U.S. patent application number 14/537638 was filed with the patent office on 2015-05-14 for compositions and methods comprising serine protease variants.
This patent application is currently assigned to DANISCO US INC.. The applicant listed for this patent is DANISCO US INC.. Invention is credited to Wolfgang Aehle, Luis G. Cascao-Pereira, David A. Estell, Frits Goedegebuur, James T. Kellis, JR., Ayrookaran J. Poulose, Brian F. Schmidt.
Application Number | 20150132825 14/537638 |
Document ID | / |
Family ID | 42025792 |
Filed Date | 2015-05-14 |
United States Patent
Application |
20150132825 |
Kind Code |
A1 |
Aehle; Wolfgang ; et
al. |
May 14, 2015 |
COMPOSITIONS AND METHODS COMPRISING SERINE PROTEASE VARIANTS
Abstract
The present invention provides methods for protein engineering
and serine protease variants produced there from. Specifically, the
present invention provides serine protease variants having one or
more substitutions as compared to a reference serine protease. In
addition, the present invention provides compositions comprising
these serine protease variants. In some embodiments, the present
invention provides cleaning compositions comprising at least one of
these serine protease variants.
Inventors: |
Aehle; Wolfgang;
(Zwingenberg, DE) ; Cascao-Pereira; Luis G.;
(Redwood City, CA) ; Estell; David A.; (San
Francisco, CA) ; Goedegebuur; Frits; (Vlaardingen,
NL) ; Kellis, JR.; James T.; (San Carlos, CA)
; Poulose; Ayrookaran J.; (Belmont, CA) ; Schmidt;
Brian F.; (Half Moon Bay, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
DANISCO US INC. |
Palo Alto |
CA |
US |
|
|
Assignee: |
DANISCO US INC.
Palo Alto
CA
|
Family ID: |
42025792 |
Appl. No.: |
14/537638 |
Filed: |
November 10, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12616097 |
Nov 10, 2009 |
|
|
|
14537638 |
|
|
|
|
61113545 |
Nov 11, 2008 |
|
|
|
61113552 |
Nov 11, 2008 |
|
|
|
61113548 |
Nov 11, 2008 |
|
|
|
61218802 |
Jun 19, 2009 |
|
|
|
Current U.S.
Class: |
435/212 ;
435/264; 510/392 |
Current CPC
Class: |
C11D 3/38636 20130101;
C12N 9/50 20130101; C12N 9/54 20130101; C11D 3/38618 20130101; C11D
3/38609 20130101; C12Y 304/21062 20130101; C11D 3/386 20130101;
C11D 3/38645 20130101; C11D 3/38654 20130101 |
Class at
Publication: |
435/212 ;
435/264; 510/392 |
International
Class: |
C11D 3/386 20060101
C11D003/386; C12N 9/50 20060101 C12N009/50 |
Claims
1-22. (canceled)
23. A cleaning composition comprising a subtilisin, wherein said
variant comprises a combination of substitutions selected from:
TS87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109K,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109L/N185R/A215R,
S87R/G118R/S128L/P129Q/S130A/S101K/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109L,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/T213E/N248R,
S87R/G118R/S128L/P129Q/S130A/172V/S164I/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D,
S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109K,
S87N/G118V/S128L/P129Q/S130A/N43S/P52V/S101R/Q109R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/Q109L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/Q109R/S164I/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D/S101L,
S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109L,
S87N/G118V/S128L/P129Q/S130A/N76D/S164I,
S87R/G118R/S128L/P129Q/S130A/N76D/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/N248R,
S87R/G118R/S128L/P129Q/S130A/V118R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D/S101M,
S87N/G118V/S128L/P129Q/S130A/N18K/N76D/G97P/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/T213E/N248R,
S87R/G118R/S128L/P129Q/S130A/Q109L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/T213E/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/Q109L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101V/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101V/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/T213E/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/Q109L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101H/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101H/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/Q109R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109L/N185R/A215R,
S87R/G118R/S128L/P129Q/S130A/S101M/S188D/N248R,
N76D/S87R/G118R/S128L/P129Q/S130A/S188D,
N76D/S87R/G118R/S128L/P129Q/S130A/S188D/N248K,
S87N/G118V/G127S/S128L/P129Q/S130A,
S87N/S101H/G118V/S128L/P129Q/S130A,
S87N/S101K/G118V/S128L/P129Q/S130A,
S87N/S101V/G118V/S128L/P129Q/S130A,
S87N/S101Y/G118V/S128L/P129Q/S130A,
S87N/S101L/G118V/S128L/P129Q/S130A,
172V/S87N/G118V/S128L/P129Q/S130A//S164I, wherein the positions are
numbered by correspondence with the amino acid sequence of B.
amyloliquefaciens subtilisin BPN' set forth as SEQ ID NO:1.
24-38. (canceled)
39. The cleaning composition of claim 23, wherein said composition
comprises a liquid, gel, tablet, powder and/or granule
detergent.
40-47. (canceled)
48. The cleaning composition of claim 23, wherein said cleaning
composition is selected from laundry detergents and dish
detergents.
49-56. (canceled)
57. The cleaning composition of claim 48, comprising a laundry
detergent.
58. The cleaning composition of claim 57, wherein said laundry
detergent is a heavy duty detergent.
59. The cleaning composition of claim 48, comprising a dish
detergent selected from hand dishwashing and automatic dishwashing
detergents.
60. The cleaning composition of claim 23, further comprising at
least one bleaching agent.
61. The cleaning composition of claim 23, wherein said cleaning
composition is a phosphate-free or phosphate-containing
detergent.
62. The cleaning composition of claim 23, wherein said cleaning
composition is a cold water detergent.
63. The cleaning composition of claim 23, further comprising at
least one additional enzyme.
64. The cleaning composition of claim 63, wherein said at least one
additional enzyme is selected from hemicellulases, cellulases,
peroxidases, proteases, metalloproteases, xylanases, lipases,
phospholipases, esterases, perhydrolasess, cutinases, pectinases,
pectate lyases, mannanases, keratinases, reductases, oxidases,
phenoloxidases, lipoxygenases, ligninases, pullulanases, tannases,
pentosanases, malanases, .beta.-glucanases, arabinosidases,
hyaluronidase, chondroitinase, laccase, and amylases, or mixtures
thereof.
65. A method for cleaning comprising providing an item to be
cleaned and a composition comprising the cleaning composition set
forth in claim 23, and contacting said item with said composition,
under conditions effective to provide cleaning of said item.
66. The method of claim 65, further comprising the step of rinsing
said item after contacting said item with said cleaning
composition.
67. The method of claim 65, wherein said item to be cleaned
comprises dishware.
68. The method of claim 65, wherein said item to be cleaned
comprises fabric.
Description
[0001] The present application is a divisional application of U.S.
patent application Ser. No. 12/616,097, filed Nov. 10, 2009, which
claims priority to U.S. Provisional Patent Application Ser. Nos.
61/113,545, 61/113,552, and 61/113,548, all of which were filed on
Nov. 11, 2008, and 61/218,802, which was filed on Jun. 19, 2009,
all of which are herein incorporated by reference.
FIELD OF THE INVENTION
[0002] The present invention provides methods for protein
engineering and serine protease variants produced therefrom.
Specifically, the present invention provides serine protease
variants having one or more substitutions as compared to a
reference serine protease. In addition, the present invention
provides compositions comprising these serine protease variants. In
some embodiments, the present invention provides cleaning
compositions comprising at least one of these serine protease
variants.
BACKGROUND OF THE INVENTION
[0003] Various protein engineering methods are known to those in
the art. In general, proteins are modified in order to obtain
desired protein properties. In most methods, the nucleotide
sequence of a cloned gene encoding a protein is mutated and the
modified gene is expressed to produce mutants, which are screened
for activities of interest. Often, the mutant properties are
compared with the properties of wild-type protein.
[0004] Historically, the protein design process has been approached
as equivalent to the problem of finding in all of protein space the
one best sequence for the desired application. This problem is
extremely difficult and is "NP hard." In complexity theory,
problems defined as being in class P, are considered easy and
efficient, polynomial-time algorithms exist for their solution.
NP-hard problems are problems for which efficient polynomial-time
algorithms are not currently known, and if any NP-hard problem
could be solved, all NP-hard problems could be solved (See e.g.,
Pierce and Winfree, Protein Engineer., 15:779-782, 2002). Current
strategies for building and screening libraries generally involve
generating protein sequence diversity randomly across the whole
sequence or in controlled random fashion at defined positions
within the protein. These libraries generally have a large number
of members that are "negative" with respect to the primary property
of interest, and require large numbers be screened in order to find
the relatively small numbers of positive mutations. Generally,
negative mutations are ignored, and sequence information is only
obtained for the positive members.
[0005] Saturation mutagenesis (Estell et al., in World Biotech
Report 1984, vol. 2, USA, Online Publications, London, pp. 181-187,
1984; and Wells et al., Gene, 34:315-323, 1985) is one technique
that can be used to search protein space for mutations that
optimize several properties in a protein. Several groups have
developed strategies for identifying sites to be changed by
saturation mutagenesis (Reetz et al., Angew. Chem. Int Edn,
44:4192-4196, 2005; Kato et al., J Mol Biol, 351:683-692, 2005; and
Sandberg et al., Proc Natl Acad Sci USA, 90:8367-8371, 1993), but
no general system for site identification has been proposed.
[0006] In addition, because most protein engineering methods
produce a great number of amino acid mutation options, screening of
a large number of variants generally is required to produce a
desired protein property. Generally, screening is repeated multiple
times to produce a beneficial variant. Thus, most methods are
laborious and time-consuming. There is a continuing need in the art
for protein engineering methods that are efficient and produce the
desired results.
SUMMARY OF THE INVENTION
[0007] The present invention provides methods for protein
engineering. Specifically, the invention provides methods utilizing
site evaluation libraries. In particular, the present invention
provides means to use information obtained about a number of
desired properties, in order to rationally and efficiently design
libraries that will optimize those properties. In some embodiments,
the present invention provides means to design libraries that are
improved for at least two desired properties. The present invention
also provides serine protease variants having one or more
substitutions as compared to a reference serine protease, produced
using the protein engineering methods described herein.
[0008] The present invention provides means to identify positions
within an amino acid sequence of a protein that are relevant in
improving desired properties of the protein. In some particularly
preferred embodiments, the present invention provides means to
determine which mutations are desirable in order to produce
proteins with these desired properties, as well as improved
properties. In some additional particularly preferred embodiments,
the present invention provides means to identify amino acid
positions and mutations that have improvements of a particular
percentage better than the wild-type protein (e.g., better than
about 110% of the wild-type for one property). In still further
preferred embodiments, the present invention provides means to
identify mutations that provide at least one much improved property
and at least one additional property that is not significantly
worse than the wild-type protein (e.g., better than 110% of
wild-type for one property, yet not worse than 90% of wild-type for
another property). In yet further preferred embodiments, libraries
are constructed based on this information. In some embodiments, the
libraries are constructed using all of the identified mutations,
while in some other embodiments the libraries are constructed using
a subset of the identified mutations. Indeed, it is not intended
that the libraries be constrained to any particular number and/or
type of mutations.
[0009] The present invention provides methods for protein
engineering comprising the steps of: providing a library of protein
variants; testing the library of protein variants for at least one
property of interest in a test of interest; identifying a range of
values for at least one property of interest; identifying a minimum
within the range of values that is associated with a favorable
outcome in the test of interest; and providing a plurality of
protein variants having at least one mutation above the minimum in
the range of the at least one property of interest, thereby
providing a library of protein variants comprising at least one
mutation, and wherein the library is enriched in members having a
favorable outcome in the test of interest. In some embodiments, the
favorable outcome corresponds to a value of greater than about 50%,
about 60%, about 70%, about 80%, about 90%, or about 95% of a
maximal value observed in the test set forth in the first step
above. In some alternative embodiments, more than one test of
interest is used in the methods of the present invention. In some
preferred embodiments, the protein is an enzyme. In some
particularly preferred embodiments, the enzyme is selected from
proteases, transferases, metalloproteases, esterases, amylases,
cellulases, oxidases, cutinases, and lipases.
[0010] The present invention also provides methods for protein
engineering comprising the steps of: providing a library of protein
variants; testing the library of protein variants for at least two
properties of interest in a test of interest; identifying a range
of values for the at least two properties of interest; identifying
a minimum within the range of values that is associated with a
favorable outcome in the test of interest; and providing a
plurality of protein variants above the minimum of the range of the
at least two properties of interest, thereby providing a library of
protein variants enriched in members having the favorable outcome
in the test of interest. In some preferred embodiments, the
favorable outcome corresponds to a value of greater than about 50%,
about 60%, about 70%, about 80%, about 90%, or about 95% of a
maximal value observed in the test set forth in the first step
above. In some preferred embodiments, the protein is an enzyme. In
some particularly preferred embodiments, the enzyme is selected
from proteases, transferases, metalloproteases, esterases,
amylases, cellulases, oxidases, cutinases, and lipases.
[0011] The present invention also provides methods for protein
engineering comprising the steps of: providing a wild-type protein
and a library of protein variants of the wild-type protein; testing
the library of protein variants and the wild-type protein for at
least one property of interest in a test of interest; identifying a
range of values for the at least one property of interest;
identifying a minimum within the range of values that is associated
with a favorable outcome in the test of interest; identifying the
protein variants having a favorable outcome as compared to the
results obtained for the wild-type, wherein the favorable outcome
is an improved property of interest; and providing a plurality of
protein variants above the minimum of the range of the at least one
property of interest, thereby providing a library of improved
protein variants enriched in members having the favorable outcome
in the test of interest. In some preferred embodiments, the methods
further comprise the step of determining the performance index,
wherein the performance index is determined by dividing the value
obtained for each of the improved protein variants and the value
obtained for the wild-type protein. In some particularly preferred
embodiments, the methods further comprise the step of identifying
the improved protein variants, wherein the improved protein
variants achieve performance index values greater than about 1.1 in
the test of interest. In some additional embodiments, the protein
is an enzyme. In some particularly preferred embodiments, the
enzyme is selected from proteases, transferases, metalloproteases,
esterases, amylases, cellulases, oxidases, cutinases, and lipases.
In some alternative embodiments, the protein is selected from
antibodies and growth factors. In still additional preferred
embodiments, the wild-type protein is a mature form of an enzyme
selected from proteases, transferases, metalloproteases, esterases,
amylases, cellulases, oxidases, cutinases, and lipases. In some
preferred embodiments, the property of interest is selected from
charge, wash performance, hard surface cleaning performance,
thermal stability, storage stability, detergent stability,
substrate binding, enzyme inhibition, expression level, reaction
rate, and substrate degradation. In some embodiments, the wild-type
protein and the protein variant are components of at least one
detergent composition. In some preferred embodiments, wash
performance is tested in a detergent composition formulated into a
powdered or liquid detergent having a pH of between about 5 and
about 12.0.
[0012] The present invention also provides methods for producing an
improved variant of a reference protein within a protein fold,
comprising: assaying multiple variants of a test protein within the
protein fold spanning a range of a property of interest in an assay
of interest; identifying a minimum within the range of the property
of interest that is associated with a favorable outcome in the
assay of interest; assaying a reference protein of the protein fold
in the assay of interest; and producing an improved variant of the
reference protein by introducing an amino acid substitution is the
reference protein such that the improved variant is above the
minimum of the range of the property of interest. In some preferred
embodiments, the reference protein and the test protein are
different. In some embodiments, the methods further comprise the
step of determining the performance index, wherein the performance
index is determined by dividing the value obtained for the improved
protein variant and the value obtained for the reference protein.
In some embodiments, the test proteins and the reference proteins
are enzymes. In some particularly preferred embodiments, the
enzymes are selected from proteases, transferases,
metalloproteases, esterases, amylases, cellulases, oxidases,
cutinases, and lipases. In some alternative embodiments, the test
and reference proteins are selected from antibodies and growth
factors. In still additional preferred embodiments, the reference
protein is a mature form an enzyme selected from proteases,
transferases, metalloproteases, esterases, amylases, cellulases,
oxidases, cutinases, and lipases. In some preferred embodiments,
the property of interest is selected from charge, wash performance,
hard surface cleaning performance, thermal stability, storage
stability, detergent stability, substrate binding, enzyme
inhibition, expression level, reaction rate, and substrate
degradation. In some embodiments, the test and reference proteins
are components of at least one detergent composition. In some
alternative embodiment, the improved protein variant is a component
of a detergent composition. In some preferred embodiments, wash
performance is tested in a detergent composition formulated into a
powdered or liquid detergent having a pH of between about 5 and
about 12.0.
[0013] In some embodiments, the present invention provides cleaning
compositions comprising at least one serine protease variant
described herein. In some preferred embodiments, the cleaning
composition is a laundry detergent. In a subset of these
embodiments, the laundry detergent is a cold water detergent, a low
pH detergent, or a compact detergent. In other embodiments, the
cleaning composition is a dishwashing detergent. In some
embodiments, the dishwashing detergent is a phosphate-free
detergent, while in other embodiments the dishwashing detergent is
a phosphate-containing detergent. In some preferred embodiments,
the cleaning compositions further comprise at least one additional
enzyme, which in particularly preferred embodiments is selected
from a neutral metalloprotease, a lipase, a cutinase, an amylase, a
carbohydrase, a cellulase, a pectinase, a mannanase, an arabinase,
a galactanase, a xylanase, an oxidase, and a peroxidase. Also
provided by the present invention are isolated nucleic acids
encoding the serine protease variant, expression vectors comprising
the nucleic acid, and host cells comprising the expression
vector.
[0014] In addition, the present invention provides methods for
producing a serine protease variant of a Bacillus serine protease,
comprising: transforming a host cell with an expression vector
comprising a nucleic acid encoding the serine protease variant; and
cultivating the transformed host cell under conditions suitable for
the production of the serine protease variant. In some embodiments,
the methods further comprise the step of harvesting the produced
serine protease variant. In some embodiments, the host cell is a
Bacillus species, and in a subset of these embodiments, the
Bacillus species is B. subtilis. Furthermore, the present invention
provides methods of cleaning, comprising the step of contacting a
surface and/or an article comprising a fabric with a cleaning
composition comprising an isolated serine protease variant. In some
alternative methods, the present invention provides methods of
cleaning, comprising the step of contacting a surface and/or an
article comprising dishware with a cleaning composition comprising
an isolated serine protease variant.
[0015] Additionally the present invention provides methods for
protease engineering comprising the steps of: a) providing a
plurality of site evaluation libraries (SELs) each comprising a
plurality of protease variants having distinct substitutions at an
identical amino acid position of the protease; b) testing the
protease variants of the SELs and a standard protease in a test of
a property of interest; c) determining a performance index (PI) for
each of the protease variants for the test; d) identifying two or
more of the amino acid positions as non-restrictive positions,
wherein at least one of the plurality of protease variants in each
of two of the SELs has a PI greater than about 0.5; and f)
providing a multiple mutation library comprising a plurality of
multiply-substituted protease variants each comprising
substitutions in the two or more non-restrictive positions. In some
embodiments, the test comprises two or more different assays
selected from stain removal assays (microswatch), LAS stability
assays, detergent stability assays, and specific activity assays.
In some further embodiments, additional and/or alternative assay
methods find use.
[0016] In some further embodiments, the present invention provides
methods for producing a multiply substituted serine protease
variant of a Bacillus serine protease, comprising: testing a
plurality of singly-substituted serine protease variants in a first
test of a first property and a second test of a second property,
wherein the property of a reference serine protease is given a
value of 1.0 in each test, a favorable first or second property has
a value greater than 1.0, and an unduly unfavorable first or second
property has a value less than about 0.80 or in some preferred
embodiments, less than about 0.60; identifying a substitution in at
least one of the singly-substituted serine protease variants that
is associated with a favorable first property and which is not
associated with an unduly unfavorable second property; identifying
a substitution in at least one of the singly-substituted serine
protease variants that is associated with a favorable second
property and which is not associated with an unduly unfavorable
first property; and introducing the substitution from the previous
steps into a serine protease to yield a multiply-substituted serine
protease variant. In some embodiments, the methods further comprise
testing the multiply-substituted serine protease variant in the
first test and the second test, wherein an improved serine protease
variant achieves a value of greater than about 1.0 in both of the
first and second tests, or a value of greater than 1.0 in the first
test and a value of about 0.80 to about 1.0 in the second test. In
some embodiments, the methods further comprise producing the
improved serine protease variant(s). In some embodiments, the first
and second properties are negatively correlated. In some
embodiments, a favorable first or second property has a value
greater than about 1.2. In some embodiments, an unduly unfavorable
first or second property has a value less than about 0.40. In some
embodiments, the first property is stability, and the second
property is wash performance. In a subset of these the stability
comprises stability in detergent and wash performance comprises
blood milk ink (BMI) wash performance in detergent. In some
embodiments, the reference bacterial serine protease is a wild type
mature form of a B. amyloliquefaciens serine protease BPN' having
an amino acid sequence set forth as SEQ ID NO:1. In other
embodiments, the reference bacterial serine protease is a wild type
of GG36 serine protease having an amino acid sequence set forth as
SEQ ID NO:2 (i.e., the reference bacterial serine protease used to
produce "GG36 variants"). In some embodiments of the present
invention, wash performance is tested in a powder or liquid
detergent composition having a pH of between about 5 and about
12.0. It is not intended that the steps be limited to the exact
order listed above, as any suitable order finds use in the present
invention. However in some preferred embodiments, the substitutions
are in positions in a reference serine protease having a solvent
accessible surface (SAS) of greater than about 50% or greater than
about 65%.
[0017] In addition the present invention provides subtilisin
variants, wherein the variants are mature forms having proteolytic
activity and comprising a substitution at one or more (preferably
1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more) positions selected
from: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 22, 24, 25, 26, 27, 28, 29, 30, 31, 33, 34, 35, 36,
37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53,
54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 66, 67, 68, 69, 71, 72, 73,
74, 75, 76, 77, 78, 79, 80, 81, 82, 84, 85, 86, 87, 88, 89, 90, 91,
92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106,
107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119,
120, 121, 122, 123, 124, 126, 127, 128, 129, 130, 131, 132, 133,
134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146,
147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159,
160, 161, 162, 163, 164, 165, 166, 167, 169, 170, 171, 172, 173,
174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212, 213,
214, 215, 216, 217, 218, 219, 220, 222, 223, 224, 225, 226, 227,
228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238, 239, 240,
241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251, 252, 253,
254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264, 265, 266,
267, 268, 269, 270, 271, 272, 273, 274 and 275 and wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1.
In some preferred embodiments, the substitution comprises one or
more of: X001A, X001C, X001E, X001F, X001G, X001H, X001I, X001K,
X001L, X001N, X001P, X001Q, X001R, X001S, X001T, X001V, X001Y,
X002A, X002C, X002E, X002G, X002K, X002L, X002M, X002N, X002P,
X002Q, X002R, X002S, X002T, X002V, X002W, X002Y, X003D, X003E,
X003F, X003G, X003H, X003I, X003L, X003M, X003N, X003P, X003R,
X003S, X003T, X003V, X003W, X003Y, X004A, X004C, X004D, X004E,
X004F, X004G, X004H, X004K, X004L, X004N, X004P, X004R, X004S,
X004T, X004V, X004W, X005A, X005C, X005D, X005E, X005G, X005I,
X005M, X005P, X005Q, X005S, X005T, X005W, X005Y, X006A, X006D,
X006E, X006M, X006W, X007A, X007C, X007D, X007G, X007H, X007N,
X007P, X007Q, X007S, X007T, X008A, X008F, X008G, X008I, X008L,
X008M, X008Q, X008T, X008V, X008W, X008Y, X009A, X009C, X009D,
X009E, X009F, X009G, X009H, X009L, X009N, X009P, X009Q, X009R,
X009S, X009T, X009V, X009W, X009Y, X010A, X010C, X010F, X010G,
X010H, X010I, X010K, X010L, X010M, X010N, X010Q, X010R, X010S,
X010T, X010V, X010W, X010Y, X011A, X011C, X011D, X011G, X011I,
X011M, X011R, X011S, X011T, X011V, X011Y, X012D, X012F, X012G,
X012H, X012I, X012K, X012L, X012M, X012N, X012P, X012Q, X012R,
X012S, X012T, X012V, X012W, X012Y, X013A, X013G, X013I, X013M,
X013Q, X013T, X013V, X014A, X014C, X014D, X014E, X014F, X014G,
X014H, X014I, X014K, X014L, X014P, X014Q, X014S, X014T, X014V,
X014Y, X015A, X015D, X015F, X015G, X015I, X015K, X015L, X015M,
X015P, X015Q, X015R, X015S, X015V, X015W, X016A, X016D, X016E,
X016G, X016L, X016N, X016P, X016Q, X016R, X016S, X016T, X016V,
X017A, X017D, X017E, X017F, X017G, X017H, X017I, X017K, X017M,
X017N, X017R, X017S, X017T, X017V, X017W, X017Y, X018A, X018C,
X018D, X018E, X018F, X018G, X018H, X018I, X018K, X018L, X018M,
X018N, X018P, X018Q, X018R, X018S, X018T, X018V, X018W, X018Y,
X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K, X019L,
X019M, X019N, X019P, X019R, X019S, X019T, X019V, X019W, X019Y,
X020A, X020C, X020D, X020F, X020G, X020I, X020K, X020L, X020M,
X020P, X020Q, X020R, X020S, X020T, X020V, X020W, X020Y, X021A,
X021C, X021D, X021E, X021G, X021H, X021I, X021K, X021L, X021M,
X021N, X021P, X021Q, X021R, X021S, X021T, X021V, X021W, X022A,
X022C, X022G, X022I, X022K, X022L, X022M, X022N, X022P, X022Q,
X022R, X022S, X022T, X022V, X022W, X022Y, X023A, X023G, X023S,
X024A, X024C, X024D, X024F, X024G, X024H, X024L, X024M, X024N,
X024P, X024Q, X024R, X024S, X024T, X024V, X024W, X025C, X025D,
X025E, X025F, X025G, X025H, X025K, X025L, X025M, X025N, X025Q,
X025R, X025S, X025T, X025V, X025W, X026C, X026F, X026G, X026I,
X026L, X026M, X026N, X026P, X026R, X026S, X026T, X026V, X027A,
X027C, X027D, X027F, X027G, X027I, X027K, X027L, X027M, X027N,
X027P, X027R, X027S, X027T, X027V, X027W, X027Y, X028A, X028E,
X028G, X028H, X028I, X028L, X028M, X028N, X028P, X028S, X028V,
X028Y, X029A, X029C, X029G, X029I, X029K, X029S, X029T, X029V,
X030A, X030C, X030D, X030E, X030F, X030G, X030L, X030M, X030Q,
X030S, X030T, X030V, X031A, X031F, X031I, X031L, X031M, X031S,
X031T, X031V, X032A, X032C, X032D, X032E, X032G, X032V, X032W,
X033A, X033C, X033D, X033E, X033G, X033H, X033I, X033L, X033M,
X033N, X033Q, X033R, X033S, X033T, X033V, X033Y, X034E, X034G,
X034H, X034L, X034Q, X034S, X035A, X035F, X035H, X035I, X035K,
X035L, X035M, X035P, X035Q, X035R, X035S, X035A, X035C, X035E,
X035F, X035G, X035H, X035I, X035L, X035M, X035N, X035P, X035Q,
X035R, X035T, X035V, X035W, X035Y, X038C, X038F, X038G, X038H,
X038I, X038K, X038L, X038M, X038N, X038Q, X038R, X038T, X038V,
X038W, X038Y, X039A, X039E, X039G, X039H, X039L, X039M, X039N,
X039Q, X039S, X039T, X039V, X039Y, X040A, X040C, X040D, X040E,
X040G, X040H, X040I, X040K, X040L, X040M, X040N, X040P, X040R,
X040S, X040T, X040V, X040W, X040Y, X041C, X041D, X041E, X041N,
X041P, X041Q, X041S, X042A, X042C, X042F, X042G, X042H, X042I,
X042L, X042M, X042N, X042Q, X042S, X042T, X042V, X042Y, X043A,
X043C, X043D, X043E, X043F, X043G, X043I, X043L, X043M, X043N,
X043P, X043R, X043S, X043T, X043V, X043W, X043Y, X044A, X044C,
X044D, X044F, X044G, X044I, X044K, X044L, X044M, X044N, X044P,
X044Q, X044R, X044S, X044T, X044V, X044W, X044Y, X045A, X045D,
X045F, X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P,
X045Q, X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D,
X046E, X046F, X046G, X046H, X046I, X046K, X046L, X046M, X046N,
X046P, X046Q, X046R, X046S, X046T, X046V, X046W, X047A, X047C,
X047E, X047F, X047G, X047H, X047K, X047L, X047M, X047N, X047P,
X047Q, X047R, X047S, X047T, X047W, X048A, X048C, X048E, X048F,
X048G, X048H, X048I, X048K, X048L, X048M, X048N, X048P, X048Q,
X048R, X048S, X048T, X048V, X048Y, X049A, X049E, X049F, X049G,
X049H, X049K, X049L, X049M, X049P, X049Q, X049R, X049S, X049T,
X050C, X050F, X050G, X050H, X050I, X050L, X050N, X050T, X050V,
X050Y, X051F, X051G, X051H, X051K, X051L, X051N, X051P, X051R,
X051S, X051T, X051V, X051W, X052A, X052C, X052E, X052F, X052G,
X052H, X052I, X052L, X052M, X052N, X052P, X052Q, X052R, X052T,
X052V, X052W, X052Y, X053A, X053C, X053D, X053E, X053G, X053H,
X053I, X053K, X053L, X053M, X053P, X053Q, X053R, X053S, X053T,
X053V, X053W, X053Y, X054A, X054C, X054D, X054E, X054F, X054G,
X054H, X054I, X054K, X054L, X054M, X054N, X054P, X054Q, X054R,
X054S, X054V, X054W, X054Y, X055A, X055C, X055E, X055F, X055G,
X055H, X055I, X055K, X055L, X055M, X055N, X055P, X055Q, X055R,
X055S, X055T, X055W, X055Y, X056A, X056C, X056D, X056E, X056H,
X056L, X056M, X056N, X056P, X056Q, X056R, X056S, X056T, X056V,
X057A, X057C, X057E, X057F, X057G, X057H, X057I, X057K, X057L,
X057M, X057N, X057P, X057Q, X057R, X057S, X057T, X057V, X057W,
X057Y, X059A, X059C, X059D, X059E, X059F, X059G, X059I, X059K,
X059L, X059M, X059N, X059P, X059Q, X059R, X059S, X059T, X059V,
X059W, X059Y, X060A, X060C, X060D, X060F, X060G, X060K, X060L,
