosis, hyperostosis, and osteitis), secondary
amyloidosis, shock lung, scleritis, sciatica, secondary adrenal
insufficiency, silicone associated connective tissue disease,
Sneddon-Wilkinson dermatosis, spondylitis ankylosans,
Stevens-Johnson syndrome (SJS), systemic inflammatory response
syndrome, temporal arteritis, toxoplasmic retinitis, toxic
epidermal necrolysis, transverse myelitis, TRAPS (tumor-necrosis
factor receptor type 1 (TNFR)-associated periodic syndrome), type 1
allergic reaction, type II diabetes, urticaria, usual interstitial
pneumonia (UIP), vasculitis, vernal conjunctivitis, viral
retinitis, Vogt-Koyanagi-Harada syndrome (VKH syndrome), and wet
macular degeneration. In a particular embodiment, the
TNF-associated disease or disorder is rheumatoid arthritis.
[0208] The disclosure may be embodied in other specific forms
without departing from the spirit or essential characteristics
thereof. The foregoing embodiments are therefore to be considered
in all respects illustrative rather than limiting of the
disclosure. Scope of the disclosure is thus indicated by the
appended claims rather than by the foregoing description, and all
changes that come within the meaning and range of equivalency of
the claims are therefore intended to be embraced herein.
[0209] Any patent, patent application, publication, or other
disclosure material identified in the specification is hereby
incorporated by reference herein in its entirety. Any material, or
portion thereof, that is said to be incorporated by reference
herein, but which conflicts with existing definitions, statements,
or other disclosure material set forth herein is only incorporated
to the extent that no conflict arises between that incorporated
material and the present disclosure material.
EXAMPLES
[0210] Examples have been set forth below for the purpose of
illustration and to describe certain specific embodiments of the
invention. However, the scope of the claims is not to be in any way
limited by the examples set forth herein. Various changes and
modifications to the disclosed embodiments will be apparent to
those skilled in the art and such changes and modifications
including, without limitation, those relating to the packaging
vectors, cell lines and/or methods of the invention may be made
without departing from the spirit of the invention and the scope of
the appended claims.
Example 1
Generation of Monoclonal Antibody-Producing Cho Cells
Overexpressing .beta. 1, 4 Galactosyl-Transferase
[0211] A mouse galactosyltransferase .beta. 1, 4 (Genbank accession
number: D00314) was amplified by PCR and cloned downstream of CMV
promoter of the pcDNA.TM.3.3 TOPO.RTM. Mammalian Expression Vector
(Invitrogen Life Sciences, Catalog Number: K8300-01) as shown in
FIG. 2A. The nucleic acid and corresponding amino acid sequence of
mouse galactosyltransferase .beta. 1, 4 is shown in FIG. 2B.
[0212] Adalimumab-producing CHO cells were electroporated with the
mouse galactosyltransferase .beta. 1, 4 expression vector. After 48
hours of culture, G418 (Geneticin.RTM., Life Technologies Catalog
Number 10131035) was added to the cell media at a final
concentration of 500 .mu.g/ml and the cells were cultured an
additional 2-3 weeks. Media was changed once every other day.
Stable neomycin resistant transformants were isolated and expanded
in culture for 1-3 passages prior to cryopreservation. Two
exemplary cell lines, designated GALTR-11 and Gal88-D2E7 were
analyzed further.
Example 2
Generation of Monoclonal Antibody-Producing Cho Cells Having a
Beta-Galactosidase Knock Down
[0213] A knock out in one of the alleles of the beta galactosidase
gene (Cricetulus griseus Glb1 (Gene ID: 100767446); mRNA sequence:
NCBI Reference Sequence: XM.sub.--007630176.1; genomic sequence
NW.sub.--003613697.1 from 2278553 to 2336708) of the
adalimumab-producing DHFR-deficient CHO cell line was generated
using zinc finger nuclease following procedures that are well known
in the art (Santiago et al., Proc. Natl. Acad. Sci. USA. 2008;
105(15):5809-14; Remy et al., Transgenic Res. 2010; 19(3): 363-71;
Zhang et al., Advances in Biochemical Engineering/Biotechnology
Volume 131, 2013, pp 63-87; U.S. Pat. No. 8,313,925). One exemplary
cell line, designated ZFN-B1 was analyzed further.
Example 3
Generation of DVD-Ig-Producing CHO Cells Overexpressing .beta. 1, 4
Galactosyltransferase
[0214] IL17xTNF DVD-Ig-producing CHO cells are electroporated with
the mouse galactosyltransferase .beta.1, 4 expression vector and
G418 (Geneticin.RTM., Life Technologies Catalog Number 10131035) is
added to the cell media 48 hours after the transfection at a final
concentration of 500 .mu.g/ml for 2-3 weeks. Media is changed once
every other day. Stable neomycin resistant transformants are
isolated and cultured for 1-3 passages prior to
cryopreservation.
Example 4A
Culture of Cho Cells Producing a High Gal/Low Man Fc Containing
Binding Protein
[0215] This exemplary protocol is described for the production of
High Gal/Low Man adalimumab but it is generally applicable to the
culture of High Gal/Low Man CHO cells expressing any Fc containing
binding protein including, but not limited to, DVD-Ig. High Gal/Low
Man CHO cells can be either overexpressing galactosyltransferase
.beta. 1, 4, as described in Example 1, or have a knockout of an
allele of the endogenous beta galactosidase gene as described in
Example 2.
[0216] Growth and production media for the culture of a High
Gal/Low Man adalimumab-producing CHO cell line were prepared using
a proprietary Life Technologies GIBCO chemically defined media,
GIA-1. Basal production and feed media were supplemented with 50
.mu.M Manganese (II) Chloride (Sigma M1787-100 mL; 1.0 M.+-.0.1 M)
and 30 mM D(+)Galactose (Sigma G5388-1 kg) (see published U.S.
Patent Application No. 2012/0276631 and U.S. Provisional
Application 61/886,855). All media were filtered through Corning
0.5 L or 1 L filter systems 0.22 .mu.m Poly (Ether Sulfone) (PES)
and stored at 4.degree. C. until use.
[0217] The High Gal/Low Man adalimumab-producing CHO cell line was
adapted to chemically defined media for 7 (2 to 3 day each)
passages in a combination of 250 mL and 500 mL Corning vented
non-baffled shake flasks before freezing.
[0218] Upon thaw, for the batch shake flask study, cells were
expanded for 3 to 5 passages (2 to 3 days each) in a combination of
250 mL and 500 mL Corning vented non-baffled shake flasks.
Production cultures were initiated in duplicate 500 mL Corning
vented non-baffled shake flasks (200 mL working volume) at an
initial viable cell density (VCD) of approximately
0.5.times.10.sup.6 cells/mL. Cultures were maintained on orbital
shakers at 110 revolutions per minute (RPM) in a dry incubator at
35.degree. C. and 5% CO.sub.2. The shake flask study was run in an
extended batch mode by feeding with a glucose solution (1.25% (v/v)
of 40% solution) when the media glucose concentration fell below 3
g/L.
[0219] For the fed-batch bioreactor study, cells were expanded for
8 passages (2 to 3 days each) in Corning vented non-baffled shake
flasks maintained on orbital shakers at 110 RPM and in 20 L cell
bags (3 L to 10 L working volume) maintained at 20-25 RPM,
7.5.degree. angle, and 0.25 SLPM airflow in a dry incubator at
35.degree. C. and 5% CO.sub.2. Production cultures were initiated
in duplicate 3 L bioreactors (1.5 L working volume) at 35.degree.
C., 30% dissolved oxygen, 200 RPM, pH ramp from 7.1 to 6.9 over 3
days, and pH setpoint of 6.9 thereafter. A fixed split ratio of
cells to media of 1:5 was utilized to initiate the production stage
cultures. In the fed-batch mode, a chemically-defined feed from
Life Technologies GIBCO, JCL-5 (proprietary formulation), was added
as follows: 3% (v/v)--day 3, 5%--day 4, 7%--day 5, 10%--day 6, and
10%--day 7. Additional glucose (1.25% (v/v) of 40% solution) was
fed when the media glucose concentration fell below 3 g/L.
[0220] For all studies with CHO cell lines, samples were collected
daily and measured for cell density and viability using a Cedex
cell counter. Retention samples for titer analysis via Poros A
method were collected by centrifugation at 12,000 RPM for 5 min
when the culture viability began declining. The cultures were
harvested by collecting 125 mL aliquots and centrifuging at 3,000
RPM for 30 min when culture viability was near or below 50%. All
supernatants were stored at -80.degree. C. until analysis.
[0221] High Gal/Low Man adalimumab produced by the ZFN-B1 CHO cell
(as described in Example 2) is referred to herein as ZFN-B1. High
Gal/Low Man adalimumab produced by the GALTR-11 and Gal88-D2E7 CHO
cell clones that overexpress .beta.-1, 4 galactosyltransferase (as
described in Example 1) are referred to herein as GALTR-11 and
Gal88-D2E7, respectively. A High Gal/Low Man anti-TNF.times.IL17
DVD-Ig (ABT-122) produced by the cell line of Example 3 is referred
to herein as Gal79-DVD-Ig.