X060M, X060N, X060P, X060Q, X060S, X060T, X060V, X060W, X060Y,
X061A, X061C, X061D, X061F, X061G, X061H, X061I, X061L, X061M,
X061N, X061P, X061R, X061S, X061T, X061V, X061Y, X062C, X062E,
X062F, X062G, X062H, X062I, X062K, X062L, X062M, X062N, X062P,
X062Q, X062R, X062S, X062T, X062V, X062Y, X063A, X063C, X063D,
X063E, X063F, X063G, X063H, X063I, X063K, X063M, X063P, X063Q,
X063R, X063S, X063T, X063V, X063W, X064H, X064S, X065G, X066A,
X066C, X066D, X066E, X066I, X066K, X066L, X066N, X066Q, X066S,
X066T, X067A, X067C, X067F, X067H, X067L, X067M, X067N, X067P,
X067Q, X067R, X067S, X067T, X067V, X068A, X068C, X068D, X068E,
X068G, X068H, X068I, X068L, X068M, X068N, X068Q, X068S, X068T,
X068V, X069A, X069C, X069E, X069F, X069G, X069I, X069L, X069M,
X069N, X069P, X069R, X069S, X069T, X069V, X069W, X070G, X071A,
X071C, X071D, X071E, X071G, X071I, X071L, X071M, X071N, X071P,
X071S, X071T, X071V, X071W, X072C, X072D, X072F, X072H, X072I,
X072K, X072L, X072M, X072N, X072Q, X072S, X072T, X072V, X072W,
X073A, X073C, X073D, X073E, X073H, X073K, X073L, X073N, X073R,
X073S, X073T, X073V, X074A, X074C, X074S, X074T, X075A, X075C,
X075D, X075E, X075F, X075G, X075H, X075I, X075L, X075M, X075N,
X075P, X075Q, X075R, X075S, X075T, X075V, X075W, X076C, X076D,
X076E, X076F, X076G, X076H, X076I, X076K, X076L, X076M, X076N,
X076Q, X076R, X076S, X076T, X076W, X076Y, X077A, X077C, X077D,
X077E, X077F, X077G, X077H, X077K, X077L, X077M, X077N, X077Q,
X077R, X077S, X077V, X077Y, X078A, X078C, X078E, X078F, X078G,
X078H, X078I, X078K, X078L, X078M, X078N, X078P, X078Q, X078R,
X078S, X078T, X078V, X078W, X078Y, X079C, X079D, X079E, X079F,
X079G, X079I, X079K, X079L, X079M, X079N, X079P, X079Q, X079R,
X079S, X079T, X079V, X079W, X079Y, X080A, X080D, X080E, X080G,
X080K, X080L, X080M, X080R, X080T, X080V, X080W, X080Y, X081A,
X081C, X081D, X081E, X081F, X081G, X081H, X081I, X081K, X081L,
X081M, X081P, X081Q, X081R, X081S, X081T, X081V, X081W, X081Y,
X082A, X082E, X082F, X082G, X082K, X082L, X082M, X082N, X082Q,
X082R, X082S, X082T, X082V, X082W, X082Y, X083G, X083S, X084C,
X084E, X084F, X084G, X084H, X084I, X084L, X084M, X084N, X084Q,
X084S, X084T, X084V, X085A, X085C, X085I, X085L, X085N, X086A,
X086C, X086D, X086E, X086G, X086I, X086L, X086P, X086R, X086S,
X086V, X086W, X086Y, X087A, X087C, X087D, X087E, X087F, X087G,
X087I, X087K, X087L, X087N, X087P, X087T, X087V, X087Y, X088A,
X088C, X088D, X088E, X088G, X088H, X088K, X088M, X088Q, X088R,
X088S, X088V, X088W, X089A, X089C, X089D, X089E, X089F, X089G,
X089H, X089I, X089L, X089N, X089P, X089Q, X089R, X089S, X089T,
X089V, X089W, X090A, X090C, X090E, X090F, X090G, X090I, X090K,
X090L, X090M, X090P, X090Q, X090T, X090V, X090W, X090Y, X091C,
X091D, X091F, X091I, X091K, X091L, X091M, X091N, X091Q, X091R,
X091S, X091T, X091V, X091W, X091Y, X092A, X092C, X092D, X092E,
X092F, X092G, X092H, X092I, X092K, X092L, X092N, X092P, X092Q,
X092R, X092T, X092V, X092W, X092Y, X093A, X093C, X093D, X093F,
X093G, X093L, X093M, X093N, X093P, X093S, X093T, X093V, X093W,
X093Y, X094A, X094D, X094E, X094G, X094H, X094I, X094K, X094L,
X094M, X094N, X094Q, X094R, X094V, X095A, X095C, X095E, X095G,
X095I, X095K, X095L, X095M, X095R, X095S, X095T, X095V, X095W,
X096A, X096E, X096F, X096G, X096H, X096I, X096L, X096M, X096Q,
X096R, X096S, X096T, X096W, X096Y, X097A, X097D, X097E, X097F,
X097G, X097H, X097I, X097K, X097L, X097M, X097N, X097P, X097Q,
X097R, X097S, X097T, X097V, X097W, X097Y, X098A, X098C, X098D,
X098E, X098F, X098G, X098K, X098L, X098N, X098P, X098Q, X098R,
X098S, X098T, X098V, X098Y, X099A, X099C, X099F, X099G, X099K,
X099M, X099P, X099Q, X099R, X099S, X099T, X099V, X099Y, X100D,
X100E, X100F, X100G, X100I, X100K, X100L, X100M, X100N, X100P,
X100Q, X100R, X100S, X100T, X100V, X100W, X100Y, X101A, X101C,
X101D, X101E, X101F, X101G, X101H, X101I, X101K, X101N, X101P,
X101Q, X101R, X101S, X101T, X101V, X101Y, X102A, X102C, X102D,
X102E, X102F, X102G, X102H, X102M, X102N, X102T, X103A, X103C,
X103D, X103E, X103F, X103G, X103I, X103L, X103N, X103P, X103Q,
X103R, X103S, X103T, X103V, X103W, X103Y, X104A, X104C, X104D,
X104E, X104F, X104G, X104H, X104I, X104L, X104P, X104R, X104S,
X104T, X104V, X104W, X104Y, X105A, X105C, X105D, X105E, X105F,
X105G, X105H, X105I, X105K, X105L, X105M, X105N, X105Q, X105R,
X105S, X105T, X105V, X105W, X105Y, X106A, X106D, X106E, X106F,
X106G, X106I, X106L, X106M, X106P, X106R, X106S, X106T, X106V,
X106W, X107A, X107C, X107E, X107F, X107H, X107I, X107L, X107M,
X107Q, X107S, X107T, X107V, X107W, X107Y, X108A, X108C, X108F,
X108G, X108I, X108L, X108M, X108Q, X108S, X108T, X108V, X109A,
X109C, X109E, X109F, X109G, X109H, X109I, X109K, X109L, X109M,
X109N, X109P, X109Q, X109R, X109S, X109T, X109W, X109Y, X110A,
X110G, X110S, X111A, X111C, X111E, X111F, X111I, X111L, X111M,
X111P, X111T, X111V, X111Y, X112A, X112C, X112D, X112E, X112F,
X112G, X112I, X112L, X112M, X112N, X112Q, X112S, X112T, X112V,
X112W, X112Y, X113A, X113C, X113D, X113E, X113L, X113M, X113N,
X113S, X113V, X113W, X114A, X114C, X114G, X114T, X115C, X115E,
X115F, X115G, X115H, X115I, X115K, X115L, X115M, X115N, X115P,
X115Q, X115R, X115S, X115T, X115V, X115W, X115Y, X116A, X116C,
X116D, X116F, X116G, X116I, X116K, X116L, X116M, X116N, X116Q,
X116S, X116T, X116V, X116W, X117A, X117C, X117D, X117F, X117G,
X117I, X117N, X117Q, X117R, X117T, X117Y, X118A, X118C, X118D,
X118E, X118F, X118G, X118I, X118K, X118L, X118M, X118N, X118P,
X118R, X118S, X118T, X118V, X118W, X119A, X119C, X119E, X119F,
X119G, X119H, X119K, X119M, X119N, X119P, X119Q, X119T, X119W,
X120A, X120C, X120E, X120F, X120G, X120H, X120I, X120L, X120M,
X120N, X120R, X120S, X120T, X120W, X121A, X121C, X121E, X121F,
X121G, X121I, X121K, X121L, X121M, X121Q, X121S, X121T, X121V,
X121Y, X122A, X122C, X122G, X122I, X122L, X122S, X122T, X122V,
X123E, X123G, X123I, X123L, X123M, X123N, X123P, X123S, X123V,
X124G, X124H, X124L, X124N, X124Q, X124S, X124T, X124Y, X125A,
X125C, X125G, X125P, X125S, X125T, X126A, X126C, X126E, X126F,
X126G, X126H, X126I, X126K, X126L, X126M, X126N, X126Q, X126S,
X126T, X126V, X126W, X126Y, X127D, X127F, X127G, X127I, X127L,
X127Q, X127R, X127S, X127T, X127V, X128A, X128C, X128D, X128F,
X128G, X128H, X128I, X128K, X128L, X128M, X128N, X128P, X128Q,
X128R, X128S, X128T, X128W, X128Y, X129A, X129E, X129F, X129G,
X129I, X129L, X129M, X129N, X129P, X129R, X129S, X129T, X129V,
X129W, X129Y, X130C, X130K, X130L, X130N, X130P, X130Q, X130R,
X130S, X130V, X130W, X130Y, X131A, X131D, X131E, X131F, X131G,
X131I, X131K, X131L, X131M, X131P, X131Q, X131R, X131V, X132A,
X132E, X132F, X132H, X132I, X132L, X132M, X132N, X132Q, X132R,
X132S, X132T, X132W, X133A, X133F, X133K, X133L, X133N, X133P,
X133Q, X133S, X133T, X133V, X133Y, X134A, X134F, X134I, X134L,
X134M, X134P, X134S, X134T, X134V, X135A, X135C, X135E, X135F,
X135L, X135M, X135Q, X135T, X135W, X136A, X136D, X136E, X136F,
X136G, X136K, X136M, X136N, X136Q, X136R, X136S, X136V, X136W,
X136Y, X137A, X137C, X137E, X137G, X137H, X137K, X137L, X137M,
X137Q, X137R, X137S, X137V, X137W, X138A, X138C, X138E, X138G,
X138H, X138L, X138M, X138Q, X138R, X138V, X139A, X139C, X139E,
X139F, X139G, X139I, X139M, X139Q, X139S, X139T, X139V, X139Y,
X140A, X140C, X140D, X140E, X140F, X140G, X140I, X140K, X140L,
X140M, X140N, X140Q, X140R, X140S, X140T, X140V, X140Y, X141D,
X141E, X141G, X141H, X141I, X141K, X141L, X141N, X141Q, X141R,
X141S, X141V, X141Y, X142A, X142C, X142E, X142G, X142I, X142L,
X142M, X142N, X142Q, X142S, X142T, X142V, X142Y, X143C, X143D,
X143F, X143G, X143H, X143I, X143K, X143L, X143M, X143N, X143R,
X143S, X143T, X143V, X143W, X143Y, X144A, X144C, X144D, X144G,
X144H, X144I, X144L, X144M, X144N, X144Q, X144R, X144S, X144T,
X144V, X144W, X144Y, X145A, X145C, X145D, X145E, X145F, X145G,
X145K, X145L, X145M, X145N, X145Q, X145R, X145S, X145T, X145W,
X145Y, X146A, X146C, X146D, X146E, X146F, X146G, X146I, X146K,
X146L, X146M, X146Q, X146R, X146S, X146T, X146W, X146Y, X147F,
X147G, X147I, X147L, X147M, X147P, X147Q, X147T, X147V, X148A,
X148C, X148E, X148F, X148G, X148H, X148I, X148L, X148M, X148N,
X148S, X148T, X148V, X148W, X148Y, X149A, X149C, X149F, X149G,
X149H, X149I, X149L, X149M, X149P, X149Q, X149S, X149T, X149V,
X150A, X150E, X150F, X150G, X150H, X150L, X150P, X150Q, X150S,
X150T, X150V, X151A, X151G, X151M, X151S, X151T, X151V, X152A,
X152C, X152P, X152R, X152S, X152T, X152V, X153A, X153E, X153F,
X153G, X153I, X153M, X153N, X153Q, X153S, X153V, X153Y, X154A,
X154C, X154G, X154N, X154Q, X154S, X155A, X155D, X155E, X155F,
X155I, X155L, X155N, X155P, X155Q, X155R, X155S, X155T, X155V,
X155Y, X156A, X156C, X156D, X156E, X156F, X156G, X156I, X156K,
X156L, X156M, X156N, X156P, X156Q, X156R, X156S, X156T, X156V,
X156Y, X157A, X157C, X157D, X157G, X157K, X157L, X157Q, X157R,
X157S, X157V, X158A, X158C, X158E, X158F, X158H, X158K, X158L,
X158M, X158P, X158Q, X158R, X158S, X158T, X158V, X158W, X159A,
X159C, X159E, X159G, X159H, X159L, X159M, X159P, X159Q, X159R,
X159S, X159V, X159W, X159Y, X160A, X160C, X160D, X160F, X160G,
X160I, X160L, X160M, X160N, X160Q, X160R, X160S, X160T, X160V,
X160Y, X165A, X165C, X165D, X165E, X165F, X165G, X165H, X165I,
X165K, X165L, X165M, X165P, X165R, X165S, X165T, X165V, X165W,
X165Y, X166A, X166C, X166D, X166E, X166F, X166H, X166I, X166L,
X166M, X166N, X166P, X166R, X166S, X166T, X166V, X166W, X166Y,
X167A, X167C, X167D, X167E, X167F, X167G, X167H, X167I, X167K,
X167L, X167M, X167N, X167P, X167Q, X167R, X167S, X167T, X167V,
X167W, X167Y, X168A, X168C, X168F, X168I, X168M, X168N, X168P,
X168S, X168T, X168V, X169A, X169C, X169G, X169I, X169L, X169S,
X170A, X170D, X170E, X170G, X170H, X170K, X170L, X170N, X170P,
X170Q, X170R, X170S, X170V, X170W, X170Y, X171A, X171C, X171D,
X171E, X171F, X171G, X171H, X171I, X171L, X171M, X171N, X171Q,
X171S, X171T, X171V, X171W, X171Y, X172A, X172C, X172D, X172F,
X172G, X172I, X172K, X172L, X172M, X172P, X172Q, X172R, X172S,
X172T, X172V, X172W, X172Y, X173A, X173C, X173D, X173E, X173F,
X173G, X173H, X173I, X173K, X173L, X173M, X173N, X173P, X173Q,
X173R, X173T, X173V, X173W, X173Y, X174A, X174G, X174I, X174N,
X174P, X174S, X174T, X174V, X175A, X175C, X175E, X175G, X175H,
X175I, X175K, X175L, X175M, X175Q, X175S, X175T, X175V, X175W,
X175Y, X176A, X176C, X176E, X176G, X176I, X176K, X176P, X176S,
X176T, X176V, X177A, X177C, X177I, X177T, X177V, X178A, X178G,
X178S, X178T, X179A, X179C, X179G, X179H, X179I, X180C, X180G,
X180H, X180I, X180L, X180N, X180Q, X180S, X180T, X180V, X181A,
X181D, X181E, X181G, X181H, X181L, X181M, X181N, X182A, X182D,
X182E, X182F, X182G, X182H, X182I, X182K, X182L, X182M, X182N,
X182P, X182Q, X182R, X182S, X182T, X182V, X182W, X182Y, X183A,
X183D, X183F, X183G, X183H, X183I, X183K, X183L, X183M, X183N,
X183P, X183Q, X183R, X183S, X183T, X183V, X183W, X183Y, X184A,
X184C, X184D, X184E, X184F, X184G, X184H, X184L, X184M, X184N,
X184S, X184T, X184W, X184Y, X185A, X185C, X185E, X185F, X185G,
X185H, X185I, X185K, X185L, X185M, X185N, X185Q, X185R, X185S,
X185T, X185V, X185Y, X186A, X186C, X186G, X186H, X186I, X186K,
X186L, X186M, X186N, X186P, X186Q, X186R, X186S, X186T, X186W,
X187A, X187C, X187D, X187E, X187F, X187G, X187H, X187I, X187L,
X187M, X187N, X187P, X187Q, X187S, X187T, X187V, X187W, X187Y,
X188A, X188D, X188E, X188F, X188G, X188H, X188I, X188K, X188L,
X188P, X188Q, X188R, X188S, X188T, X188V, X188W, X188Y, X189A,
X189C, X189E, X189F, X189G, X189H, X189K, X189L, X189M, X189N,
X189P, X189Q, X189R, X189S, X189T, X189V, X189Y, X190A, X190D,
X190E, X190F, X190G, X190H, X190I, X190K, X190L, X190M, X190N,
X190P, X190Q, X190R, X190S, X190V, X190W, X190Y, X191A, X191D,
X191E, X191F, X191H, X191I, X191K, X191L, X191P, X191Q, X191R,
X191S, X191T, X191V, X191W, X191Y, X192C, X192D, X192E, X192G,
X192H, X192I, X192K, X192L, X192M, X192N, X192P, X192Q,
X192R, X192S, X192T, X192V, X192W, X192Y, X193A, X193D, X193E,
X193F, X193G, X193H, X193I, X193K, X193L, X193R, X193S, X193T,
X193V, X193W, X193Y, X194A, X194C, X194D, X194E, X194F, X194G,
X194H, X194I, X194L, X194M, X194P, X194Q, X194R, X194S, X194T,
X194V, X194W, X194Y, X195A, X195C, X195D, X195E, X195F, X195G,
X195I, X195K, X195L, X195Q, X195R, X195S, X195T, X195V, X195W,
X195Y, X196A, X196D, X196E, X196F, X196I, X196L, X196M, X196P,
X196Q, X196T, X196V, X196Y, X197A, X197C, X197D, X197E, X197F,
X197G, X197H, X197I, X197L, X197M, X197N, X197Q, X197R, X197S,
X197T, X197V, X197W, X197Y, X198A, X198D, X198E, X198F, X198G,
X198H, X198I, X198L, X198M, X198N, X198Q, X198R, X198S, X198T,
X198W, X198Y, X199A, X199C, X199D, X199E, X199F, X199G, X199H,
X199I, X199L, X199M, X199Q, X199S, X199T, X199V, X199W, X200A,
X200C, X200G, X200H, X200I, X200S, X201C, X201G, X201P, X201S,
X201T, X201V, X202F, X202G, X203A, X203C, X203E, X203F, X203G,
X203H, X203I, X203K, X203L, X203N, X203R, X203S, X203T, X203V,
X203W, X203Y, X204A, X204C, X204E, X204F, X204G, X204I, X204K,
X204L, X204N, X204P, X204R, X204S, X204T, X204W, X204Y, X205A,
X205F, X205G, X205I, X205L, X205M, X205Q, X205T, X205V, X206A,
X206C, X206D, X206E, X206F, X206G, X206H, X206I, X206K, X206L,
X206N, X206P, X206Q, X206R, X206S, X206T, X206V, X206W, X206Y,
X207A, X207G, X207H, X207S, X208A, X208C, X208L, X208N, X208P,
X208S, X208T, X208V, X209A, X209C, X209D, X209E, X209F, X209G,
X209H, X209I, X209K, X209L, X209M, X209N, X209R, X209S, X209T,
X209V, X209W, X209Y, X210A, X210C, X210D, X210E, X210F, X210G,
X210H, X210I, X210L, X210M, X210N, X210P, X210Q, X210R, X210S,
X210V, X210W, X210Y, X211A, X211C, X211E, X211F, X211G, X211H,
X211I, X211L, X211M, X211P, X211Q, X211R, X211T, X211V, X211W,
X211Y, X212C, X212F, X212G, X212H, X212I, X212M, X212N, X212P,
X212R, X212S, X212T, X212V, X212Y, X213A, X213C, X213D, X213E,
X213F, X213G, X213I, X213K, X213L, X213M, X213N, X213P, X213Q,
X213R, X213S, X213T, X213V, X213W, X213Y, X214A, X214C, X214E,
X214F, X214G, X214H, X214I, X214K, X214L, X214M, X214N, X214P,
X214Q, X214R, X214S, X214T, X214V, X214W, X214Y, X215A, X215C,
X215D, X215E, X215F, X215G, X215H, X215I, X215K, X215M, X215N,
X215P, X215R, X215S, X215T, X215V, X215W, X215Y, X216A, X216C,
X216D, X216E, X216F, X216G, X216H, X216I, X216K, X216L, X216M,
X216N, X216P, X216Q, X216R, X216S, X216V, X216W, X216Y, X217A,
X217C, X217D, X217E, X217F, X217G, X217I, X217K, X217L, X217M,
X217N, X217Q, X217S, X217T, X217V, X217Y, X218C, X218D, X218E,
X218F, X218G, X218H, X218I, X218L, X218M, X218N, X218P, X218Q,
X218R, X218S, X218T, X218V, X218W, X218Y, X219A, X219G, X219S,
X220A, X220C, X220G, X220H, X220N, X220S, X220T, X220V, X221G,
X221S, X221T, X222A, X222C, X222E, X222F, X222G, X222I, X222K,
X222L, X222M, X222N, X222P, X222Q, X222R, X222S, X222T, X222V,
X222W, X223A, X223C, X223G, X223M, X223S, X223T, X224A, X224D,
X224E, X224G, X224I, X224L, X224M, X224N, X224P, X224S, X224T,
X225A, X225C, X225G, X225I, X225N, X225P, X225S, X225T, X225V,
X226C, X226F, X226G, X226H, X226I, X226L, X226M, X226N, X226R,
X226S, X226T, X226V, X226Y, X227A, X227C, X227F, X227G, X227I,
X227L, X227M, X227P, X227Q, X227S, X227T, X227V, X227Y, X228A,
X228C, X228G, X228I, X228L, X228M, X228P, X228S, X228V, X229A,
X229G, X229P, X229S, X230A, X230D, X230E, X230F, X230G, X230H,
X230I, X230L, X230N, X230P, X230Q, X230S, X230T, X230V, X230W,
X230Y, X231A, X231C, X231F, X231G, X231H, X231I, X231L, X231S,
X231T, X231W, X231Y, X232A, X232G, X232H, X232K, X232L, X232M,
X232P, X232S, X232V, X233A, X233C, X233E, X233F, X233G, X233I,
X233L, X233M, X233N, X233P, X233Q, X233R, X233S, X233T, X233V,
X233Y, X234D, X234F, X234G, X234H, X234L, X234M, X234N, X234P,
X234Q, X234S, X234T, X234V, X234Y, X235C, X235D, X235E, X235F,
X235G, X235H, X235I, X235K, X235L, X235M, X235N, X235Q, X235R,
X235S, X235V, X235W, X235Y, X236A, X236C, X236E, X236F, X236G,
X236H, X236K, X236L, X236N, X236P, X236Q, X236R, X236S, X236T,
X236V, X236W, X236Y, X237A, X237C, X237F, X237G, X237H, X237I,
X237K, X237L, X237M, X237P, X237Q, X237R, X237S, X237T, X237V,
X237W, X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I,
X238K, X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V,
X238Y, X239C, X239D, X239F, X239G, X239H, X239I, X239K, X239L,
X239M, X239N, X239P, X239Q, X239R, X239S, X239T, X239V, X239W,
X239Y, X240A, X240C, X240E, X240F, X240I, X240K, X240L, X240M,
X240N, X240Q, X240R, X240S, X240T, X240W, X240Y, X241A, X241C,
X241D, X241E, X241F, X241G, X241H, X241I, X241K, X241L, X241M,
X241N, X241P, X241Q, X241R, X241S, X241T, X241V, X241W, X241Y,
X242A, X242C, X242D, X242F, X242G, X242H, X242I, X242L, X242M,
X242P, X242Q, X242R, X242S, X242T, X242V, X242W, X243C, X243D,
X243E, X243F, X243G, X243H, X243I, X243K, X243L, X243M, X243N,
X243P, X243Q, X243R, X243S, X243T, X243V, X243W, X244A, X244D,
X244E, X244F, X244H, X244I, X244L, X244M, X244N, X244P, X244Q,
X244R, X244S, X244T, X244V, X244W, X244Y, X245A, X245C, X245E,
X245G, X245H, X245K, X245L, X245P, X245Q, X245R, X245S, X245V,
X245W, X245Y, X246A, X246C, X246E, X246F, X246G, X246H, X246I,
X246L, X246M, X246N, X246P, X246Q, X246R, X246S, X246T, X246V,
X246W, X246Y, X247A, X247C, X247D, X247E, X247F, X247G, X247H,
X247I, X247K, X247L, X247M, X247N, X247P, X247Q, X247R, X247S,
X247T, X247V, X247W, X247Y, X248C, X248D, X248E, X248G, X248H,
X248I, X248K, X248L, X248M, X248N, X248P, X248R, X248S, X248T,
X248V, X248W, X248Y, X249A, X249D, X249E, X249F, X249G, X249H,
X249I, X249K, X249L, X249M, X249N, X249Q, X249R, X249S, X249T,
X249V, X249W, X249Y, X250A, X250C, X250E, X250F, X250G, X250H,
X250I, X250L, X250M, X250N, X250Q, X250S, X250V, X250Y, X251A,
X251D, X251E, X251F, X251G, X251K, X251L, X251M, X251P, X251Q,
X251R, X251S, X251T, X251V, X251Y, X252A, X252C, X252D, X252F,
X252G, X252H, X252I, X252K, X252L, X252M, X252N, X252P, X252R,
X252S, X252V, X252W, X252Y, X253A, X253D, X253E, X253F, X253G,
X253H, X253I, X253K, X253M, X253R, X253S, X253T, X253V, X253W,
X254A, X254C, X254D, X254E, X254G, X254N, X254P, X254S, X254T,
X254V, X255A, X255C, X255D, X255E, X255F, X255H, X255I, X255L,
X255N, X255P, X255Q, X255R, X255S, X255T, X255V, X255W, X255Y,
X256A, X256C, X256D, X256E, X256G, X256H, X256I, X256K, X256L,
X256M, X256N, X256P, X256R, X256S, X256T, X256V, X256W, X256Y,
X257A, X257C, X257E, X257F, X257G, X257H, X257I, X257K, X257L,
X257M, X257P, X257S, X257T, X257V, X257W, X257Y, X258A, X258C,
X258D, X258E, X258F, X258G, X258H, X258I, X258L, X258M, X258P,
X258Q, X258R, X258S, X258T, X258V, X258W, X258Y, X259A, X259C,
X259E, X259G, X259I, X259L, X259M, X259P, X259Q, X259R, X259S,
X259T, X259V, X260A, X260D, X260E, X260F, X260H, X260I, X260L,
X260M, X260N, X260P, X260R, X260S, X260T, X260V, X260Y, X261A,
X261C, X261E, X261F, X261G, X261I, X261K, X261L, X261N, X261P,
X261Q, X261R, X261S, X261T, X261V, X261W, X261Y, X262A, X262C,
X262D, X262F, X262G, X262H, X262I, X262K, X262L, X262M, X262P,
X262Q, X262R, X262S, X262T, X262V, X262W, X262Y, X263A, X263C,
X263D, X263F, X263G, X263H, X263I, X263K, X263L, X263M, X263N,
X263P, X263Q, X263R, X263W, X263Y, X264A, X264C, X264E, X264F,
X264G, X264H, X264I, X264L, X264P, X264Q, X264S, X264T, X264V,
X264Y, X265A, X265C, X265D, X265F, X265G, X265H, X265I, X265K,
X265L, X265M, X265N, X265P, X265Q, X265R, X265S, X265T, X265V,
X265W, X265Y, X266G, X266W, X266Y, X267A, X267C, X267D, X267E,
X267F, X267G, X267H, X267I, X267K, X267L, X267M, X267N, X267S,
X267T, X267V, X267Y, X268A, X268D, X268E, X268G, X268H, X268K,
X268L, X268M, X268N, X268P, X268Q, X268R, X268S, X268V, X268W,
X268Y, X269C, X269D, X269F, X269G, X269H, X269I, X269L, X269M,
X269N, X269Q, X269R, X269S, X269T, X269V, X270A, X270C, X270D,
X270E, X270F, X270G, X270H, X270I, X270L, X270M, X270N, X270P,
X270Q, X270S, X270T, X270V, X271A, X271C, X271E, X271F, X271G,
X271H, X271I, X271K, X271L, X271M, X271N, X271P, X271T, X271V,
X271Y, X272A, X272C, X272D, X272E, X272F, X272G, X272H, X272K,
X272L, X272M, X272N, X272P, X272R, X272S, X272T, X272W, X272Y,
X273A, X273C, X273D, X273E, X273F, X273G, X273H, X273I, X273K,
X273L, X273R, X273S, X273T, X273V, X273W, X273Y, X274A, X274C,
X274D, X274E, X274G, X274H, X274K, X274L, X274M, X274N, X274P,
X274Q, X274R, X274S, X274T, X274W, X275A, X275C, X275D, X275E,
X275F, X275G, X275H, X275K, X275L, X275M, X275P, X275Q, X275R,
X275V, and X275W.
[0019] The present invention also provides dishwashing compositions
comprising the subtilisin variant, and fabric cleaning compositions
comprising the subtilisin variant. In some preferred embodiments,
the dishwashing and fabric cleaning compositions further comprise
at least one additional enzyme. In some preferred embodiments, the
additional enzyme is selected from: a protease (e.g., a neutral
metalloprotease, a wild type serine protease, or a second variant
serine protease) a lipase, a cutinase, an amylase, a carbohydrase,
a cellulase, a pectinase, a mannanase, an arabinase, a galactanase,
a xylanase, an oxidase, and a peroxidase. Moreover, the present
invention provides dishwashing methods, comprising the steps of:
providing i) the dishwashing composition comprising the subtilisin
variant, and ii) dishware in need of cleaning; and contacting the
dishware with the dishwashing composition under conditions
effective to provide cleaning of the dishware. Similarly, the
present invention provides fabric cleaning methods, comprising the
steps of: providing i) the fabric cleaning composition comprising
the subtilisin variant, and ii) laundry in need of cleaning; and
contacting the laundry with the fabric cleaning composition under
conditions effective to provide cleaning of the laundry. In still
further embodiments, the present invention provides an isolated
nucleic acid encoding the variant, an expression vector comprising
the isolated nucleic acid in operable combination with a promoter,
and/or host cells comprising the expression vector are
provided.
[0020] The present invention also provides isolated subtilisin
variants of a Bacillus subtilisin, wherein the subtilisin variant
is a mature form having proteolytic activity and comprising
substitutions at three or more positions selected from: 1, 2, 3, 4,
5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22,
23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39,
40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56,
57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 71, 72, 73, 74,
75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91,
92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106,
107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119,
120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132,
133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145,
146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158,
159, 160, 161, 162, 163, 164, 165, 166, 167, 169, 170, 171, 172,
173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185,
186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198,
199, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211,
212, 213, 214, 215, 216, 217, 218, 219, 220, 222, 223, 224, 225,
226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238,
239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251,
252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264,
265, 266, 267, 268, 269, 270, 271, 272, 273, 274, and 275, wherein
the positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises
four, five, six, seven, eight, nine, ten, eleven, twelve or more of
the positions recited above.
[0021] In some embodiments, the subtilisin variant is a mature form
having proteolytic activity and comprising substitutions at three
or more positions selected from: 1, 3, 4, 8, 9, 10, 11, 12, 13, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33,
35, 36, 38, 40, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55,
56, 57, 59, 61, 62, 68, 69, 72, 73, 76, 78, 84, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117, 118, 119,
120, 121, 122, 124, 126, 128, 129, 130, 131, 132, 133, 134, 135,
136, 137, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149,
150, 151, 152, 156, 158, 159, 160, 165, 166, 167, 170, 171, 172,
173, 174, 175, 176, 177, 180, 182, 183, 184, 185, 186, 187, 188,
191, 194, 195, 198, 199, 203, 204, 206, 209, 210, 211, 212, 213,
215, 216, 217, 218, 222, 223, 224, 227, 228, 230, 231, 232, 233,
234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246,
247, 248, 249, 250, 251, 252, 253, 255, 256, 258, 259, 260, 261,
262, 265, 267, 268, 269, 270, 271, 272, 273, 274, and 275, wherein
the positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises
four, five, six, seven, eight, nine, ten, eleven, twelve or more of
the positions recited above.
[0022] The present invention also provides isolated subtilisin
variants, wherein the subtilisin variants are mature forms having
proteolytic activity and comprising substitutions at three or more
positions selected from: 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 12, 13,
14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30,
31, 33, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50,
51, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 63, 66, 68, 69, 71, 72,
73, 74, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117, 118, 119,
120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132,
133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145,
146, 147, 148, 149, 150, 151, 152, 153, 156, 158, 159, 160, 165,
166, 167, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179,
180, 181, 182, 183, 184, 185, 186, 187, 188, 191, 192, 194, 195,
196, 197, 198, 199, 200, 203, 204, 205, 206, 207, 208, 209, 210,
211, 212, 213, 214, 215, 216, 217, 218, 220, 222, 223, 224, 225,
226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238,
239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251,
252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264,
265, 267, 268, 269, 270, 271, 272, 273, 274, and 275, wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises
four, five, six, seven, eight, nine, ten, eleven, twelve or more of
the positions recited above.
The present invention further comprises isolated subtilisin
variants comprising substitutions at three or more positions
selected from: X001A, X001C, X001E, X001F, X001G, X001H, X001I,
X001K, X001L, X001N, X001P, X001Q, X001R, X001S, X001T, X001V,
X001Y, X002A, X002C, X002E, X002G, X002K, X002L, X002M, X002N,
X002P, X002Q, X002R, X002S, X002T, X002V, X002W, X002Y, X003D,
X003E, X003F, X003G, X003H, X003I, X003L, X003M, X003N, X003P,
X003R, X003S, X003T, X003V, X003W, X003Y, X004A, X004C, X004D,
X004E, X004F, X004G, X004H, X004K, X004L, X004N, X004P, X004R,
X004S, X004T, X004V, X004W, X005A, X005C, X005D, X005E, X005G,
X005I, X005M, X005P, X005Q, X005S, X005T, X005W, X005Y, X006A,
X006D, X006E, X006M, X006W, X007A, X007C, X007D, X007G, X007H,
X007N, X007P, X007Q, X007S, X007T, X008A, X008F, X008G, X008I,
X008L, X008M, X008Q, X008T, X008V, X008W, X008Y, X009A, X009C,
X009D, X009E, X009F, X009G, X009H, X009L, X009N, X009P, X009Q,
X009R, X009S, X009T, X009V, X009W, X009Y, X010A, X010C, X010F,
X010G, X010H, X010I, X010K, X010L, X010M, X010N, X010Q, X010R,
X010S, X010T, X010V, X010W, X010Y, X011A, X011C, X011D, X011G,
X011I, X011M, X011R, X011S, X011T, X011V, X011Y, X012D, X012F,
X012G, X012H, X012I, X012K, X012L, X012M, X012N, X012P, X012Q,
X012R, X012S, X012T, X012V, X012W, X012Y, X013A, X013G, X013I,
X013M, X013Q, X013T, X013V, X014A, X014C, X014D, X014E, X014F,
X014G, X014H, X014I, X014K, X014L, X014P, X014Q, X014S, X014T,
X014V, X014Y, X015A, X015D, X015F, X015G, X015I, X015K, X015L,
X015M, X015P, X015Q, X015R, X015S, X015V, X015W, X016A, X016D,
X016E, X016G, X016L, X016N, X016P, X016Q, X016R, X016S, X016T,
X016V, X017A, X017D, X017E, X017F, X017G, X017H, X017I, X017K,
X017M, X017N, X017R, X017S, X017T, X017V, X017W, X017Y, X018A,
X018C, X018D, X018E, X018F, X018G, X018H, X018I, X018K, X018L,
X018M, X018N, X018P, X018Q, X018R, X018S, X018T, X018V, X018W,
X018Y, X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K,
X019L, X019M, X019N, X019P, X019R, X019S, X019T, X019V, X019W,
X019Y, X020A, X020C, X020D, X020F, X020G, X020I, X020K, X020L,
X020M, X020P, X020Q, X020R, X020S, X020T, X020V, X020W, X020Y,
X021A, X021C, X021D, X021E, X021G, X021H, X021I, X021K, X021L,
X021M, X021N, X021P, X021Q, X021R, X021S, X021T, X021V, X021W,
X022A, X022C, X022G, X022I, X022K, X022L, X022M, X022N, X022P,
X022Q, X022R, X022S, X022T, X022V, X022W, X022Y, X023A, X023G,
X023S, X024A, X024C, X024D, X024F, X024G, X024H, X024L, X024M,
X024N, X024P, X024Q, X024R, X024S, X024T, X024V, X024W, X025C,
X025D, X025E, X025F, X025G, X025H, X025K, X025L, X025M, X025N,
X025Q, X025R, X025S, X025T, X025V, X025W, X026C, X026F, X026G,
X026I, X026L, X026M, X026N, X026P, X026R, X026S, X026T, X026V,
X027A, X027C, X027D, X027F, X027G, X027I, X027K, X027L, X027M,
X027N, X027P, X027R, X027S, X027T, X027V, X027W, X027Y, X028A,
X028E, X028G, X028H, X028I, X028L, X028M, X028N, X028P, X028S,
X028V, X028Y, X029A, X029C, X029G, X029I, X029K, X029S, X029T,
X029V, X030A, X030C, X030D, X030E, X030F, X030G, X030L, X030M,
X030Q, X030S, X030T, X030V, X031A, X031F, X031I, X031L, X031M,
X031S, X031T, X031V, X032A, X032C, X032D, X032E, X032G, X032V,
X032W, X033A, X033C, X033D, X033E, X033G, X033H, X033I, X033L,
X033M, X033N, X033Q, X033R, X033S, X033T, X033V, X033Y, X034E,
X034G, X034H, X034L, X034Q, X034S, X035A, X035F, X035H, X035I,
X035K, X035L, X035M, X035P, X035Q, X035R, X035S, X035A, X035C,
X035E, X035F, X035G, X035H, X035I, X035L, X035M, X035N, X035P,
X035Q, X035R, X035T, X035V, X035W, X035Y, X038C, X038F, X038G,
X038H, X038I, X038K, X038L, X038M, X038N, X038Q, X038R, X038T,
X038V, X038W, X038Y, X039A, X039E, X039G, X039H, X039L, X039M,
X039N, X039Q, X039S, X039T, X039V, X039Y, X040A, X040C, X040D,
X040E, X040G, X040H, X040I, X040K, X040L, X040M, X040N, X040P,
X040R, X040S, X040T, X040V, X040W, X040Y, X041C, X041D, X041E,
X041N, X041P, X041Q, X041S, X042A, X042C, X042F, X042G, X042H,
X042I, X042L, X042M, X042N, X042Q, X042S, X042T, X042V, X042Y,
X043A, X043C, X043D, X043E, X043F, X043G, X043I, X043L, X043M,
X043N, X043P, X043R, X043S, X043T, X043V, X043W, X043Y, X044A,
X044C, X044D, X044F, X044G, X044I, X044K, X044L, X044M, X044N,
X044P, X044Q, X044R, X044S, X044T, X044V, X044W, X044Y, X045A,
X045D, X045F, X045G, X045H, X045I, X045K, X045L, X045M, X045N,
X045P, X045Q, X045R, X045S, X045T, X045V, X045W, X045Y, X046C,
X046D, X046E, X046F, X046G, X046H, X046I, X046K, X046L, X046M,
X046N, X046P, X046Q, X046R, X046S, X046T, X046V, X046W, X047A,
X047C, X047E, X047F, X047G, X047H, X047K, X047L, X047M, X047N,
X047P, X047Q, X047R, X047S, X047T, X047W, X048A, X048C, X048E,
X048F, X048G, X048H, X048I, X048K, X048L, X048M, X048N, X048P,
X048Q, X048R, X048S, X048T, X048V, X048Y, X049A, X049E, X049F,
X049G, X049H, X049K, X049L, X049M, X049P, X049Q, X049R, X049S,
X049T, X050C, X050F, X050G, X050H, X050I, X050L, X050N, X050T,
X050V, X050Y, X051F, X051G, X051H, X051K, X051L, X051N, X051P,
X051R, X051S, X051T, X051V, X051W, X052A, X052C, X052E, X052F,
X052G, X052H, X052I, X052L, X052M, X052N, X052P, X052Q, X052R,
X052T, X052V, X052W, X052Y, X053A, X053C, X053D, X053E, X053G,
X053H, X053I, X053K, X053L, X053M, X053P, X053Q, X053R, X053S,
X053T, X053V, X053W, X053Y, X054A, X054C, X054D, X054E, X054F,
X054G, X054H, X054I, X054K, X054L, X054M, X054N, X054P, X054Q,
X054R, X054S, X054V, X054W, X054Y, X055A, X055C, X055E, X055F,
X055G, X055H, X055I, X055K, X055L, X055M, X055N, X055P, X055Q,
X055R, X055S, X055T, X055W, X055Y, X056A, X056C, X056D, X056E,
X056H, X056L, X056M, X056N, X056P, X056Q, X056R, X056S, X056T,
X056V, X057A, X057C, X057E, X057F, X057G, X057H, X057I, X057K,
X057L, X057M, X057N, X057P, X057Q, X057R, X057S, X057T, X057V,
X057W, X057Y, X059A, X059C, X059D, X059E, X059F, X059G, X059I,
X059K, X059L, X059M, X059N, X059P, X059Q, X059R, X059S, X059T,
X059V, X059W, X059Y, X060A, X060C, X060D, X060F, X060G, X060K,
X060L, X060M, X060N, X060P, X060Q, X060S, X060T, X060V, X060W,
X060Y, X061A, X061C, X061D, X061F, X061G, X061H, X061I, X061L,
X061M, X061N, X061P, X061R, X061S, X061T, X061V, X061Y, X062C,
X062E, X062F, X062G, X062H, X062I, X062K, X062L, X062M, X062N,
X062P, X062Q, X062R, X062S, X062T, X062V, X062Y, X063A, X063C,
X063D, X063E, X063F, X063G, X063H, X063I, X063K, X063M, X063P,
X063Q, X063R, X063S, X063T, X063V, X063W, X064H, X064S, X065G,
X066A, X066C, X066D, X066E, X066I, X066K, X066L, X066N, X066Q,
X066S, X066T, X067A, X067C, X067F, X067H, X067L, X067M, X067N,
X067P, X067Q, X067R, X067S, X067T, X067V, X068A, X068C, X068D,
X068E, X068G, X068H, X068I, X068L, X068M, X068N, X068Q, X068S,
X068T, X068V, X069A, X069C, X069E, X069F, X069G, X069I, X069L,
X069M, X069N, X069P, X069R, X069S, X069T, X069V, X069W, X070G,
X071A, X071C, X071D, X071E, X071G, X071I, X071L, X071M, X071N,
X071P, X071S, X071T, X071V, X071W, X072C, X072D, X072F, X072H,
X072I, X072K, X072L, X072M, X072N, X072Q, X072S, X072T, X072V,
X072W, X073A, X073C, X073D, X073E, X073H, X073K, X073L, X073N,
X073R, X073S, X073T, X073V, X074A, X074C, X074S, X074T, X075A,
X075C, X075D, X075E, X075F, X075G, X075H, X075I, X075L, X075M,
X075N, X075P, X075Q, X075R, X075S, X075T, X075V, X075W, X076C,
X076D, X076E, X076F, X076G, X076H, X076I, X076K, X076L, X076M,
X076N, X076Q, X076R, X076S, X076T, X076W, X076Y, X077A, X077C,
X077D, X077E, X077F, X077G, X077H, X077K, X077L, X077M, X077N,
X077Q, X077R, X077S, X077V, X077Y, X078A, X078C, X078E, X078F,
X078G, X078H, X078I, X078K, X078L, X078M, X078N, X078P, X078Q,
X078R, X078S, X078T, X078V, X078W, X078Y, X079C, X079D, X079E,
X079F, X079G, X079I, X079K, X079L, X079M, X079N, X079P, X079Q,
X079R, X079S, X079T, X079V, X079W, X079Y, X080A, X080D, X080E,
X080G, X080K, X080L, X080M, X080R, X080T, X080V, X080 W, X080Y,
X081A, X081C, X081D, X081E, X081F, X081G, X081H, X081I, X081K,
X081L, X081M, X081P, X081Q, X081R, X081S, X081T, X081V, X081W,
X081Y, X082A, X082E, X082F, X082G, X082K, X082L, X082M, X082N,
X082Q, X082R, X082S, X082T, X082V, X082W, X082Y, X083G, X083S,
X084C, X084E, X084F, X084G, X084H, X084I, X084L, X084M, X084N,
X084Q, X084S, X084T, X084V, X085A, X085C, X085I, X085L, X085N,