Example 4B
Production of Highly Sialylated Glycoforms
[0222] To prepare approximately 40 mg of GALTR-11 for in-vitro
sialylation, the buffer was changed to 35 mM tris acetate, pH 7.4
through dialysis and the concentration adjusted to approximately 5
mg/mL. In vitro sialylation was accomplished by incubating GALTR-11
with activated sialic acid, or more specifically, activated
CMP-N-acetyl neuraminic acid (CMP-NANA) and a specific enzyme,
.alpha.-2,6 sialyltransferase that attaches the sialic acid (NANA)
on to the penultimate galactose residue in an .alpha.-2,6 linkage.
The CMP-NANA was added in a 1:2 CMP-NANA:GALTR-11 ratio and the
enzyme was added in a 1:10 enzyme:GALTR-11 ratio, or 4 mg of enzyme
to approximately 40 mg of antibody. The volume of the reaction mix
was brought up to 15 mL and incubated overnight at 37.degree. C.
with gentle shaking.
[0223] The level of incorporated sialic acid was quantified by weak
ion exchange chromatography using a Shimadzu HPLC equipped with an
analytical ProPac.RTM. WCX-10 column (4.times.250 mm) Sample was
loaded at 94% mobile phase A (10 mM sodium phosphate, pH 7.5) and
6% buffer B (10 mM sodium phosphate, 500 mM sodium chloride, pH
5.5) and then eluted by the gradient and conditions shown in Table
1 to obtain the glycoengineered adalimumab composition referred to
herein as SA-D2E7.
TABLE-US-00003 TABLE 1 WCX-10 Chromatography Conditions Item
Description/Operating Conditions Mobile phase A 10 mM sodium
phosphate, pH 7.5 Mobile phase B 10 mM sodium phosphate/500 mM
sodium chloride, pH 5.5 Gradient Binary Gradient Time (minute)
Mobile Phase B % 0.5 6 20 16 22 100 26 100 28 6 34 6 35 0 (stop)
Flow rate 1.0 mL/min. Detector wavelength 280 nm Autosampler
temperature Nominal 4.degree. C. Column oven temperature ambient
Sample load Up to 100 .mu.L/100 .mu.g Run time 35.0 minutes
[0224] Chromatograms of the SA-D2E7 composition are shown in FIG.
7C. Sialylated GALTR-11 was be separated from the rest of the
antibodies containing other glycoforms (i.e., high mannose, G0F,
etc.) since sialic acids impart a negative charge to antibodies due
to the loss of a proton by the carboxylic group at physiological
pH. The other glycoforms are neutral and eluted from the column in
the same peak while sialylated GALTR-11 eluted earlier. Sialylated
GALTR-11 will elute from an anion exchange column at different
retention times depending on the level of sialic acids it contains.
Up to four sialic acids can be added to each D2E7 antibody; two for
each Fc biantennary glycan. Only the peaks containing three and
four sialic acids were collected to ensure relatively pure
fractions of SA-D2E7 (containing near 100% of G2S1F and G2S2F type
glycans).
[0225] The weak ion exchange chromatography method used to collect
SA-D2E7 was a modification of the analytical method described
above. A GE AKTA Avant system was used with a preparative
ProPac.RTM. WCX-10 column (22.times.250 mm) at a flow rate of 25
mL/min. The initial gradient was also stretched out longer, to
increase the separation between the early eluting peaks.
Example 5
Analysis of Glycoengineered Adalimumab
[0226] The glycan profiles of the ZFN-B1, GALTR-11, Gal88-D2E7,
SA-D2E7 and Gal79-DVD were determined.
[0227] For all studies, the harvest samples were protein A purified
using standard methods (Pure 1A.RTM. Kit, Sigma Aldrich, St. Louis,
Mo.) and prepared for the oligosaccharide assay using the following
procedures.
[0228] As a first step in the process of identifying and
quantifying the oligosaccharides, total N-glycans were released
from protein A-purified hypergalactosylated adalimumab by enzymatic
digestion with N-glycanase. Once the glycans were released, the
free reducing end of each glycan was labeled by reductive amination
with a fluorescent tag, 2-aminobenzamide (2-AB). The resulting
labeled glycans were separated by normal-phase HPLC (NP-HPLC) in
acetonitrile: 50 mM ammonium formate, pH 4.4, and detected by a
fluorescence detector. Quantitation was based on the relative area
percent of detected sugars. The results of the analysis for
non-hyperglycosylated adalimumab and the hyperglycosylated
Adalimumab ZFN-B1, GALTR-11 and Gal88-D2E7 variants are shown in
FIG. 2C.
[0229] N-deglycosylation of the antibody samples may also be
carried out according to the manufacturer's procedure using a
Prozyme.RTM. N-deglycosylation kit (San Leandro, Calif., USA).
Briefly, 300 .mu.g of dried antibody sample are recovered in 135
.mu.L of a 10-mM aqueous Tris-HCl buffer pH 8.0, and 4.5 .mu.L of a
10% (v/v) beta-mercaptoethanol aqueous solution is added to reduce
the antibody disulfide bridges. The N-deglycosylation is carried
out by the addition of 7.5 mU of peptidyl-N-glycosidase (PNGase F)
followed by an overnight incubation at 37 C. At this stage, many
N-glycans are released as glycosylamines before slowly hydrolyzing
into reducing glycans. The full regeneration of reducing glycans is
performed by adding to PNGase F-digested antibody samples glacial
acetic acid at a final concentration of 5% (v/v) followed by a one
hour incubation at room temperature. The freshly regenerated
reducing N-glycan mix is purified by a solid phase extraction (SPE)
onto a 50-mg Hypersep Hypercarb.RTM. porous graphitized carbon
(PGC) column (Thermofischer Scientific, Bremen, Germany) (Packer et
al., 1998). The PGC SPE column is sequentially washed with 1 mL
methanol and 2.times.1 mL of a 0.1% (v/v) aqueous trifluoroacetic
acid (TFA). The oligosaccharides are dissolved in 200 .mu.L of a
0.1% (v/v) aqueous TFA, applied to the column and washed with
2.times.1 mL of a 0.1% (v/v) aqueous TFA. The elution of the
glycans is performed by applying 2.times.400 .mu.L of a 25% (v/v)
aqueous acetonitrile containing 0.1% (v/v) TFA and the eluate is
vacuum-dried.
[0230] The PGC-purified glycans are reductively aminated with
2-aminobenzamide (2-AB) by recovering dried glycans by 10 .mu.L of
a 33% (v/v) acetic acid in DMSO containing 0.35 M 2-AB and 1 M
sodium cyanoborohydride and the reaction is kept at 37 C for 16
hours. The 2-AB-labeled N-glycans are purified onto a 50-mg
Oasis.RTM. polymeric HLB SPE column, used in the hydrophilic
interaction chromatography (HILIC) mode (Waters, Milford, Mass.,
USA). The HILIC SPE column is sequentially wetted with 1 mL of a
20% (v/v) aqueous acetonitrile and equilibrated with 2.times.1 mL
of acetonitrile, the 2-AB derivatives dissolved in acetonitrile are
then loaded onto the SPE column After washing the column with
2.times.1 mL of acetonitrile, the elution of the 2-AB derivatives
is next performed by applying 2.times.500 .mu.L of a 20% (v/v)
aqueous acetonitrile. The 1-mL eluate is vacuum-concentrated to 50
.mu.L.
[0231] The purified 2-AB derivatives are finally profiled by
normal-phase high-performance liquid chromatography (NP-HPLC) using
a 150.times.4 6 mm ID TSK-gel amide-80 HILIC HPLC column (TOSOH
Bioscience, King of Prussia, Pa., USA) with 3 .mu.m packing
particles (Guile et al., 1996). The mobile phase is composed of a
mixture of a 50-mM ammonium formate aqueous solution adjusted at pH
4.4 (A) and acetonitrile (B). The operating flow rate and
temperature are respectively 1 mL/min and 30 C. 5 .mu.L of the
purified 2-AB derivatives are 40-fold diluted using a 80% (v/v)
aqueous acetonitrile, and 50 .mu.L of the freshly shaken organic
mixture is injected into the HILIC column, and equilibrated with
80% (v/v) B. Once sample injected, the separation of the N-glycans
is performed as follows: from 80% to 70% (v/v) B in 15 min; from
70% to 55% (v/v) B in 150 min; from 55% to 10% (v/v) B in 5 min;
10% (v/v) B during 10 min; from 10% to 80% (v/v) in 1 min; 80%
(v/v) B during 45 minutes (reequilibration). The detection of the
fluorescent derivatives is performed by fluorescence detection (FD)
with an excitation wavelength of 330 nm and an emission wavelength
of 420 nm
[0232] MALDI-TOF mass spectroscopy may also be performed to confirm
the identity of the apparent hypergalactosylated species. FIG. 2D
shows that the major glycans present in a High Gal/Low Man
adalimumab preparation (ZFN-B1) are G1F and G2F. FIG. 2E shows the
major glycans present in the High Gal/Low Man adalimumab
preparation (SA-D2E7) prior to and following treatment with
sialyltransferase.
Example 6
TNF.alpha. Binding and Internalization of Glycoengineered
Adalimumab
Isolation of Monocytes, Culture and Stimulation:
[0233] Peripheral blood mononuclear cells (PBMC) were isolated from
leukopack of healthy donors by density gradient centrifugation over
Ficoll-Paque (GE Health Sciences). Monocytes were isolated by
magnetic sorting using CD14 microbeads (Miltenyi Biotec). The
purity of the resulting monocytes, as assessed by flow cytometric
analysis, was typically greater than 98%. Monocytes were cultured
in RPMI1640 medium (Cellgro) supplemented 2 mM L-glutamine, 100
ng/ml of recombinant human GM-CSF (Abbvie) and 5 ng/ml of human
IL-4 (Peprotech), 100 .mu.g/ml penicillin, and streptomycin, and
10% fetal bovine serum at a density of 1.times.10.sup.6 cells/ml at
37.degree. C. with 5% CO2 for 5 days.