X086A, X086C, X086D, X086E, X086G, X086I, X086L, X086P, X086R,
X086S, X086V, X086W, X086Y, X087A, X087C, X087D, X087E, X087F,
X087G, X087I, X087K, X087L, X087N, X087P, X087T, X087V, X087Y,
X088A, X088C, X088D, X088E, X088G, X088H, X088K, X088M, X088Q,
X088R, X088S, X088V, X088W, X089A, X089C, X089D, X089E, X089F,
X089G, X089H, X089I, X089L, X089N, X089P, X089Q, X089R, X089S,
X089T, X089V, X089W, X090A, X090C, X090E, X090F, X090G, X090I,
X090K, X090L, X090M, X090P, X090Q, X090T, X090V, X090 W, X090Y,
X091C, X091D, X091F, X091I, X091K, X091L, X091M, X091N, X091Q,
X091R, X091S, X091T, X091V, X091W, X091Y, X092A, X092C, X092D,
X092E, X092F, X092G, X092H, X092I, X092K, X092L, X092N, X092P,
X092Q, X092R, X092T, X092V, X092W, X092Y, X093A, X093C, X093D,
X093F, X093G, X093L, X093M, X093N, X093P, X093S, X093T, X093V,
X093W, X093Y, X094A, X094D, X094E, X094G, X094H, X094I, X094K,
X094L, X094M, X094N, X094Q, X094R, X094V, X095A, X095C, X095E,
X095G, X095I, X095K, X095L, X095M, X095R, X095S, X095T, X095V,
X095W, X096A, X096E, X096F, X096G, X096H, X096I, X096L, X096M,
X096Q, X096R, X096S, X096T, X096W, X096Y, X097A, X097D, X097E,
X097F, X097G, X097H, X097I, X097K, X097L, X097M, X097N, X097P,
X097Q, X097R, X097S, X097T, X097V, X097W, X097Y, X098A, X098C,
X098D, X098E, X098F, X098G, X098K, X098L, X098N, X098P, X098Q,
X098R, X098S, X098T, X098V, X098Y, X099A, X099C, X099F, X099G,
X099K, X099M, X099P, X099Q, X099R, X099S, X099T, X099V, X099Y,
X100D, X100E, X100F, X100G, X100I, X100K, X100L, X100M, X100N,
X100P, X100Q, X100R, X100S, X100T, X100V, X100W, X100Y, X101A,
X101C, X101D, X101E, X101F, X101G, X101H, X101I, X101K, X101N,
X101P, X101Q, X101R, X101S, X101T, X101V, X101Y, X102A, X102C,
X102D, X102E, X102F, X102G, X102H, X102M, X102N, X102T, X103A,
X103C, X103D, X103E, X103F, X103G, X103I, X103L, X103N, X103P,
X103Q, X103R, X103S, X103T, X103V, X103W, X103Y, X104A, X104C,
X104D, X104E, X104F, X104G, X104H, X104I, X104L, X104P, X104R,
X104S, X104T, X104V, X104W, X104Y, X105A, X105C, X105D, X105E,
X105F, X105G, X105H, X105I, X105K, X105L, X105M, X105N, X105Q,
X105R, X105S, X105T, X105V, X105W, X105Y, X106A, X106D, X106E,
X106F, X106G, X106I, X106L, X106M, X106P, X106R, X106S, X106T,
X106V, X106W, X107A, X107C, X107E, X107F, X107H, X107I, X107L,
X107M, X107Q, X107S, X107T, X107V, X107W, X107Y, X108A, X108C,
X108F, X108G, X108I, X108L, X108M, X108Q, X108S, X108T, X108V,
X109A, X109C, X109E, X109F, X109G, X109H, X109I, X109K, X109L,
X109M, X109N, X109P, X109Q, X109R, X109S, X109T, X109W, X109Y,
X110A, X110G, X110S, X111A, X111C, X111E, X111F, X111I, X111L,
X111M, X111P, X111T, X111V, X111Y, X112A, X112C, X112D, X112E,
X112F, X112G, X112I, X112L, X112M, X112N, X112Q, X112S, X112T,
X112V, X112W, X112Y, X113A, X113C, X113D, X113E, X113L, X113M,
X113N, X113S, X113V, X113W, X114A, X114C, X114G, X114T, X115C,
X115E, X115F, X115G, X115H, X115I, X115K, X115L, X115M, X115N,
X115P, X115Q, X115R, X115S, X115T, X115V, X115W, X115Y, X116A,
X116C, X116D, X116F, X116G, X116I, X116K, X116L, X116M, X116N,
X116Q, X116S, X116T, X116V, X116W, X117A, X117C, X117D, X117F,
X117G, X117I, X117N, X117Q, X117R, X117T, X117Y, X118A, X118C,
X118D, X118E, X118F, X118G, X118I, X118K, X118L, X118M, X118N,
X118P, X118R, X118S, X118T, X118V, X118W, X119A, X119C, X119E,
X119F, X119G, X119H, X119K, X119M, X119N, X119P, X119Q, X119T,
X119W, X120A, X120C, X120E, X120F, X120G, X120H, X120I, X120L,
X120M, X120N, X120R, X120S, X120T, X120W, X121A, X121C, X121E,
X121F, X121G, X121I, X121K, X121L, X121M, X121Q, X121S, X121T,
X121V, X121Y, X122A, X122C, X122G, X122I, X122L, X122S, X122T,
X122V, X123E, X123G, X123I, X123L, X123M, X123N, X123P, X123S,
X123V, X124G, X124H, X124L, X124N, X124Q, X124S, X124T, X124Y,
X125A, X125C, X125G, X125P, X125S, X125T, X126A, X126C, X126E,
X126F, X126G, X126H, X126I, X126K, X126L, X126M, X126N, X126Q,
X126S, X126T, X126V, X126W, X126Y, X127D, X127F, X127G, X127I,
X127L, X127Q, X127R, X127S, X127T, X127V, X128A, X128C, X128D,
X128F, X128G, X128H, X128I, X128K, X128L, X128M, X128N, X128P,
X128Q, X128R, X128S, X128T, X128W, X128Y, X129A, X129E, X129F,
X129G, X129I, X129L, X129M, X129N, X129P, X129R, X129S, X129T,
X129V, X129W, X129Y, X130C, X130K, X130L, X130N, X130P, X130Q,
X130R, X130S, X130V, X130W, X130Y, X131A, X131D, X131E, X131F,
X131G, X131I, X131K, X131L, X131M, X131P, X131Q, X131R, X131V,
X132A, X132E, X132F, X132H, X132I, X132L, X132M, X132N, X132Q,
X132R, X132S, X132T, X132W, X133A, X133F, X133K, X133L, X133N,
X133P, X133Q, X133S, X133T, X133V, X133Y, X134A, X134F, X134I,
X134L, X134M, X134P, X134S, X134T, X134V, X135A, X135C, X135E,
X135F, X135L, X135M, X135Q, X135T, X135W, X136A, X136D, X136E,
X136F, X136G, X136K, X136M, X136N, X136Q, X136R, X136S, X136V,
X136W, X136Y, X137A, X137C, X137E, X137G, X137H, X137K, X137L,
X137M, X137Q, X137R, X137S, X137V, X137W, X138A, X138C, X138E,
X138G, X138H, X138L, X138M, X138Q, X138R, X138V, X139A, X139C,
X139E, X139F, X139G, X139I, X139M, X139Q, X139S, X139T, X139V,
X139Y, X140A, X140C, X140D, X140E, X140F, X140G, X140I, X140K,
X140L, X140M, X140N, X140Q, X140R, X140S, X140T, X140V, X140Y,
X141D, X141E, X141G, X141H, X141I, X141K, X141L, X141N, X141Q,
X141R, X141S, X141V, X141Y, X142A, X142C, X142E, X142G, X142I,
X142L, X142M, X142N, X142Q, X142S, X142T, X142V, X142Y, X143C,
X143D, X143F, X143G, X143H, X143I, X143K, X143L, X143M, X143N,
X143R, X143S, X143T, X143V, X143W, X143Y, X144A, X144C, X144D,
X144G, X144H, X144I, X144L, X144M, X144N, X144Q, X144R, X144S,
X144T, X144V, X144W, X144Y, X145A, X145C, X145D, X145E, X145F,
X145G, X145K, X145L, X145M, X145N, X145Q, X145R, X145S, X145T,
X145W, X145Y, X146A, X146C, X146D, X146E, X146F, X146G, X146I,
X146K, X146L, X146M, X146Q, X146R, X146S, X146T, X146W, X146Y,
X147F, X147G, X147I, X147L, X147M, X147P, X147Q, X147T, X147V,
X148A, X148C, X148E, X148F, X148G, X148H, X148I, X148L, X148M,
X148N, X148S, X148T, X148V, X148W, X148Y, X149A, X149C, X149F,
X149G, X149H, X149I, X149L, X149M, X149P, X149Q, X149S, X149T,
X149V, X150A, X150E, X150F, X150G, X150H, X150L, X150P, X150Q,
X150S, X150T, X150V, X151A, X151G, X151M, X151S, X151T, X151V,
X152A, X152C, X152P, X152R, X152S, X152T, X152V, X153A, X153E,
X153F, X153G, X153I, X153M, X153N, X153Q, X153S, X153V, X153Y,
X154A, X154C, X154G, X154N, X154Q, X154S, X155A, X155D, X155E,
X155F, X155I, X155L, X155N, X155P, X155Q, X155R, X155S, X155T,
X155V, X155Y, X156A, X156C, X156D, X156E, X156F, X156G, X156I,
X156K, X156L, X156M, X156N, X156P, X156Q, X156R, X156S, X156T,
X156V, X156Y, X157A, X157C, X157D, X157G, X157K, X157L, X157Q,
X157R, X157S, X157V, X158A, X158C, X158E, X158F, X158H, X158K,
X158L, X158M, X158P, X158Q, X158R, X158S, X158T, X158V, X158W,
X159A, X159C, X159E, X159G, X159H, X159L, X159M, X159P, X159Q,
X159R, X159S, X159V, X159W, X159Y, X160A, X160C, X160D, X160F,
X160G, X160I, X160L, X160M, X160N, X160Q, X160R, X160S, X160T,
X160V, X160Y, X165A, X165C, X165D, X165E, X165F, X165G, X165H,
X165I, X165K, X165L, X165M, X165P, X165R, X165S, X165T, X165V,
X165W, X165Y, X166A, X166C, X166D, X166E, X166F, X166H, X166I,
X166L, X166M, X166N, X166P, X166R, X166S, X166T, X166V, X166W,
X166Y, X167A, X167C, X167D, X167E, X167F, X167G, X167H, X167I,
X167K, X167L, X167M, X167N, X167P, X167Q, X167R, X167S, X167T,
X167V, X167W, X167Y, X168A, X168C, X168F, X168I, X168M, X168N,
X168P, X168S, X168T, X168V, X169A, X169C, X169G, X169I, X169L,
X169S, X170A, X170D, X170E, X170G, X170H, X170K, X170L, X170N,
X170P, X170Q, X170R, X170S, X170V, X170W, X170Y, X171A, X171C,
X171D, X171E, X171F, X171G, X171H, X171I, X171L, X171M, X171N,
X171Q, X171S, X171T, X171V, X171W, X171Y, X172A, X172C, X172D,
X172F, X172G, X172I, X172K, X172L, X172M, X172P, X172Q, X172R,
X172S, X172T, X172V, X172W, X172Y, X173A, X173C, X173D, X173E,
X173F, X173G, X173H, X173I, X173K, X173L, X173M, X173N, X173P,
X173Q, X173R, X173T, X173V, X173W, X173Y, X174A, X174G, X174I,
X174N, X174P, X174S, X174T, X174V, X175A, X175C, X175E, X175G,
X175H, X175I, X175K, X175L, X175M, X175Q, X175S, X175T, X175V,
X175W, X175Y, X176A, X176C, X176E, X176G, X176I, X176K, X176P,
X176S, X176T, X176V, X177A, X177C, X177I, X177T, X177V, X178A,
X178G, X178S, X178T, X179A, X179C, X179G, X179H, X179I, X180C,
X180G, X180H, X180I, X180L, X180N, X180Q, X180S, X180T, X180V,
X181A, X181D, X181E, X181G, X181H, X181L, X181M, X181N, X182A,
X182D, X182E, X182F, X182G, X182H, X182I, X182K, X182L, X182M,
X182N, X182P, X182Q, X182R, X182S, X182T, X182V, X182W, X182Y,
X183A, X183D, X183F, X183G, X183H, X183I, X183K, X183L, X183M,
X183N, X183P, X183Q, X183R, X183S, X183T, X183V, X183W, X183Y,
X184A, X184C, X184D, X184E, X184F, X184G, X184H, X184L, X184M,
X184N, X184S, X184T, X184W, X184Y, X185A, X185C, X185E, X185F,
X185G, X185H, X185I, X185K, X185L, X185M, X185N, X185Q, X185R,
X185S, X185T, X185V, X185Y, X186A, X186C, X186G, X186H, X186I,
X186K, X186L, X186M, X186N, X186P, X186Q, X186R, X186S, X186T,
X186W, X187A, X187C, X187D, X187E, X187F, X187G, X187H, X187I,
X187L, X187M, X187N, X187P, X187Q, X187S, X187T, X187V, X187W,
X187Y, X188A, X188D, X188E, X188F, X188G, X188H, X188I, X188K,
X188L, X188P, X188Q, X188R, X188S, X188T, X188V, X188W, X188Y,
X189A, X189C, X189E, X189F, X189G, X189H, X189K, X189L, X189M,
X189N, X189P, X189Q, X189R, X189S, X189T, X189V, X189Y, X190A,
X190D, X190E, X190F, X190G, X190H, X190I, X190K, X190L, X190M,
X190N, X190P, X190Q, X190R, X190S, X190V, X190W, X190Y, X191A,
X191D, X191E, X191F, X191H, X191I, X191K, X191L, X191P, X191Q,
X191R, X191S, X191T, X191V, X191W, X191Y, X192C, X192D, X192E,
X192G, X192H, X192I, X192K, X192L, X192M, X192N, X192P, X192Q,
X192R, X192S, X192T, X192V, X192W, X192Y, X193A, X193D, X193E,
X193F, X193G, X193H, X193I, X193K, X193L, X193R, X193S, X193T,
X193V, X193W, X193Y, X194A, X194C, X194D, X194E, X194F, X194G,
X194H, X194I, X194L, X194M, X194P, X194Q, X194R, X194S, X194T,
X194V, X194W, X194Y, X195A, X195C, X195D, X195E, X195F, X195G,
X195I, X195K, X195L, X195Q, X195R, X195S, X195T, X195V, X195W,
X195Y, X196A, X196D, X196E, X196F, X196I, X196L, X196M, X196P,
X196Q, X196T, X196V, X196Y, X197A, X197C, X197D, X197E, X197F,
X197G, X197H, X197I, X197L, X197M, X197N, X197Q, X197R, X197S,
X197T, X197V, X197W, X197Y, X198A, X198D, X198E, X198F, X198G,
X198H, X198I, X198L, X198M, X198N, X198Q, X198R, X198S, X198T,
X198W, X198Y, X199A, X199C, X199D, X199E, X199F, X199G, X199H,
X199I, X199L, X199M, X199Q, X199S, X199T, X199V, X199W, X200A,
X200C, X200G, X200H, X200I, X200S, X201C, X201G, X201P, X201S,
X201T, X201V, X202F, X202G, X203A, X203C, X203E, X203F, X203G,
X203H, X203I, X203K, X203L, X203N, X203R, X203S, X203T, X203V,
X203W, X203Y, X204A, X204C, X204E, X204F, X204G, X204I, X204K,
X204L, X204N, X204P, X204R, X204S, X204T, X204W, X204Y, X205A,
X205F, X205G, X205I, X205L, X205M, X205Q, X205T, X205V, X206A,
X206C, X206D, X206E, X206F, X206G, X206H, X206I, X206K, X206L,
X206N, X206P, X206Q, X206R, X206S, X206T, X206V, X206W, X206Y,
X207A, X207G, X207H, X207S, X208A, X208C, X208L, X208N, X208P,
X208S, X208T, X208V, X209A, X209C, X209D, X209E, X209F, X209G,
X209H, X209I, X209K, X209L, X209M, X209N, X209R, X209S, X209T,
X209V, X209W, X209Y, X210A, X210C, X210D, X210E, X210F, X210G,
X210H, X210I, X210L, X210M, X210N, X210P, X210Q, X210R, X210S,
X210V, X210W, X210Y, X211A, X211C, X211E, X211F, X211G, X211H,
X211I, X211L, X211M, X211P, X211Q, X211R, X211T, X211V, X211W,
X211Y, X212C, X212F, X212G, X212H, X212I, X212M, X212N, X212P,
X212R, X212S, X212T, X212V, X212Y, X213A, X213C, X213D, X213E,
X213F, X213G, X213I, X213K, X213L, X213M, X213N, X213P, X213Q,
X213R, X213S, X213T, X213V, X213W, X213Y, X214A, X214C, X214E,
X214F, X214G, X214H, X214I, X214K, X214L, X214M, X214N, X214P,
X214Q, X214R, X214S, X214T, X214V, X214W, X214Y, X215A, X215C,
X215D, X215E, X215F, X215G, X215H, X215I, X215K, X215M, X215N,
X215P, X215R, X215S, X215T, X215V, X215W, X215Y, X216A, X216C,
X216D, X216E, X216F, X216G, X216H, X216I, X216K, X216L, X216M,
X216N, X216P, X216Q, X216R, X216S, X216V, X216W, X216Y, X217A,
X217C, X217D, X217E, X217F, X217G, X217I, X217K, X217L, X217M,
X217N, X217Q, X217S, X217T, X217V, X217Y, X218C, X218D, X218E,
X218F, X218G, X218H, X218I, X218L, X218M, X218N, X218P, X218Q,
X218R, X218S, X218T, X218V, X218W, X218Y, X219A, X219G, X219S,
X220A, X220C, X220G, X220H, X220N, X220S, X220T, X220V, X221G,
X221S, X221T, X222A, X222C, X222E, X222F, X222G, X222I, X222K,
X222L, X222M, X222N, X222P, X222Q, X222R, X222S, X222T, X222V,
X222W, X223A, X223C, X223G, X223M, X223S, X223T, X224A, X224D,
X224E, X224G, X224I, X224L, X224M, X224N, X224P, X224S, X224T,
X225A, X225C, X225G, X225I, X225N, X225P, X225S, X225T, X225V,
X226C, X226F, X226G, X226H, X226I, X226L, X226M, X226N, X226R,
X226S, X226T, X226V, X226Y, X227A, X227C, X227F, X227G, X227I,
X227L, X227M, X227P, X227Q, X227S, X227T, X227V, X227Y, X228A,
X228C, X228G, X228I, X228L, X228M, X228P, X228S, X228V, X229A,
X229G, X229P, X229S, X230A, X230D, X230E, X230F, X230G, X230H,
X230I, X230L, X230N, X230P, X230Q, X230S, X230T, X230V, X230W,
X230Y, X231A, X231C, X231F, X231G, X231H, X231I, X231L, X231S,
X231T, X231W, X231Y, X232A, X232G, X232H, X232K, X232L, X232M,
X232P, X232S, X232V, X233A, X233C, X233E, X233F, X233G, X233I,
X233L, X233M, X233N, X233P, X233Q, X233R, X233S, X233T, X233V,
X233Y, X234D, X234F, X234G, X234H, X234L, X234M, X234N, X234P,
X234Q, X234S, X234T, X234V, X234Y, X235C, X235D, X235E, X235F,
X235G, X235H, X235I, X235K, X235L, X235M, X235N, X235Q, X235R,
X235S, X235V, X235W, X235Y, X236A, X236C, X236E, X236F, X236G,
X236H, X236K, X236L, X236N, X236P, X236Q, X236R, X236S, X236T,
X236V, X236W, X236Y, X237A, X237C, X237F, X237G, X237H, X237I,
X237K, X237L, X237M, X237P, X237Q, X237R, X237S, X237T, X237V,
X237W, X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I,
X238K, X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V,
X238Y, X239C, X239D, X239F, X239G, X239H, X239I, X239K, X239L,
X239M, X239N, X239P, X239Q, X239R, X239S, X239T, X239V, X239W,
X239Y, X240A, X240C, X240E, X240F, X240I, X240K, X240L, X240M,
X240N, X240Q, X240R, X240S, X240T, X240W, X240Y, X241A, X241C,
X241D, X241E, X241F, X241G, X241H, X241I, X241K, X241L, X241M,
X241N, X241P, X241Q, X241R, X241S, X241T, X241V, X241W, X241Y,
X242A, X242C, X242D, X242F, X242G, X242H, X242I, X242L, X242M,
X242P, X242Q, X242R, X242S, X242T, X242V, X242W, X243C, X243D,
X243E, X243F, X243G, X243H, X243I, X243K, X243L, X243M, X243N,
X243P, X243Q, X243R, X243S, X243T, X243V, X243W, X244A, X244D,
X244E, X244F, X244H, X244I, X244L, X244M, X244N, X244P, X244Q,
X244R, X244S, X244T, X244V, X244W, X244Y, X245A, X245C, X245E,
X245G, X245H, X245K, X245L, X245P, X245Q, X245R, X245S, X245V,
X245W, X245Y, X246A, X246C, X246E, X246F, X246G, X246H, X246I,
X246L, X246M, X246N, X246P, X246Q, X246R, X246S, X246T, X246V,
X246W, X246Y, X247A, X247C, X247D, X247E, X247F, X247G, X247H,
X247I, X247K, X247L, X247M, X247N, X247P, X247Q, X247R, X247S,
X247T, X247V, X247W, X247Y, X248C, X248D, X248E, X248G, X248H,
X248I, X248K, X248L, X248M, X248N, X248P, X248R, X248S, X248T,
X248V, X248W, X248Y, X249A, X249D, X249E, X249F, X249G, X249H,
X249I, X249K, X249L, X249M, X249N, X249Q, X249R, X249S, X249T,
X249V, X249W, X249Y, X250A, X250C, X250E, X250F, X250G, X250H,
X250I, X250L, X250M, X250N, X250Q, X250S, X250V, X250Y, X251A,
X251D, X251E, X251F, X251G, X251K, X251L, X251M, X251P, X251Q,
X251R, X251S, X251T, X251V, X251Y, X252A, X252C, X252D, X252F,
X252G, X252H, X252I, X252K, X252L, X252M, X252N, X252P, X252R,
X252S, X252V, X252W, X252Y, X253A, X253D, X253E, X253F, X253G,
X253H, X253I, X253K, X253M, X253R, X253S, X253T, X253V, X253W,
X254A, X254C, X254D, X254E, X254G, X254N, X254P, X254S, X254T,
X254V, X255A, X255C, X255D, X255E, X255F, X255H, X255I, X255L,
X255N, X255P, X255Q, X255R, X255S, X255T, X255V, X255W, X255Y,
X256A, X256C, X256D, X256E, X256G, X256H, X256I, X256K, X256L,
X256M, X256N, X256P, X256R, X256S, X256T, X256V, X256W, X256Y,
X257A, X257C, X257E, X257F, X257G, X257H, X257I, X257K, X257L,
X257M, X257P, X257S, X257T, X257V, X257W, X257Y, X258A, X258C,
X258D, X258E, X258F, X258G, X258H, X258I, X258L, X258M, X258P,
X258Q, X258R, X258S, X258T, X258V, X258W, X258Y, X259A, X259C,
X259E, X259G, X259I, X259L, X259M, X259P, X259Q, X259R, X259S,
X259T, X259V, X260A, X260D, X260E, X260F, X260H, X260I, X260L,
X260M, X260N, X260P, X260R, X260S, X260T, X260V, X260Y, X261A,
X261C, X261E, X261F, X261G, X261I, X261K, X261L, X261N, X261P,
X261Q, X261R, X261S, X261T, X261V, X261W, X261Y, X262A, X262C,
X262D, X262F, X262G, X262H, X262I, X262K, X262L, X262M, X262P,
X262Q, X262R, X262S, X262T, X262V, X262W, X262Y, X263A, X263C,
X263D, X263F, X263G, X263H, X263I, X263K, X263L, X263M, X263N,
X263P, X263Q, X263R, X263W, X263Y, X264A, X264C, X264E, X264F,
X264G, X264H, X264I, X264L, X264P, X264Q, X264S, X264T, X264V,
X264Y, X265A, X265C, X265D, X265F, X265G, X265H, X265I, X265K,
X265L, X265M, X265N, X265P, X265Q, X265R, X265S, X265T, X265V,
X265W, X265Y, X266G, X266W, X266Y, X267A, X267C, X267D, X267E,
X267F, X267G, X267H, X267I, X267K, X267L, X267M, X267N, X267S,
X267T, X267V, X267Y, X268A, X268D, X268E, X268G, X268H, X268K,
X268L, X268M, X268N, X268P, X268Q, X268R, X268S, X268V, X268W,
X268Y, X269C, X269D, X269F, X269G, X269H, X269I, X269L, X269M,
X269N, X269Q, X269R, X269S, X269T, X269V, X270A, X270C, X270D,
X270E, X270F, X270G, X270H, X270I, X270L, X270M, X270N, X270P,
X270Q, X270S, X270T, X270V, X271A, X271C, X271E, X271F, X271G,
X271H, X271I, X271K, X271L, X271M, X271N, X271P, X271T, X271V,
X271Y, X272A, X272C, X272D, X272E, X272F, X272G, X272H, X272K,
X272L, X272M, X272N, X272P, X272R, X272S, X272T, X272W, X272Y,
X273A, X273C, X273D, X273E, X273F, X273G, X273H, X273I, X273K,
X273L, X273R, X273S, X273T, X273V, X273W, X273Y, X274A, X274C,
X274D, X274E, X274G, X274H, X274K, X274L, X274M, X274N, X274P,
X274Q, X274R, X274S, X274T, X274W, X275A, X275C, X275D, X275E,
X275F, X275G, X275H, X275K, X275L, X275M, X275P, X275Q, X275R,
X275V, and X275W, wherein the positions are numbered by
correspondence with the amino acid sequence of
[0023] B. amyloliquefaciens subtilisin BPN' set forth as SEQ ID
NO:1. In some embodiments, the subtilisin variant comprises four,
five, six, seven, eight, nine, ten, eleven, twelve or more of the
positions recited above.
[0024] In some preferred embodiments, the present invention
provides isolated subtilisin variants having a performance index
greater than 1 in at least one assay selected from a BMI assay, an
egg yolk microswatch assay, and/or an AAPF activity assay, and a
performance index of greater than 0.8 for LAS stability or in a TCA
assay, wherein the variants comprise at least one substitution at
one or more positions selected from: 1, 2, 3, 4, 5, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 33, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 63, 66, 68,
69, 71, 72, 73, 74, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
104, 105, 106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117,
118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,
131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143,
144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 156, 158, 159,
160, 165, 166, 167, 169, 170, 171, 172, 173, 174, 175, 176, 177,
178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 191, 192,
194, 195, 196, 197, 198, 199, 200, 203, 204, 205, 206, 207, 208,
209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 220, 222, 223,
224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236,
237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249,
250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262,
263, 264, 265, 267, 268, 269, 270, 271, 272, 273, 274, and 275,
wherein the positions are numbered by correspondence with the amino
acid sequence of B. amyloliquefaciens subtilisin BPN' set forth as
SEQ ID NO:1. In some embodiments, the subtilisin variant comprises
two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve or more of the positions recited above.
[0025] In some preferred embodiments, the present invention
provides isolated subtilisin variants having a performance index
greater than 1 in at least one assay selected from a BMI assay, an
egg yolk microswatch assay, and/or an AAPF activity assay, and a
performance index of greater than 0.8 for LAS stability and/or in a
TCA assay, wherein the variants comprise at least one substitution
at one or more positions selected from: 1, 2, 3, 4, 5, 7, 8, 9, 10,
11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27,
28, 29, 30, 31, 33, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47,
48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 63, 66, 68,
69, 71, 72, 73, 74, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85, 86, 87,
88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103,
104, 105, 106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117,
118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,
131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143,
144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 156, 158, 159,
160, 165, 166, 167, 169, 170, 171, 172, 173, 174, 175, 176, 177,
178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 191, 192,
194, 195, 196, 197, 198, 199, 200, 203, 204, 205, 206, 207, 208,
209, 210, 211, 212, 213, 214, 215, 216, 217, 218, 220, 222, 223,
224, 225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236,
237, 238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249,
250, 251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262,
263, 264, 265, 267, 268, 269, 270, 271, 272, 273, 274, and 275,
wherein the positions are numbered by correspondence with the amino
acid sequence of B. amyloliquefaciens subtilisin BPN' set forth as
SEQ ID NO:1. In some embodiments, the subtilisin variant comprises
two, three, four, five, six, seven, eight, nine, ten, eleven,
twelve or more of the positions recited above.
[0026] In some further embodiments, the present invention provides
isolated subtilisin variants having a performance index greater
than 0.8 in at least one assay selected from a BMI assay, egg yolk
microswatch assay, and/or an AAPF activity assay, and a performance
index of greater than 0.8 for LAS stability and in a TCA assay,
wherein the variants comprise at least one substitution at one or
more positions selected from: 1, 3, 4, 8, 9, 10, 11, 12, 13, 15,
16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33,
35, 36, 38, 40, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55,
56, 57, 59, 61, 62, 68, 69, 72, 73, 76, 78, 84, 86, 87, 88, 89, 90,
91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105,
106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117, 118, 119,
120, 121, 122, 124, 126, 128, 129, 130, 131, 132, 133, 134, 135,
136, 137, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149,
150, 151, 152, 156, 158, 159, 160, 165, 166, 167, 170, 171, 172,
173, 174, 175, 176, 177, 180, 182, 183, 184, 185, 186, 187, 188,
191, 194, 195, 198, 199, 203, 204, 206, 209, 210, 211, 212, 213,
215, 216, 217, 218, 222, 223, 224, 227, 228, 230, 231, 232, 233,
234, 235, 236, 237, 238, 239, 240, 241, 242, 243, 244, 245, 246,
247, 248, 249, 250, 251, 252, 253, 255, 256, 258, 259, 260, 261,
262, 265, 267, 268, 269, 270, 271, 272, 273, 274, and 275, wherein
the positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve or
more of the positions recited above.
In some further embodiments, the present invention provides
isolated subtilisin variants having a performance index greater
than 1 in at least one assay selected from a BMI assay, egg yolk
microswatch assay, and/or AAPF activity assay, and a performance
index of greater than 0.8 for LAS/EDTA stability or in a TCA assay,
wherein the variants comprise at least three substitutions selected
from: X001A, X001C, X001E, X001F, X001G, X001H, X001I, X001K,
X001L, X001N, X001Q, X001R, X001S, X001T, X001V, X001Y, X002A,
X002C, X002E, X002G, X002K, X002L, X002M, X002N, X002P, X002Q,
X002R, X002S, X002T, X002V, X002W, X002Y, X003D, X003E, X003F,
X003G, X003H, X003I, X003L, X003M, X003N, X003P, X003R, X003S,
X003T, X003V, X003W, X003Y, X004A, X004C, X004D, X004E, X004F,
X004H, X004K, X004L, X004N, X004P, X004R, X004S, X004T, X004V,
X004W, X005A, X005C, X005D, X005E, X005G, X005P, X005Q, X005S,
X005T, X007A, X007C, X007D, X007G, X007H, X007N, X007S, X007T,
X008A, X008F, X008I, X008L, X008M, X008T, X008V, X009D, X009E,
X009F, X009G, X009H, X009L, X009N, X009P, X009Q, X009R, X009S,
X009T, X009V, X009W, X009Y, X010A, X010C, X010G, X010H, X010K,
X010M, X010N, X010Q, X010R, X010S, X010T, X010W, X011A, X011I,
X011M, X011S, X011V, X012D, X012F, X012G, X012H, X012I, X012K,
X012L, X012M, X012N, X012Q, X012R, X012S, X012T, X012V, X012W,
X013A, X013G, X013I, X013T, X013V, X014A, X014D, X014E, X014F,
X014H, X014I, X014K, X014L, X014P, X014Q, X014S, X014T, X014V,
X014Y, X015A, X015D, X015F, X015G, X015I, X015K, X015L, X015M,
X015P, X015Q, X015R, X015S, X015V, X015W, X016A, X016G, X016L,
X016N, X016P, X016Q, X016S, X016T, X016V, X017A, X017F, X017H,
X017I, X017K, X017M, X017N, X017R, X017S, X017V, X017W, X017Y,
X018A, X018C, X018D, X018E, X018F, X018G, X018H, X018K, X018L,
X018M, X018N, X018P, X018Q, X018R, X018S, X018T, X018V, X018W,
X018Y, X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K,
X019L, X019M, X019N, X019R, X019S, X019T, X019V, X019W, X019Y,
X020A, X020C, X020D, X020F, X020G, X020I, X020K, X020L, X020M,
X020P, X020Q, X020R, X020S, X020T, X020V, X020W, X020Y, X021A,
X021C, X021D, X021E, X021G, X021H, X021I, X021K, X021L, X021M,
X021N, X021P, X021Q, X021R, X021S, X021T, X021V, X021W, X022A,
X022C, X022G, X022I, X022K, X022L, X022M, X022N, X022P, X022Q,
X022R, X022S, X022T, X022V, X022W, X022Y, X023A, X023G, X023S,
X024A, X024C, X024D, X024F, X024G, X024H, X024L, X024M, X024N,
X024P, X024Q, X024R, X024S, X024T, X024V, X024W, X025C, X025D,
X025E, X025F, X025G, X025H, X025K, X025L, X025M, X025N, X025Q,
X025R, X025S, X025T, X025V, X025W, X026C, X026F, X026G, X026I,
X026L, X026M, X026N, X026P, X026R, X026S, X026T, X026V, X027A,
X027C, X027D, X027F, X027G, X027I, X027K, X027L, X027M, X027N,
X027P, X027R, X027S, X027T, X027V, X027W, X027Y, X028A, X028E,
X028H, X028I, X028L, X028M, X028N, X028S, X028V, X029A, X029C,
X029G, X029S, X029V, X030C, X030E, X030L, X030S, X030T, X030V,
X031A, X031F, X031I, X031L, X031M, X031S, X031T, X031V, X033A,
X033D, X033E, X033G, X033H, X033M, X033N, X033Q, X033S, X033T,
X033Y, X035A, X035F, X035I, X035L, X035M, X035P, X036A, X036C,
X036E, X036F, X036G, X036H, X036I, X036L, X036M, X036N, X036Q,
X036R, X036S, X036T, X036V, X038C, X038F, X038G, X038H, X038I,
X038K, X038L, X038M, X038N, X038Q, X038R, X038T, X038V, X038W,
X038Y, X039H, X039V, X040A, X040C, X040D, X040E, X040G, X040H,
X040I, X040K, X040L, X040M, X040N, X040P, X040R, X040S, X040T,
X040V, X040W, X040Y, X041D, X041E, X042C, X042H, X042I, X042L,
X042M, X042N, X042T, X042V, X043A, X043C, X043D, X043E, X043F,
X043G, X043I, X043L, X043M, X043N, X043P, X043R, X043S, X043T,
X043V, X043W, X043Y, X044A, X044C, X044D, X044G, X044I, X044K,
X044L, X044M, X044N, X044P, X044Q, X044R, X044S, X044T, X044V,
X044W, X044Y, X045A, X045D, X045F, X045G, X045H, X045I, X045K,
X045L, X045M, X045N, X045P, X045Q, X045R, X045S, X045T, X045V,
X045W, X045Y, X046C, X046D, X046E, X046F, X046G, X046H, X046I,
X046K, X046L, X046M, X046N, X046P, X046Q, X046R, X046S, X046T,
X046V, X046W, X047A, X047F, X047G, X047N, X047R, X047S, X047T,
X047W, X048A, X048C, X048E, X048F, X048G, X048H, X048I, X048K,
X048L, X048M, X048N, X048P, X048Q, X048R, X048S, X048T, X048V,
X048Y, X049A, X049F, X049G, X049L, X049M, X049P, X049S, X049T,
X050C, X050F, X050H, X050I, X050L, X050N, X050T, X050V, X050Y,
X051F, X051G, X051H, X051K, X051L, X051N, X051P, X051R, X051S,
X051T, X051V, X051W, X052A, X052C, X052E, X052F, X052G, X052H,
X052I, X052L, X052M, X052N, X052P, X052Q, X052R, X052T, X052V,
X052W, X052Y, X053A, X053C, X053D, X053E, X053G, X053H, X053K,
X053L, X053M, X053P, X053Q, X053R, X053S, X053T, X053V, X053W,
X053Y, X054A, X054C, X054D, X054E, X054F, X054I, X054M, X054N,
X054Q, X054S, X054V, X055A, X055C, X055E, X055F, X055G, X055H,
X055I, X055K, X055L, X055M, X055N, X055P, X055Q, X055S, X055T,
X055W, X055Y, X056A, X056C, X056D, X056E, X056H, X056L, X056M,
X056N, X056P, X056Q, X056S, X056T, X057A, X057C, X057E, X057F,
X057G, X057H, X057I, X057K, X057L, X057M, X057N, X057P, X057Q,
X057R, X057S, X057T, X057V, X057W, X057Y, X059A, X059C, X059D,
X059E, X059F, X059G, X059I, X059L, X059M, X059N, X059P, X059Q,
X059R, X059S, X059T, X059V, X059W, X059Y, X060D, X060S, X060V,
X061A, X061C, X061D, X061F, X061G, X061H, X061I, X061L, X061M,
X061N, X061P, X061R, X061S, X061T, X061V, X061Y, X062C, X062E,
X062F, X062G, X062H, X062I, X062K, X062L, X062M, X062N, X062P,
X062Q, X062R, X062S, X062T, X062V, X062Y, X063A, X063C, X063D,
X063E, X063F, X063G, X063H, X063K, X063M, X063Q, X063R, X063S,
X063W, X066K, X066S, X066T, X068I, X068T, X068V, X069A, X069E,
X069G, X069N, X069S, X069T, X071A, X071I, X071N, X071T, X071V,
X072C, X072F, X072I, X072L, X072M, X072T, X072V, X073A, X073C,
X073D, X073E, X073H, X073K, X073L, X073N, X073S, X073T, X073V,
X074A, X074C, X074S, X075A, X075H, X075I, X075L, X075M, X075N,
X075P, X075Q, X075R, X075S, X075V, X076D, X076E, X076F, X076G,
X076H, X076K, X076M, X076N, X076Q, X076R, X076S, X076T, X076W,
X076Y, X077D, X077N, X078A, X078C, X078E, X078F, X078G, X078H,
X078I, X078K, X078L, X078M, X078N, X078P, X078Q, X078R, X078S,
X078T, X078V, X078Y, X079C, X079D, X079E, X079F, X079G, X079I,
X079K, X079L, X079N, X079Q, X079R, X079S, X079T, X079V, X079W,
X079Y, X081C, X081G, X081H, X081I, X081L, X081M, X081Q, X081S,
X081T, X081V, X082A, X082E, X082F, X082K, X082L, X082M, X082Q,
X082R, X082T, X082V, X082Y, X083G, X083S, X084C, X084E, X084G,
X084I, X084L, X084M, X084N, X084T, X084V, X085A, X085C, X085I,
X086A, X086C, X086D, X086E, X086G, X086P, X086S, X086W, X086Y,
X087A, X087C, X087D, X087E, X087F, X087G, X087I, X087K, X087L,
X087N, X087S, X087T, X087V, X087Y, X088A, X088C, X088D, X088G,
X088Q, X088S, X088W, X089A, X089C, X089D, X089E, X089F, X089G,
X089H, X089I, X089L, X089N, X089P, X089Q, X089R, X089S, X089T,
X089V, X089W, X090A, X090C, X090F, X090G, X090I, X090K, X090L,
X090M, X090Q, X090T, X090V, X091C, X091D, X091F, X091I, X091K,
X091L, X091M, X091N, X091Q, X091R, X091S, X091T, X091V, X091W,
X091Y, X092A, X092D, X092G, X092N, X092P, X092R, X092T, X092V,
X093A, X093C, X093G, X093L, X093M, X093S, X093T, X093V, X093Y,
X094K, X094N, X094Q, X094R, X095A, X095C, X095G, X095I, X095K,
X095R, X095S, X095T, X095V, X095W, X096E, X096I, X096L, X096M,
X096T, X097A, X097D, X097E, X097G, X097H, X097I, X097K, X097L,
X097M, X097N, X097P, X097Q, X097R, X097S, X097T, X097V, X097Y,
X098A, X098C, X098D, X098E, X098F, X098G, X098K, X098L, X098N,
X098P, X098Q, X098R, X098S, X098T, X098V, X098Y, X099A, X099C,
X099F, X099G, X099K, X099M, X099P, X099Q, X099R, X099S, X099T,
X099V, X099Y, X100D, X100E, X100G, X100I, X100P, X100S, X100V,
X100Y, X101A, X101D, X101E, X101F, X101G, X101H, X101I, X101K,
X101N, X101P, X101Q, X101R, X101S, X101T, X101V, X101Y, X102A,
X102C, X102D, X102G, X102N, X102T, X103A, X103D, X103E, X103F,
X103G, X103I, X103L, X103N, X103P, X103Q, X103R, X103S, X103T,
X103V, X103Y, X104A, X104C, X104D, X104E, X104F, X104H, X104I,
X104L, X104P, X104R, X104S, X104T, X104V, X104W, X104Y, X105A,
X105C, X105D, X105E, X105F, X105G, X105H, X105I, X105K, X105L,
X105N, X105Q, X105R, X105S, X105T, X105V, X105W, X105Y, X106A,
X106D, X106E, X106F, X106G, X106I, X106L, X106M, X106P, X106R,
X106S, X106V, X106W, X107A, X107F, X107I, X107L, X107M, X107Q,
X107S, X107T, X107V, X108A, X108G, X108I, X108L, X108S, X108T,
X108V, X109A, X109C, X109E, X109F, X109G, X109H, X109I, X109K,
X109L, X109M, X109N, X109Q, X109R, X109S, X109T, X109W, X109Y,
X110A, X110G, X110S, X111C, X111E, X111F, X111I, X111L, X111M,
X111V, X111Y, X112A, X112C, X112D, X112E, X112F, X112G, X112I,
X112L, X112N, X112Q, X112S, X112T, X112V, X112W, X112Y, X114A,
X114C, X114G, X114T, X115C, X115E, X115F, X115G, X115H, X115I,
X115K, X115L, X115M, X115N, X115P, X115Q, X115R, X115S, X115T,
X115V, X115W, X115Y, X116A, X116C, X116D, X116F, X116G, X116I,
X116K, X116L, X116M, X116N, X116Q, X116S, X116T, X116V, X116W,
X117A, X117C, X117D, X117F, X117G, X117I, X117N, X117Q, X117R,
X117T, X117Y, X118A, X118C, X118D, X118E, X118F, X118G, X118I,
X118K, X118L, X118M, X118N, X118P, X118R, X118S, X118T, X118V,
X118W, X119A, X119C, X119F, X119H, X119M, X119N, X119Q, X119T,
X119W, X120A, X120C, X120E, X120F, X120G, X120H, X120I, X120L,
X120M, X120N, X120R, X120S, X120T, X120W, X121A, X121C, X121E,
X121F, X121G, X121I, X121L, X121M, X121Q, X121S, X121T, X121V,
X121Y, X122A, X122C, X122G, X122I, X122L, X122S, X122T, X122V,
X123G, X123N, X123S, X124G, X124L, X124S, X124T, X125A, X125S,
X126A, X126F, X126L, X127F, X127G, X127I, X127R, X127S, X127T,
X128A, X128F, X128G, X128I, X128K, X128L, X128M, X128N, X128Q,
X128R, X128S, X128T, X128W, X129A, X129E, X129F, X129G, X129I,
X129L, X129M, X129N, X129P, X129R, X129S, X129T, X129V, X129W,
X129Y, X130C, X130K, X130L, X130N, X130Q, X130R, X130S, X130V,
X130W, X130Y, X131A, X131D, X131E, X131F, X131G, X131I, X131K,
X131L, X131P, X131Q, X131R, X131V, X132A, X132E, X132F, X132H,
X132I, X132L, X132M, X132N, X132Q, X132S, X132T, X132W, X133A,
X133F, X133K, X133L, X133N, X133P, X133Q, X133S, X133T, X133V,
X133Y, X134A, X134F, X134I, X134L, X134M, X134P, X134S, X134T,
X134V, X135C, X135E, X135L, X135M, X135W, X136A, X136E, X136F,
X136K, X136Q, X136R, X136S, X136V, X136W, X136Y, X137A, X137C,
X137E, X137G, X137H, X137K, X137L, X137M, X137Q, X137R, X137S,
X137V, X137W, X138A, X138G, X138M, X138R, X138V, X139A, X139C,
X139I, X139M, X139T, X139V, X140A, X140C, X140D, X140E, X140F,
X140G, X140I, X140L, X140M, X140N, X140Q, X140R, X140S, X140T,
X140V, X140Y, X141D, X141E, X141G, X141H, X141I, X141K, X141L,
X141N, X141Q, X141R, X141S, X141V, X141Y, X142A, X142C, X142L,
X142T, X142V, X142Y, X143C, X143D, X143F, X143G, X143H, X143I,