[0234] To test the surface TNFalpha expression, PBMCs or monocytes
were stimulated with ultra-low (0.025 ng/ml), low (0.25 ng/ml) or
high (250 ng/ml) of LPS (from Salmonella typhimurium,
Sigma-Aldrich) for one hour.
Dendritic Cell Differentiation and Stimulation
[0235] Dendritic cells were generated by culturing monocytes in
RPMI1640 medium supplemented with 100 ng/ml of recombinant human
GM-CSF (Abbvie) and 5 ng/ml of human IL-4 (Peprotech) for 4 days.
To investigate the TNFalpha production, DCs were stimulated with 1
mg/ml LPS (from Salmonella typhimurium, Sigma-Aldrich) for 1
hour.
Staining Cells and Flow Cytometric Analysis
[0236] LPS stimulated PBCs, monocyte or DCs were blocked with human
IgG and stained with pH.sup.Rodo red labeled D2E7 on ice, then
incubated at 37.degree. C. As a negative control an isotype matched
control antibody (AB446) was used. All the antibodies were
conjugated with A488 using antibody labeling kit (Invitrogen)
according to manufacturer's protocol. Monocytes and T cells were
gated based on the expression of CD14 (Biolegend) and CD3
(eBioscience) respectively. Samples were analyzed on a Becton
Dickinson Fortessa.RTM. flow cytometer, and analysis was performed
using Flowjo.RTM. software (TreeStar Inc., Ashland, Oreg.,
USA).
Internalization Assay
[0237] To investigate the internalization of surface TNF bound
adalimumab antibodies, monocytes were stimulated with LPS for 4, 7,
9 or 24 hours in the presence of Alexa 488 conjugated AB436
antibodies. Cells were permeabilized and nucleus was stained with
DAPI. The images were acquired using confocal microscope (Zeiss).
To study the internalization of anti-TNF adalimumab antibodies by
dendritic cells, the monocyte derived DCs were stimulated with LPS
for 4 hours in the presence of anti-TNF adalimumab or matched
isotype control antibodies. The anti-TNFalpha specific adalimumab
antibodies and control antibodies were conjugated with pH sensitive
dye pH.sup.Rodo Red (Invitrogen) according to manufacturer's
protocol. The cells were analyzed by fluorescent microscope and
FACS. Where indicated, the surface of the cells was stained with
A488-conjugated anti-HLA-A,B.C (W6/32, Biolegend) antibodies and
the nucleus was stained with Nuce.RTM. blue (Invitrogen). To study
the internalization kinetics of anti-TNFalpha adalimumab antibodies
by membrane TNF on DCs, cells were either left in un-stimulated or
stimulated with LPS for 1 hour or 24 hours. The surface TNFalpha
was stained with pH.sup.Rodo Red conjugated anti-TNFalpha antibody
(AB441). The stained cells were cultured in RPMI medium for the
indicated time and the internalization was assessed as an increase
in fluorescence using BD Fortessa flow cytometer (see FIGS. 3A-3C).
The results indicate that that the glycoengineered Adalimumab
preparations of the invention exhibit pronounced decrease
immunogenicity as a result of their reduced internalization and
antigenic presentation by dendritic cells.
Example 7
Pharmacokinetic Studies
[0238] Non-hypergalactosylated adalimumab (D2E7) and
hypergalactosylated adalimumab (ZFN-B1) monoclonal antibodies were
administered to CD-1 or BALB/C mice by slow intravenous bolus dose
injection at a 5 mg/kg dose. Blood samples were collected from each
mouse at 1, 24 and 96 hours and 7, 10, 14 and 21 days post dose.
Blood samples were collected from each rat at 0.25, 4, and 24 hours
and 2, 3, 7, 10, 14, 21 and 28 days post dose. All samples were
stored at -80.degree. C. until analysis.
[0239] Serum samples were analyzed using an anti-TNF capture assay
depicted in FIG. 4 in which a biotinylated human TNF.alpha. was
used for capture and a labeled anti-human Sulfo-Tag for detection.
The assay was carried out in 1% final serum concentration. The
lower limit of quantitation (LLOQ) was 0.004 .mu.g/mL. The linear
range: 15-0.004 .mu.g/mL. The low control was 0.1 .mu.g/mL.
[0240] Standard curve fitting and data evaluation was performed
using XLfit4 software with a four-parameter logistic fit. Plates
passed when at least 2/3 of the QC's were within 30% of the
expected values. Pharmacokinetic parameters for each animal were
calculated using WinNonlin.RTM. software Version 5.0.1 (Pharsight
Corporation, Mountain View, Calif.) by non-compartmental analysis
using linear trapezoidal fit (NCA Models #201 for IV dosing). For
calculations in WinNonlin, the time of dosing was defined as Day 0
Time 0 hr.
[0241] The serum concentrations as a function of time are shown in
FIG. 5A (ZFN-B1) and FIG. 5B (D2E7). The pharmacokinetic parameters
for High Gal ZFN-B1 administered mice #3 and 5 are depicted in FIG.
5C. The result show that 4 of 5 animals administered anti-TNF
hypergalactosylated ZFN-B1 monoclonal antibody had measurable
antibody levels out to 21 days (FIG. 5A). The High Gal ZFN-B1
administered mouse #3 displayed a long half-life and low CL (24.5
days and 0.14 mL/h/kg). In contrast, all the animals administered
the anti-TNF D2E7 monoclonal antibody displayed probable anti-drug
antibodies (ADA). The results suggest that anti-drug antibodies
decrease as a function of the galactosylation of the administered
recombinant Fc binding protein (see FIG. 6).
Sequence CWU 1
1
41451PRTArtificial SequenceDescription of Artificial Sequence
Synthetic polypeptide 1Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu
Val Gln Pro Gly Arg 1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser
Gly Phe Thr Phe Asp His Tyr 20 25 30 Ala Met His Trp Val Arg Gln
Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ser Ala Ile Thr Trp
Asn Ser Gly His Ile Asp Tyr Ala Asp Ser Val 50 55 60 Glu Gly Arg
Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn Ser Leu Tyr 65 70 75 80 Leu
Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90
95 Ala Lys Val Ser Tyr Leu Ser Thr Ala Ser Ser Leu Asp Tyr Trp Gly
100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser Ala Ser Thr Lys Gly
Pro Ser 115 120 125 Val Phe Pro Leu Ala Pro Ser Ser Lys Ser Thr Ser
Gly Gly Thr Ala 130 135 140 Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe
Pro Glu Pro Val Thr Val 145 150 155 160 Ser Trp Asn Ser Gly Ala Leu
Thr Ser Gly Val His Thr Phe Pro Ala 165 170 175 Val Leu Gln Ser Ser
Gly Leu Tyr Ser Leu Ser Ser Val Val Thr Val 180 185 190 Pro Ser Ser
Ser Leu Gly Thr Gln Thr Tyr Ile Cys Asn Val Asn His 195 200 205 Lys
Pro Ser Asn Thr Lys Val Asp Lys Lys Val Glu Pro Lys Ser Cys 210 215
220 Asp Lys Thr His Thr Cys Pro Pro Cys Pro Ala Pro Glu Leu Leu Gly
225 230 235 240 Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp
Thr Leu Met 245 250 255 Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val
Val Asp Val Ser His 260 265 270 Glu Asp Pro Glu Val Lys Phe Asn Trp
Tyr Val Asp Gly Val Glu Val 275 280 285 His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Tyr Asn Ser Thr Tyr 290 295 300 Arg Val Val Ser Val
Leu Thr Val Leu His Gln Asp Trp Leu Asn Gly 305 310 315 320 Lys Glu
Tyr Lys Cys Lys Val Ser Asn Lys Ala Leu Pro Ala Pro Ile 325 330 335
Glu Lys Thr Ile Ser Lys Ala Lys Gly Gln Pro Arg Glu Pro Gln Val 340
345 350 Tyr Thr Leu Pro Pro Ser Arg Asp Glu Leu Thr Lys Asn Gln Val
Ser 355 360 365 Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
Ala Val Glu 370 375 380 Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr Thr Pro Pro 385 390 395 400 Val Leu Asp Ser Asp Gly Ser Phe
Phe Leu Tyr Ser Lys Leu Thr Val 405 410 415 Asp Lys Ser Arg Trp Gln
Gln Gly Asn Val Phe Ser Cys Ser Val Met 420 425 430 His Glu Ala Leu
His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser 435 440 445 Pro Gly
Lys 450 2214PRTArtificial SequenceDescription of Artificial