X143K, X143L, X143M, X143N, X143S, X143T, X143V, X143W, X143Y,
X144A, X144C, X144D, X144G, X144H, X144I, X144L, X144M, X144N,
X144Q, X144R, X144S, X144T, X144V, X144W, X144Y, X145A, X145C,
X145D, X145E, X145F, X145G, X145K, X145L, X145M, X145N, X145Q,
X145R, X145S, X145T, X145W, X145Y, X146A, X146C, X146D, X146E,
X146G, X146K, X146Q, X147I, X147L, X147M, X147T, X147V, X148A,
X148C, X148E, X148F, X148H, X148I, X148L, X148M, X148N, X148S,
X148T, X148V, X148Y, X149A, X149C, X149I, X149L, X149M, X149P,
X149S, X149T, X149V, X150A, X150F, X150L, X150T, X150V, X151A,
X151G, X151S, X152A, X152S, X153A, X153G, X153S, X153V, X156A,
X156C, X156D, X156E, X156F, X156L, X156M, X156N, X156S, X156T,
X158A, X158C, X158E, X158F, X158H, X158K, X158L, X158M, X158Q,
X158R, X158S, X158T, X158V, X158W, X159A, X159C, X159E, X159G,
X159H, X159M, X159P, X159Q, X159R, X159S, X159W, X160A, X160C,
X160D, X160F, X160G, X160I, X160L, X160M, X160N, X160Q, X160R,
X160S, X160T, X160V, X160Y, X165I, X165L, X165T, X165V, X166A,
X166C, X166D, X166E, X166H, X166M, X166N, X166S, X167C, X167D,
X167E, X167F, X167P, X167V, X167W, X167Y, X169A, X169G, X169S,
X170A, X170D, X170E, X170G, X170H, X170K, X170L, X170P, X170Q,
X170R, X170S, X170V, X170W, X170Y, X171C, X171F, X171L, X171N,
X171Y, X172A, X172C, X172D, X172F, X172G, X172I, X172K, X172L,
X172M, X172P, X172Q, X172R, X172S, X172T, X172V, X172Y, X173A,
X173C, X173D, X173E, X173F, X173G, X173H, X173K, X173L, X173M,
X173N, X173Q, X173R, X173T, X173V, X173W, X174A, X174G, X174S,
X174T, X174V, X175A, X175C, X175I, X175L, X175M, X175Q, X175T,
X175V, X175Y, X176A, X176G, X176S, X177A, X177C, X177I, X177T,
X177V, X178A, X178G, X179A, X179G, X180C, X180I, X180L, X180S,
X180T, X180V, X181D, X181N, X182A, X182D, X182E, X182F, X182G,
X182H, X182I, X182K, X182L, X182M, X182N, X182P, X182Q, X182R,
X182S, X182T, X182V, X182W, X182Y, X183A, X183D, X183F, X183G,
X183H, X183I, X183K, X183L, X183M, X183N, X183Q, X183R, X183S,
X183T, X183V, X183W, X183Y, X184D, X184N, X185A, X185C, X185E,
X185F, X185G, X185H, X185I, X185K, X185L, X185M, X185N, X185Q,
X185R, X185S, X185T, X185V, X185Y, X186H, X186I, X186K, X186L,
X186R, X187A, X187P, X187W, X188A, X188D, X188E, X188F, X188G,
X188H, X188I, X188K, X188L, X188P, X188Q, X188R, X188S, X188T,
X188V, X188W, X188Y, X191D, X191Q, X192W, X192Y, X194A, X194C,
X194D, X194E, X194F, X194G, X194H, X194I, X194L, X194M, X194P,
X194Q, X194R, X194S, X194T, X194V, X194W, X194Y, X195A, X195C,
X195D, X195E, X195G, X195Q, X195Y, X196L, X196M, X197A, X197C,
X197D, X197E, X197G, X197N, X197Q, X197S, X197T, X198A, X198F,
X198G, X198H, X198I, X198L, X198M, X198N, X198R, X198S, X198T,
X198Y, X199A, X199C, X199I, X199M, X199S, X199T, X199V, X200A,
X200C, X200G, X200S, X203A, X203C, X203E, X203I, X203L, X203S,
X203T, X203V, X204A, X204C, X204E, X204F, X204G, X204I, X204K,
X204L, X204N, X204R, X204S, X204T, X204W, X204Y, X205I, X205T,
X205V, X206A, X206C, X206D, X206E, X206G, X206H, X206I, X206K,
X206L, X206N, X206P, X206Q, X206R, X206S, X206T, X206V, X206W,
X206Y, X207A, X207S, X208C, X208L, X208S, X208T, X208V, X209A,
X209C, X209F, X209G, X209H, X209I, X209K, X209L, X209M, X209N,
X209R, X209S, X209V, X209W, X209Y, X210A, X210C, X210E, X210G,
X210H, X210I, X210L, X210M, X210N, X210P, X210R, X210S, X210V,
X210Y, X211A, X211C, X211E, X211F, X211G, X211H, X211I, X211L,
X211M, X211P, X211Q, X211R, X211T, X211V, X211W, X211Y, X212C,
X212F, X212G, X212H, X212I, X212M, X212N, X212P, X212R, X212S,
X212T, X212V, X212Y, X213A, X213C, X213D, X213E, X213F, X213G,
X213I, X213K, X213L, X213M, X213N, X213Q, X213R, X213S, X213T,
X213V, X213W, X213Y, X214F, X214L, X214W, X214Y, X215A, X215C,
X215D, X215E, X215F, X215G, X215H, X215I, X215K, X215M, X215N,
X215P, X215R, X215S, X215T, X215V, X215W, X215Y, X216A, X216C,
X216D, X216E, X216F, X216G, X216H, X216I, X216K, X216L, X216M,
X216N, X216P, X216Q, X216R, X216S, X216V, X216W, X216Y, X217A,
X217C, X217E, X217F, X217G, X217I, X217K, X217L, X217M, X217Q,
X218C, X218D, X218E, X218F, X218G, X218H, X218I, X218M, X218N,
X218Q, X218R, X218S, X218T, X218V, X218Y, X220S, X220T, X222A,
X222M, X222Q, X223A, X223G, X223S, X224A, X224G, X224L, X224N,
X224S, X224T, X225C, X225P, X226C, X226F, X226H, X226M, X226V,
X227A, X227C, X227G, X227I, X227L, X227M, X227S, X227T, X227V,
X228A, X228C, X228G, X228I, X228S, X228V, X229A, X229G, X229P,
X229S, X230A, X230D, X230E, X230G, X230H, X230I, X230L, X230N,
X230Q, X230S, X230T, X230V, X231A, X231C, X231F, X231G, X231H,
X231I, X231L, X231S, X231T, X231Y, X232A, X232G, X232H, X232L,
X232M, X232S, X232V, X233A, X233C, X233E, X233F, X233G, X233I,
X233L, X233M, X233N, X233P, X233Q, X233S, X233T, X233V, X233Y,
X234D, X234F, X234G, X234H, X234L, X234M, X234N, X234Q, X234S,
X234T, X234V, X234Y, X235C, X235D, X235E, X235F, X235G, X235H,
X235I, X235K, X235L, X235M, X235N, X235Q, X235R, X235S, X235V,
X235W, X235Y, X236A, X236C, X236E, X236F, X236H, X236K, X236N,
X236P, X236Q, X236R, X236S, X236T, X236V, X236W, X236Y, X237A,
X237C, X237F, X237G, X237H, X237I, X237K, X237L, X237M, X237P,
X237Q, X237R, X237S, X237T, X237V, X237W, X237Y, X238C, X238D,
X238E, X238F, X238G, X238H, X238I, X238K, X238L, X238M, X238N,
X238Q, X238R, X238S, X238T, X238V, X238Y, X239C, X239D, X239F,
X239G, X239H, X239I, X239K, X239L, X239M, X239N, X239P, X239Q,
X239R, X239S, X239T, X239V, X239W, X239Y, X240A, X240C, X240E,
X240F, X240I, X240K, X240L, X240M, X240N, X240Q, X240R, X240S,
X240T, X240W, X240Y, X241A, X241C, X241D, X241E, X241F, X241G,
X241H, X241I, X241K, X241L, X241M, X241N, X241P, X241Q, X241R,
X241S, X241T, X241V, X241W, X241Y, X242A, X242C, X242D, X242F,
X242G, X242H, X242I, X242L, X242M, X242P, X242Q, X242R, X242S,
X242T, X242V, X242W, X243C, X243D, X243E, X243F, X243G, X243H,
X243I, X243K, X243L, X243M, X243N, X243P, X243Q, X243R, X243S,
X243T, X243V, X243W, X244A, X244D, X244E, X244F, X244H, X244I,
X244L, X244M, X244N, X244P, X244Q, X244R, X244S, X244T, X244V,
X244W, X244Y, X245A, X245C, X245E, X245G, X245H, X245K, X245L,
X245P, X245Q, X245R, X245S, X245V, X245W, X245Y, X246A, X246C,
X246E, X246F, X246G, X246H, X246I, X246L, X246M, X246N, X246Q,
X246S, X246T, X246V, X246W, X246Y, X247A, X247C, X247D, X247E,
X247F, X247G, X247H, X247I, X247K, X247L, X247M, X247N, X247P,
X247Q, X247R, X247S, X247T, X247V, X247W, X247Y, X248C, X248D,
X248E, X248G, X248H, X248I, X248K, X248L, X248N, X248P, X248R,
X248S, X248T, X248V, X248W, X248Y, X249A, X249D, X249E, X249F,
X249G, X249H, X249I, X249K, X249L, X249M, X249N, X249Q, X249R,
X249S, X249T, X249V, X249W, X249Y, X250A, X250C, X250F, X250I,
X250L, X250M, X250Q, X250S, X250V, X251A, X251D, X251E, X251F,
X251G, X251K, X251L, X251M, X251Q, X251R, X251T, X251V, X251Y,
X252A, X252C, X252D, X252F, X252G, X252H, X252I, X252K, X252L,
X252M, X252N, X252R, X252S, X252V, X252W, X252Y, X253A, X253D,
X253E, X253F, X253G, X253H, X253I, X253K, X253M, X253R, X253S,
X253T, X253V, X253W, X254A, X254C, X254G, X254S, X254T, X255A,
X255C, X255D, X255E, X255F, X255H, X255I, X255L,
X255N, X255P, X255Q, X255R, X255S, X255T, X255V, X255W, X255Y,
X256A, X256C, X256D, X256E, X256G, X256H, X256I, X256K, X256L,
X256M, X256N, X256P, X256R, X256S, X256T, X256V, X256W, X256Y,
X257C, X257F, X257I, X257K, X257L, X257M, X257V, X258A, X258C,
X258D, X258E, X258F, X258G, X258H, X258I, X258L, X258M, X258P,
X258Q, X258R, X258S, X258T, X258V, X258W, X258Y, X259A, X259C,
X259E, X259G, X259I, X259L, X259M, X259P, X259Q, X259R, X259S,
X259T, X259V, X260A, X260D, X260E, X260F, X260H, X260I, X260L,
X260M, X260N, X260P, X260R, X260S, X260T, X260V, X260Y, X261A,
X261C, X261E, X261F, X261G, X261I, X261K, X261L, X261N, X261P,
X261Q, X261R, X261S, X261T, X261V, X261W, X261Y, X262A, X262C,
X262D, X262F, X262G, X262H, X262I, X262K, X262L, X262M, X262Q,
X262R, X262S, X262T, X262V, X262W, X262Y, X263C, X263F, X263L,
X263Y, X264A, X264G, X265A, X265C, X265D, X265F, X265G, X265H,
X265K, X265M, X265Q, X265R, X265S, X265T, X265W, X265Y, X267G,
X267I, X267L, X267M, X267N, X267V, X268A, X268G, X268H, X268L,
X268M, X268N, X268P, X268Q, X268S, X268V, X269C, X269D, X269F,
X269G, X269H, X269I, X269L, X269M, X269N, X269Q, X269R, X269S,
X269T, X269V, X270A, X270C, X270D, X270G, X270I, X270L, X270M,
X270N, X270S, X270T, X270V, X271A, X271C, X271E, X271F, X271G,
X271H, X271I, X271K, X271L, X271M, X271N, X271P, X271T, X271V,
X271Y, X272A, X272C, X272D, X272E, X272F, X272G, X272H, X272K,
X272L, X272M, X272N, X272P, X272R, X272S, X272T, X272W, X272Y,
X273A, X273C, X273D, X273E, X273F, X273G, X273H, X273I, X273L,
X273S, X273T, X273V, X274A, X274C, X274D, X274E, X274G, X274H,
X274L, X274M, X274N, X274P, X274Q, X274R, X274S, X274T, X274W,
X275A, X275C, X275D, X275E, X275F, X275G, X275H, X275K, X275L,
X275M, X275P, X275Q, X275R, X275V, and X275W, wherein the positions
are numbered by correspondence with the amino acid sequence of
[0027] B. amyloliquefaciens subtilisin BPN' set forth as SEQ ID
NO:1. In some embodiments, the subtilisin variant comprises two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve or
more of the positions recited above.
[0028] In some embodiments, the present invention provides isolated
subtilisin variants having a performance index greater than 1 in at
least one assay selected from a BMI assay, an egg yolk microswatch
assay, and/or an AAPF activity assay, and a performance index of
greater than 0.8 for LAS stability and in a TCA assay, wherein the
variant comprises at least three substitutions selected from:
X001A, X001E, X001G, X001H, X001Q, X001V, X003E, X003H, X003I,
X003M, X003S, X003T, X003V, X004T, X004V, X008I, X008V, X009E,
X009H, X009N, X009Q, X009S, X009T, X010A, X010C, X010G, X010H,
X010K, X010M, X010N, X010R, X010S, X010T, X011I, X011V, X012G,
X012I, X012N, X012Q, X012S, X012T, X012V, X013A, X013G, X015A,
X015D, X015F, X015G, X015I, X015L, X015M, X015P, X015Q, X015S,
X015V, X015W, X016A, X016G, X016N, X016P, X016S, X016T, X016V,
X017H, X017I, X017M, X017N, X018A, X018C, X018D, X018E, X018G,
X018H, X018L, X018M, X018N, X018P, X018Q, X018S, X018T, X018V,
X018Y, X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K,
X019L, X019M, X019N, X019R, X019S, X019V, X019W, X019Y, X020A,
X020C, X020D, X020F, X020G, X020I, X020K, X020L, X020M, X020P,
X020Q, X020R, X020S, X020T, X020V, X020W, X020Y, X021A, X021C,
X021E, X021G, X021H, X021I, X021K, X021L, X021M, X021N, X021P,
X021Q, X021S, X021T, X021V, X021W, X022A, X022C, X022G, X022I,
X022L, X022M, X022N, X022P, X022Q, X022T, X022V, X022W, X023A,
X023G, X023S, X024A, X024C, X024D, X024F, X024G, X024H, X024L,
X024M, X024N, X024P, X024Q, X024R, X024S, X024T, X024V, X024W,
X025C, X025D, X025E, X025F, X025G, X025K, X025L, X025M, X025Q,
X025R, X025S, X025T, X025V, X025W, X026C, X026F, X026G, X026M,
X026N, X026R, X026S, X026T, X026V, X027A, X027C, X027D, X027F,
X027G, X027K, X027L, X027M, X027N, X027P, X027R, X027S, X027T,
X027W, X028A, X028I, X028L, X028M, X028V, X029A, X029C, X029G,
X029S, X029V, X030A, X030C, X030L, X030M, X030T, X030V, X031A,
X031F, X031I, X031L, X031M, X031S, X031V, X033C, X033M, X033S,
X033T, X035I, X035L, X035M, X035P, X036A, X036E, X036S, X036T,
X036V, X038C, X038F, X038H, X038I, X038K, X038L, X038M, X038N,
X038Q, X038R, X038T, X038V, X038Y, X040A, X040D, X040E, X040I,
X040L, X040P, X040V, X043A, X043C, X043D, X043E, X043F, X043G,
X043I, X043L, X043M, X043N, X043R, X043S, X043T, X043W, X043Y,
X044A, X044C, X044D, X044F, X044G, X044I, X044K, X044L, X044M,
X044N, X044Q, X044R, X044S, X044T, X044V, X044Y, X045A, X045D,
X045F, X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P,
X045Q, X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D,
X046E, X046G, X046H, X046I, X046K, X046L, X046M, X046N, X046P,
X046Q, X046R, X046S, X046T, X046V, X047G, X047R, X048A, X048C,
X048E, X048F, X048H, X048I, X048K, X048L, X048M, X048N, X048P,
X048Q, X048R, X048S, X048T, X048V, X048Y, X049A, X049G, X049H,
X049S, X049T, X050F, X050H, X050I, X050L, X050T, X050V, X050Y,
X051F, X051H, X051K, X051L, X051R, X051S, X051T, X051V, X051W,
X052A, X052C, X052E, X052F, X052G, X052H, X052I, X052L, X052M,
X052N, X052P, X052Q, X052R, X052T, X052V, X052W, X052Y, X053A,
X053C, X053D, X053E, X053G, X053H, X053K, X053L, X053M, X053Q,
X053R, X053S, X053T, X053W, X053Y, X054A, X054C, X054D, X054E,
X054F, X054H, X054M, X054N, X054Q, X054S, X055C, X055E, X055G,
X055H, X055K, X055L, X055P, X055Q, X055S, X055T, X055W, X056A,
X056C, X056D, X056E, X056H, X056L, X056M, X056N, X056P, X056Q,
X056S, X056T, X057C, X057E, X057F, X057G, X057H, X057I, X057L,
X057M, X057N, X057P, X057Q, X057R, X057S, X057T, X057V, X057W,
X057Y, X059A, X059D, X059G, X059I, X059L, X059M, X059N, X059Q,
X059R, X059S, X059T, X059V, X059W, X061A, X061C, X061D, X061F,
X061G, X061H, X061I, X061L, X061M, X061N, X061P, X061R, X061S,
X061T, X061V, X061Y, X062C, X062E, X062F, X062H, X062I, X062K,
X062L, X062M, X062N, X062Q, X062R, X062S, X062T, X062V, X068I,
X068L, X068V, X069A, X069G, X069S, X069T, X072I, X072L, X072T,
X072V, X073A, X073C, X073S, X076D, X076N, X078A, X078C, X078E,
X078H, X078L, X078M, X078N, X078Q, X078S, X078T, X084C, X084G,
X084I, X084M, X084V, X086C, X086P, X087A, X087C, X087D, X087E,
X087G, X087K, X087L, X087N, X087S, X087V, X088A, X088C, X088G,
X088S, X089A, X089D, X089E, X089G, X089H, X089I, X089N, X089Q,
X089R, X089S, X089T, X089W, X090C, X090I, X090L, X090M, X090Q,
X090T, X090V, X091D, X091F, X091I, X091N, X091S, X091V, X091W,
X091Y, X092A, X092G, X092P, X092R, X092V, X093A, X093C, X093G,
X093L, X093M, X093T, X093V, X094K, X094R, X095A, X095C, X095I,
X095S, X095V, X096F, X096I, X096L, X096M, X097A, X097D, X097E,
X097F, X097G, X097H, X097K, X097L, X097M, X097N, X097P, X097Q,
X097R, X097S, X097T, X097V, X097W, X097Y, X098A, X098C, X098D,
X098E, X098F, X098G, X098K, X098L, X098N, X098P, X098Q, X098R,
X098S, X098T, X098V, X098Y, X099A, X099C, X099F, X099G, X099K,
X099M, X099P, X099Q, X099R, X099S, X099T, X099V, X099Y, X100D,
X100E, X100G, X100I, X100K, X100N, X100R, X100S, X100T, X100V,
X100Y, X101A, X101C, X101D, X101E, X101F, X101G, X101H, X101I,
X101K, X101N, X101P, X101Q, X101R, X101S, X101T, X101V, X101Y,
X102A, X102G, X102T, X103A, X103C, X103D, X103F, X103G, X103I,
X103L, X103N, X103P, X103Q, X103R, X103S, X103T, X103V, X103W,
X104C, X104F, X104H, X104I, X104L, X104R, X104S, X104T, X104V,
X104W, X104Y, X105A, X105C, X105D, X105E, X105F, X105G, X105K,
X105L, X105N, X105Q, X105R, X105S, X105T, X105V, X106A, X106D,
X106E, X106G, X106I, X106L, X106R, X106S, X106T, X106V, X106W,
X107A, X107C, X107F, X107I, X107L, X107M, X107Q, X107S, X107T,
X107V, X108A, X108C, X108I, X108S, X108T, X108V, X109A, X109E,
X109F, X109G, X109H, X109I, X109K, X109L, X109M, X109N, X109Q,
X109R, X109S, X109T, X109W, X109Y, X110A, X110G, X111F, X111I,
X111L, X111M, X112D, X112E, X112I, X112Q, X112V, X114A, X114C,
X115C, X115E, X115G, X115L, X115M, X115P, X115Q, X115S, X115T,
X115W, X115Y, X116A, X116C, X116D, X116F, X116G, X116I, X116K,
X116L, X116M, X116N, X116Q, X116S, X116T, X116V, X116W, X117A,
X117C, X117N, X117Q, X117R, X117T, X117Y, X118A, X118C, X118D,
X118E, X118F, X118G, X118K, X118M, X118N, X118R, X118S, X118V,
X118W, X119A, X119F, X119M, X119T, X120A, X120C, X120E, X120F,
X120G, X120H, X120I, X120L, X120M, X120N, X120R, X120S, X120T,
X120W, X121A, X121C, X121F, X121I, X121L, X121M, X121S, X121T,
X121V, X122A, X122G, X122S, X122V, X124G, X124L, X124T, X126A,
X126F, X126I, X126L, X126M, X126V, X128A, X128F, X128G, X128I,
X128K, X128L, X128M, X128N, X128Q, X128R, X128S, X128T, X128W,
X129A, X129E, X129F, X129G, X129M, X129N, X129P, X129R, X129S,
X129Y, X130C, X130K, X130L, X130N, X130Q, X130R, X130S, X130V,
X130W, X130Y, X131A, X131D, X131E, X131F, X131G, X131K, X131P,
X131Q, X132A, X132H, X132I, X132N, X132Q, X132R, X132S, X132T,
X133A, X133F, X133K, X133N, X133P, X133S, X133T, X133V, X133Y,
X134A, X134S, X134T, X134V, X135L, X135M, X135W, X136E, X136Q,
X137A, X137C, X137E, X137H, X137K, X137L, X137M, X137Q, X137R,
X137S, X137W, X139C, X139I, X139V, X140D, X140E, X140N, X141D,
X141E, X141G, X141H, X141I, X141K, X141L, X141N, X141Q, X141R,
X141S, X141V, X141Y, X142A, X142C, X142V, X143C, X143D, X143F,
X143H, X143N, X143T, X144A, X144C, X144D, X144G, X144H, X144I,
X144L, X144M, X144N, X144R, X144S, X144T, X144V, X144Y, X145A,
X145C, X145D, X145F, X145K, X145L, X145N, X145Q, X145R, X146D,
X146G, X147I, X147L, X147T, X147V, X148C, X148I, X148L, X148M,
X148N, X148V, X149C, X149I, X149L, X149V, X150A, X150L, X150T,
X150V, X151A, X151S, X152A, X152S, X156D, X156E, X156L, X156N,
X156S, X156T, X158A, X158C, X158E, X158F, X158H, X158K, X158L,
X158M, X158Q, X158R, X158S, X158T, X158V, X159A, X159C, X159E,
X159G, X159H, X159M, X159P, X159S, X160A, X160C, X160D, X160F,
X160I, X160L, X160M, X160N, X160Q, X160S, X160T, X160V, X160Y,
X165I, X165L, X165V, X166A, X166C, X166D, X166E, X166H, X166M,
X166S, X166T, X167F, X167Y, X170A, X170D, X170E, X170G, X170H,
X170K, X170Q, X170R, X170S, X170V, X170Y, X171C, X171Y, X172A,
X172C, X172D, X172G, X172I, X172K, X172L, X172M, X172P, X172Q,
X172R, X172S, X172V, X172Y, X173A, X173C, X173D, X173H, X173M,
X173N, X173Q, X173T, X174A, X174S, X174T, X174V, X175L, X175M,
X175V, X176A, X176S, X177C, X177V, X180T, X180V, X182A, X182D,
X182E, X182Q, X183A, X183D, X183N, X183Q, X183S, X184D, X184N,
X185A, X185C, X185E, X185H, X185K, X185M, X185N, X185Q, X185T,
X185V, X186I, X186K, X186L, X186R, X187A, X187C, X188A, X188D,
X188E, X188F, X188H, X188I, X188K, X188L, X188P, X188Q, X188S,
X188T, X191A, X191D, X191Q, X191S, X194A, X194C, X194D, X194E,
X194F, X194H, X194I, X194L, X194M, X194P, X194Q, X194R, X194S,
X194T, X194W, X194Y, X195C, X195D, X195E, X195G, X195Q, X198I,
X198L, X199C, X199M, X199S, X199V, X203C, X203E, X203T, X203V,
X204A, X204C, X204E, X204G, X204N, X204S, X206D, X206E, X206H,
X206L, X206N, X206Q, X206S, X209F, X209M, X209W, X209Y, X210A,
X210C, X210I, X210L, X210M, X210N, X210P, X211A, X211C, X211E,
X211G, X211H, X211I, X211M, X211P, X211Q, X211T, X211V, X212C,
X212F, X212G, X212H, X212M, X212N, X212R, X212S, X212Y, X213A,
X213D, X213E, X213N, X213Q, X213S, X213T, X215A, X215C, X215D,
X215E, X215H, X215I, X215K, X215M, X215N, X215S, X215T, X215V,
X215Y, X216A, X216C, X216D, X216E, X216F, X216H, X216I, X216L,
X216M, X216N, X216Q, X216S, X216V, X216W, X216Y, X217A, X217C,
X217D, X217E, X217F, X217K, X217L, X217M, X217Q, X218C, X218D,
X218E, X218N, X218Q, X222C, X222M, X222S, X223A, X223S, X224A,
X224N, X224S, X224T, X227A, X227C, X227V, X228A, X228G, X228S,
X228V, X230A, X230G, X230N, X230S, X230T, X230V, X231A, X231C,
X231F, X231G, X231S, X232A, X232L, X232M, X233A, X233C, X233E,
X233G, X233I, X233L, X233N, X233Q, X233S, X233T, X233V, X234L,
X234M, X234N, X234Q, X234S, X234T, X234V, X235C, X235F, X235G,
X235H, X235I, X235K, X235L, X235M, X235N, X235Q, X235R, X235S,
X235V, X235W, X235Y, X236A, X236C, X236E, X236F, X236H, X236N,
X236Q, X236S, X236T, X236Y, X237A, X237C, X237F, X237G, X237H,
X237I, X237K, X237L, X237M, X237Q, X237R, X237S, X237T, X237V,
X237W, X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I,
X238K, X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V,
X238Y, X239C, X239D, X239F, X239G, X239H, X239K, X239L, X239M,
X239N, X239P, X239Q, X239R, X239S, X239T, X239V, X239W, X239Y,
X240A, X240C, X240E, X240F, X240I, X240K, X240M, X240N, X240Q,
X240R, X240S, X240T, X240W, X240Y, X241A, X241C, X241D, X241E,
X241F, X241G, X241H, X241I, X241K, X241L, X241M, X241N, X241Q,
X241R, X241S, X241T, X241V, X241W, X241Y, X242A, X242C, X242D,
X242G, X242H, X242I, X242L, X242M, X242P, X242Q, X242S, X242T,
X242V, X243C, X243D, X243E, X243F, X243G, X243H, X243I, X243L,
X243M, X243N, X243P, X243Q, X243S, X243T, X243V, X243W, X244D,
X244E, X244F, X244H, X244I, X244L, X244M, X244N, X244Q, X244S,
X244T, X244V, X244W, X245A, X245C, X245E, X245G, X245H, X245K,
X245L, X245P, X245Q, X245S, X245V, X245W, X245Y, X246A, X246C,
X246I, X246L, X246M, X246T, X246V, X247A, X247C, X247F, X247G,
X247H, X247K, X247L, X247M, X247N, X247R, X247S, X247T, X247V,
X247W, X247Y, X248C, X248D, X248E, X248G, X248H, X248I, X248L,
X248N, X248P, X248R, X248S, X248T, X248V, X248Y, X249A, X249D,
X249E, X249F, X249G, X249H, X249I, X249K, X249L, X249M, X249N,
X249Q, X249S, X249T, X249W, X249Y, X250C, X250I, X250L, X250M,
X250V, X251A, X251D, X251E, X251F, X251G, X251K, X251L, X251M,
X251Q, X251R, X251T, X251V, X251Y, X252A, X252C, X252D, X252F,
X252G, X252H, X252I, X252K, X252L, X252M, X252N, X252R, X252S,
X252V, X252W, X253A, X253E, X253H, X253M, X253S, X253T, X253W,
X255A, X255C, X255D, X255E, X255I, X255L, X255N, X255Q, X255T,
X255V, X255Y, X256A, X256C, X256D, X256E, X256G, X256H, X256I,
X256K, X256L, X256M, X256N, X256P, X256S, X256V, X256W, X256Y,
X258D, X258G, X259A, X259C, X259E, X259P, X259Q, X259S, X260A,
X260D, X260E, X260H, X260I, X260N, X260P, X260S, X260T, X260V,
X261A, X261C, X261E, X261F, X261I, X261K, X261L, X261N, X261P,
X261Q, X261S, X261T, X261V, X261W, X261Y, X262A, X262C, X262D,
X262F, X262H, X262I, X262L, X262M, X262Q, X262T, X262V, X262Y,
X265A, X265D, X265S, X267I, X267L, X268A, X268L, X268V, X269D,
X269H, X269N, X269Q, X269S, X270A, X270C, X270G, X270I, X270L,
X270N, X270S, X270T, X270V, X271C, X271E, X272A, X272C, X272D,
X272E, X272F, X272G, X272H, X272L, X272M, X272N, X272P, X272S,
X272T, X272W, X272Y, X273A, X273C, X273G, X273S, X274A, X274C,
X274G, X274L, X274M, X274N, X274S, X274T, X275D, X275E, X275F,
X275H, X275K, X275L, X275M, X275P, X275Q, and X275R, wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve or
more of the positions recited above.
[0029] In some embodiments, the present invention provides isolated
subtilisin variants having a performance index greater than 1 in at
least one assay selected from a BMI assay, an egg yolk microswatch
assay, and/or an AAPF activity assay, and a performance index of
greater than 0.8 for LAS stability or in a TCA assay, wherein the
variant comprises at least three substitutions selected from:
X001A, X001E, X001G, X001H, X001Q, X001V, X003E, X003H, X003I,
X003M, X003S, X003T, X003V, X004T, X004V, X008I, X008V, X009E,
X009H, X009N, X009Q, X009S, X009T, X010A, X010C, X010G, X010H,
X010K, X010M, X010N, X010R, X010S, X010T, X011I, X011V, X012G,
X012I, X012N, X012Q, X012S, X012T, X012V, X013A, X013G, X015A,
X015D, X015F, X015G, X015I, X015L, X015M, X015P, X015Q, X015S,
X015V, X015W, X016A, X016G, X016N, X016P, X016S, X016T, X016V,
X017H, X017I, X017M, X017N, X018A, X018C, X018D, X018E, X018G,
X018H, X018L, X018M, X018N, X018P, X018Q, X018S, X018T, X018V,
X018Y, X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K,
X019L, X019M, X019N, X019R, X019S, X019V, X019W, X019Y, X020A,
X020C, X020D, X020F, X020G, X020I, X020K, X020L, X020M, X020P,
X020Q, X020R, X020S, X020T, X020V, X020W, X020Y, X021A, X021C,
X021E, X021G, X021H, X021I, X021K, X021L, X021M, X021N, X021P,
X021Q, X021S, X021T, X021V, X021W, X022A, X022C, X022G, X022I,
X022L, X022M, X022N, X022P, X022Q, X022T, X022V, X022W, X023A,
X023G, X023S, X024A, X024C, X024D, X024F, X024G, X024H, X024L,
X024M, X024N, X024P, X024Q, X024R, X024S, X024T, X024V, X024W,
X025C, X025D, X025E, X025F, X025G, X025K, X025L, X025M, X025Q,
X025R, X025S, X025T, X025V, X025W, X026C, X026F, X026G, X026M,
X026N, X026R, X026S, X026T, X026V, X027A, X027C, X027D, X027F,
X027G, X027K, X027L, X027M, X027N, X027P, X027R, X027S, X027T,
X027W, X028A, X028I, X028L, X028M, X028V, X029A, X029C, X029G,
X029S, X029V, X030A, X030C, X030L, X030M, X030T, X030V, X031A,
X031F, X031I, X031L, X031M, X031S, X031V, X033C, X033M, X033S,
X033T, X035I, X035L, X035M, X035P, X036A, X036E, X036S, X036T,
X036V, X038C, X038F, X038H, X038I, X038K, X038L, X038M, X038N,
X038Q, X038R, X038T, X038V, X038Y, X040A, X040D, X040E, X040I,
X040L, X040P, X040V, X043A, X043C, X043D, X043E, X043F, X043G,
X043I, X043L, X043M, X043N, X043R, X043S, X043T, X043W, X043Y,
X044A, X044C, X044D, X044F, X044G, X044I, X044K, X044L, X044M,
X044N, X044Q, X044R, X044S, X044T, X044V, X044Y, X045A, X045D,
X045F, X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P,
X045Q, X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D,
X046E, X046G, X046H, X046I, X046K, X046L, X046M, X046N, X046P,
X046Q, X046R, X046S, X046T, X046V, X047G, X047R, X048A, X048C,
X048E, X048F, X048H, X048I, X048K, X048L, X048M, X048N, X048P,
X048Q, X048R, X048S, X048T, X048V, X048Y, X049A, X049G, X049H,
X049S, X049T, X050F, X050H, X050I, X050L, X050T, X050V, X050Y,
X051F, X051H, X051K, X051L, X051R, X051S, X051T, X051V, X051W,
X052A, X052C, X052E, X052F, X052G, X052H, X052I, X052L, X052M,
X052N, X052P, X052Q, X052R, X052T, X052V, X052W, X052Y, X053A,
X053C, X053D, X053E, X053G, X053H, X053K, X053L, X053M, X053Q,
X053R, X053S, X053T, X053W, X053Y, X054A, X054C, X054D, X054E,
X054F, X054H, X054M, X054N, X054Q, X054S, X055C, X055E, X055G,
X055H, X055K, X055L, X055P, X055Q, X055S, X055T, X055W, X056A,
X056C, X056D, X056E, X056H, X056L, X056M, X056N, X056P, X056Q,
X056S, X056T, X057C, X057E, X057F, X057G, X057H, X057I, X057L,
X057M, X057N, X057P, X057Q, X057R, X057S, X057T, X057V, X057W,
X057Y, X059A, X059D, X059G, X059I, X059L, X059M, X059N, X059Q,
X059R, X059S, X059T, X059V, X059W, X061A, X061C, X061D, X061F,
X061G, X061H, X061I, X061L, X061M, X061N, X061P, X061R, X061S,
X061T, X061V, X061Y, X062C, X062E, X062F, X062H, X062I, X062K,
X062L, X062M, X062N, X062Q, X062R, X062S, X062T, X062V, X068I,
X068L, X068V, X069A, X069G, X069S, X069T, X072I, X072L, X072T,
X072V, X073A, X073C, X073S, X076D, X076N, X078A, X078C, X078E,
X078H, X078L, X078M, X078N, X078Q, X078S, X078T, X084C, X084G,
X084I, X084M, X084V, X086C, X086P, X087A, X087C, X087D, X087E,
X087G, X087K, X087L, X087N, X087S, X087V, X088A, X088C, X088G,
X088S, X089A, X089D, X089E, X089G, X089H, X089I, X089N, X089Q,
X089R, X089S, X089T, X089W, X090C, X090I, X090L, X090M, X090Q,
X090T, X090V, X091D, X091F, X091I, X091N, X091S, X091V, X091W,
X091Y, X092A, X092G, X092P, X092R, X092V, X093A, X093C, X093G,
X093L, X093M, X093T, X093V, X094K, X094R, X095A, X095C, X095I,
X095S, X095V, X096F, X096I, X096L, X096M, X097A, X097D, X097E,
X097F, X097G, X097H, X097K, X097L, X097M, X097N, X097P, X097Q,
X097R, X097S, X097T, X097V, X097W, X097Y, X098A, X098C, X098D,
X098E, X098F, X098G, X098K, X098L, X098N, X098P, X098Q, X098R,
X098S, X098T, X098V, X098Y, X099A, X099C, X099F, X099G, X099K,
X099M, X099P, X099Q, X099R, X099S, X099T, X099V, X099Y, X100D,
X100E, X100G, X100I, X100K, X100N, X100R, X100S, X100T, X100V,
X100Y, X101A, X101C, X101D, X101E, X101F, X101G, X101H, X101I,
X101K, X101N, X101P, X101Q, X101R, X101S, X101T, X101V, X101Y,
X102A, X102G, X102T, X103A, X103C, X103D, X103F, X103G, X103I,
X103L, X103N, X103P, X103Q, X103R, X103S, X103T, X103V, X103W,
X104C, X104F, X104H, X104I, X104L, X104R, X104S, X104T, X104V,
X104W, X104Y, X105A, X105C, X105D, X105E, X105F, X105G, X105K,
X105L, X105N, X105Q, X105R, X105S, X105T, X105V, X106A, X106D,
X106E, X106G, X106I, X106L, X106R, X106S, X106T, X106V, X106W,
X107A, X107C, X107F, X107I, X107L, X107M, X107Q, X107S, X107T,
X107V, X108A, X108C, X108I, X108S, X108T, X108V, X109A, X109E,
X109F, X109G, X109H, X109I, X109K, X109L, X109M, X109N, X109Q,
X109R, X109S, X109T, X109W, X109Y, X110A, X110G, X111F, X111I,
X111L, X111M, X112D, X112E, X112I, X112Q, X112V, X114A, X114C,
X115C, X115E, X115G, X115L, X115M, X115P, X115Q, X115S, X115T,
X115W, X115Y, X116A, X116C, X116D, X116F, X116G, X116I, X116K,
X116L, X116M, X116N, X116Q, X116S, X116T, X116V, X116W, X117A,
X117C, X117N, X117Q, X117R, X117T, X117Y, X118A, X118C, X118D,
X118E, X118F, X118G, X118K, X118M, X118N, X118R, X118S, X118V,
X118W, X119A, X119F, X119M, X119T, X120A, X120C, X120E, X120F,
X120G, X120H, X120I, X120L, X120M, X120N, X120R, X120S, X120T,
X120W, X121A, X121C, X121F, X121I, X121L, X121M, X121S, X121T,
X121V, X122A, X122G, X122S, X122V, X124G, X124L, X124T, X126A,
X126F, X126I, X126L, X126M, X126V, X128A, X128F, X128G, X128I,
X128K, X128L, X128M, X128N, X128Q, X128R, X128S, X128T, X128W,
X129A, X129E, X129F, X129G, X129M, X129N, X129P, X129R, X129S,
X129Y, X130C, X130K, X130L, X130N, X130Q, X130R, X130S, X130V,
X130W, X130Y, X131A, X131D, X131E, X131F, X131G, X131K, X131P,
X131Q, X132A, X132H, X132I, X132N, X132Q, X132R, X132S, X132T,
X133A, X133F, X133K, X133N, X133P, X133S, X133T, X133V, X133Y,
X134A, X134S, X134T, X134V, X135L, X135M, X135W, X136E, X136Q,
X137A, X137C, X137E, X137H, X137K, X137L, X137M, X137Q, X137R,
X137S, X137W, X139C, X139I, X139V, X140D, X140E, X140N, X141D,
X141E, X141G, X141H, X141I, X141K, X141L, X141N, X141Q, X141R,
X141S, X141V, X141Y, X142A, X142C, X142V, X143C, X143D, X143F,
X143H, X143N, X143T, X144A, X144C, X144D, X144G, X144H, X144I,
X144L, X144M, X144N, X144R, X144S, X144T, X144V, X144Y, X145A,
X145C, X145D, X145F, X145K, X145L, X145N, X145Q, X145R, X146D,
X146G, X147I, X147L, X147T, X147V, X148C, X148I, X148L, X148M,
X148N, X148V, X149C, X149I, X149L, X149V, X150A, X150L, X150T,
X150V, X151A, X151S, X152A, X152S, X156D, X156E, X156L, X156N,
X156S, X156T, X158A, X158C, X158E, X158F, X158H, X158K, X158L,
X158M, X158Q, X158R, X158S, X158T, X158V, X159A, X159C, X159E,
X159G, X159H, X159M, X159P, X159S, X160A, X160C, X160D, X160F,
X160I, X160L, X160M, X160N, X160Q, X160S, X160T, X160V, X160Y,
X165I, X165L, X165V, X166A, X166C, X166D, X166E, X166H, X166M,
X166S, X166T, X167F, X167Y, X170A, X170D, X170E, X170G, X170H,
X170K, X170Q, X170R, X170S, X170V, X170Y, X171C, X171Y, X172A,
X172C, X172D, X172G, X172I, X172K, X172L, X172M, X172P, X172Q,
X172R, X172S, X172V, X172Y, X173A, X173C, X173D, X173H, X173M,
X173N, X173Q, X173T, X174A, X174S, X174T, X174V, X175L, X175M,
X175V, X176A, X176S, X177C, X177V, X180T, X180V, X182A, X182D,
X182E, X182Q, X183A, X183D, X183N, X183Q, X183S, X184D, X184N,
X185A, X185C, X185E, X185H, X185K, X185M, X185N, X185Q, X185T,
X185V, X186I, X186K, X186L, X186R, X187A, X187C, X188A, X188D,
X188E, X188F, X188H, X188I, X188K, X188L, X188P, X188Q, X188S,
X188T, X191A, X191D, X191Q, X191S, X194A, X194C, X194D, X194E,
X194F, X194H, X194I, X194L, X194M, X194P, X194Q, X194R, X194S,
X194T, X194W, X194Y, X195C, X195D, X195E, X195G, X195Q, X198I,
X198L, X199C, X199M, X199S, X199V, X203C, X203E, X203T, X203V,
X204A, X204C, X204E, X204G, X204N, X204S, X206D, X206E, X206H,
X206L, X206N, X206Q, X206S, X209F, X209M, X209W, X209Y, X210A,
X210C, X210I, X210L, X210M, X210N, X210P, X211A, X211C, X211E,
X211G, X211H, X211I, X211M, X211P, X211Q, X211T, X211V, X212C,
X212F, X212G, X212H, X212M, X212N, X212R, X212S, X212Y, X213A,
X213D, X213E, X213N, X213Q, X213S, X213T, X215A, X215C, X215D,
X215E, X215H, X215I, X215K, X215M, X215N, X215S, X215T, X215V,
X215Y, X216A, X216C, X216D, X216E, X216F, X216H, X216I, X216L,
X216M, X216N, X216Q, X216S, X216V, X216W, X216Y, X217A, X217C,
X217D, X217E, X217F, X217K, X217L, X217M, X217Q, X218C, X218D,
X218E, X218N, X218Q, X222C, X222M, X222S, X223A, X223S, X224A,
X224N, X224S, X224T, X227A, X227C, X227V, X228A, X228G, X228S,
X228V, X230A, X230G, X230N, X230S, X230T, X230V, X231A, X231C,
X231F, X231G, X231S, X232A, X232L, X232M, X233A, X233C, X233E,
X233G, X233I, X233L, X233N, X233Q, X233S, X233T, X233V, X234L,
X234M, X234N, X234Q, X234S, X234T, X234V, X235C, X235F, X235G,
X235H, X235I, X235K, X235L, X235M, X235N, X235Q, X235R, X235S,
X235V, X235W, X235Y, X236A, X236C, X236E, X236F, X236H, X236N,
X236Q, X236S, X236T, X236Y, X237A, X237C, X237F, X237G, X237H,
X237I, X237K, X237L, X237M, X237Q, X237R, X237S, X237T, X237V,
X237W, X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I,
X238K, X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V,
X238Y, X239C, X239D, X239F, X239G, X239H, X239K, X239L, X239M,
X239N, X239P, X239Q, X239R, X239S, X239T, X239V, X239W, X239Y,
X240A, X240C, X240E, X240F, X240I, X240K, X240M, X240N, X240Q,
X240R, X240S, X240T, X240W, X240Y, X241A, X241C, X241D, X241E,
X241F, X241G, X241H, X241I, X241K, X241L, X241M, X241N, X241Q,
X241R, X241S, X241T, X241V, X241W, X241Y, X242A, X242C, X242D,
X242G, X242H, X242I, X242L, X242M, X242P, X242Q, X242S, X242T,
X242V, X243C, X243D, X243E, X243F, X243G, X243H, X243I, X243L,
X243M, X243N, X243P, X243Q, X243S, X243T, X243V, X243W, X244D,
X244E, X244F, X244H, X244I, X244L, X244M, X244N, X244Q, X244S,
X244T, X244V, X244W, X245A, X245C, X245E, X245G, X245H, X245K,
X245L, X245P, X245Q, X245S, X245V, X245W, X245Y, X246A, X246C,
X246I, X246L, X246M, X246T, X246V, X247A, X247C, X247F, X247G,
X247H, X247K, X247L, X247M, X247N, X247R, X247S, X247T, X247V,
X247W, X247Y, X248C, X248D, X248E, X248G, X248H, X248I, X248L,
X248N, X248P, X248R, X248S, X248T, X248V, X248Y, X249A, X249D,
X249E, X249F, X249G, X249H, X249I, X249K, X249L, X249M, X249N,
X249Q, X249S, X249T, X249W, X249Y, X250C, X250I, X250L, X250M,
X250V, X251A, X251D, X251E, X251F, X251G, X251K, X251L, X251M,
X251Q, X251R, X251T, X251V, X251Y, X252A, X252C, X252D, X252F,
X252G, X252H, X252I, X252K, X252L, X252M, X252N, X252R, X252S,
X252V, X252W, X253A, X253E, X253H, X253M, X253S, X253T, X253W,
X255A, X255C, X255D, X255E, X255I, X255L, X255N, X255Q, X255T,
X255V, X255Y, X256A, X256C, X256D, X256E, X256G, X256H, X256I,
X256K, X256L, X256M, X256N, X256P, X256S, X256V, X256W, X256Y,
X258D, X258G, X259A, X259C, X259E, X259P, X259Q, X259S, X260A,
X260D, X260E, X260H, X260I, X260N, X260P, X260S, X260T, X260V,
X261A, X261C, X261E, X261F, X261I, X261K, X261L, X261N, X261P,
X261Q, X261S, X261T, X261V, X261W, X261Y, X262A, X262C, X262D,
X262F, X262H, X262I, X262L, X262M, X262Q, X262T, X262V, X262Y,
X265A, X265D, X265S, X267I, X267L, X268A, X268L, X268V, X269D,
X269H, X269N, X269Q, X269S, X270A, X270C, X270G, X270I, X270L,
X270N, X270S, X270T, X270V, X271C, X271E, X272A, X272C, X272D,
X272E, X272F, X272G, X272H, X272L, X272M, X272N, X272P, X272S,
X272T, X272W, X272Y, X273A, X273C, X273G, X273S, X274A, X274C,
X274G, X274L, X274M, X274N, X274S, X274T, X275D, X275E, X275F,
X275H, X275K, X275L, X275M, X275P, X275Q, and X275R, wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1. In some embodiments, the subtilisin variant comprises two,
three, four, five, six, seven, eight, nine, ten, eleven, twelve or
more of the positions recited above.