Sequence Synthetic polypeptide 2Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly 1 5 10 15 Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser His Ser Ile Arg Asn Tyr 20 25 30 Leu Ser Trp Tyr Gln
Gln Lys Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Ala
Ser Thr Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro 65 70
75 80 Glu Asp Val Ala Thr Tyr Tyr Cys Gln Arg Tyr Asn Arg Ala Pro
Tyr 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys Arg Thr
Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser Asp Glu
Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys Leu Leu Asn
Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp Lys Val Asp
Asn Ala Leu Gln Ser Gly Asn Ser Gln 145 150 155 160 Glu Ser Val Thr
Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175 Ser Thr
Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180 185 190
Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys Ser 195
200 205 Phe Asn Arg Gly Glu Cys 210 31200DNAMus sp.CDS(1)..(1197)
3atg agg ttt cgt gag cag ttc ctg ggc ggc agc gcc gcg atg ccg ggc
48Met Arg Phe Arg Glu Gln Phe Leu Gly Gly Ser Ala Ala Met Pro Gly 1
5 10 15 gcg acc ctg cag cgg gcc tgc cgc ctg ctc gtg gcc gtc tgc gcg
ctg 96Ala Thr Leu Gln Arg Ala Cys Arg Leu Leu Val Ala Val Cys Ala
Leu 20 25 30 cac ctc ggc gtc acc ctc gtc tat tac ctc tct ggc cgc
gat ctg agc 144His Leu Gly Val Thr Leu Val Tyr Tyr Leu Ser Gly Arg
Asp Leu Ser 35 40 45 cgc ctg ccc cag ttg gtc gga gtc tcc tct aca
ctg cag ggc ggc acg 192Arg Leu Pro Gln Leu Val Gly Val Ser Ser Thr
Leu Gln Gly Gly Thr 50 55 60 aac ggc gcc gca gcc agc aag cag ccc
cca gga gag cag cgg ccg cgg 240Asn Gly Ala Ala Ala Ser Lys Gln Pro
Pro Gly Glu Gln Arg Pro Arg 65 70 75 80 ggt gcg cgg ccg ccg cct cct
tta ggc gtc tcc ccg aag cct cgc ccg 288Gly Ala Arg Pro Pro Pro Pro
Leu Gly Val Ser Pro Lys Pro Arg Pro 85 90 95 ggt ctc gac tcc agc
cct ggt gca gct tct ggc ccc ggc ttg aag agc 336Gly Leu Asp Ser Ser
Pro Gly Ala Ala Ser Gly Pro Gly Leu Lys Ser 100 105 110 aac ttg tct
tcg ttg cca gtg ccc acc acc act gga ctg ttg tcg ctg 384Asn Leu Ser
Ser Leu Pro Val Pro Thr Thr Thr Gly Leu Leu Ser Leu 115 120 125 cca
gct tgc cct gag gag tcc ccg ctg ctc gtt ggc ccc atg ctg att 432Pro
Ala Cys Pro Glu Glu Ser Pro Leu Leu Val Gly Pro Met Leu Ile 130 135
140 gac ttt aat att gct gtg gat ctg gag ctt ttg gca aag aag aac cca
480Asp Phe Asn Ile Ala Val Asp Leu Glu Leu Leu Ala Lys Lys Asn Pro
145 150 155 160 gag ata aag acg ggc ggc cgt tac tcc ccc aag gac tgt
gtc tct cct 528Glu Ile Lys Thr Gly Gly Arg Tyr Ser Pro Lys Asp Cys
Val Ser Pro 165 170 175 cac aag gtg gcc atc atc atc cca ttc cgt aac
cgg cag gag cat ctc 576His Lys Val Ala Ile Ile Ile Pro Phe Arg Asn
Arg Gln Glu His Leu 180 185 190 aaa tac tgg ctg tat tat ttg cat ccc
atc ctt cag cgc cag caa ctc 624Lys Tyr Trp Leu Tyr Tyr Leu His Pro
Ile Leu Gln Arg Gln Gln Leu 195 200 205 gac tat ggc atc tac gtc atc
aat cag gct gga gac acc atg ttc aat 672Asp Tyr Gly Ile Tyr Val Ile
Asn Gln Ala Gly Asp Thr Met Phe Asn 210 215 220 cga gct aag ctg ctc
aat att ggc ttt caa gag gcc ttg aag gac tat 720Arg Ala Lys Leu Leu
Asn Ile Gly Phe Gln Glu Ala Leu Lys Asp Tyr 225 230 235 240 gat tac
aac tgc ttt gtg ttc agt gat gtg gac ctc att ccg atg gac 768Asp Tyr
Asn Cys Phe Val Phe Ser Asp Val Asp Leu Ile Pro Met Asp 245 250 255