[0030] In some embodiments, the subtilisin variants comprise a
further substitution at one or more positions selected from the
group consisting of: 18, 52, 72, 117, 119, 127, 144, 185, 209 and
213, and wherein the positions are numbered by correspondence with
the amino acid sequence of B. amyloliquefaciens subtilisin BPN' set
forth as SEQ ID NO:1.
[0031] In some particularly preferred embodiments, the isolated
subtilisin variants described above and herein are GG36 variants.
In some preferred embodiments, the GG36 variants are variants of
SEQ ID NO:2. In some alternative embodiments, the isolated
subtilisin variants described above and herein are BPN'
variants.
[0032] In some yet additional embodiments, the isolated subtilisin
variants comprise a combination of substitutions selected from:
S87N/Q109Q/G118D/S128L/P129Q/S130A/S188S/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213R/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213T/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213E/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213T/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213T/N248R,
S87R/Q109R/G118V/S128L/P129Q/S130A/S188D/T213E/N248R,
S87R/Q109Q/G118R/S128L/P129Q/S130A/S188D/T213T/N248R,
S87R/Q109R/G118R/S128L/P129Q/S130A/S188D/T213T/N248R,
S87N/Q109Q/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213R/N248R,
S87R/Q109Q/G118R/S128L/P129Q/S130A/S188S/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213T/N248N,
S87R/Q109Q/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213E/N248R,
S87D/Q109D/G118D/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213R/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213T/N248R,
S87R/Q109R/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87R/Q109Q/G118R/S128L/P129Q/S130A/S188D/T213E/N248N,
S87N/Q109R/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213E/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213E/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213T/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213R/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213T/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213R/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213T/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213T/N248D,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213R/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213E/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213T/N248D,
S87R/Q109D/G118D/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213R/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213R/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213R/N248N,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213E/N248N,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213E/N248N,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213R/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213T/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213R/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213T/N248N,
S87R/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109D/G118V/S128L/P129Q/S130A/S188R/T213R/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213T/N248D,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213E/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213R/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213E/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188D/T213E/N248D,
S87R/Q109D/G118R/S128L/P129Q/S130A/S188D/T213E/N248N,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188R/T213R/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213R/N248N,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213T/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213E/N248R,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213R/N248D, and
S87N/Q109Q/G118V/S128LP129Q/S130A/S188R/T213E/N248R, wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1.
[0033] In some still further embodiments, the isolated subtilisin
variants comprise a combination of substitutions selected from:
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213T/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213R/N248N,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213R/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213E/N248D,
S87R/Q109D/G118R/S128L/P129Q/S130A/S188S/T213E/N248R,
S87R/Q109D/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109D/G118V/S128L/P129Q/S130A/S188D/T213E/N248D, and
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213E/N248D,
wherein the positions are numbered by correspondence with the amino
acid sequence of B. amyloliquefaciens subtilisin BPN' set forth as
SEQ ID NO:1.
[0034] In some yet further embodiments, the isolated subtilisin
variants comprise a combination of substitutions selected from:
S87D/Q109D/G118R/S128L/P129Q/S130A/S188R/T213E/N248D,
S87N/Q109D/G118R/S128L/P129Q/S130A/S188D/T213E/N248R,
S87D/Q109Q/G118D/S128L/P129Q/S130A/S188S/T213E/N248D,
S87N/Q109R/G118V/S128L/P129Q/S130A/S188S/T213E/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188D/T213E/N248D,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188R/T213T/N248D,
S87R/Q109D/G118V/S128L/P129Q/S130A/S188D/T213E/N248R,
S87N/Q109Q/G118V/S128L/P129Q/S130A/S188S/T213R/N248D, and
S87R/Q109D/G118R/S128L/P129Q/S130A/S188D/T213T/N248R, wherein the
positions are numbered by correspondence with the amino acid
sequence of B. amyloliquefaciens subtilisin BPN' set forth as SEQ
ID NO:1.
In some additional embodiments, the present invention provides
isolated subtilisin variants comprising a combination of
substitutions selected from: A001C/S024V/I107L,
A001I/R045T/I107R/A172T, A001K/A172L, A001K/A172W,
A001K/I072C/L126F, A001K/I072C/L126F/S164Q,
A001K/I072C/V104I/L126F, A001K/I072C/V104I/L126F/S164Q,
A001K/I072V, A001K/I072V/L126F, A001K/I072V/L126F/S164F,
A001K/I072V/V104I, A001K/I072V/V104I/L126F/S164I,
A001K/I072V/V104I/S164F, A001K/I072V/V104I/S164Q,
A001K/I107T/A172Q, A001K/I107V/G127Q, A001K/I107V/G127Q/A172Q,
A001K/I107V/G127R/A172Q, A001K/L126F, A001K/L126F/S164F,
A001K/L126F/S164I, A001K/L126F/S164Q, A001K/R045F/I072C,
A001K/R045F/I072C/L126F, A001K/R045F/I072C/V104I/S164F,
A001K/R045F/I072V/L126F/S164I, A001K/R045F/I072V/L126F/S164Q,
A001K/R045F/I072V/S164F, A001K/R045F/I072V/V104G/S164T,
A001K/R045F/I107L/A172N, A001K/R045F/I107T,
A001K/R045F/I107V/G127Q, A001K/R045F/L126F/S164F,
A001K/R045F/L126F/S164I, A001K/R045F/S164F,
A001K/R045F/V104I/L126F/S164Q, A001K/R045K/I072C/L126F/S164Q,
A001K/R045K/I072V/L126F, A001K/R045K/I072V/L126F/S164F,
A001K/R045K/I072V/L126F/S164Q, A001K/R045K/I072V/S164F,
A001K/R045K/I072V/S164Q, A001K/R045K/I072V/V104I/L126F/S164F,
A001K/R045K/I072V/V104I/L126F/S164I,
A001K/R045K/I072V/V104I/L126F/S164Q, A001K/R045K/I107A/A172T,
A001K/R045K/I107R/G127A/A172N, A001K/R045K/I107T/G127R,
A001K/R045K/I107T/G127R/A172Q, A001K/R045K/L126F,
A001K/R045K/L126F/S164I, A001K/R045K/L126F/S164P,
A001K/R045K/L126F/S164Q, A001K/R045K/S164F, A001K/R045KN104I/S164Q,
A001K/R045K/V104L/S164A, A001K/R045N/I107T/G127Q,
A001K/R045S/V104C/L126Y/S164F, A001K/S024H/I107T/G127Q,
A001K/S024H/I107T/G127R, A001K/S024H/I107V,
A001K/S024H/R045N/I107T, A001K/S024H/R045N/I107T/G127Q/A172Q,
A001K/S024L/R045A, A001K/S024N/I107V/G127T,
A001K/S024N/R045K/A172Y, A001K/S024R/I107T,
A001K/S024R/R045N/A172C, A001K/S024R/R045N/I107T,
A001K/S024R/R045N/I107T/G127R, A001K/S024T/I107T/G127Q/A172Q,
A001K/S024T/R045N/G127Q/A172Q, A001K/S024W/I107T/G127R,
A001K/S024W/I107V/G127T/A172Q, A001K/S164Q, A001K/V104E,
A001KN104I/L126F, A001KN104I/L126F/S164I, A001KN104I/L126F/S164Q,
A001L/I072C, A001L/R045Q/G127H/A172R, A001L/S024D/R045Y/I107Y,
A001M/R045S/I107E/A172D, A001P/A172V, A001Q/R045K/I107T,
A001R/A172G, A001R/A172Q, A001R/I107T, A001R/I107T/A172Q,
A001R/I107T/G127Q/A172Q, A001R/I107V/A172Q, A001R/R045F,
A001R/R045K/A172Q, A001R/R045K/G127R, A001R/R045K/I107T/G127Q,
A001R/R045K/I107V/G127R, A001R/R045N/A172K, A001R/R045N/A172Q,
A001R/R045N/I107T, A001R/R045N/I107T/G127Q,
A001R/R045N/I107V/A172V, A001R/R045N/I107V/G127Q/A172Q,
A001R/R045N/I107V/G127R, A001R/S024H/I107T,
A001R/S024H/R045K/I107T, A001R/S024H/R045K/I107T/A172Q,
A001R/S024H/R045N/I107T/A172Q, A001R/S024N, A001R/S024R,
A001R/S024R/A172H, A001R/S024R/A172Q, A001R/S024R/I107V/A172L,
A001R/S024R/I107V/G127R, A001R/S024R/R045F/I107T/G127Q,
A001R/S024R/R045F/I107T/G127R, A001R/S024R/R045K/I107T/G127Q,
A001R/S024T/I107T/A172Q, A001R/S024T/R045K/A172Q,
A001R/S024T/R045K/I107L/G127P/A172P, A001R/S024T/R045N/I107T/A172Q,
A001R/S024W/I107V/A172S, A001R/S024W/R045F/I107V/G127Q,
A001R/S024W/R045F/I107V/G127R, A001R/S024W/R045K,
A001R/S024W/R045K/I107T/A172Q, A001R/S024W/R045N/I107T,
A001S/A172V, A001S/S024L/I107Y/A172S, A001T/S024H/I107L/A172Y,
A001V/I107L/A172I, G097P/N185Q/A215I, G097P/Y209W/A215V/S256W,
G118L/G127R/S132L, G118T/G127Q, I107A/G127K/A172G, I107C/A172S,
I107P/A172S, I107Q/A172D, L126A/S164N, L126F/S164V, M119F/N185R,
M119F/N185R/Y209W/S256T, M119F/N185V/Y209W,
M119F/S144T/N185V/S256I, M119F/S144W/N185R/S256L, M119F/Y209W,
M119F/Y209W/S256I, N018K/A215I, N018K/A215R, N018K/A215V,
N018K/G097P/A215I/S256W, N018K/G097P/N185K/S256W,
N018K/G097P/N185K/Y209W/A215I/S256W,
N018K/G097P/N185Q/Y209W/A215V/S256W, N018K/G097P/N185R/A215R/S256W,
N018K/G097P/N185R/A215V/S256W, N018K/G097P/N185R/S256W,
N018K/G097P/N185R/Y209W, N018K/G097P/N185R/Y209W/S256W,
N018K/G097P/Y209W/A215V/S256W, N018K/N185K,
N018K/N185K/A215V/S256W, N018K/N185K/S256W,
N018K/N185K/Y209W/A215R, N018K/N185Q/A215R/S256W,
N018K/N185Q/A215V/S256W, N018K/N185Q/S256W,
N018K/N185Q/Y209W/S256W, N018K/N185R/A215I/S256W,
N018K/N185R/A215R/S256W, N018K/N185R/A215V,
N018K/N185R/Y209W/A215V/S256W, N018K/S256W,
N018Q/G097P/N185K/A215V, N018Q/G097P/N185K/Y209W, N018Q/N185K,
N018Q/N185K/S256W, N018Q/N185K/Y209W/A215I/S256W,
N018Q/N185K/Y209W/A215V, N018Q/N185K/Y209W/A215V/S256W,
N018Q/N185Q/A215V, N018Q/N185Q/S256W, N018Q/N185Q/Y209W/S256W,
N018Q/N185R/A215R, N018Q/N185R/S256W, N018R/G097P/N185Q/A215I,
N018R/G097P/Y209W/A215V, N018R/G097P/Y209W/S256W,
N018R/N185K/A215V/S256W, N018R/N185K/S256W,
N018R/N185Q/A215V/S256W, N018R/N185Q/Y209W/S256W,
N018R/N185R/A215R, N018R/N185R/S256W, N018R/N185R/Y209W/S256W,
N018R/Y209W/A215V/S256W, N018R/Y209W/S256W, N043E/S101E,
N043E/S101E/N248K, N043E/S101F, N043E/S101N/N117Y, N043E/S101V,
N043E/S101Y/N117I/N248K, N043E/S101Y/N117Y/N248K, N043F/N117I,
N043F/S101E/N117I/N248K, N043F/S101R, N043I/N117Y,
N043I/S101E/N248I, N043I/S101F/N117Y/N248K,
N043I/S101N/N117Y/N248K, N043I/S101R/N248K,
N043I/S101Y/N117I/N248I, N043I/S101Y/N117Y/N248K,
N043S/N117Y/N248K, N043S/N248I, N043S/S101E,
N043S/S101E/N117I/N248I, N043S/S101E/N117Y/N248K,
N043S/S101E/N248K, N043S/S101F, N043S/S101F/N248K,
N043S/S101N/N117I, N043S/S101R/N117I/N248K,
N043S/S101V/N117I/N248I, N043S/S101Y, N043S/S101Y/N117I,
N043S/S101Y/N117Y, N043S/S101Y/N248K, N043V/N117Y/N248I,
N043V/N248I, N043V/N248K, N043V/S101E/N117I/N248K,
N043V/S101E/N248I, N043V/S101F, N043V/S101F/N117I,
N043V/S101F/N117Y, N043V/S101F/N248K, N043V/S101R/N117I/N248K,
N043V/S101T/N248K, N043V/S101V/N117I, N043V/S101V/N248K,
N043V/S101Y, N043V/S101Y/N117I, N043V/S101Y/N117I/N248K,
N185K/A215V, N185K/Y209W/S256W, N185Q/A215R/S256W, N185Q/S256W,
N185R/S256W, N185R/Y209W/A215I, N185R/Y209W/S256W, N185V/Y209W,
P052I/M119F, P052I/M119F/S144T/N185R/Y209W,
P052I/M119F/S144V/Y209W, P052I/M119F/S144Y/N185R,
P052I/M119F/S144Y/N185R/Y209W/S256I, P052I/M119F/Y209W/S256I,
P052I/N185R/Y209W/S256I, P052I/N185V/Y209W,
P052I/N185V/Y209W/S256I, P052I/S144T,
P052I/S144T/N185R/Y209W/S256T, P052I/S144T/N185V/Y209W/S256T,
P052I/S144T/S256I, P052I/S144T/Y209W/S256I,
P052I/S144T/Y209W/S256T, P052I/S144V/Y209W,
P052I/S144Y/N185R/Y209W, P052I/S144Y/N185V,
P052I/S144Y/N185V/S256T, P052I/S144Y/S256T,
P052I/S144Y/Y209W/S256I, P052V/M119F/N185V/Y209W/S256I,
P052V/M119F/S144T, P052V/M119F/S144T/N185R/S256T,
P052V/M119F/S144T/N185R/Y209W, P052V/M119F/S144T/S256T,
P052V/M119F/S144T/Y209W, P052V/M119F/S144V/N185V/S256I,
P052V/N185V/Y209W/S256I, P052V/S144T,
P052V/S144T/N185V/Y209W/S256I, P052V/S144T/N185V/Y209W/S256T,
P052V/S144T/Y209W/S256I, P052V/S144V/N185R/Y209W/S256T,
P052V/S144V/N185V/Y209W, P052V/S144V/Y209W/S256I,
P052V/S144W/N185R, P052V/S144W/N185V/Y209W, P052V/S144W/Y209W,
P052V/S144Y/S256T, P052V/S144Y/Y209W, P052V/S256T, Q109A/G118S,
Q109D/G118V/G127H, Q109H/G118S/S132P, Q109H/G127R, Q109I/G118R,
Q109I/G118S, Q109I/G127C, Q109I/G127T/S132Y, Q109I/S132N,
Q109K/G118F/G127Q/S132N, Q109L/G118L/G127Q/S132N, Q109P/G118Q,
Q109R/G118V, Q109S/G118R, Q109T/G118N, Q109V/G118F, Q109V/G127Q,
Q109V/G127R, Q109V/G127R/S132N, Q109V/G127R/S132Y,
R045F/I072V/L126F/S164Q, R045F/I107T,
R045K/I072C/V104I/L126F/S164F, R045K/I107T, R045K/L126F/S164F,
R045L/I072S/S164I, R045N/I107A/A172R, R045N/I107T/A172Q,
R045N/I107V/A172Q, R045S/I107L, R045V/I107R/A172D, S024A/G118I,
S024A/Q109Y/G118C, S024C/Q109K/G118I, S024G/G118F/G127R/S132N,
S024H/G118K/G127I, S024H/G118L/G127T/S132Y, S024H/G127R,
S024H/I107K, S024H/Q109L, S024H/Q109T/G118R,
S024H/Q109V/G127R/S132N, S024H/Q109V/G127T,
S024H/S099K/G118F/G127R, S024H/S099K/G118R/G127R/S132H,
S024H/S099K/S103P, S024H/S099K/S103P/G118F,
S024H/S099K/S103R/G118A/S132P, S024H/S099Q/G118R/G127Q/S132H,
S024H/S099Q/G118R/S132H, S024H/S099Q/S103N/G118R/G127T/S132N,
S024H/S099Q/S103N/G118T/S132H, S024H/S099Q/S103P,
S024H/S099Q/S103P/G118R/S132H, S024H/S099Q/S103P/S132H,
S024H/S099Q/S132H, S024H/S099Q/S132N, S024H/S099T/G118R,
S024H/S099T/S103N, S024H/S099T/S103N/G127R/S132N,
S024H/S099T/S103N/S132N, S024H/S099T/S103P/G118R,
S024H/S099T/S103P/G118R/S132H, S024H/S099T/S103P/S132N,
S024H/S103N/S132H, S024H/S103P/G127R/S132R, S024H/S132N,
S024H/S132R, S024I/I107R/G127I/A172R, S024L/G127R,
S024L/Q109K/G127R/S132Y, S024L/Q109T/G118V/G127Q/S132R,
S024L/Q109V/G118R/G127Q, S024M/G118V, S024N/G118R/G127L/S132Y,
S024N/G127R, S024N/I107T, S024N/Q109T/G127R/S132N,
S024N/Q109T/G127T/S132R, S024N/Q109T/G127T/S132Y,
S024N/Q109V/G118L/G127Q, S024N/Q109V/G118R/G127T/S132Y,
S024N/Q109V/G127R/S132N, S024N/R045K/A172L,
S024N/R045K/I107V/A172N, S024N/S099T/G127T/S132H, S024N/S132R,
S024P/S099Q/S103P/G118R, S024Q/Q109R/S132R, S024R/G118H/S132V,
S024R/G118L/G127R/S132R, S024R/G118R/S132N, S024R/Q109C/G127H,
S024R/Q109I/G127T, S024R/Q109K/G118T/G127Q/S132N,
S024R/Q109L/G127Q, S024R/Q109R/G118T/G127R,
S024R/Q109T/G127R/S132N, S024R/Q109T/G127R/S132Y,
S024R/Q109T/G127T/S132Y, S024R/Q109T/S132Y, S024R/Q109V,
S024R/Q109V/G118C/S132A, S024R/Q109V/G118R/G127T,
S024R/Q109V/G127S, S024R/Q109V/S132N, S024R/R045F/I107T/A172Q,
S024R/S132Y, S024T/G118D, S024T/I107T, S024T/Q109I/G127T,
S024T/R045K/I107T/G127R/A172Q, S024T/R045K/I107V,
S024V/Q109C/G118L, S024V/Q109L/G118V, S024V/Q109R/G118F,
S024V/R045I/A172V, S024W/A172Q, S024W/G118K,
S024W/G118L/G127T/S132Y, S024W/G127R, S024W/G127R/S132N,
S024W/Q109I, S024W/Q109I/G127T, S024W/Q109K/G118R, S024W/Q109L,
S024W/Q109L/G127R/S132N, S024W/Q109R/G127T/S132N,
S024W/Q109T/G118L, S024W/Q109T/G118R/G127Q/S132N,
S024W/Q109T/G118T/G127T, S024W/Q109T/G127R/S132R,
S024W/Q109V/G118S/S132Y, S024W/Q109V/G127T,
S024W/Q109V/G127T/S132Y, S024W/R045N/A172Q,
S024W/S099K/S103P/G118R/S132H, S024W/S099K/S103P/S132H,
S024W/S099Q, S024W/S099Q/G118T,
S024W/S099Q/S103N/G118R/G127Q/S132N, S024W/S099Q/S103N/G118R/S132N,
S024W/S099Q/S103N/G118T, S024W/S099Q/S103P,
S024W/S099Q/S103P/G118R/S132H, S024W/S099Q/S103P/G118T/S132N,
S024W/S099Q/S103P/S132N, S024W/S099T, S024W/S099T/G118R,
S024W/S099T/G118R/G127Q, S024W/S099T/G118R/S132R,
S024W/S099T/G118T/S132H, S024W/S099T/S103N,
S024W/S099T/S103N/G118R, S024W/S099T/S103N/G127R/S132H,
S024W/S099T/S103N/S132H, S024W/S099T/S103N/S132N,
S024W/S099T/S103P, S024W/S099T/S103P/G118R,
S024W/S099T/S103P/G118R/S132H, S024W/S099T/S103P/G118T,
S024W/S099T/S103P/G118T/S132N, S024W/S099T/S103P/S132H,
S024W/S103K/S132R, S024W/S103P, S024W/S103P/G118F/S132H,
S024W/S132H, S024W/S132N, S024Y/G127R/A172E,
S087N/G118V/S128L/P129Q/S130A/A001C/S024E/I107G,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F/S164I,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/S164I,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/S164Q,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/V104I/L126F,
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/V104I/S164I,
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164I,
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164Q,
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/V104I/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/I107T,
S087N/G118V/S128L/P129Q/S130A/A001K/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001K/I107W/A172P,
S087N/G118V/S128L/P129Q/S130A/A001K/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/R045F,
S087N/G118V/S128L/P129Q/S130A/A001K/R045K/I107S,
S087N/G118V/S128L/P129Q/S130A/A001K/R045N/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001K/R045N/I107V,
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/I107V,
S087N/G118V/S128L/P129Q/S130A/A001K/S024T/I107V/A172W,
S087N/G118V/S128L/P129Q/S130A/A001K/S024W/R045N/I107T,
S087N/G118V/S128L/P129Q/S130A/A001K/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/S164I,
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/A001KN104I/L126F/S164Q,
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164F,
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164I,
S087N/G118V/S128L/P129Q/S130A/A001N/R045N/I107T,
S087N/G118V/S128L/P129Q/S130A/A001R,
S087N/G118V/S128L/P129Q/S130A/A001R/A172I,
S087N/G118V/S128L/P129Q/S130A/A001R/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172P,
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172W,
S087N/G118V/S128L/P129Q/S130A/A001R/R045K,
S087N/G118V/S128L/P129Q/S130A/A001R/R045K/I107T,
S087N/G118V/S128L/P129Q/S130A/A001R/R045N/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045F/I107T,
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/A172N,
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/A001R/S024N/I107T,
S087N/G118V/S128L/P129Q/S130A/A001R/S024R/R045K/I107G/A172L,
S087N/G118V/S128L/P129Q/S130A/A001R/S024T/R045N/I107T,
S087N/G118V/S128L/P129Q/S130A/A001R/S024W/A172W,
S087N/G118V/S128L/P129Q/S130A/A001S/S024L/R045L/I107W/A172F,
S087N/G118V/S128L/P129Q/S130A/A172N,
S087N/G118V/S128L/P129Q/S130A/A215V,
S087N/G118V/S128L/P129Q/S130A/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/G097P/N185K/A215I,
S087N/G118V/S128L/P129Q/S130A/G097P/N185Q/Y209W/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/G097P/N185R/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/G097S/N185R/S256I,
S087N/G118V/S128L/P129Q/S130A/G097S/S144V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/G097S/S144Y/S256I,
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/N185R/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/S256I,
S087N/G118V/S128L/P129Q/S130A/G097T/S144W/N185R/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/G097T/S144W/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W,
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/G127Q,
S087N/G118V/S128L/P129Q/S130A/G127T,
S087N/G118V/S128L/P129Q/S130A/I072C,
S087N/G118V/S128L/P129Q/S130A/I072C/L126F,
S087N/G118V/S128L/P129Q/S130A/I072C/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/I072C/S164I,
S087N/G118V/S128L/P129Q/S130A/I072C/S164Q,
S087N/G118V/S128L/P129Q/S130A/I072C/V104I/L126F/S164I,
S087N/G118V/S128L/P129Q/S130A/I072P,
S087N/G118V/S128L/P129Q/S130A/I072V/S164F,
S087N/G118V/S128L/P129Q/S130A/L126F,
S087N/G118V/S128L/P129Q/S130A/L126F/S164I,
S087N/G118V/S128L/P129Q/S130A/N018K,
S087N/G118V/S128L/P129Q/S130A/N018K/A215R/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185Q/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/A215R,
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185K,
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W/A215I,
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q,
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215R,
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185R,
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/S256W,
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W,
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W/A215V,
S087N/G118V/S128L/P129Q/S130A/N018Q/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018Q/A215R/S256W,
S087N/G118V/S128L/P129Q/S130A/N018Q/G097P/N185R,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215R,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215V,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/S256W,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/S256W,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/Y209W/S256W,
S087N/G118V/S128L/P129Q/S130A/N018Q/N185R/A215R/S256P,
S087N/G118V/S128L/P129Q/S130A/N018Q/Y209W/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R,
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/A215R,
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/Y209W/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/N185K,
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W,
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/N185Q/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/A215R,
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/Y209W/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/S256W,
S087N/G118V/S128L/P129Q/S130A/N043E,
S087N/G118V/S128L/P129Q/S130A/N043E/P052I/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043E/P052V/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/N043E/S101E,
S087N/G118V/S128L/P129Q/S130A/N043E/S101R,
S087N/G118V/S128L/P129Q/S130A/N043E/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043F/P052V/S101T/N248K,
S087N/G118V/S128L/P129Q/S130A/N043F/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043I/P052I/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/N043I/P052V/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/N043I/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/N043I/S101N,
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S,
S087N/G118V/S128L/P129Q/S130A/N043S/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/N043S/N185V/S256T,
S087N/G118V/S128L/P129Q/S130A/N043S/P052I,
S087N/G118V/S128L/P129Q/S130A/N043S/P052I/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101F,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101R,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101V/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/N043S/S101N/N248I,
S087N/G118V/S128L/P129Q/S130A/N043S/S101T,
S087N/G118V/S128L/P129Q/S130A/N043S/S144W,
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185R/S256P,
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185V/S256T,
S087N/G118V/S128L/P129Q/S130A/N043S/S256I,
S087N/G118V/S128L/P129Q/S130A/N043T,
S087N/G118V/S128L/P129Q/S130A/N043T/N248K,
S087N/G118V/S128L/P129Q/S130A/N043T/P052I/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043T/P052V/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043T/S101E/N248I,
S087N/G118V/S128L/P129Q/S130A/N043T/S144V/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/N043V/N185V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/N043V/P052I,
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101T/N248K,
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/N248K,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144V/N185R/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144W/S256T,
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144Y/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248I,
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/N043V/S101F,
S087N/G118V/S128L/P129Q/S130A/N043V/S101R,
S087N/G118V/S128L/P129Q/S130A/N043V/S101R/N248I,
S087N/G118V/S128L/P129Q/S130A/N043V/S101T,
S087N/G118V/S128L/P129Q/S130A/N043V/S101T/N248K,
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y/N248I,
S087N/G118V/S128L/P129Q/S130A/N043V/S144T/N185V/S256I,
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/N185V,
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/N043V/S144Y/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/N043V/S144Y/N185V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y,
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y/N248K,
S087N/G118V/S128L/P129Q/S130A/N043W/S101E,
S087N/G118V/S128L/P129Q/S130A/N043W/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/N185K/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V,
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215R,
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N185R/A215V/S256W,
S087N/G118V/S128L/P129Q/S130A/N185R/S256T,
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/A215V/S256R,
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/S256L,
S087N/G118V/S128L/P129Q/S130A/N185V/Y209W,
S087N/G118V/S128L/P129Q/S130A/N248I,
S087N/G118V/S128L/P129Q/S130A/N248K,
S087N/G118V/S128L/P129Q/S130A/P052I/N248K,
S087N/G118V/S128L/P129Q/S130A/P052I/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/P052I/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/P052I/S101V/N248K,
S087N/G118V/S128L/P129Q/S130A/P052V,
S087N/G118V/S128L/P129Q/S130A/P052V/G097T/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/P052V/S101E/N248I,
S087N/G118V/S128L/P129Q/S130A/P052V/S101R,
S087N/G118V/S128L/P129Q/S130A/P052V/S144T,
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/S256T,
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/S256I,
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/Y209W,
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185R/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V,
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W,
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/Q109I,
S087N/G118V/S128L/P129Q/S130A/Q109L/G127Q,
S087N/G118V/S128L/P129Q/S130A/Q109T,
S087N/G118V/S128L/P129Q/S130A/Q109T/G127Q,
S087N/G118V/S128L/P129Q/S130A/Q109V,
S087N/G118V/S128L/P129Q/S130A/R045F/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/R045K/I072C/L126F,
S087N/G118V/S128L/P129Q/S130A/R045N/A172Q,
S087N/G118V/S128L/P129Q/S130A/R045N/I107V/A172P,
S087N/G118V/S128L/P129Q/S130A/R045S,
S087N/G118V/S128L/P129Q/S130A/S024H,
S087N/G118V/S128L/P129Q/S130A/S024H/I107V/A172S,
S087N/G118V/S128L/P129Q/S130A/S024H/Q109V,
S087N/G118V/S128L/P129Q/S130A/S024H/Q109V/G127Q,
S087N/G118V/S128L/P129Q/S130A/S024H/R045N/I107T,
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N,
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N/S132N,
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q,
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S103P,
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S132N,
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P,
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P/S132H,
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P/S132N,
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S132N,
S087N/G118V/S128L/P129Q/S130A/S024H/S103P/S132N,
S087N/G118V/S128L/P129Q/S130A/S024L/S099K/S103P/S132N,
S087N/G118V/S128L/P129Q/S130A/S024N/I107N,
S087N/G118V/S128L/P129Q/S130A/S024N/I107T,
S087N/G118V/S128L/P129Q/S130A/S024N/I107V,
S087N/G118V/S128L/P129Q/S130A/S024N/Q109K,
S087N/G118V/S128L/P129Q/S130A/S024N/Q109T/G127T,
S087N/G118V/S128L/P129Q/S130A/S024R,
S087N/G118V/S128L/P129Q/S130A/S024R/G127R,
S087N/G118V/S128L/P129Q/S130A/S024R/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/S024R/I107V/A172S,
S087N/G118V/S128L/P129Q/S130A/S024R/Q109K,
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L,
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L/G127Q,
S087N/G118V/S128L/P129Q/S130A/S024R/Q109V,
S087N/G118V/S128L/P129Q/S130A/S024R/R045F/I107T,
S087N/G118V/S128L/P129Q/S130A/S024T,
S087N/G118V/S128L/P129Q/S130A/S024T/G127T,
S087N/G118V/S128L/P129Q/S130A/S024T/I107T/A172Q,
S087N/G118V/S128L/P129Q/S130A/S024T/Q109V/G127T,
S087N/G118V/S128L/P129Q/S130A/S024T/R045N/I107V/A172S,
S087N/G118V/S128L/P129Q/S130A/S024W,
S087N/G118V/S128L/P129Q/S130A/S024W/G127T,
S087N/G118V/S128L/P129Q/S130A/S024W/I107T,
S087N/G118V/S128L/P129Q/S130A/S024W/Q109I,
S087N/G118V/S128L/P129Q/S130A/S024W/Q109L,
S087N/G118V/S128L/P129Q/S130A/S024W/Q109R/G127Q,
S087N/G118V/S128L/P129Q/S130A/S024W/Q109T,
S087N/G118V/S128L/P129Q/S130A/S024W/Q109V,
S087N/G118V/S128L/P129Q/S130A/S024W/R045F/I107V/A172Q,
S087N/G118V/S128L/P129Q/S130A/S024W/S099K,
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S103P,
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S132H,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103N/G127R/S132N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103N/S132N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103P,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132H,
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/G127R/S132H,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N/G127R/S132N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N/S132N,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103P/S132H,
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S132N,
S087N/G118V/S128L/P129Q/S130A/S099K,
S087N/G118V/S128L/P129Q/S130A/S099K/S103N,
S087N/G118V/S128L/P129Q/S130A/S099K/S103P,
S087N/G118V/S128L/P129Q/S130A/S099K/S132H,
S087N/G118V/S128L/P129Q/S130A/S099Q,
S087N/G118V/S128L/P129Q/S130A/S099Q/S103N,
S087N/G118V/S128L/P129Q/S130A/S099Q/S103P,
S087N/G118V/S128L/P129Q/S130A/S099Q/S103P/S132H,
S087N/G118V/S128L/P129Q/S130A/S099Q/S132H,
S087N/G118V/S128L/P129Q/S130A/S099T/G127Q,
S087N/G118V/S128L/P129Q/S130A/S099T/S103N,
S087N/G118V/S128L/P129Q/S130A/S099T/S103N/S132H,
S087N/G118V/S128L/P129Q/S130A/S099T/S103P,
S087N/G118V/S128L/P129Q/S130A/S099T/S103P/S132H,
S087N/G118V/S128L/P129Q/S130A/S099T/S132H,
S087N/G118V/S128L/P129Q/S130A/S101E,
S087N/G118V/S128L/P129Q/S130A/S101E/N248K,
S087N/G118V/S128L/P129Q/S130A/S101F/N248K,
S087N/G118V/S128L/P129Q/S130A/S101N/N248K,
S087N/G118V/S128L/P129Q/S130A/S101R/N248K,
S087N/G118V/S128L/P129Q/S130A/S101Y,
S087N/G118V/S128L/P129Q/S130A/S103N/S132H,
S087N/G118V/S128L/P129Q/S130A/S103P,
S087N/G118V/S128L/P129Q/S130A/S144T/N185R,
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/S256I,
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/S256I,
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/Y209W,
S087N/G118V/S128L/P129Q/S130A/S144T/S256I,
S087N/G118V/S128L/P129Q/S130A/S144T/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/S144V,
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/S256I,
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/Y209W,
S087N/G118V/S128L/P129Q/S130A/S144V/N185V,
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/S256I,
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/Y209W,
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256I,
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/S144W/Y209W,
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R,
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R/Y209W/S256T,
S087N/G118V/S128L/P129Q/S130A/S144Y/N185V/Y209W,
S087N/G118V/S128L/P129Q/S130A/S164I,
S087N/G118V/S128L/P129Q/S130A/S164Q,
S087N/G118V/S128L/P129Q/S130A/V104I,
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164F,
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164I,
S087N/G118V/S128L/P129Q/S130A/V104I/S164I,
S087N/G118V/S128L/P129Q/S130A/V104I/S164Q,
S087N/G118V/S128L/P129Q/S130A/Y209W,
S087N/G118V/S128L/P129Q/S130A/Y209W/A215I/S256W,
S087N/G118V/S128L/P129Q/S130A/Y209W/S256W, S099H/S103I/G118N,
S099K/G118R, S099K/S103N/G118T, S099K/S103P/G118L/S132N,
S099K/S103P/G127Q, S099K/S103P/S132H, S099K/S103R/G118A/S132P,
S099N/S132R, S099Q/G118F/G127R, S099Q/G118T/G127Q,
S099Q/S103N/G118R/S132N, S099Q/S103N/G118T,
S099Q/S103N/G118T/S132H, S099Q/S103N/S132H, S099Q/S103P/G118R,
S099Q/S103P/G118R/S132N, S099Q/S103P/S132H, S099Q/S132R,
S099T/G118F, S099T/G118R/S132H, S099T/G118T/S132H,
S099T/G118T/S132N, S099T/S103P, S099T/S103P/G118L/S132H,
S101E/N117I, S101E/N117Y/N248K, S101F/N117I/N248I,
S101F/N117Y/N248I, S101F/N117Y/N248K, S101F/N248K,
S101R/N117I/N248K, S101R/N117Y, S101R/N248K, S101T/N117Y/N248K,
S101T/N248I, S101V/N248K, S101Y/N117I/N248K, S101Y/N117Y,
S101Y/N248K, S103G/G118I/G127E/S132E, S103L/S132E, S103R/S132P,
S144T/N185R, S144T/N185R/Y209W/S256I, S144T/N185R/Y209W/S256T,
S144T/N185V, S144V/N185R/S256I, S144V/N185R/Y209W,
S144V/N185R/Y209W/S256T, S144V/S256I, S144V/Y209W,
S144W/N185R/Y209W/S256T, S144W/N185V/Y209W/S256I, S144W/S256I,
S144Y/Y209W/S256I, V104E/L126I/S164L, wherein the positions are
numbered by correspondence with the amino acid sequence of
[0035] B. amyloliquefaciens subtilisin BPN' set forth as SEQ ID
NO:1.
[0036] In some still further embodiments, the present invention
provides isolated subtilisin variants comprising a combination of
substitutions selected from:
TS87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109K,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109L/N185R/A215R,
S87R/G118R/S128L/P129Q/S130A/S101K/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109L,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/T213E/N248R,
S87R/G118R/S128L/P129Q/S130A/172V/S164I/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D,
S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109K,
S87N/G118V/S128L/P129Q/S130A/N43S/P52V/S101R/Q109R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/Q109R/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/Q109L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/Q109R/S164I/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D/S101L,
S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109L,
S87N/G118V/S128L/P129Q/S130A/N76D/S164I,
S87R/G118R/S128L/P129Q/S130A/N76D/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/N248R,
S87R/G118R/S128L/P129Q/S130A/V118R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N76D/S101M,
S87N/G118V/S128L/P129Q/S130A/N18K/N76D/G97P/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/T213E/N248R,
S87R/G118R/S128L/P129Q/S130A/Q109L/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/S164I,
S87N/G118V/S128L/P129Q/S130A/S101Y/T213E/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/S101L/Q109L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101V/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101V/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/T213E/N248R,
S87N/G118V/S128L/P129Q/S130A/172V/S101Y/Q109L/S164I,
S87R/G118R/S128L/P129Q/S130A/S101H/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/Q109R/N185R/A215R,
S87N/G118V/S128L/P129Q/S130A/172V/S101H/S164I,
S87N/G118V/S128L/P129Q/S130A/S101L/Q109R/S188D/N248R,
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109L/N185R/A215R,
S87R/G118R/S128L/P129Q/S130A/S101M/S188D/N248R,
N76D/S87R/G118R/S128L/P129Q/S130A/S188D,
N76D/S87R/G118R/S128L/P129Q/S130A/S188D/N248K,
S87N/G118V/G127S/S128L/P129Q/S130A,
S87N/S101H/G118V/S128L/P129Q/S130A,
S87N/S101K/G118V/S128L/P129Q/S130A,
S87N/S101V/G118V/S128L/P129Q/S130A,
S87N/S101Y/G118V/S128L/P129Q/S130A,
S87N/S101L/G118V/S128L/P129Q/S130A,
172V/S87N/G118V/S128L/P129Q/S130A//S164I, wherein the positions are
numbered by correspondence with the amino acid sequence of B.
amyloliquefaciens subtilisin BPN' set forth as SEQ ID NO:1.
[0037] The present invention also provides isolated nucleic acids
encoding the subtilisin variants set forth above and herein. The
present invention further provides expression vectors comprising
the nucleic acids encoding these subtilisin variants provided above
and herein. In addition, the present invention provides host cells
comprising the expression vectors encoding the nucleic acids
encoding these subtilisin variants provided above and herein.
[0038] The present invention also provides cleaning compositions
comprising the subtilisin variants provided herein. In some
embodiments, these cleaning compositions comprise more than one of
the subtilisin variants provided herein. In some preferred
embodiments, these cleaning compositions comprise a liquid, gel,
tablet, powder and/or granule detergent. In some further
embodiments, these cleaning compositions are selected from laundry
detergents and dish detergents. In some preferred embodiments,
these cleaning compositions comprise laundry detergents. In some
particularly preferred embodiments, these cleaning compositions are
heavy duty detergents. In some additional embodiments, these
cleaning compositions comprise dish detergents selected from hand
dishwashing and automatic dishwashing detergents. In some further
preferred embodiments, these cleaning compositions provided herein
further comprise at least one bleaching agent. In some further
embodiments, these cleaning compositions further comprise one or
more adjunct ingredients, in addition to the at least one
subtilisin variant provided herein. In some additional embodiments,
these cleaning compositions provided herein are phosphate-free,
while in some alternative embodiments, these cleaning compositions
provided herein are phosphate-containing detergents. In some still
further embodiments, these cleaning compositions provided herein
are cold water detergents. In yet some additional embodiments,
these cleaning compositions provided herein further comprise at
least one additional enzyme, in addition to the one or more
subtilisin variants provided herein. In some embodiments, these
cleaning compositions comprise at least one additional enzyme
selected from hemicellulases, cellulases, peroxidases, proteases,
metalloproteases, xylanases, lipases, phospholipases, esterases,
perhydrolasess, cutinases, pectinases, pectate lyases, mannanases,
keratinases, reductases, oxidases, phenoloxidases, lipoxygenases,
ligninases, pullulanases, tannases, pentosanases, malanases,
.beta.-glucanases, arabinosidases, hyaluronidase, chondroitinase,
laccase, and amylases, or mixtures thereof.
[0039] The present invention also provides methods for cleaning,
comprising providing an item to be cleaned and a composition
comprising at least one cleaning composition provided herein, and
contacting the item with the composition, under conditions
effective to provide cleaning of the item. In some embodiments, the
methods further comprise the step of rinsing the item after
contacting the item with the cleaning composition. In some
preferred embodiments, the item to be cleaned comprises dishware.
In some alternative embodiments, the item to be cleaned comprises
fabric.
BRIEF DESCRIPTION OF THE DRAWINGS
[0040] FIG. 1 provides an alignment of various reference proteases
including: BPN' (SEQ ID NO:1), GC GCI-P036 (SEQ ID NO:2), GCI-P037
(SEQ ID NO:3), and GCI-P038 (SEQ ID NO:4). Unless otherwise
specified, substitution positions are given in relationship to
BPN'.
[0041] FIG. 2 provides a map of pHPLT-GG36.
[0042] FIG. 3 provides a map of p2JH-GG36ci.
[0043] FIG. 4 depicts protease concentration as determined using an
eglin c inhibition assay for variant proteases.
[0044] FIG. 5 depicts wash performance (BMI microswatch) of variant
proteases.
DESCRIPTION OF THE INVENTION
[0045] The present invention provides methods for protein
engineering and serine protease variants produced therefrom.
Specifically, the present invention provides serine protease
variants having one or more substitutions as compared to a
reference serine protease. In addition, the present invention
provides compositions comprising these serine protease variants. In
some embodiments, the present invention provides cleaning
compositions comprising at least one of these serine protease
variants.
[0046] For practical purposes, it is not usually necessary to find
the best sequence in a protein space in order to create a protein
that is optimum for a particular application. For most
applications, the problem to be solved is to identify at least one
protein sequence that meets or exceeds the minimum value required
for a number of properties. This requires knowledge of mutations
that are good for a particular property, as well as knowledge of
those mutations that are bad for any of the desired properties. The
present invention provides means to meet the goal by identifying
those positions in the protein that can be altered to improve the
primary property and keep the values for other properties within
desired limits.
[0047] The present invention provides means to evaluate all
positions in a protein for all the properties of interest by
building "site evaluation libraries" at each site. In preferred
embodiments, these libraries contain 9-19 mutations at each
position, and are used to evaluate each position for use in
engineering the protein and constructing libraries. Each property
is measured relative to the reference enzyme and an apparent free
energy difference for each mutant vs. wild type is calculated.
These delta delta G ("i.e., .DELTA..DELTA.G") apparent values are
then used to determine additivity.
[0048] One ideal way to analyze variants would be through the
difference in free energy for the variant versus the reference
protein in the process of interest. The Gibbs Free Energy for a
process represents the maximum amount of work that can be performed
by a system. The change in Free energy relative to the reference
enzyme (.DELTA..DELTA. G) is given as follows;
.DELTA..DELTA.G=-RT ln(k.sub.variant/k.sub.reference)
[0049] where k.sub.variant is the rate constant for the variant
enzyme, and k.sub.reference is the rate constant for the reference
enzyme, R is the Gas law constant and T is the absolute
temperature. Most assays are not constructed to allow determination
of true Free Energies, so we utilized a quantity
.DELTA..DELTA.G.sub.app=-RT ln(P.sub.variant/P.sub.reference)
[0050] where P.sub.variant is the performance value for the variant
and P.sub.reference is the performance value for the reference
enzyme under the same conditions. The .DELTA..DELTA. G.sub.app
values may be expected to behave in a similar fashion as to
.DELTA..DELTA. G for data distributions and additivity. However,
since .DELTA..DELTA. G is the maximum amount of work that can be
carried out by the variant compared to the reference enzyme, the
quantity .DELTA..DELTA. G.sub.app will generally underestimate the
.DELTA..DELTA. G and lead to results that appear synergistic in
that the properties of two additive positions may be greater than
the value predicted by adding their .DELTA..DELTA. G.sub.app values
together.
[0051] In addition, the present invention provides subtilisin
variants and compositions comprising these variants.
DEFINITIONS
[0052] Unless otherwise indicated, the practice of the present
invention involves conventional techniques commonly used in
molecular biology, protein engineering, microbiology, and
recombinant DNA, which are within the skill of the art. Such
techniques are known to those of skill in the art and are described
in numerous texts and reference works well known to those of skill
in the art. All patents, patent applications, articles and
publications mentioned herein, both supra and infra, are hereby
expressly incorporated herein by reference.
[0053] Unless defined otherwise herein, all technical and
scientific terms used herein have the same meaning as commonly
understood by one of ordinary skill in the art to which this
invention pertains. Many technical dictionaries are known to those
of skill in the art. Although any methods and materials similar or
equivalent to those described herein find use in the practice of
the present invention, the preferred methods and materials are
described herein. Accordingly, the terms defined immediately below
are more fully described by reference to the Specification as a
whole. Also, as used herein, the singular "a", "an" and "the"
includes the plural reference unless the context clearly indicates
otherwise. Numeric ranges are inclusive of the numbers defining the
range. Unless otherwise indicated, nucleic acids are written left
to right in 5' to 3' orientation; amino acid sequences are written
left to right in amino to carboxy orientation, respectively. It is
to be understood that this invention is not limited to the
particular methodology, protocols, and reagents described, as these
may vary, depending upon the context they are used by those of
skill in the art.
[0054] The practice of the present invention employs, unless
otherwise indicated, conventional techniques of protein
purification, molecular biology, microbiology, recombinant DNA
techniques and protein sequencing, all of which are within the
skill of those in the art.
[0055] Furthermore, the headings provided herein are not
limitations of the various aspects or embodiments of the invention
which can be had by reference to the specification as a whole.
Accordingly, the terms defined immediately below are more fully
defined by reference to the specification as a whole. Nonetheless,
in order to facilitate understanding of the invention, a number of
terms are defined below.
[0056] As used herein, the terms "protease," and "proteolytic
activity" refer to a protein or peptide exhibiting the ability to
hydrolyze peptides or substrates having peptide linkages. Many well
known procedures exist for measuring proteolytic activity (Kalisz,
"Microbial Proteinases," In: Fiechter (ed.), Advances in
Biochemical Engineering/Biotechnology, [1988]). For example,
proteolytic activity may be ascertained by comparative assays which
analyze the respective protease's ability to hydrolyze a commercial
substrate. Exemplary substrates useful in the analysis of protease
or proteolytic activity, include, but are not limited to di-methyl
casein (Sigma C-9801), bovine collagen (Sigma C-9879), bovine
elastin (Sigma E-1625), and bovine keratin (ICN Biomedical 902111).
Colorimetric assays utilizing these substrates are well known in
the art (See e.g., WO 99/34011; and U.S. Pat. No. 6,376,450, both
of which are incorporated herein by reference). The pNA assay (See
e.g., Del Mar et al., Anal. Biochem., 99:316-320 [1979]) also finds
use in determining the active enzyme concentration for fractions
collected during gradient elution. This assay measures the rate at
which p-nitroaniline is released as the enzyme hydrolyzes the
soluble synthetic substrate,
succinyl-alanine-alanine-proline-phenylalanine-p-nitroanilide
(suc-AAPF-pNA). The rate of production of yellow color from the
hydrolysis reaction is measured at 410 nm on a spectrophotometer
and is proportional to the active enzyme concentration. In
addition, absorbance measurements at 280 nm can be used to
determine the total protein concentration. The active
enzyme/total-protein ratio gives the enzyme purity.
[0057] As used herein, the term "subtilisin" refers any member of
the S8 serine protease family as described in MEROPS--The Peptidase
Data base (Rawlings et al., MEROPS: the peptidase database, Nucl
Acids Res, 34 Database issue, D270-272, 2006). As described
therein, the peptidase family S8 contains the serine endopeptidase
subtilisin and its homologues (Biochem J, 290:205-218, 1993).
Family S8, also known as the subtilase family, is the second
largest family of serine peptidases, and can be divided into two
subfamilies, with subtilisin (S08.001) the type-example for
subfamily S8A and kexin (S08.070) the type-example for subfamily
S8B. Tripeptidyl-peptidase II (TPP-II; S08.090) was formerly
considered to be the type-example of a third subfamily, but has
since been determined to be misclassified. Members of family S8
have a catalytic triad in the order Asp, His and Ser in the
sequence, which is a different order to that of families S1, S9 and
S10. In subfamily S8A, the active site residues frequently occurs
in the motifs Asp-Thr/Ser-Gly (which is similar to the sequence
motif in families of aspartic endopeptidases in clan AA),
His-Gly-Thr-His and Gly-Thr-Ser-Met-Ala-Xaa-Pro. In subfamily S8B,
the catalytic residues frequently occur in the motifs Asp-Asp-Gly,
His-Gly-Thr-Arg and Gly-Thr-Ser-Ala/Val-Ala/Ser-Pro. Most members
of the S8 family are endopeptidases, and are active at
neutral-mildly alkali pH. Many peptidases in the family are
thermostable. Casein is often used as a protein substrate and a
typical synthetic substrate is suc-AAPF. Most members of the family
are nonspecific peptidases with a preference to cleave after
hydrophobic residues. However, members of subfamily S8B, such as
kexin (S08.070) and furin (S08.071), cleave after dibasic amino
acids. Most members of the S8 family are inhibited by general
serine peptidase inhibitors such as DFP and PMSF. Because many
members of the family bind calcium for stability, inhibition can be
seen with EDTA and EGTA, which are often thought to be specific
inhibitors of metallopeptidases. Protein inhibitors include turkey
ovomucoid third domain (101.003), Streptomyces subtilisin inhibitor
(116.003), and members of family 113 such as eglin C (113.001) and
barley inhibitor CI-1A (113.005), many of which also inhibit
chymotrypsin (S01.001). The subtilisin propeptide is itself
inhibitory, and the homologous proteinase B inhibitor from
Saccharomyces inhibits cerevisin (S08.052). The tertiary structures
for several members of family S8 have now been determined A typical
S8 protein structure consists of three layers with a seven-stranded
.beta. sheet sandwiched between two layers of helices. Subtilisin
(S08.001) is the type structure for clan SB (SB). Despite the
different structure, the active sites of subtilisin and
chymotrypsin (S01.001) can be superimposed, which suggests the
similarity is the result of convergent rather than divergent
evolution.
[0058] As used herein, the terms "protease variant" and "variant
protease" are used in reference to proteases that are similar to a
reference protease, particularly in their function, but have
mutations in their amino acid sequence that make them different in
sequence from the wild-type protease at from one to 20 positions.
The amino acid sequences of the mature region of several exemplary
reference proteases are shown in the alignment of FIG. 1. In some
preferred embodiments, the present invention provides "GG36
variants," wherein the mutations are present in the mature GG36
sequence set forth in SEQ ID NO:2. In some embodiments, variant
proteases herein are referred to as "GCI-P036 variants" or
"variants of GCI-P036." In some embodiments, the variant proteases
provided herein are also referred to as "Bacillus sp. subtilisin
variants" and "subtilisin variants."
[0059] As used herein, "the genus Bacillus" includes all species
within the genus "Bacillus," as known to those of skill in the art,
including but not limited to B. subtilis, B. licheniformis, B.
lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B.
amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B.
coagulans, B. circulans, B. lautus, and B. thuringiensis. It is
recognized that the genus Bacillus continues to undergo taxonomical
reorganization. Thus, it is intended that the genus include species
that have been reclassified, including but not limited to such
organisms as B. stearothermophilus, which is now named "Geobacillus
stearothermophilus." The production of resistant endospores in the
presence of oxygen is considered the defining feature of the genus
Bacillus, although this characteristic also applies to the recently
named Alicyclobacillus, Amphibacillus, Aneurinibacillus,
Anoxybacillus, Brevibacillus, Filobacillus, Gracilibacillus,
Halobacillus, Paenibacillus, Salibacillus, Thermobacillus,
Ureibacillus, and Virgibacillus.
[0060] The terms "polynucleotide" and "nucleic acid", used
interchangeably herein, refer to a polymeric form of nucleotides of
any length, either ribonucleotides or deoxyribonucleotides. These
terms include, but are not limited to, a single-, double- or
triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid, or a
polymer comprising purine and pyrimidine bases, or other natural,
chemically, biochemically modified, non-natural or derivatized
nucleotide bases. The following are non-limiting examples of
polynucleotides: genes, gene fragments, chromosomal fragments,
ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA,
recombinant polynucleotides, branched polynucleotides, plasmids,
vectors, isolated DNA of any sequence, isolated RNA of any
sequence, nucleic acid probes, and primers. In some embodiments,
polynucleotides comprise modified nucleotides, such as methylated
nucleotides and nucleotide analogs, uracyl, other sugars and
linking groups such as fluororibose and thioate, and nucleotide
branches. In alternative embodiments, the sequence of nucleotides
is interrupted by non-nucleotide components.
[0061] As used herein, the terms "DNA construct" and "transforming
DNA" are used interchangeably to refer to DNA used to introduce
sequences into a host cell or organism. The DNA may be generated in
vitro by PCR or any other suitable technique(s) known to those in
the art. In particularly preferred embodiments, the DNA construct
comprises a sequence of interest (e.g., as an incoming sequence).
In some embodiments, the sequence is operably linked to additional
elements such as control elements (e.g., promoters, etc.). The DNA
construct may further comprise a selectable marker. It may further
comprise an incoming sequence flanked by homology boxes. In a
further embodiment, the transforming DNA comprises other
non-homologous sequences, added to the ends (e.g., stuffer
sequences or flanks). In some embodiments, the ends of the incoming
sequence are closed such that the transforming DNA forms a closed
circle. The transforming sequences may be wild-type, mutant or
modified. In some embodiments, the DNA construct comprises
sequences homologous to the host cell chromosome. In other
embodiments, the DNA construct comprises non-homologous sequences.
Once the DNA construct is assembled in vitro it may be used to: 1)
insert heterologous sequences into a desired target sequence of a
host cell, and/or 2) mutagenize a region of the host cell
chromosome (i.e., replace an endogenous sequence with a
heterologous sequence), 3) delete target genes, and/or 4) introduce
a replicating plasmid into the host.
[0062] As used herein, the terms "expression cassette" and
"expression vector" refer to nucleic acid constructs generated
recombinantly or synthetically, with a series of specified nucleic
acid elements that permit transcription of a particular nucleic
acid in a target cell. The recombinant expression cassette can be
incorporated into a plasmid, chromosome, mitochondrial DNA, plastid
DNA, virus, or nucleic acid fragment. Typically, the recombinant
expression cassette portion of an expression vector includes, among
other sequences, a nucleic acid sequence to be transcribed and a
promoter. In preferred embodiments, expression vectors have the
ability to incorporate and express heterologous DNA fragments in a
host cell. Many prokaryotic and eukaryotic expression vectors are
commercially available. Selection of appropriate expression vectors
is within the knowledge of those of skill in the art. The term
"expression cassette" is used interchangeably herein with "DNA
construct," and their grammatical equivalents. Selection of
appropriate expression vectors is within the knowledge of those of
skill in the art.
[0063] As used herein, the term "vector" refers to a polynucleotide
construct designed to introduce nucleic acids into one or more cell
types. Vectors include cloning vectors, expression vectors, shuttle
vectors, plasmids, cassettes and the like. In some embodiments, the
polynucleotide construct comprises a DNA sequence encoding the
protease (e.g., precursor or mature protease) that is operably
linked to a suitable prosequence (e.g., secretory, etc.) capable of
effecting the expression of the DNA in a suitable host.
[0064] As used herein, the term "plasmid" refers to a circular
double-stranded (ds) DNA construct used as a cloning vector, and
which forms an extrachromosomal self-replicating genetic element in
some eukaryotes or prokaryotes, or integrates into the host
chromosome.
[0065] As used herein in the context of introducing a nucleic acid
sequence into a cell, the term "introduced" refers to any method
suitable for transferring the nucleic acid sequence into the cell.
Such methods for introduction include but are not limited to
protoplast fusion, transfection, transformation, conjugation, and
transduction (See e.g., Ferrari et al., "Genetics," in Hardwood et
al, (eds.), Bacillus, Plenum Publishing Corp., pages 57-72,
[1989]).
[0066] As used herein, the terms "transformed" and "stably
transformed" refers to a cell that has a non-native (heterologous)
polynucleotide sequence integrated into its genome or as an
episomal plasmid that is maintained for at least two
generations.
[0067] As used herein, a nucleic acid is "operably linked" when it
is placed into a functional relationship with another nucleic acid
sequence. For example, DNA encoding a secretory leader (i.e., a
signal peptide), is operably linked to DNA for a polypeptide if it
is expressed as a preprotein that participates in the secretion of
the polypeptide; a promoter or enhancer is operably linked to a
coding sequence if it affects the transcription of the sequence; or
a ribosome binding site is operably linked to a coding sequence if
it is positioned so as to facilitate translation. Generally,
"operably linked" means that the DNA sequences being linked are
contiguous, and, in the case of a secretory leader, contiguous and
in reading phase. However, enhancers do not have to be contiguous.
Linking is accomplished by ligation at convenient restriction
sites. If such sites do not exist, the synthetic oligonucleotide
adaptors or linkers are used in accordance with conventional
practice.
[0068] As used herein the term "gene" refers to a polynucleotide
(e.g., a DNA segment), that encodes a polypeptide and includes
regions preceding and following the coding regions as well as
intervening sequences (introns) between individual coding segments
(exons).
[0069] As used herein, "homologous genes" refers to a pair of genes
from different, but usually related species, which correspond to
each other and which are identical or very similar to each other.
The term encompasses genes that are separated by speciation (i.e.,
the development of new species) (e.g., orthologous genes), as well
as genes that have been separated by genetic duplication (e.g.,
paralogous genes).
[0070] As used herein, proteins are defined as having a common
"fold" if they have the same major secondary structures in the same
arrangement and with the same topological connections. Different
proteins with the same fold often have peripheral elements of
secondary structure and turn regions that differ in size and
conformation. In some cases, these differing peripheral regions may
comprise half the structure. Proteins placed together in the same
fold category do not necessarily have a common evolutionary origin
(e.g., structural similarities arising from the physics and
chemistry of proteins favoring certain packing arrangements and
chain topologies).
[0071] As used herein, "homology" refers to sequence similarity or
identity, with identity being preferred. This homology is
determined using standard techniques known in the art (See e.g.,
Smith and Waterman, Adv. Appl. Math., 2:482 [1981]; Needleman and
Wunsch, J. Mol. Biol., 48:443 [1970]; Pearson and Lipman, Proc.
Natl. Acad. Sci. USA 85:2444 [1988]; programs such as GAP, BESTFIT,
FASTA, and TFASTA in the Wisconsin Genetics Software Package
(Genetics Computer Group, Madison, Wis.); and Devereux et al.,
Nucl. Acid Res., 12:387-395 [1984]).
[0072] One example of a useful algorithm is PILEUP. PILEUP creates
a multiple sequence alignment from a group of related sequences
using progressive, pair-wise alignments. It can also plot a tree
showing the clustering relationships used to create the alignment.
PILEUP uses a simplification of the progressive alignment method of
Feng and Doolittle (Feng and Doolittle, J. Mol. Evol., 35:351-360
[1987]). The method is similar to that described by Higgins and
Sharp (Higgins and Sharp, CABIOS 5:151-153 [1989]). Useful PILEUP
parameters including a default gap weight of 3.00, a default gap
length weight of 0.10, and weighted end gaps.
[0073] Another example of a useful algorithm is the BLAST
algorithm, described by Altschul et al., (Altschul et al., J. Mol.
Biol., 215:403-410, [1990]; and Karlin et al., Proc. Natl. Acad.
Sci. USA 90:5873-5787 [1993]). A particularly useful BLAST program
is the WU-BLAST-2 program (See, Altschul et al., Meth. Enzymol.,
266:460-480 [1996]). WU-BLAST-2 uses several search parameters,
most of which are set to the default values. The adjustable
parameters are set with the following values: overlap span=1,
overlap fraction=0.125, word threshold (T)=11. The HSP S and HSP S2
parameters are dynamic values and are established by the program
itself depending upon the composition of the particular sequence
and composition of the particular database against which the
sequence of interest is being searched. However, the values may be
adjusted to increase sensitivity. A % amino acid sequence identity
value is determined by the number of matching identical residues
divided by the total number of residues of the "longer" sequence in
the aligned region. The "longer" sequence is the one having the
most actual residues in the aligned region (gaps introduced by
WU-Blast-2 to maximize the alignment score are ignored).
[0074] Thus, "percent (%) nucleic acid sequence identity" is
defined as the percentage of nucleotide residues in a candidate
sequence that are identical with the nucleotide residues of the
starting sequence (i.e., the sequence of interest). A preferred
method utilizes the BLASTN module of WU-BLAST-2 set to the default
parameters, with overlap span and overlap fraction set to 1 and
0.125, respectively.
[0075] As used herein, "recombinant" includes reference to a cell
or vector, that has been modified by the introduction of a
heterologous nucleic acid sequence or that the cell is derived from
a cell so modified. Thus, for example, recombinant cells express
genes that are not found in identical form within the native
(non-recombinant) form of the cell or express native genes that are
otherwise abnormally expressed, under expressed or not expressed at
all as a result of deliberate human intervention. "Recombination,"
"recombining," and generating a "recombined" nucleic acid are
generally the assembly of two or more nucleic acid fragments
wherein the assembly gives rise to a chimeric gene.
[0076] In some preferred embodiments, mutant DNA sequences are
generated with site saturation mutagenesis in at least one codon.
In another preferred embodiment, site saturation mutagenesis is
performed for two or more codons. In a further embodiment, mutant
DNA sequences have more than about 50%, more than about 55%, more
than about 60%, more than about 65%, more than about 70%, more than
about 75%, more than about 80%, more than about 85%, more than
about 90%, more than about 95%, or more than about 98% homology
with the wild-type sequence. In alternative embodiments, mutant DNA
is generated in vivo using any known mutagenic procedure such as,
for example, radiation, nitrosoguanidine and the like. The desired
DNA sequence is then isolated and used in the methods provided
herein.
[0077] As used herein, the terms "amplification" and "gene
amplification" refer to a process by which specific DNA sequences
are disproportionately replicated such that the amplified gene
becomes present in a higher copy number than was initially present
in the genome. In some embodiments, selection of cells by growth in
the presence of a drug (e.g., an inhibitor of an inhibitable
enzyme) results in the amplification of either the endogenous gene
encoding the gene product required for growth in the presence of
the drug or by amplification of exogenous (i.e., input) sequences
encoding this gene product, or both.
[0078] "Amplification" is a special case of nucleic acid
replication involving template specificity. It is to be contrasted
with non-specific template replication (i.e., replication that is
template-dependent but not dependent on a specific template).
Template specificity is here distinguished from fidelity of
replication (i.e., synthesis of the proper polynucleotide sequence)
and nucleotide (ribo- or deoxyribo-) specificity. Template
specificity is frequently described in terms of "target"
specificity. Target sequences are "targets" in the sense that they
are sought to be sorted out from other nucleic acid. Amplification
techniques have been designed primarily for this sorting out.
[0079] As used herein, the term "primer" refers to an
oligonucleotide, whether occurring naturally as in a purified
restriction digest or produced synthetically, which is capable of
acting as a point of initiation of synthesis when placed under
conditions in which synthesis of a primer extension product which
is complementary to a nucleic acid strand is induced, (i.e., in the
presence of nucleotides and an inducing agent such as DNA
polymerase and at a suitable temperature and pH). The primer is
preferably single stranded for maximum efficiency in amplification,
but may alternatively be double stranded. If double stranded, the
primer is first treated to separate its strands before being used
to prepare extension products. Preferably, the primer is an
oligodeoxyribonucleotide. The primer must be sufficiently long to
prime the synthesis of extension products in the presence of the
inducing agent. The exact lengths of the primers will depend on
many factors, including temperature, source of primer and the use
of the method.
[0080] As used herein, the term "probe" refers to an
oligonucleotide (i.e., a sequence of nucleotides), whether
occurring naturally as in a purified restriction digest or produced
synthetically, recombinantly or by PCR amplification, which is
capable of hybridizing to another oligonucleotide of interest. A
probe may be single-stranded or double-stranded. Probes are useful
in the detection, identification and isolation of particular gene
sequences. It is contemplated that any probe used in the present
invention will be labeled with any "reporter molecule," so that is
detectable in any detection system, including, but not limited to
enzyme (e.g., ELISA, as well as enzyme-based histochemical assays),
fluorescent, radioactive, and luminescent systems. It is not
intended that the present invention be limited to any particular
detection system or label.
[0081] As used herein, the term "target" when used in reference to
the polymerase chain reaction, refers to the region of nucleic acid
bounded by the primers used for polymerase chain reaction. Thus,
the "target" is sought to be sorted out from other nucleic acid
sequences. A "segment" is defined as a region of nucleic acid
within the target sequence.
[0082] As used herein, the term "polymerase chain reaction" (PCR)
refers to the methods of U.S. Pat. Nos. 4,683,195 4,683,202, and
4,965,188, hereby incorporated by reference, which include methods
for increasing the concentration of a segment of a target sequence
in a mixture of genomic DNA without cloning or purification. This
process for amplifying the target sequence is well known in the
art.
[0083] As used herein, the term "amplification reagents" refers to
those reagents (deoxyribonucleotide triphosphates, buffer, etc.),
needed for amplification except for primers, nucleic acid template
and the amplification enzyme. Typically, amplification reagents
along with other reaction components are placed and contained in a
reaction vessel (test tube, microwell, etc.).
[0084] As used herein, the terms "restriction endonucleases" and
"restriction enzymes" refer to bacterial enzymes, each of which cut
double-stranded DNA at or near a specific nucleotide sequence.
[0085] A "restriction site" refers to a nucleotide sequence
recognized and cleaved by a given restriction endonuclease and is
frequently the site for insertion of DNA fragments. In certain
embodiments of the invention restriction sites are engineered into
the selective marker and into 5' and 3' ends of the DNA
construct.
[0086] "Homologous recombination" means the exchange of DNA
fragments between two DNA molecules or paired chromosomes at the
site of identical or nearly identical nucleotide sequences. In a
preferred embodiment, chromosomal integration is homologous
recombination.
[0087] As used herein "amino acid" refers to peptide or protein
sequences or portions thereof. The terms "protein," "peptide," and
"polypeptide" are used interchangeably.
[0088] As used herein, "protein of interest" and "polypeptide of
interest" refer to a protein/polypeptide that is desired and/or
being assessed. In some embodiments, the protein of interest is
expressed intracellularly, while in other embodiments, it is a
secreted polypeptide. In particularly preferred embodiments, these
enzymes include the serine proteases of the present invention. In
some embodiments, the protein of interest is a secreted polypeptide
which is fused to a signal peptide (i.e., an amino-terminal
extension on a protein to be secreted). Nearly all secreted
proteins use an amino-terminal protein extension which plays a
crucial role in the targeting to and translocation of precursor
proteins across the membrane. This extension is proteolytically
removed by a signal peptidase during or immediately following
membrane transfer.
[0089] A polynucleotide is said to "encode" an RNA or a polypeptide
if, in its native state or when manipulated by methods known to
those of skill in the art, it can be transcribed and/or translated
to produce the RNA, the polypeptide or a fragment thereof. The
anti-sense strand of such a nucleic acid is also said to encode the
sequences. As is known in the art, a DNA can be transcribed by an
RNA polymerase to produce RNA, but an RNA can be reverse
transcribed by reverse transcriptase to produce a DNA. Thus a DNA
can encode a RNA and vice versa.
[0090] "Host strain" or "host cell" refers to a suitable host for
an expression vector comprising DNA according to the present
invention.
[0091] An enzyme is "overexpressed" in a host cell if the enzyme is
expressed in the cell at a higher level that the level at which it
is expressed in a corresponding wild-type cell.
[0092] The terms "protein" and "polypeptide" are used
interchangeability herein. The 3-letter code for amino acids as
defined in conformity with the IUPAC-IUB Joint Commission on
Biochemical Nomenclature (JCBN) is used through out this
disclosure. It is also understood that a polypeptide may be coded
for by more than one nucleotide sequence due to the degeneracy of
the genetic code.
[0093] A "prosequence" is an amino acid sequence between the signal
sequence and mature protease that is necessary for the secretion of
the protease. Cleavage of the pro sequence results in a mature
active protease.
[0094] The term "signal sequence" or "signal peptide" refers to any
sequence of nucleotides and/or amino acids which may participate in
the secretion of the mature or precursor forms of the protein. This
definition of signal sequence is a functional one, meant to include
all those amino acid sequences encoded by the N-terminal portion of
the protein gene, which participate in the effectuation of the
secretion of protein. They are often, but not universally, bound to
the N-terminal portion of a protein or to the N-terminal portion of
a precursor protein. The signal sequence may be endogenous or
exogenous. The signal sequence may be that normally associated with
the protein (e.g., protease), or may be from a gene encoding
another secreted protein. One exemplary exogenous signal sequence
comprises the first seven amino acid residues of the signal
sequence from Bacillus subtilis subtilisin fused to the remainder
of the signal sequence of the subtilisin from Bacillus lentus (ATCC
21536).
[0095] The term "hybrid signal sequence" refers to signal sequences
in which part of sequence is obtained from the expression host
fused to the signal sequence of the gene to be expressed. In some
embodiments, synthetic sequences are utilized.
[0096] The term "mature" form of a protein or peptide refers to the
final functional form of the protein or peptide.
[0097] The term "precursor" form of a protein or peptide refers to
a mature form of the protein having a prosequence operably linked
to the amino or carbonyl terminus of the protein. The precursor may
also have a "signal" sequence operably linked, to the amino
terminus of the prosequence. The precursor may also have additional
polynucleotides that are involved in post-translational activity
(e.g., polynucleotides cleaved therefrom to leave the mature form
of a protein or peptide).
[0098] "Naturally occurring enzyme" refers to an enzyme having the
unmodified amino acid sequence identical to that found in nature.
Naturally occurring enzymes include native enzymes, those enzymes
naturally expressed or found in the particular microorganism.
[0099] The terms "derived from" and "obtained from" refer to not
only a protease produced or producible by a strain of the organism
in question, but also a protease encoded by a DNA sequence isolated
from such strain and produced in a host organism containing such
DNA sequence. Additionally, the term refers to a protease which is
encoded by a DNA sequence of synthetic and/or cDNA origin and which
has the identifying characteristics of the protease in question. To
exemplify, "proteases derived from Bacillus" refers to those
enzymes having proteolytic activity which are naturally-produced by
Bacillus, as well as to serine proteases like those produced by
Bacillus sources but which through the use of genetic engineering
techniques are produced by non-Bacillus organisms transformed with
a nucleic acid encoding the serine proteases.
[0100] A "derivative" within the scope of this definition generally
retains the characteristic proteolytic activity observed in the
wild-type, native or reference form to the extent that the
derivative is useful for similar purposes as the wild-type, native
or reference form. Functional derivatives of serine protease
encompass naturally occurring, synthetically or recombinantly
produced peptides or peptide fragments which have the general
characteristics of the serine protease of the present
invention.
[0101] The term "functional derivative" refers to a derivative of a
nucleic acid which has the functional characteristics of a nucleic
acid which encodes serine protease. Functional derivatives of a
nucleic acid which encode serine protease of the present invention
encompass naturally occurring, synthetically or recombinantly
produced nucleic acids or fragments and encode serine protease
characteristic of the present invention. Wild type nucleic acid
encoding serine proteases according to the invention include
naturally occurring alleles and homologues based on the degeneracy
of the genetic code known in the art.
[0102] The term "identical" in the context of two nucleic acids or
polypeptide sequences refers to the residues in the two sequences
that are the same when aligned for maximum correspondence, as
measured using one of the following sequence comparison or analysis
algorithms.
[0103] The term "optimal alignment" refers to the alignment giving
the highest percent identity score.
[0104] "Percent sequence identity," "percent amino acid sequence
identity," "percent gene sequence identity," and/or "percent
nucleic acid/polynucloetide sequence identity," with respect to two
amino acid, polynucleotide and/or gene sequences (as appropriate),
refer to the percentage of residues that are identical in the two
sequences when the sequences are optimally aligned. Thus, 80% amino
acid sequence identity means that 80% of the amino acids in two
optimally aligned polypeptide sequences are identical.
[0105] The phrase "substantially identical" in the context of two
nucleic acids or polypeptides thus refers to a polynucleotide or
polypeptide that comprising at least about 70% sequence identity,
preferably at least about 75%, preferably at least about 80%,
preferably at least about 85%, preferably at least about 90%,
preferably at least about 95%, preferably at least about 97%,
preferably at least about 98%, and preferably at least about 99%
sequence identity as compared to a reference sequence using the
programs or algorithms (e.g., BLAST, ALIGN, CLUSTAL) using standard
parameters. One indication that two polypeptides are substantially
identical is that the first polypeptide is immunologically
cross-reactive with the second polypeptide. Typically, polypeptides
that differ by conservative amino acid substitutions are
immunologically cross-reactive. Thus, a polypeptide is
substantially identical to a second polypeptide, for example, where
the two peptides differ only by a conservative substitution.