gac cgt aat gcc tac agg tgt ttt tcg cag cca cgg cac att tct gtt
816Asp Arg Asn Ala Tyr Arg Cys Phe Ser Gln Pro Arg His Ile Ser Val
260 265 270 gca atg gac aag ttc ggg ttt agc ctg cca tat gtt cag tat
ttt gga 864Ala Met Asp Lys Phe Gly Phe Ser Leu Pro Tyr Val Gln Tyr
Phe Gly 275 280 285 ggt gtc tct gct ctc agt aaa caa cag ttt ctt gcc
atc aat gga ttc 912Gly Val Ser Ala Leu Ser Lys Gln Gln Phe Leu Ala
Ile Asn Gly Phe 290 295 300 cct aat aat tat tgg ggt tgg gga gga gaa
gat gac gac att ttt aac 960Pro Asn Asn Tyr Trp Gly Trp Gly Gly Glu
Asp Asp Asp Ile Phe Asn 305 310 315 320 aga tta gtt cat aaa ggc atg
tct ata tca cgt cca aat gct gta gta 1008Arg Leu Val His Lys Gly Met
Ser Ile Ser Arg Pro Asn Ala Val Val 325 330 335 ggg agg tgt cga atg
atc cgg cat tca aga gac aag aaa aat gag ccc 1056Gly Arg Cys Arg Met
Ile Arg His Ser Arg Asp Lys Lys Asn Glu Pro 340 345 350 aat cct cag
agg ttt gac cgg atc gca cat aca aag gaa acg atg cgc 1104Asn Pro Gln
Arg Phe Asp Arg Ile Ala His Thr Lys Glu Thr Met Arg 355 360 365 ttc
gat ggt ttg aac tca ctt acc tac aag gtg ttg gat gta cag aga 1152Phe
Asp Gly Leu Asn Ser Leu Thr Tyr Lys Val Leu Asp Val Gln Arg 370 375
380 tac ccg tta tat acc caa atc aca gtg gac atc ggg aca ccg aga tag
1200Tyr Pro Leu Tyr Thr Gln Ile Thr Val Asp Ile Gly Thr Pro Arg 385
390 395 4399PRTMus sp. 4Met Arg Phe Arg Glu Gln Phe Leu Gly Gly Ser
Ala Ala Met Pro Gly 1 5 10 15 Ala Thr Leu Gln Arg Ala Cys Arg Leu
Leu Val Ala Val Cys Ala Leu 20 25 30 His Leu Gly Val Thr Leu Val
Tyr Tyr Leu Ser Gly Arg Asp Leu Ser 35 40 45 Arg Leu Pro Gln Leu
Val Gly Val Ser Ser Thr Leu Gln Gly Gly Thr 50 55 60 Asn Gly Ala
Ala Ala Ser Lys Gln Pro Pro Gly Glu Gln Arg Pro Arg 65 70 75 80 Gly
Ala Arg Pro Pro Pro Pro Leu Gly Val Ser Pro Lys Pro Arg Pro 85 90
95 Gly Leu Asp Ser Ser Pro Gly Ala Ala Ser Gly Pro Gly Leu Lys Ser
100 105 110 Asn Leu Ser Ser Leu Pro Val Pro Thr Thr Thr Gly Leu Leu
Ser Leu 115 120 125 Pro Ala Cys Pro Glu Glu Ser Pro Leu Leu Val Gly
Pro Met Leu Ile 130 135 140 Asp Phe Asn Ile Ala Val Asp Leu Glu Leu
Leu Ala Lys Lys Asn Pro 145 150 155 160 Glu Ile Lys Thr Gly Gly Arg
Tyr Ser Pro Lys Asp Cys Val Ser Pro 165 170 175 His Lys Val Ala Ile
Ile Ile Pro Phe Arg Asn Arg Gln Glu His Leu 180 185 190 Lys Tyr Trp
Leu Tyr Tyr Leu His Pro Ile Leu Gln Arg Gln Gln Leu 195 200 205 Asp
Tyr Gly Ile Tyr Val Ile Asn Gln Ala Gly Asp Thr Met Phe Asn 210 215
220 Arg Ala Lys Leu Leu Asn Ile Gly Phe Gln Glu Ala Leu Lys Asp Tyr
225 230 235 240 Asp Tyr Asn Cys Phe Val Phe Ser Asp Val Asp Leu Ile
Pro Met Asp 245 250 255 Asp Arg Asn Ala Tyr Arg Cys Phe Ser Gln Pro
Arg His Ile Ser Val 260 265 270 Ala Met Asp Lys Phe Gly Phe Ser Leu
Pro Tyr Val Gln Tyr Phe Gly 275 280 285 Gly Val Ser Ala Leu Ser Lys
Gln Gln Phe Leu Ala Ile Asn Gly Phe 290 295 300 Pro Asn Asn Tyr Trp
Gly Trp Gly Gly Glu Asp Asp Asp Ile Phe Asn 305 310 315 320 Arg Leu
Val His Lys Gly Met Ser Ile Ser Arg Pro Asn Ala Val Val 325 330 335
Gly Arg Cys Arg Met Ile Arg His Ser Arg Asp Lys Lys Asn Glu Pro 340
345 350 Asn Pro Gln Arg Phe Asp Arg Ile Ala His Thr Lys Glu Thr Met
Arg 355 360 365 Phe Asp Gly Leu Asn Ser Leu Thr Tyr Lys Val Leu Asp
Val Gln Arg 370 375 380 Tyr Pro Leu Tyr Thr Gln Ile Thr Val Asp Ile
Gly Thr Pro Arg 385 390 395
* * * * *