Another indication that two nucleic acid sequences are
substantially identical is that the two molecules hybridize to each
other under stringent conditions (e.g., within a range of medium to
high stringency).
[0106] The phrase "equivalent," in this context, refers to serine
proteases enzymes that are encoded by a polynucleotide capable of
hybridizing to the polynucleotide having the sequence as shown in
SEQ ID NO:1 or SEQ ID NO:5, under conditions of medium to maximum
stringency. For example, being equivalent means that an equivalent
mature serine protease comprises at least about 70%, at least about
75%, at least about 80%, at least about 85%, at least about 90%, at
least about 91%, at least about 92%, at least about 93%, at least
about 94%, at least about 95%, at least about 96%, at least about
97%, at least about 98%, and/or at least about 99% sequence
identity to the mature BPN' or GG36 serine protease having the
amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
[0107] The term "isolated" or "purified" refers to a material that
is removed from its original environment (e.g., the natural
environment if it is naturally occurring). For example, the
material is said to be "purified" when it is present in a
particular composition in a higher or lower concentration than
exists in a naturally occurring or wild type organism or in
combination with components not normally present upon expression
from a naturally occurring or wild type organism. For example, a
naturally-occurring polynucleotide or polypeptide present in a
living animal is not isolated, but the same polynucleotide or
polypeptide, separated from some or all of the coexisting materials
in the natural system, is isolated. In some embodiments, such
polynucleotides are part of a vector, and/or such polynucleotides
or polypeptides are part of a composition, and still be isolated in
that such vector or composition is not part of its natural
environment. In preferred embodiments, a nucleic acid or protein is
said to be purified, for example, if it gives rise to essentially
one band in an electrophoretic gel or blot.
[0108] The term "isolated", when used in reference to a DNA
sequence, refers to a DNA sequence that has been removed from its
natural genetic milieu and is thus free of other extraneous or
unwanted coding sequences, and is in a form suitable for use within
genetically engineered protein production systems. Such isolated
molecules are those that are separated from their natural
environment and include cDNA and genomic clones. Isolated DNA
molecules of the present invention are free of other genes with
which they are ordinarily associated, but may include naturally
occurring 5' and 3' untranslated regions such as promoters and
terminators. The identification of associated regions will be
evident to one of ordinary skill in the art (See e.g., Dynan and
Tijan, Nature 316:774-78 [1985]). The term "an isolated DNA
sequence" is alternatively referred to as "a cloned DNA
sequence".
[0109] The term "isolated," when used in reference to a protein,
refers to a protein that is found in a condition other than its
native environment. In a preferred form, the isolated protein is
substantially free of other proteins, particularly other homologous
proteins. An isolated protein is more than about 10% pure,
preferably more than about 20% pure, and even more preferably more
than about 30% pure, as determined by SDS-PAGE. Further aspects of
the invention encompass the protein in a highly purified form
(i.e., more than about 40% pure, more than about 60% pure, more
than about 70% pure, more than about 80% pure, more than about 90%
pure, more than about 95% pure, more than about 97% pure, and even
more than about 99% pure), as determined by SDS-PAGE.
[0110] As used herein, the term, "combinatorial mutagenesis" refers
to methods in which libraries of variants of a starting sequence
are generated. In these libraries, the variants contain one or
several mutations chosen from a predefined set of mutations. In
addition, the methods provide means to introduce random mutations
which were not members of the predefined set of mutations. In some
embodiments, the methods include those set forth in U.S. patent
application Ser. No. 09/699,250, filed Oct. 26, 2000, hereby
incorporated by reference. In alternative embodiments,
combinatorial mutagenesis methods encompass commercially available
kits (e.g., QUIKCHANGE.RTM. Multisite (Stratagene).
[0111] As used herein, the terms "library of mutants" and "library
of variants" refer to a population of cells which are identical in
most of their genome but include different homologues of one or
more genes. Such libraries can be used, for example, to identify
genes or operons with improved traits.
[0112] As used herein, the term "starting gene" refers to a gene of
interest that encodes a protein of interest that is to be improved
and/or changed using the present invention.
[0113] As used herein, the term "multiple sequence alignment"
("MSA") refers to the sequences of multiple homologs of a starting
gene that are aligned using an algorithm (e.g., Clustal W).
[0114] As used herein, the terms "consensus sequence" and
"canonical sequence" refer to an archetypical amino acid sequence
against which all variants of a particular protein or sequence of
interest are compared. The terms also refer to a sequence that sets
forth the nucleotides that are most often present in a DNA sequence
of interest. For each position of a gene, the consensus sequence
gives the amino acid that is most abundant in that position in the
MSA.
[0115] As used herein, the term "consensus mutation" refers to a
difference in the sequence of a starting gene and a consensus
sequence. Consensus mutations are identified by comparing the
sequences of the starting gene and the consensus sequence resulting
from an MSA. In some embodiments, consensus mutations are
introduced into the starting gene such that it becomes more similar
to the consensus sequence. Consensus mutations also include amino
acid changes that change an amino acid in a starting gene to an
amino acid that is more frequently found in an MSA at that position
relative to the frequency of that amino acid in the starting gene.
Thus, the term consensus mutation comprises all single amino acid
changes that replace an amino acid of the starting gene with an
amino acid that is more abundant than the amino acid in the
MSA.
[0116] As used herein, the term "initial hit" refers to a variant
that was identified by screening a combinatorial consensus
mutagenesis library. In preferred embodiments, initial hits have
improved performance characteristics, as compared to the starting
gene.
[0117] As used herein, the term "improved hit" refers to a variant
that was identified by screening an enhanced combinatorial
consensus mutagenesis library.
[0118] As used herein, the terms "improving mutation" and
"performance-enhancing mutation" refer to a mutation that leads to
improved performance when it is introduced into the starting gene.
In some preferred embodiments, these mutations are identified by
sequencing hits that were identified during the screening step of
the method. In most embodiments, mutations that are more frequently
found in hits are likely to be improving mutations, as compared to
an unscreened combinatorial consensus mutagenesis library.
[0119] As used herein, the term "enhanced combinatorial consensus
mutagenesis library" refers to a CCM library that is designed and
constructed based on screening and/or sequencing results from an
earlier round of CCM mutagenesis and screening. In some
embodiments, the enhanced CCM library is based on the sequence of
an initial hit resulting from an earlier round of CCM. In
additional embodiments, the enhanced CCM is designed such that
mutations that were frequently observed in initial hits from
earlier rounds of mutagenesis and screening are favored. In some
preferred embodiments, this is accomplished by omitting primers
that encode performance-reducing mutations or by increasing the
concentration of primers that encode performance-enhancing
mutations relative to other primers that were used in earlier CCM
libraries.
[0120] As used herein, the term "performance-reducing mutations"
refer to mutations in the combinatorial consensus mutagenesis
library that are less frequently found in hits resulting from
screening as compared to an unscreened combinatorial consensus
mutagenesis library. In preferred embodiments, the screening
process removes and/or reduces the abundance of variants that
contain "performance-reducing mutations."
[0121] As used herein, the term "functional assay" refers to an
assay that provides an indication of a protein's activity. In
particularly preferred embodiments, the term refers to assay
systems in which a protein is analyzed for its ability to function
in its usual capacity. For example, in the case of enzymes, a
functional assay involves determining the effectiveness of the
enzyme in catalyzing a reaction.
[0122] As used herein, the term "target property" refers to the
property of the starting gene that is to be altered. It is not
intended that the present invention be limited to any particular
target property. However, in some preferred embodiments, the target
property is the stability of a gene product (e.g., resistance to
denaturation, proteolysis or other degradative factors), while in
other embodiments, the level of production in a production host is
altered. Indeed, it is contemplated that any property of a starting
gene will find use in the present invention.
[0123] The term "property" or grammatical equivalents thereof in
the context of a nucleic acid, as used herein, refer to any
characteristic or attribute of a nucleic acid that can be selected
or detected. These properties include, but are not limited to, a
property affecting binding to a polypeptide, a property conferred
on a cell comprising a particular nucleic acid, a property
affecting gene transcription (e.g., promoter strength, promoter
recognition, promoter regulation, enhancer function), a property
affecting RNA processing (e.g., RNA splicing, RNA stability, RNA
conformation, and post-transcriptional modification), a property
affecting translation (e.g., level, regulation, binding of mRNA to
ribosomal proteins, post-translational modification). For example,
a binding site for a transcription factor, polymerase, regulatory
factor, etc., of a nucleic acid may be altered to produce desired
characteristics or to identify undesirable characteristics.
[0124] The term "property" or grammatical equivalents thereof in
the context of a polypeptide (including proteins), as used herein,
refer to any characteristic or attribute of a polypeptide that can
be selected or detected. These properties include, but are not
limited to oxidative stability, substrate specificity, catalytic
activity, thermal stability, alkaline stability, pH activity
profile, resistance to proteolytic degradation, K.sub.M, k.sub.cat,
k.sub.cat/k.sub.M ratio, protein folding, inducing an immune
response, ability to bind to a ligand, ability to bind to a
receptor, ability to be secreted, ability to be displayed on the
surface of a cell, ability to oligomerize, ability to signal,
ability to stimulate cell proliferation, ability to inhibit cell
proliferation, ability to induce apoptosis, ability to be modified
by phosphorylation or glycosylation, and/or ability to treat
disease, etc.
[0125] As used herein, the term "screening" has its usual meaning
in the art and is, in general a multi-step process. In the first
step, a mutant nucleic acid or variant polypeptide therefrom is
provided. In the second step, a property of the mutant nucleic acid
or variant polypeptide is determined. In the third step, the
determined property is compared to a property of the corresponding
precursor nucleic acid, to the property of the corresponding
naturally occurring polypeptide or to the property of the starting
material (e.g., the initial sequence) for the generation of the
mutant nucleic acid.
[0126] It will be apparent to the skilled artisan that the
screening procedure for obtaining a nucleic acid or protein with an
altered property depends upon the property of the starting material
the modification of which the generation of the mutant nucleic acid
is intended to facilitate. The skilled artisan will therefore
appreciate that the invention is not limited to any specific
property to be screened for and that the following description of
properties lists illustrative examples only. Methods for screening
for any particular property are generally described in the art. For
example, one can measure binding, pH, specificity, etc., before and
after mutation, wherein a change indicates an alteration.
Preferably, the screens are performed in a high-throughput manner,
including multiple samples being screened simultaneously,
including, but not limited to assays utilizing chips, phage
display, and multiple substrates and/or indicators.
[0127] As used herein, in some embodiments, screens encompass
selection steps in which variants of interest are enriched from a
population of variants. Examples of these embodiments include the
selection of variants that confer a growth advantage to the host
organism, as well as phage display or any other method of display,
where variants can be captured from a population of variants based
on their binding or catalytic properties. In a preferred
embodiment, a library of variants is exposed to stress (heat,
protease, denaturation) and subsequently variants that are still
intact are identified in a screen or enriched by selection. It is
intended that the term encompass any suitable means for selection.
Indeed, it is not intended that the present invention be limited to
any particular method of screening.
[0128] As used herein, the term "targeted randomization" refers to
a process that produces a plurality of sequences where one or
several positions have been randomized. In some embodiments,
randomization is complete (i.e., all four nucleotides, A, T, G, and
C can occur at a randomized position. In alternative embodiments,
randomization of a nucleotide is limited to a subset of the four
nucleotides. Targeted randomization can be applied to one or
several codons of a sequence, coding for one or several proteins of
interest. When expressed, the resulting libraries produce protein
populations in which one or more amino acid positions can contain a
mixture of all 20 amino acids or a subset of amino acids, as
determined by the randomization scheme of the randomized codon. In
some embodiments, the individual members of a population resulting
from targeted randomization differ in the number of amino acids,
due to targeted or random insertion or deletion of codons. In
further embodiments, synthetic amino acids are included in the
protein populations produced. In some preferred embodiments, the
majority of members of a population resulting from targeted
randomization show greater sequence homology to the consensus
sequence than the starting gene. In some embodiments, the sequence
encodes one or more proteins of interest. In alternative
embodiments, the proteins have differing biological functions. In
some preferred embodiments, the incoming sequence comprises at
least one selectable marker. This sequence can code for one or more
proteins of interest. It can have other biological function. In
many cases the incoming sequence will include a selectable marker,
such as a gene that confers resistance to an antibiotic.
[0129] The terms "modified sequence" and "modified genes" are used
interchangeably herein to refer to a sequence that includes a
deletion, insertion or interruption of naturally occurring nucleic
acid sequence. In some preferred embodiments, the expression
product of the modified sequence is a truncated protein (e.g., if
the modification is a deletion or interruption of the sequence). In
some particularly preferred embodiments, the truncated protein
retains biological activity. In alternative embodiments, the
expression product of the modified sequence is an elongated protein
(e.g., modifications comprising an insertion into the nucleic acid
sequence). In some embodiments, an insertion leads to a truncated
protein (e.g., when the insertion results in the formation of a
stop codon). Thus, an insertion may result in either a truncated
protein or an elongated protein as an expression product.
[0130] As used herein, the terms "mutant sequence" and "mutant
gene" are used interchangeably and refer to a sequence that has an
alteration in at least one codon occurring in a host cell's
wild-type sequence. The expression product of the mutant sequence
is a protein with an altered amino acid sequence relative to the
wild-type. The expression product may have an altered functional
capacity (e.g., enhanced enzymatic activity).
[0131] The terms "mutagenic primer" or "mutagenic oligonucleotide"
(used interchangeably herein) are intended to refer to
oligonucleotide compositions which correspond to a portion of the
template sequence and which are capable of hybridizing thereto.
With respect to mutagenic primers, the primer will not precisely
match the template nucleic acid, the mismatch or mismatches in the
primer being used to introduce the desired mutation into the
nucleic acid library. As used herein, "non-mutagenic primer" or
"non-mutagenic oligonucleotide" refers to oligonucleotide
compositions which will match precisely to the template nucleic
acid. In one embodiment of the invention, only mutagenic primers
are used. In another preferred embodiment of the invention, the
primers are designed so that for at least one region at which a
mutagenic primer has been included, there is also non-mutagenic
primer included in the oligonucleotide mixture. By adding a mixture
of mutagenic primers and non-mutagenic primers corresponding to at
least one of the mutagenic primers, it is possible to produce a
resulting nucleic acid library in which a variety of combinatorial
mutational patterns are presented. For example, if it is desired
that some of the members of the mutant nucleic acid library retain
their precursor sequence at certain positions while other members
are mutant at such sites, the non-mutagenic primers provide the
ability to obtain a specific level of non-mutant members within the
nucleic acid library for a given residue. The methods of the
invention employ mutagenic and non-mutagenic oligonucleotides which
are generally between about 10-50 bases in length, or more
preferably, about 15-45 bases in length. However, it may be
necessary to use primers that are either shorter than about 10
bases or longer than about 50 bases to obtain the mutagenesis
result desired. With respect to corresponding mutagenic and
non-mutagenic primers, it is not necessary that the corresponding
oligonucleotides be of identical length, but only that there is
overlap in the region corresponding to the mutation to be added.
Primers may be added in a pre-defined ratio according to the
present invention. For example, if it is desired that the resulting
library have a significant level of a certain specific mutation and
a lesser amount of a different mutation at the same or different
site, by adjusting the amount of primer added, it is possible to
produce the desired biased library. Alternatively, by adding lesser
or greater amounts of non-mutagenic primers, it is possible to
adjust the frequency with which the corresponding mutation(s) are
produced in the mutant nucleic acid library.
[0132] As used herein, the phrase "contiguous mutations" refers to
mutations which are presented within the same oligonucleotide
primer. For example, contiguous mutations may be adjacent or nearby
each other, however, they will be introduced into the resulting
mutant template nucleic acids by the same primer.
[0133] As used herein, the phrase "discontiguous mutations" refers
to mutations which are presented in separate oligonucleotide
primers. For example, discontiguous mutations will be introduced
into the resulting mutant template nucleic acids by separately
prepared oligonucleotide primers.
[0134] The terms "wild-type sequence" or "wild-type gene" are used
interchangeably herein, to refer to a sequence that is native or
naturally occurring in a host cell. In some embodiments, the
wild-type sequence refers to a sequence of interest that is the
starting point of a protein engineering project. The wild-type
sequence may encode either a homologous or heterologous protein. A
homologous protein is one the host cell would produce without
intervention. A heterologous protein is one that the host cell
would not produce but for the intervention.
[0135] As used herein, the term "antibodies" refers to
immunoglobulins. Antibodies include but are not limited to
immunoglobulins obtained directly from any species from which it is
desirable to produce antibodies. In addition, the present invention
encompasses modified antibodies. The term also refers to antibody
fragments that retain the ability to bind to the epitope that the
intact antibody binds and include polyclonal antibodies, monoclonal
antibodies, chimeric antibodies, anti-idiotype (anti-ID)
antibodies. Antibody fragments include, but are not limited to the
complementarity-determining regions (CDRs), single-chain fragment
variable regions (scFv), heavy chain variable region (VH), light
chain variable region (VL). Polyclonal and monoclonal antibodies
are also encompassed by the present invention. Preferably, the
antibodies are monoclonal antibodies.
[0136] As used herein, the phrase "alteration in substrate
specificity" refers to changes in the substrate specificity of an
enzyme. In some embodiments, a change in substrate specificity is
defined as a change in k.sub.cat and/or K.sub.m for a particular
substrate, resulting from mutations of the enzyme or alteration of
reaction conditions. The substrate specificity of an enzyme is
determined by comparing the catalytic efficiencies it exhibits with
different substrates. These determinations find particular use in
assessing the efficiency of mutant enzymes, as it is generally
desired to produce variant enzymes that exhibit greater ratios of
k.sub.cat/K.sub.m for substrates of interest. However, it is not
intended that the present invention be limited to any particular
substrate composition or substrate specificity.
[0137] As used herein, "surface property" is used in reference to
electrostatic charge, as well as properties such as the
hydrophobicity and hydrophilicity exhibited by the surface of a
protein.
[0138] As used herein, the phrase "is independently selected from
the group consisting of . . . " means that moieties or elements
that are selected from the referenced Markush group can be the
same, can be different or any mixture of elements as indicated in
the following example:
[0139] A molecule having 3 R groups wherein each R group is
independently selected from the group consisting of A, B and C.
Here the three R groups may be: AAA, BBB, CCC, AAB, AAC, BBA, BBC,
CCA, CCB, or ABC.
[0140] In reference to chemical compositions, the term
"substituted" as used herein, means that the organic composition or
radical to which the term is applied is: [0141] (a) made
unsaturated by the elimination of at least one element or radical;
or [0142] (b) at least one hydrogen in the compound or radical is
replaced with a moiety containing one or more (i) carbon, (ii)
oxygen, (iii) sulfur, (iv) nitrogen or (v) halogen atoms; or [0143]
(c) both (a) and (b). Moieties which may replace hydrogen as
described in (b) immediately above, that contain only carbon and
hydrogen atoms, are hydrocarbon moieties including, but not limited
to, alkyl, alkenyl, alkynyl, alkyldienyl, cycloalkyl, phenyl, alkyl
phenyl, naphthyl, anthryl, phenanthryl, fluoryl, steroid groups,
and combinations of these groups with each other and with
polyvalent hydrocarbon groups such as alkylene, alkylidene and
alkylidyne groups. Moieties containing oxygen atoms that may
replace hydrogen as described in (b) immediately above include, but
are not limited to, hydroxy, acyl or keto, ether, epoxy, carboxy,
and ester containing groups. Moieties containing sulfur atoms that
may replace hydrogen as described in (b) immediately above include,
but are not limited to, the sulfur-containing acids and acid ester
groups, thioether groups, mercapto groups and thioketo groups.
Moieties containing nitrogen atoms that may replace hydrogen as
described in (b) immediately above include, but are not limited to,
amino groups, the nitro group, azo groups, ammonium groups, amide
groups, azido groups, isocyanate groups, cyano groups and nitrile
groups. Moieties containing halogen atoms that may replace hydrogen
as described in (b) immediately above include chloro, bromo,
fluoro, iodo groups and any of the moieties previously described
where a hydrogen or a pendant alkyl group is substituted by a halo
group to form a stable substituted moiety.
[0144] It is understood that any of the above moieties (b)(i)
through (b)(v) can be substituted into each other in either a
monovalent substitution or by loss of hydrogen in a polyvalent
substitution to form another monovalent moiety that can replace
hydrogen in the organic compound or radical.
[0145] The term "oxidation stable" refers to proteases of the
present invention that retain a specified amount of enzymatic
activity over a given period of time under conditions prevailing
during the proteolytic, hydrolyzing, cleaning or other process of
the invention, for example while exposed to or contacted with
bleaching agents or oxidizing agents. In some embodiments, the
proteases retain at least about 50%, about 60%, about 70%, about
75%, about 80%, about 85%, about 90%, about 92%, about 95%, about
96%, about 97%, about 98%, or about 99% proteolytic activity after
contact with a bleaching or oxidizing agent over a given time
period, for example, at least about 1 minute, about 3 minutes,
about 5 minutes, about 8 minutes, about 12 minutes, about 16
minutes, about 20 minutes, etc. In some embodiments, the stability
is measured as described in the Examples.
[0146] The term "chelator stable" refers to proteases of the
present invention that retain a specified amount of enzymatic
activity over a given period of time under conditions prevailing
during the proteolytic, hydrolyzing, cleaning or other process of
the invention, for example while exposed to or contacted with
chelating agents. In some embodiments, the proteases retain at
least about 50%, about 60%, about 70%, about 75%, about 80%, about
85%, about 90%, about 92%, about 95%, about 96%, about 97%, about
98%, or about 99% proteolytic activity after contact with a
chelating agent over a given time period, for example, at least
about 10 minutes, about 20 minutes, about 40 minutes, about 60
minutes, about 100 minutes, etc. In some embodiments, the chelator
stability is measured as described in the Examples.
[0147] The terms "thermally stable" and "thermostable" refer to
proteases of the present invention that retain a specified amount
of enzymatic activity after exposure to identified temperatures
over a given period of time under conditions prevailing during the
proteolytic, hydrolyzing, cleaning or other process of the
invention, for example while exposed altered temperatures. Altered
temperatures include increased or decreased temperatures. In some
embodiments, the proteases retain at least about 50%, about 60%,
about 70%, about 75%, about 80%, about 85%, about 90%, about 92%,
about 95%, about 96%, about 97%, about 98%, or about 99%
proteolytic activity after exposure to altered temperatures over a
given time period, for example, at least about 60 minutes, about
120 minutes, about 180 minutes, about 240 minutes, about 300
minutes, etc. In some embodiments, the thermostability is
determined as described in the Examples.
[0148] The term "enhanced stability" in the context of an
oxidation, chelator, thermal and/or pH stable protease refers to a
higher retained proteolytic activity over time as compared to other
serine proteases (e.g., subtilisin proteases) and/or wild-type
enzymes.
[0149] The term "diminished stability" in the context of an
oxidation, chelator, thermal and/or pH stable protease refers to a
lower retained proteolytic activity over time as compared to other
serine proteases (e.g., subtilisin proteases) and/or wild-type
enzymes.
[0150] The term "cleaning activity" refers to the cleaning
performance achieved by the protease under conditions prevailing
during the proteolytic, hydrolyzing, cleaning or other process of
the invention. In some embodiments, cleaning performance is
determined by the application of various cleaning assays concerning
enzyme sensitive stains, for example grass, blood, milk, or egg
protein as determined by various chromatographic,
spectrophotometric or other quantitative methodologies after
subjection of the stains to standard wash conditions. Exemplary
assays include, but are not limited to those described in WO
99/34011, and U.S. Pat. No. 6,605,458 (both of which are herein
incorporated by reference), as well as those methods included in
the Examples.
[0151] The term "cleaning effective amount" of a protease refers to
the quantity of protease described hereinbefore that achieves a
desired level of enzymatic activity in a specific cleaning
composition. Such effective amounts are readily ascertained by one
of ordinary skill in the art and are based on many factors, such as
the particular protease used, the cleaning application, the
specific composition of the cleaning composition, and whether a
liquid or dry (e.g., granular, bar) composition is required,
etc.
[0152] The term "cleaning adjunct materials," as used herein, means
any liquid, solid or gaseous material selected for the particular
type of cleaning composition desired and the form of the product
(e.g., liquid, granule, powder, bar, paste, spray, tablet, gel; or
foam composition), which materials are also preferably compatible
with the protease enzyme used in the composition. In some
embodiments, granular compositions are in "compact" form, while in
other embodiments, the liquid compositions are in a "concentrated"
form.
[0153] The term "enhanced performance" in the context of cleaning
activity refers to an increased or greater cleaning activity of
certain enzyme sensitive stains such as egg, milk, grass or blood,
as determined by usual evaluation after a standard wash cycle
and/or multiple wash cycles.
[0154] The term "diminished performance" in the context of cleaning
activity refers to a decreased or lesser cleaning activity of
certain enzyme sensitive stains such as egg, milk, grass or blood,
as determined by usual evaluation after a standard wash cycle.
[0155] The term "comparative performance" in the context of
cleaning activity refers to at least about 60%, at least about 70%,
at least about 80%, at least about 90%, at least about 95% of the
cleaning activity of a comparative or reference protease (e.g.,
commercially available proteases), including but not limited to
OPTIMASE.TM. protease (Genencor), PURAFECT.TM. protease products
(Genencor), SAVINASE.TM. protease (Novozymes), BPN'-variants (See
e.g., U.S. Pat. No. Re 34,606), RELASE.TM., DURAZYME.TM.,
EVERLASE.TM., KANNASE.TM. protease (Novozymes), MAXACAL.TM.,
MAXAPEM.TM., PROPERASE.TM. proteases (Genencor; See also, U.S. Pat.
No. Re 34,606, and U.S. Pat. Nos. 5,700,676; 5,955,340; 6,312,936;
and 6,482,628), and B. lentus variant protease products (e.g.,
those described in WO 92/21760, WO 95/23221 and/or WO 97/07770).
Cleaning performance can be determined by comparing the proteases
of the present invention with those subtilisin proteases in various
cleaning assays concerning enzyme sensitive stains such as grass,
blood or milk as determined by usual spectrophotometric or
analytical methodologies after standard wash cycle conditions.
[0156] As used herein, "cleaning compositions" and "cleaning
formulations" refer to compositions that find use in the removal of
undesired compounds from items to be cleaned, such as fabric,
dishes, contact lenses, other solid substrates, hair (shampoos),
skin (soaps and creams), teeth (mouthwashes, toothpastes) etc. The
term encompasses any materials/compounds selected for the
particular type of cleaning composition desired and the form of the
product (e.g., liquid, gel, granule, or spray composition), as long
as the composition is compatible with the protease and other
enzyme(s) used in the composition. The specific selection of
cleaning composition materials are readily made by considering the
surface, item or fabric to be cleaned, and the desired form of the
composition for the cleaning conditions during use.
[0157] The terms further refer to any composition that is suited
for cleaning, bleaching, disinfecting, and/or sterilizing any
object and/or surface. It is intended that the terms include, but
are not limited to detergent compositions (e.g., liquid and/or
solid laundry detergents and fine fabric detergents; hard surface
cleaning formulations, such as for glass, wood, ceramic and metal
counter tops and windows; carpet cleaners; oven cleaners; fabric
fresheners; fabric softeners; and textile and laundry pre-spotters,
as well as dish detergents).
[0158] Indeed, the term "cleaning composition" as used herein,
includes unless otherwise indicated, granular or powder-form
all-purpose or heavy-duty washing agents, especially cleaning
detergents; liquid, gel or paste-form all-purpose washing agents,
especially the so-called heavy-duty liquid (HDL) types; liquid
fine-fabric detergents; hand dishwashing agents or light duty
dishwashing agents, especially those of the high-foaming type;
machine dishwashing agents, including the various tablet, granular,
liquid and rinse-aid types for household and institutional use;
liquid cleaning and disinfecting agents, including antibacterial
hand-wash types, cleaning bars, mouthwashes, denture cleaners, car
shampoos, carpet shampoos, bathroom cleaners; hair shampoos and/or
hair-rinses for humans and other animals; shower gels and foam
baths and metal cleaners; as well as cleaning auxiliaries such as
bleach additives and "stain-stick" or pre-treat types.
[0159] As used herein, "fabric cleaning compositions" include hand
and machine laundry detergent compositions including laundry
additive compositions and compositions suitable for use in the
soaking and/or pretreatment of stained fabrics (e.g., clothes,
linens, and other textile materials).
[0160] As used herein, "non-fabric cleaning compositions" include
non-textile (i.e., fabric) surface cleaning compositions, including
but not limited to dishwashing detergent compositions, oral
cleaning compositions, denture cleaning compositions, and personal
cleansing compositions.
[0161] As used herein, the terms "detergent composition" and
"detergent formulation" are used in reference to mixtures which are
intended for use in a wash medium for the cleaning of soiled
objects. In preferred embodiments, the term is used in reference to
detergents used to clean dishes, cutlery, etc. (e.g., "dish
detergents" or "dishwashing detergents"). It is not intended that
the present invention be limited to any particular detergent
formulation or composition. Indeed, it is intended that in addition
to detergents that contain at least one protease of the present
invention, the term encompasses detergents that contain
surfactants, transferase(s), hydrolytic enzymes, oxido reductases,
builders, bleaching agents, bleach activators, bluing agents and
fluorescent dyes, caking inhibitors, masking agents, enzyme
activators, antioxidants, and solubilizers.
[0162] As used herein, "dishwashing composition" refers to all
forms of compositions for cleaning dishware, including cutlery,
including but not limited to granular and liquid forms. In some
embodiments, the dishwashing composition is an "automatic
dishwashing" composition that finds use in automatic dish washing
machines. It is not intended that the present invention be limited
to any particular type or dishware composition. Indeed, the present
invention finds use in cleaning dishware (e.g., dishes, including,
but not limited to plates, cups, glasses, bowls, etc.) and cutlery
(e.g., utensils, including but not limited to spoons, knives,
forks, serving utensils, etc.) of any material, including but not
limited to ceramics, plastics, metals, china, glass, acrylics, etc.
The term "dishware" is used herein in reference to both dishes and
cutlery.
[0163] As used herein, the term "bleaching" refers to the treatment
of a material (e.g., fabric, laundry, pulp, etc.) or surface for a
sufficient length of time and under appropriate pH and temperature
conditions to effect a brightening (i.e., whitening) and/or
cleaning of the material. Examples of chemicals suitable for
bleaching include but are not limited to ClO.sub.2, H.sub.2O.sub.2,
peracids, NO.sub.2, etc.
[0164] As used herein, "wash performance" of a variant protease
refers to the contribution of a variant protease to washing that
provides additional cleaning performance to the detergent without
the addition of the variant protease to the composition. Wash
performance is compared under relevant washing conditions.
[0165] The term "relevant washing conditions" is used herein to
indicate the conditions, particularly washing temperature, time,
washing mechanics, sud concentration, type of detergent and water
hardness, actually used in households in a dish or laundry
detergent market segment.
[0166] The term "improved wash performance" is used to indicate
that a better end result is obtained in stain removal under
relevant washing conditions, or that less variant protease, on
weight basis, is needed to obtain the same end result relative to
the corresponding wild-type or starting parent protease.
[0167] As used herein, the term "disinfecting" refers to the
removal of contaminants from the surfaces, as well as the
inhibition or killing of microbes on the surfaces of items. It is
not intended that the present invention be limited to any
particular surface, item, or contaminant(s) or microbes to be
removed.
[0168] The "compact" form of the cleaning compositions herein is
best reflected by density and, in terms of composition, by the
amount of inorganic filler salt. Inorganic filler salts are
conventional ingredients of detergent compositions in powder form.
In conventional detergent compositions, the filler salts are
present in substantial amounts, typically about 17 to about 35% by
weight of the total composition. In contrast, in compact
compositions, the filler salt is present in amounts not exceeding
about 15% of the total composition. In some embodiments, the filler
salt is present in amounts that do not exceed about 10%, or more
preferably, about 5%, by weight of the composition. In some
embodiments, the inorganic filler salts are selected from the
alkali and alkaline-earth-metal salts of sulfates and chlorides. In
some embodiments, a preferred filler salt is sodium sulfate.
Cleaning Compositions
[0169] Unless otherwise noted, all component or composition levels
provided herein are made in reference to the active level of that
component or composition, and are exclusive of impurities, for
example, residual solvents or by-products, which may be present in
commercially available sources. Enzyme components weights are based
on total active protein. All percentages and ratios are calculated
by weight unless otherwise indicated. All percentages and ratios
are calculated based on the total composition unless otherwise
indicated. In the exemplified detergent compositions, the enzymes
levels are expressed by pure enzyme by weight of the total
composition and unless otherwise specified, the detergent
ingredients are expressed by weight of the total compositions.
[0170] As indicated herein, in some embodiments, the cleaning
compositions of the present invention further comprise adjunct
materials including, but not limited to, surfactants, builders,
bleaches, bleach activators, bleach catalysts, other enzymes,
enzyme stabilizing systems, chelants, optical brighteners, soil
release polymers, dye transfer agents, dispersants, suds
suppressors, dyes, perfumes, colorants, filler salts, hydrotropes,
photoactivators, fluorescers, fabric conditioners, hydrolyzable
surfactants, preservatives, anti-oxidants, anti-shrinkage agents,
anti-wrinkle agents, germicides, fungicides, color speckles,
silvercare, anti-tarnish and/or anti-corrosion agents, alkalinity
sources, solubilizing agents, carriers, processing aids, pigments,
and pH control agents (See e.g., U.S. Pat. Nos. 6,610,642,
6,605,458, 5,705,464, 5,710,115, 5,698,504, 5,695,679, 5,686,014
and 5,646,101, all of which are incorporated herein by reference).
Embodiments of specific cleaning composition materials are
exemplified in detail below. In embodiments in which the cleaning
adjunct materials are not compatible with the variant proteases of
the present invention in the cleaning compositions, then suitable
methods of keeping the cleaning adjunct materials and the
protease(s) separated (i.e., not in contact with each other) until
combination of the two components is appropriate are used. Such
separation methods include any suitable method known in the art
(e.g., gelcaps, encapsulation, tablets, physical separation,
etc.).
[0171] The cleaning compositions of the present invention are
advantageously employed for example, in laundry applications, hard
surface cleaning, dishwashing applications, as well as cosmetic
applications such as dentures, teeth, hair and skin. In addition,
due to the unique advantages of increased effectiveness in lower
temperature solutions, the enzymes of the present invention are
ideally suited for laundry applications. Furthermore, the enzymes
of the present invention find use in granular and liquid
compositions.
[0172] The variant proteases of the present invention also find use
cleaning additive products. In some embodiments, low temperature
solution cleaning applications find use. In some embodiments, the
present invention provides cleaning additive products including at
least one enzyme of the present invention is ideally suited for
inclusion in a wash process when additional bleaching effectiveness
is desired. Such instances include, but are not limited to low
temperature solution cleaning applications. In some embodiments,
the additive product is in its simplest form, one or more
proteases. In some embodiments, the additive is packaged in dosage
form for addition to a cleaning process. In some embodiments, the
additive is packaged in dosage form for addition to a cleaning
process where a source of peroxygen is employed and increased
bleaching effectiveness is desired. Any suitable single dosage unit
form finds use with the present invention, including but not
limited to pills, tablets, gelcaps, or other single dosage units
such as pre-measured powders or liquids. In some embodiments,
filler(s) or carrier material(s) are included to increase the
volume of such compositions. Suitable filler or carrier materials
include, but are not limited to, various salts of sulfate,
carbonate and silicate as well as talc, clay and the like. Suitable
filler or carrier materials for liquid compositions include, but
are not limited to water or low molecular weight primary and
secondary alcohols including polyols and diols. Examples of such
alcohols include, but are not limited to, methanol, ethanol,
propanol and isopropanol. In some embodiments, the compositions
contain from about 5% to about 90% of such materials. Acidic
fillers find use to reduce pH. Alternatively, in some embodiments,
the cleaning additive includes adjunct ingredients, as more fully
described below.
[0173] The present cleaning compositions and cleaning additives
require an effective amount of at least one of the protease
variants provided herein, alone or in combination with other
proteases and/or additional enzymes. The required level of enzyme
is achieved by the addition of one or more protease variants of the
present invention. Typically the present cleaning compositions will
comprise at least about 0.0001 weight percent, from about 0.0001 to
about 10, from about 0.001 to about 1, or even from about 0.01 to
about 0.1 weight percent of at least one of the variant proteases
of the present invention.
[0174] The cleaning compositions herein are typically formulated
such that, during use in aqueous cleaning operations, the wash
water will have a pH of from about 5.0 to about 11.5 or even from
about 7.5 to about 10.5. Liquid product formulations are typically
formulated to have a neat pH from about 3.0 to about 9.0 or even
from about 3 to about 5. Granular laundry products are typically
formulated to have a pH from about 9 to about 11. Techniques for
controlling pH at recommended usage levels include the use of
buffers, alkalis, acids, etc., and are well known to those skilled
in the art.
[0175] Suitable low pH cleaning compositions typically have a neat
pH of from about 3 to about 5, and are typically free of
surfactants that hydrolyze in such a pH environment. Such
surfactants include sodium alkyl sulfate surfactants that comprise
at least one ethylene oxide moiety or even from about 1 to about 16
moles of ethylene oxide. Such cleaning compositions typically
comprise a sufficient amount of a pH modifier, such as sodium
hydroxide, monoethanolamine or hydrochloric acid, to provide such
cleaning composition with a neat pH of from about 3 to about 5.
Such compositions typically comprise at least one acid stable
enzyme. In some embodiments, the compositions are liquids, while in
other embodiments, they are solids. The pH of such liquid
compositions is typically measured as a neat pH. The pH of such
solid compositions is measured as a 10% solids solution of said
composition wherein the solvent is distilled water. In these
embodiments, all pH measurements are taken at 20.degree. C., unless
otherwise indicated.
[0176] In some embodiments, when the variant protease(s) is/are
employed in a granular composition or liquid, it is desirable for
the variant protease to be in the form of an encapsulated particle
to protect the variant protease from other components of the
granular composition during storage. In addition, encapsulation is
also a means of controlling the availability of the variant
protease during the cleaning process. In some embodiments,
encapsulation enhances the performance of the variant protease(s)
and/or additional enzymes. In this regard, the variant proteases of
the present invention are encapsulated with any suitable
encapsulating material known in the art. In some embodiments, the
encapsulating material typically encapsulates at least part of the
catalyst for the variant protease(s) of the present invention.
Typically, the encapsulating material is water-soluble and/or
water-dispersible. In some embodiments, the encapsulating material
has a glass transition temperature (Tg) of 0.degree. C. or higher.
Glass transition temperature is described in more detail in WO
97/11151. The encapsulating material is typically selected from
consisting of carbohydrates, natural or synthetic gums, chitin,
chitosan, cellulose and cellulose derivatives, silicates,
phosphates, borates, polyvinyl alcohol, polyethylene glycol,
paraffin waxes, and combinations thereof. When the encapsulating
material is a carbohydrate, it is typically selected from
monosaccharides, oligosaccharides, polysaccharides, and
combinations thereof. In some typical embodiments, the
encapsulating material is a starch (See e.g., EP 0 922 499; U.S.
Pat. No. 4,977,252; U.S. Pat. No. 5,354,559, and U.S. Pat. No.
5,935,826). In some embodiments, the encapsulating material is a
microsphere made from plastic such as thermoplastics,
acrylonitrile, methacrylonitrile, polyacrylonitrile,
polymethacrylonitrile and mixtures thereof; commercially available
microspheres that find use include, but are not limited to those
supplied by EXPANCEL.RTM. (Stockviksverken, Sweden), and PM 6545,
PM 6550, PM 7220, PM 7228, EXTENDOSPHERES.RTM., LUXSIL.RTM.,
Q-CEL.RTM., and SPHERICEL.RTM. (PQ Corp., Valley Forge, Pa.).
[0177] As described herein, the variant proteases of the present
invention find particular use in the cleaning industry, including,
but not limited to laundry and dish detergents. These applications
place enzymes under various environmental stresses. The variant
proteases of the present invention provide advantages over many
currently used enzymes, due to their stability under various
conditions.
[0178] Indeed, there are a variety of wash conditions including
varying detergent formulations, wash water volumes, wash water
temperatures, and lengths of wash time, to which proteases involved
in washing are exposed. In addition, detergent formulations used in
different geographical areas have different concentrations of their
relevant components present in the wash water. For example,
European detergents typically have about 4500-5000 ppm of detergent
components in the wash water, while Japanese detergents typically
have approximately 667 ppm of detergent components in the wash
water. In North America, particularly the United States, detergents
typically have about 975 ppm of detergent components present in the
wash water.
[0179] A low detergent concentration system includes detergents
where less than about 800 ppm of the detergent components are
present in the wash water. Japanese detergents are typically
considered low detergent concentration system as they have
approximately 667 ppm of detergent components present in the wash
water.
[0180] A medium detergent concentration includes detergents where
between about 800 ppm and about 2000 ppm of the detergent
components are present in the wash water. North American detergents
are generally considered to be medium detergent concentration
systems as they have approximately 975 ppm of detergent components
present in the wash water. Brazil typically has approximately 1500
ppm of detergent components present in the wash water.
[0181] A high detergent concentration system includes detergents
where greater than about 2000 ppm of the detergent components are
present in the wash water. European detergents are generally
considered to be high detergent concentration systems as they have
approximately 4500-5000 ppm of detergent components in the wash
water.
[0182] Latin American detergents are generally high suds phosphate
builder detergents and the range of detergents used in Latin
America can fall in both the medium and high detergent
concentrations as they range from 1500 ppm to 6000 ppm of detergent
components in the wash water. As mentioned above, Brazil typically
has approximately 1500 ppm of detergent components present in the
wash water. However, other high suds phosphate builder detergent
geographies, not limited to other Latin American countries, may
have high detergent concentration systems up to about 6000 ppm of
detergent components present in the wash water.
[0183] In light of the foregoing, it is evident that concentrations
of detergent compositions in typical wash solutions throughout the
world varies from less than about 800 ppm of detergent composition
("low detergent concentration geographies"), for example about 667
ppm in Japan, to between about 800 ppm to about 2000 ppm ("medium
detergent concentration geographies"), for example about 975 ppm in
U.S. and about 1500 ppm in Brazil, to greater than about 2000 ppm
("high detergent concentration geographies"), for example about
4500 ppm to about 5000 ppm in Europe and about 6000 ppm in high
suds phosphate builder geographies.
[0184] The concentrations of the typical wash solutions are
determined empirically. For example, in the U.S., a typical washing
machine holds a volume of about 64.4 L of wash solution.
Accordingly, in order to obtain a concentration of about 975 ppm of
detergent within the wash solution about 62.79 g of detergent
composition must be added to the 64.4 L of wash solution. This
amount is the typical amount measured into the wash water by the
consumer using the measuring cup provided with the detergent.
[0185] As a further example, different geographies use different
wash temperatures. The temperature of the wash water in Japan is
typically less than that used in Europe. For example, the
temperature of the wash water in North America and Japan is
typically between about 10 and about 30.degree. C. (e.g., about
20.degree. C.), whereas the temperature of wash water in Europe is
typically between about 30 and about 60.degree. C. (e.g., about
40.degree. C.). However, in the interest of saving energy, many
consumers are switching to using cold water washing. In addition,
in some further regions, cold water is typically used for laundry,
as well as dish washing applications. In some embodiments, the
"cold water washing" of the present invention utilizes washing at
temperatures from about 10.degree. C. to about 40.degree. C., or
from about 20.degree. C. to about 30.degree. C., or from about
15.degree. C. to about 25.degree. C., as well as all other
combinations within the range of about 15.degree. C. to about
35.degree. C., and all ranges within 10.degree. C. to 40.degree.
C.
[0186] As a further example, different geographies typically have
different water hardness. Water hardness is usually described in
terms of the grains per gallon mixed Ca.sup.2+/Mg.sup.2+. Hardness
is a measure of the amount of calcium (Ca.sup.2+) and magnesium
(Mg.sup.2+) in the water. Most water in the United States is hard,
but the degree of hardness varies. Moderately hard (60-120 ppm) to
hard (121-181 ppm) water has 60 to 181 parts per million (parts per
million converted to grains per U.S. gallon is ppm # divided by
17.1 equals grains per gallon) of hardness minerals.
TABLE-US-00001 Water Grains per gallon Parts per million Soft less
than 1.0 less than 17 Slightly hard 1.0 to 3.5 17 to 60 Moderately
hard 3.5 to 7.0 60 to 120 Hard 7.0 to 10.5 120 to 180 Very hard
greater than 10.5 greater than 180
[0187] European water hardness is typically greater than about 10.5
(for example about 10.5 to about 20.0) grains per gallon mixed
Ca.sup.2+/Mg.sup.2+ (e.g., about 15 grains per gallon mixed
Ca.sup.2+/Mg.sup.2+). North American water hardness is typically
greater than Japanese water hardness, but less than European water
hardness. For example, North American water hardness can be between
about 3 to about 10 grains, about 3 to about 8 grains or about 6
grains. Japanese water hardness is typically lower than North
American water hardness, usually less than about 4, for example
about 3 grains per gallon mixed Ca.sup.2+/Mg.sup.2+.
[0188] Accordingly, in some embodiments, the present invention
provides variant proteases that show surprising wash performance in
at least one set of wash conditions (e.g., water temperature, water
hardness, and/or detergent concentration). In some embodiments, the
variant proteases of the present invention are comparable in wash
performance to other subtilisin proteases. In some embodiments, the
variant proteases of the present invention exhibit enhanced wash
performance as compared to subtilisin proteases currently
commercially available. Thus, in some preferred embodiments of the
present invention, the variant proteases provided herein exhibit
enhanced oxidative stability, enhanced thermal stability, enhanced
cleaning capabilities under various conditions, and/or enhanced
chelator stability. In addition, the variant proteases of the
present invention find use in cleaning compositions that do not
include detergents, again either alone or in combination with
builders and stabilizers.
[0189] In some embodiments of the present invention, the cleaning
compositions comprise at least one variant protease of the present
invention at a level from about 0.00001% to about 10% by weight of
the composition and the balance (e.g., about 99.999% to about
90.0%) comprising cleaning adjunct materials by weight of
composition. In other aspects of the present invention, the
cleaning compositions of the present invention comprises at least
one variant protease at a level of about 0.0001% to about 10%,
about 0.001% to about 5%, about 0.001% to about 2%, about 0.005% to
about 0.5% by weight of the composition and the balance of the
cleaning composition (e.g., about 99.9999% to about 90.0%, about
99.999% to about 98%, about 99.995% to about 99.5% by weight)
comprising cleaning adjunct materials.
[0190] In some embodiments, the cleaning compositions of the
present invention comprise one or more additional detergent
enzymes, which provide cleaning performance and/or fabric care
and/or dishwashing benefits. Examples of suitable enzymes include,
but are not limited to, hemicellulases, cellulases, peroxidases,
proteases, xylanases, lipases, phospholipases, esterases,
cutinases, pectinases, pectate lyases, mannanases, keratinases,
reductases, oxidases, phenoloxidases, lipoxygenases, ligninases,
pullulanases, tannases, pentosanases, malanases, .beta.-glucanases,
arabinosidases, hyaluronidase, chondroitinase, laccase, and
amylases, or mixtures thereof. In some embodiments, a combination
of enzymes is used (i.e., a "cocktail") comprising conventional
applicable enzymes like protease, lipase, cutinase and/or cellulase
in conjunction with amylase is used.
[0191] In addition to the protease variants provided herein, any
other suitable protease finds use in the compositions of the
present invention. Suitable proteases include those of animal,
vegetable or microbial origin. In some particularly preferred
embodiments, microbial proteases are used. In some embodiments,
chemically or genetically modified mutants are included. In some
embodiments, the protease is a serine protease, preferably an
alkaline microbial protease or a trypsin-like protease. Examples of
alkaline proteases include subtilisins, especially those derived
from Bacillus (e.g., subtilisin, lentus, amyloliquefaciens,
subtilisin Carlsberg, subtilisin 309, subtilisin 147 and subtilisin
168). Additional examples include those mutant proteases (i.e.,
variant proteases) described in U.S. Pat. Nos. RE 34,606,
5,955,340, 5,700,676, 6,312,936, and 6,482,628, all of which are
incorporated herein by reference. Additional protease examples
include, but are not limited to trypsin (e.g., of porcine or bovine
origin), and the Fusarium protease described in WO 89/06270. In
some embodiments, commercially available protease enzymes that find
use in the present invention include, but are not limited to
MAXATASE.RTM., MAXACAL.TM., MAXAPEM.TM., OPTICLEAN.RTM.,
OPTIMASE.RTM., PROPERASE.RTM., PURAFECT.RTM., PURAFECT.RTM. OXP,
PURAMAX.TM., EXCELLASE.TM., and PURAFAST.TM. (Genencor);
ALCALASE.RTM., SAVINASE.RTM., PRIMASEO, DURAZYM.TM.,
POLARZYME.RTM., OVOZYME.RTM., KANNASE.RTM., LIQUANASE.RTM.,
NEUTRASE.RTM., RELASE.RTM. and ESPERASE.RTM. (Novozymes); and
BLAP.TM. (Henkel Kommanditgesellschaft auf Aktien, Duesseldorf,
Germany. Various proteases are described in WO95/23221, WO
92/21760, U.S. Pat. Publ. No. 2008/0090747, and U.S. Pat. Nos.
5,801,039, 5,340,735, 5,500,364, 5,855,625, RE 34,606, 5,955,340,
5,700,676, 6,312,936, and 6,482,628, and various other patents. In
some further embodiments, metalloproteases find use in the present
invention, including but not limited to the neutral metalloprotease
described in WO 07/044,993.
[0192] In addition, any suitable lipase finds use in the present
invention. Suitable lipases include, but are not limited to those
of bacterial or fungal origin. Chemically or genetically modified
mutants are encompassed by the present invention. Examples of
useful lipases include Humicola lanuginosa lipase (See e.g., EP 258
068, and EP 305 216), Rhizomucor miehei lipase (See e.g., EP 238
023), Candida lipase, such as C. antarctica lipase (e.g., the C.
antarctica lipase A or B; See e.g., EP 214 761), Pseudomonas
lipases such as P. alcaligenes lipase and P. pseudoalcaligenes
lipase (See e.g., EP 218 272), P. cepacia lipase (See e.g., EP 331
376), P. stutzeri lipase (See e.g., GB 1,372,034), P. fluorescens
lipase, Bacillus lipase (e.g., B. subtilis lipase [Dartois et al.,
Biochem. Biophys. Acta 1131:253-260 [1993]); B. stearothermophilus
lipase [See e.g., JP 64/744992]; and B. pumilus lipase [See e.g.,
WO 91/16422]).
[0193] Furthermore, a number of cloned lipases find use in some
embodiments of the present invention, including but not limited to
Penicillium camembertii lipase (See, Yamaguchi et al., Gene
103:61-67 [1991]), Geotricum candidum lipase (See, Schimada et al.,
J. Biochem., 106:383-388 [1989]), and various Rhizopus lipases such
as R. delemar lipase (See, Hass et al., Gene 109:117-113 [1991]), a
R. niveus lipase (Kugimiya et al., Biosci. Biotech. Biochem.
56:716-719 [1992]) and R. oryzae lipase.
[0194] Other types of lipolytic enzymes such as cutinases also find
use in some embodiments of the present invention, including but not
limited to the cutinase derived from Pseudomonas mendocina (See, WO
88/09367), and the cutinase derived from Fusarium solani pisi (See,
WO 90/09446).
[0195] Additional suitable lipases include commercially available
lipases such as Ml LIPASE.TM., LUMA FAST.TM., and LIPOMAX.TM.
(Genencor); LIPOLASE.RTM. and LIPOLASE.RTM. ULTRA (Novozymes); and
LIPASE P.TM. "Amano" (Amano Pharmaceutical Co. Ltd., Japan).
[0196] In some embodiments of the present invention, the cleaning
compositions of the present invention further comprise lipases at a
level from about 0.00001% to about 10% of additional lipase by
weight of the composition and the balance of cleaning adjunct
materials by weight of composition. In other aspects of the present
invention, the cleaning compositions of the present invention also
comprise lipases at a level of about 0.0001% to about 10%, about
0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about
0.5% lipase by weight of the composition.
[0197] In some embodiments of the present invention, any suitable
amylase finds use in the present invention. In some embodiments,
any amylase (e.g., alpha and/or beta) suitable for use in alkaline
solutions also find use. Suitable amylases include, but are not
limited to those of bacterial or fungal origin. Chemically or
genetically modified mutants are included in some embodiments.
Amylases that find use in the present invention, include, but are
not limited to .alpha.-amylases obtained from B. licheniformis (See
e.g., GB 1,296,839). Commercially available amylases that find use
in the present invention include, but are not limited to
DURAMYL.RTM., TERMAMYL.RTM., FUNGAMYL.RTM., STAINZYME.RTM.,
STAINZYME PLUS.RTM., STAINZYME ULTRA.RTM., and BAN.TM. (Novozymes),
as well as POWERASE.TM., RAPIDASE.RTM. and MAXAMYL.RTM. P
(Genencor).
[0198] In some embodiments of the present invention, the cleaning
compositions of the present invention further comprise amylases at
a level from about 0.00001% to about 10% of additional amylase by
weight of the composition and the balance of cleaning adjunct
materials by weight of composition. In other aspects of the present
invention, the cleaning compositions of the present invention also
comprise amylases at a level of about 0.0001% to about 10%, about
0.001% to about 5%, about 0.001% to about 2%, about 0.005% to about
0.5% amylase by weight of the composition.
[0199] In some further embodiments, any suitable cellulase finds
used in the cleaning compositions of the present invention.
Suitable cellulases include, but are not limited to those of
bacterial or fungal origin. Chemically or genetically modified
mutants are included in some embodiments. Suitable cellulases
include, but are not limited to Humicola insolens cellulases (See
e.g., U.S. Pat. No. 4,435,307). Especially suitable cellulases are
the cellulases having color care benefits (See e.g., EP 0 495 257).
Commercially available cellulases that find use in the present
include, but are not limited to CELLUZYME.RTM., CAREZYME.RTM.
(Novozymes), and KAC-500(B).TM. (Kao Corporation). In some
embodiments, cellulases are incorporated as portions or fragments
of mature wild-type or variant cellulases, wherein a portion of the
N-terminus is deleted (See e.g., U.S. Pat. No. 5,874,276). In some
embodiments, the cleaning compositions of the present invention
further comprise cellulases at a level from about 0.00001% to about
10% of additional cellulase by weight of the composition and the
balance of cleaning adjunct materials by weight of composition. In
other aspects of the present invention, the cleaning compositions
of the present invention also comprise cellulases at a level of
about 0.0001% to about 10%, about 0.001% to about 5%, about 0.001%
to about 2%, about 0.005% to about 0.5% cellulase by weight of the
composition.
[0200] Any mannanase suitable for use in detergent compositions
also finds use in the present invention. Suitable mannanases
include, but are not limited to those of bacterial or fungal
origin. Chemically or genetically modified mutants are included in
some embodiments. Various mannanases are known which find use in
the present invention (See e.g., U.S. Pat. No. 6,566,114, U.S. Pat.
No. 6,602,842, and U.S. Pat. No. 6,440,991, all of which are
incorporated herein by reference). In some embodiments, the
cleaning compositions of the present invention further comprise
mannanases at a level from about 0.00001% to about 10% of
additional mannanase by weight of the composition and the balance
of cleaning adjunct materials by weight of composition. In other
aspects of the present invention, the cleaning compositions of the
present invention also comprise mannanases at a level of about
0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to
about 2%, about 0.005% to about 0.5% mannanase by weight of the
composition.
[0201] In some embodiments, peroxidases are used in combination
with hydrogen peroxide or a source thereof (e.g., a percarbonate,
perborate or persulfate) in the compositions of the present
invention. In some alternative embodiments, oxidases are used in
combination with oxygen. Both types of enzymes are used for
"solution bleaching" (i.e., to prevent transfer of a textile dye
from a dyed fabric to another fabric when the fabrics are washed
together in a wash liquor), preferably together with an enhancing
agent (See e.g., WO 94/12621 and WO 95/01426). Suitable
peroxidases/oxidases include, but are not limited to those of
plant, bacterial or fungal origin. Chemically or genetically
modified mutants are included in some embodiments. In some
embodiments, the cleaning compositions of the present invention
further comprise peroxidase and/or oxidase enzymes at a level from
about 0.00001% to about 10% of additional peroxidase and/or oxidase
by weight of the composition and the balance of cleaning adjunct
materials by weight of composition. In other aspects of the present
invention, the cleaning compositions of the present invention also
comprise, peroxidase and/or oxidase enzymes at a level of about
0.0001% to about 10%, about 0.001% to about 5%, about 0.001% to
about 2%, about 0.005% to about 0.5% peroxidase and/or oxidase
enzymes by weight of the composition.
[0202] In some embodiments, additional enzymes find use, including
but not limited to perhydrolases (See e.g., WO 05/056782). In
addition, in some particularly preferred embodiments, mixtures of
the above mentioned enzymes are encompassed herein, in particular
one or more additional protease, amylase, lipase, mannanase, and/or
at least one cellulase. Indeed, it is contemplated that various
mixtures of these enzymes will find use in the present invention.
It is also contemplated that the varying levels of the variant
protease(s) and one or more additional enzymes may both
independently range to about 10%, the balance of the cleaning
composition being cleaning adjunct materials. The specific
selection of cleaning adjunct materials are readily made by
considering the surface, item, or fabric to be cleaned, and the
desired form of the composition for the cleaning conditions during
use (e.g., through the wash detergent use).
[0203] Examples of suitable cleaning adjunct materials include, but
are not limited to, surfactants, builders, bleaches, bleach
activators, bleach catalysts, other enzymes, enzyme stabilizing
systems, chelants, optical brighteners, soil release polymers, dye
transfer agents, dye transfer inhibiting agents, catalytic
materials, hydrogen peroxide, sources of hydrogen peroxide,
preformed peracis, polymeric dispersing agents, clay soil removal
agents, structure elasticizing agents, dispersants, suds
suppressors, dyes, perfumes, colorants, filler salts, hydrotropes,
photoactivators, fluorescers, fabric conditioners, fabric
softeners, carriers, hydrotropes, processing aids, solvents,
pigments, hydrolyzable surfactants, preservatives, anti-oxidants,
anti-shrinkage agents, anti-wrinkle agents, germicides, fungicides,
color speckles, silvercare, anti-tarnish and/or anti-corrosion
agents, alkalinity sources, solubilizing agents, carriers,
processing aids, pigments, and pH control agents (See e.g., U.S.
Pat. Nos. 6,610,642, 6,605,458, 5,705,464, 5,710,115, 5,698,504,
5,695,679, 5,686,014 and 5,646,101, all of which are incorporated
herein by reference). Embodiments of specific cleaning composition
materials are exemplified in detail below. In embodiments in which
the cleaning adjunct materials are not compatible with the variant
proteases of the present invention in the cleaning compositions,
then suitable methods of keeping the cleaning adjunct materials and
the protease(s) separated (i.e., not in contact with each other)
until combination of the two components is appropriate are used.
Such separation methods include any suitable method known in the
art (e.g., gelcaps, encapsulation, tablets, physical separation,
etc.).
[0204] In some preferred embodiments, an effective amount of one or
more variant protease(s) provided herein are included in
compositions useful for cleaning a variety of surfaces in need of
proteinaceous stain removal. Such cleaning compositions include
cleaning compositions for such applications as cleaning hard
surfaces, fabrics, and dishes. Indeed, in some embodiments, the
present invention provides fabric cleaning compositions, while in
other embodiments, the present invention provides non-fabric
cleaning compositions. Notably, the present invention also provides
cleaning compositions suitable for personal care, including oral
care (including dentrifices, toothpastes, mouthwashes, etc., as
well as denture cleaning compositions), skin, and hair cleaning
compositions. It is intended that the present invention encompass
detergent compositions in any form (i.e., liquid, granular, bar,
semi-solid, gels, emulsions, tablets, capsules, etc.).
[0205] By way of example, several cleaning compositions wherein the
variant proteases of the present invention find use are described
in greater detail below. In some embodiments in which the cleaning
compositions of the present invention are formulated as
compositions suitable for use in laundry machine washing method(s),
the compositions of the present invention preferably contain at
least one surfactant and at least one builder compound, as well as
one or more cleaning adjunct materials preferably selected from
organic polymeric compounds, bleaching agents, additional enzymes,
suds suppressors, dispersants, lime-soap dispersants, soil
suspension and anti-redeposition agents and corrosion inhibitors.
In some embodiments, laundry compositions also contain softening
agents (i.e., as additional cleaning adjunct materials). The
compositions of the present invention also find use detergent
additive products in solid or liquid form. Such additive products
are intended to supplement and/or boost the performance of
conventional detergent compositions and can be added at any stage
of the cleaning process. In some embodiments, the density of the
laundry detergent compositions herein ranges from about 400 to
about 1200 g/liter, while in other embodiments, it ranges from
about 500 to about 950 g/liter of composition measured at
20.degree. C.
[0206] In embodiments formulated as compositions for use in manual
dishwashing methods, the compositions of the invention preferably
contain at least one surfactant and preferably at least one
additional cleaning adjunct material selected from organic
polymeric compounds, suds enhancing agents, group II metal ions,
solvents, hydrotropes and additional enzymes.
[0207] In some embodiments, various cleaning compositions such as
those provided in U.S. Pat. No. 6,605,458, find use with the
variant proteases of the present invention. Thus, in some
embodiments, the compositions comprising at least one variant
protease of the present invention is a compact granular fabric
cleaning composition, while in other embodiments, the composition
is a granular fabric cleaning composition useful in the laundering
of colored fabrics, in further embodiments, the composition is a
granular fabric cleaning composition which provides softening
through the wash capacity, in additional embodiments, the
composition is a heavy duty liquid fabric cleaning composition. In
some embodiments, the compositions comprising at least one variant
protease of the present invention are fabric cleaning compositions
such as those described in U.S. Pat. Nos. 6,610,642 and 6,376,450.
In addition, the variant proteases of the present invention find
use in granular laundry detergent compositions of particular
utility under European or Japanese washing conditions (See e.g.,
U.S. Pat. No. 6,610,642).
[0208] In some alternative embodiments, the present invention
provides hard surface cleaning compositions comprising at least one
variant protease provided herein. Thus, in some embodiments, the
compositions comprising at least one variant protease of the
present invention is a hard surface cleaning composition such as
those described in U.S. Pat. Nos. 6,610,642, 6,376,450, and
6,376,450.
[0209] In yet further embodiments, the present invention provides
dishwashing compositions comprising at least one variant protease
provided herein. Thus, in some embodiments, the compositions
comprising at least one variant protease of the present invention
is a hard surface cleaning composition such as those in U.S. Pat.
Nos. 6,610,642 and 6,376,450. In some still further embodiments,
the present invention provides dishwashing compositions comprising
at least one variant protease provided herein. In some further
embodiments, the compositions comprising at least one variant
protease of the present invention comprise oral care compositions
such as those in U.S. Pat. Nos. 6,376,450, and 6,376,450. The
formulations and descriptions of the compounds and cleaning adjunct
materials contained in the aforementioned U.S. Pat. Nos. 6,376,450,
6,605,458, 6,605,458, and 6,610,642, find use with the variant
proteases provided herein.
[0210] The cleaning compositions of the present invention are
formulated into any suitable form and prepared by any process
chosen by the formulator, non-limiting examples of which are
described in U.S. Pat. Nos. 5,879,584, 5,691,297, 5,574,005,
5,569,645, 5,565,422, 5,516,448, 5,489,392, and 5,486,303, all of
which are incorporated herein by reference. When a low pH cleaning
composition is desired, the pH of such composition is adjusted via
the addition of a material such as monoethanolamine or an acidic
material such as HCl.
[0211] While not essential for the purposes of the present
invention, the non-limiting list of adjuncts illustrated
hereinafter are suitable for use in the instant cleaning
compositions. In some embodiments, these adjuncts are incorporated
for example, to assist or enhance cleaning performance, for
treatment of the substrate to be cleaned, or to modify the
aesthetics of the cleaning composition as is the case with
perfumes, colorants, dyes or the like. It is understood that such
adjuncts are in addition to the variant proteases of the present
invention. The precise nature of these additional components, and
levels of incorporation thereof, will depend on the physical form
of the composition and the nature of the cleaning operation for
which it is to be used. Suitable adjunct materials include, but are
not limited to, surfactants, builders, chelating agents, dye
transfer inhibiting agents, deposition aids, dispersants,
additional enzymes, and enzyme stabilizers, catalytic materials,
bleach activators, bleach boosters, hydrogen peroxide, sources of
hydrogen peroxide, preformed peracids, polymeric dispersing agents,
clay soil removal/anti-redeposition agents, brighteners, suds
suppressors, dyes, perfumes, structure elasticizing agents, fabric
softeners, carriers, hydrotropes, processing aids and/or pigments.
In addition to the disclosure below, suitable examples of such
other adjuncts and levels of use are found in U.S. Pat. Nos.
5,576,282, 6,306,812, and 6,326,348, incorporated by reference. The
aforementioned adjunct ingredients may constitute the balance of
the cleaning compositions of the present invention.
[0212] In some embodiments, the cleaning compositions according to
the present invention comprise at least one surfactant and/or a
surfactant system wherein the surfactant is selected from nonionic
surfactants, anionic surfactants, cationic surfactants, ampholytic
surfactants, zwitterionic surfactants, semi-polar nonionic
surfactants and mixtures thereof. In some low pH cleaning
composition embodiments (e.g., compositions having a neat pH of
from about 3 to about 5), the composition typically does not
contain alkyl ethoxylated sulfate, as it is believed that such
surfactant may be hydrolyzed by such compositions the acidic
contents. In some embodiments, the surfactant is present at a level
of from about 0.1% to about 60%, while in alternative embodiments
the level is from about 1% to about 50%, while in still further
embodiments the level is from about 5% to about 40%, by weight of
the cleaning composition.
[0213] In some embodiments, the cleaning compositions of the
present invention comprise one or more detergent builders or
builder systems. In some embodiments incorporating at least one
builder, the cleaning compositions comprise at least about 1%, from
about 3% to about 60% or even from about 5% to about 40% builder by
weight of the cleaning composition. Builders include, but are not
limited to, the alkali metal, ammonium and alkanolammonium salts of
polyphosphates, alkali metal silicates, alkaline earth and alkali
metal carbonates, aluminosilicates, polycarboxylate compounds,
ether hydroxypolycarboxylates, copolymers of maleic anhydride with
ethylene or vinyl methyl ether, 1,3,5-trihydroxy
benzene-2,4,6-trisulphonic acid, and carboxymethyloxysuccinic acid,
the various alkali metal, ammonium and substituted ammonium salts
of polyacetic acids such as ethylenediamine tetraacetic acid and
nitrilotriacetic acid, as well as polycarboxylates such as mellitic
acid, succinic acid, citric acid, oxydisuccinic acid, polymaleic
acid, benzene 1,3,5-tricarboxylic acid, carboxymethyloxysuccinic
acid, and soluble salts thereof. Indeed, it is contemplated that
any suitable builder will find use in various embodiments of the
present invention.
[0214] In some embodiments, the builders form water-soluble
hardness ion complexes (e.g., sequestering builders), such as
citrates and polyphosphates (e.g., sodium tripolyphosphate and
sodium tripolyphospate hexahydrate, potassium tripolyphosphate, and
mixed sodium and potassium tripolyphosphate, etc.). It is
contemplated that any suitable builder will find use in the present
invention, including those known in the art (See e.g., EP 2 100
949).
[0215] In some embodiments, the cleaning compositions of the
present invention contain at least one chelating agent. Suitable
chelating agents include, but are not limited to copper, iron
and/or manganese chelating agents and mixtures thereof. In
embodiments in which at least one chelating agent is used, the
cleaning compositions of the present invention comprise from about
0.1% to about 15% or even from about 3.0% to about 10% chelating
agent by weight of the subject cleaning composition.
[0216] In some still further embodiments, the cleaning compositions
provided herein contain at least one deposition aid. Suitable
deposition aids include, but are not limited to, polyethylene
glycol, polypropylene glycol, polycarboxylate, soil release
polymers such as polytelephthalic acid, clays such as kaolinite,
montmorillonite, atapulgite, illite, bentonite, halloysite, and
mixtures thereof.
[0217] As indicated herein, in some embodiments, anti-redeposition
agents find use in some embodiments of the present invention. In
some preferred embodiments, non-ionic surfactants find use. For
example, in automatic dishwashing embodiments, non-ionic
surfactants find use for surface modification purposes, in
particular for sheeting, to avoid filming and spotting and to
improve shine. These non-ionic surfactants also find use in
preventing the re-deposition of soils. In some preferred
embodiments, the anti-redeposition agent is a non-ionic surfactant
as known in the art (See e.g., EP 2 100 949).
[0218] In some embodiments, the cleaning compositions of the
present invention include one or more dye transfer inhibiting
agents. Suitable polymeric dye transfer inhibiting agents include,
but are not limited to, polyvinylpyrrolidone polymers, polyamine
N-oxide polymers, copolymers of N-vinylpyrrolidone and
N-vinylimidazole, polyvinyloxazolidones and polyvinylimidazoles or
mixtures thereof. In embodiments in which at least one dye transfer
inhibiting agent is used, the cleaning compositions of the present
invention comprise from about 0.0001% to about 10%, from about
0.01% to about 5%, or even from about 0.1% to about 3% by weight of
the cleaning composition.
[0219] In some embodiments, silicates are included within the
compositions of the present invention. In some such embodiments,
sodium silicates (e.g., sodium disilicate, sodium metasilicate, and
crystalline phyllosilicates) find use. In some embodiments,
silicates are present at a level of from about 1% to about 20%. In
some preferred embodiments, silicates are present at a level of
from about 5% to about 15% by weight of the composition.
[0220] In some still additional embodiments, the cleaning
compositions of the present invention also contain dispersants.
Suitable water-soluble organic materials include, but are not
limited to the homo- or co-polymeric acids or their salts, in which
the polycarboxylic acid comprises at least two carboxyl radicals
separated from each other by not more than two carbon atoms.
[0221] In some further embodiments, the enzymes used in the
cleaning compositions are stabilized any suitable technique. In
some embodiments, the enzymes employed herein are stabilized by the
presence of water-soluble sources of calcium and/or magnesium ions
in the finished compositions that provide such ions to the enzymes.
In some embodiments, the enzyme stabilizers include
oligosaccharides, polysaccharides, and inorganic divalent metal
salts, including alkaline earth metals, such as calcium salts. It
is contemplated that various techniques for enzyme stabilization
will find use in the present invention. For example, in some
embodiments, the enzymes employed herein are stabilized by the
presence of water-soluble sources of zinc (II), calcium (II) and/or
magnesium (II) ions in the finished compositions that provide such
ions to the enzymes, as well as other metal ions (e.g., barium
(II), scandium (II), iron (II), manganese (II), aluminum (III), Tin
(II), cobalt (II), copper (II), nickel (II), and oxovanadium (IV).
Chlorides and sulfates also find use in some embodiments of the
present invention. Examples of suitable oligosaccharides and
polysaccharides (e.g., dextrins) are known in the art (See e.g., WO
07/145,964). In some embodiments, reversible protease inhibitors
also find use, such as boron-containing compounds (e.g., borate,
4-formyl phenyl boronic acid) and/or a tripeptide aldehyde find use
to further improve stability, as desired.
[0222] In some embodiments, bleaches, bleach activators and/or
bleach catalysts are present in the compositions of the present
invention. In some embodiments, the cleaning compositions of the
present invention comprise inorganic and/or organic bleaching
compound(s). Inorganic bleaches include, but are not limited to
perhydrate salts (e.g., perborate, percarbonate, perphosphate,
persulfate, and persilicate salts). In some embodiments, inorganic
perhydrate salts are alkali metal salts. In some embodiments,
inorganic perhydrate salts are included as the crystalline solid,
without additional protection, although in some other embodiments,
the salt is coated. Any suitable salt known in the art finds use in
the present invention (See e.g., EP 2 100 949).
[0223] In some embodiments, bleach activators are used in the
compositions of the present invention. Bleach activators are
typically organic peracid precursors that enhance the bleaching
action in the course of cleaning at temperatures of 60.degree. C.
and below. Bleach activators suitable for use herein include
compounds which, under perhydrolysis conditions, give aliphaic
peroxoycarboxylic acids having preferably from about 1 to about 10
carbon atoms, in particular from about 2 to about 4 carbon atoms,
and/or optionally substituted perbenzoic acid. Additional bleach
activators are known in the art and find use in the present
invention (See e.g., EP 2 100 949).
[0224] In addition, in some embodiments and as further described
herein, the cleaning compositions of the present invention further
comprise at least one bleach catalyst. In some embodiments, the
manganese triazacyclononane and related complexes find use, as well
as cobalt, copper, manganese, and iron complexes. Additional bleach
catalysts find use in the present invention (See e.g., U.S. Pat.
Nos. 4,246,612, 5,227,084, 4,810,410, WO 99/06521, and EP 2 100
949).
[0225] In some embodiments, the cleaning compositions of the
present invention contain one or more catalytic metal complexes. In
some embodiments, a metal-containing bleach catalyst finds use. In
some preferred embodiments, the metal bleach catalyst comprises a
catalyst system comprising a transition metal cation of defined
bleach catalytic activity, (e.g., copper, iron, titanium,
ruthenium, tungsten, molybdenum, or manganese cations), an
auxiliary metal cation having little or no bleach catalytic
activity (e.g., zinc or aluminum cations), and a sequestrate having
defined stability constants for the catalytic and auxiliary metal
cations, particularly ethylenediaminetetraacetic acid,
ethylenediaminetetra (methylenephosphonic acid) and water-soluble
salts thereof are used (See e.g., U.S. Pat. No. 4,430,243). In some
embodiments, the cleaning compositions of the present invention are
catalyzed by means of a manganese compound. Such compounds and
levels of use are well known in the art (See e.g., U.S. Pat. No.
5,576,282). In additional embodiments, cobalt bleach catalysts find
use in the cleaning compositions of the present invention. Various
cobalt bleach catalysts are known in the art (See e.g., U.S. Pat.
Nos. 5,597,936 and 5,595,967) and are readily prepared by known
procedures.
[0226] In some additional embodiments, the cleaning compositions of
the present invention include a transition metal complex of a
macropolycyclic rigid ligand (MRL). As a practical matter, and not
by way of limitation, in some embodiments, the compositions and
cleaning processes provided by the present invention are adjusted
to provide on the order of at least one part per hundred million of
the active MRL species in the aqueous washing medium, and in some
preferred embodiments, provide from about 0.005 ppm to about 25
ppm, more preferably from about 0.05 ppm to about 10 ppm, and most
preferably from about 0.1 ppm to about 5 ppm, of the MRL in the
wash liquor.
[0227] In some embodiments, preferred transition-metals in the
instant transition-metal bleach catalyst include, but are not
limited to manganese, iron and chromium. Preferred MRLs also
include, but are not limited to special ultra-rigid ligands that
are cross-bridged (e.g.,
5,12-diethyl-1,5,8,12-tetraazabicyclo[6.6.2]hexadecane). Suitable
transition metal MRLs are readily prepared by known procedures (See
e.g., WO 2000/32601, and U.S. Pat. No. 6,225,464).
[0228] In some embodiments, the cleaning compositions of the
present invention comprise metal care agents. Metal care agents
find use in preventing and/or reducing the tarnishing, corrosion,
and/or oxidation of metals, including aluminum, stainless steel,
and non-ferrous metals (e.g., silver and copper). Suitable metal
care agents include those described in EP 2 100 949, WO 9426860 and
WO 94/26859). In some embodiments, the metal care agent is a zinc
salt. In some further embodiments, the cleaning compositions of the
present invention comprise from about 0.1% to about 5% by weight of
one or more metal care agent.
[0229] As indicated above, the cleaning compositions of the present
invention are formulated into any suitable form and prepared by any
process chosen by the formulator, non-limiting examples of which
are described in U.S. Pat. Nos. 5,879,584, 5,691,297, 5,574,005,
5,569,645, 5,516,448, 5,489,392, and 5,486,303, all of which are
incorporated herein by reference. In some embodiments in which a
low pH cleaning composition is desired, the pH of such composition
is adjusted via the addition of an acidic material such as HCl.
[0230] The cleaning compositions disclosed herein of find use in
cleaning a situs (e.g., a surface, dishware, or fabric). Typically,
at least a portion of the situs is contacted with an embodiment of
the present cleaning composition, in neat form or diluted in a wash
liquor, and then the situs is optionally washed and/or rinsed. For
purposes of the present invention, "washing" includes but is not
limited to, scrubbing, and mechanical agitation. In some
embodiments, the cleaning compositions are typically employed at
concentrations of from about 500 ppm to about 15,000 ppm in
solution. When the wash solvent is water, the water temperature
typically ranges from about 5.degree. C. to about 90.degree. C.
and, when the situs comprises a fabric, the water to fabric mass
ratio is typically from about 1:1 to about 30:1.
EXPERIMENTAL
[0231] The present invention is described in further detail in the
following examples which are not in any way intended to limit the
scope of the invention as claimed.
[0232] In the experimental disclosure which follows, the following
abbreviations apply: PI (proteinase inhibitor), ppm (parts per
million); M (molar); mM (millimolar); .mu.M (micromolar); nM
(nanomolar); mol (moles); mmol (millimoles); .mu.mol (micromoles);
nmol (nanomoles); gm (grams); mg (milligrams); .mu.g (micrograms);
pg (picograms); L (liters); ml and mL (milliliters); .mu.l and
.mu.L, (microliters); cm (centimeters); mm (millimeters); .mu.m
(micrometers); nm (nanometers); U (units); V (volts); MW (molecular
weight); sec (seconds); min(s) (minute/minutes); h(s) and hr(s)
(hour/hours); .degree. C. (degrees Centigrade); QS (quantity
sufficient); ND (not done); rpm (revolutions per minute); H.sub.2O
(water); dH.sub.2O (deionized water); (HCl (hydrochloric acid); aa
(amino acid); by (base pair); kb (kilobase pair); kD (kilodaltons);
cDNA (copy or complementary DNA); DNA (deoxyribonucleic acid);
ssDNA (single stranded DNA); dsDNA (double stranded DNA); dNTP
(deoxyribonucleotide triphosphate); RNA (ribonucleic acid);
MgCl.sub.2 (magnesium chloride); NaCl (sodium chloride); w/v
(weight to volume); v/v (volume to volume); g (gravity); OD
(optical density); ppm (parts per million); Dulbecco's phosphate
buffered solution (DPBS); SOC (2% Bacto-Tryptone, 0.5% Bacto Yeast
Extract, 10 mM NaCl, 2.5 mM KCl); Terrific Broth (TB; 12 g/l
Bacto-Tryptone, 24 g/l glycerol, 2.31 g/l KH.sub.2PO.sub.4, and
12.54 g/lK.sub.2HPO.sub.4); OD.sub.280 (optical density at 280 nm);
OD.sub.600 (optical density at 600 nm); A.sub.405 (absorbance at
405 nm); Vmax (the maximum initial velocity of an enzyme catalyzed
reaction); PAGE (polyacrylamide gel electrophoresis); PBS
(phosphate buffered saline [150 mM NaCl, 10 mM sodium phosphate
buffer, pH 7.2]); PBST (PBS+0.25% TWEEN.RTM.-20); PEG (polyethylene
glycol); PCR (polymerase chain reaction); RT-PCR (reverse
transcription PCR); SDS (sodium dodecyl sulfate); Tris
(tris(hydroxymethyl)aminomethane); HEPES
(N-[2-Hydroxyethyl]piperazine-N-[2-ethanesulfonic acid]); HBS
(HEPES buffered saline); Tris-HCl
(tris[Hydroxymethyl]aminomethane-hydrochloride); Tricine
(N-[tris-(hydroxymethyl)-methyl]-glycine); CHES
(2-(N-cyclo-hexylamino)ethanesulfonic acid); TAPS
(3-{[tris-(hydroxymethyl)-methyl]-amino}-propanesulfonic acid);
CAPS (3-(cyclo-hexylamino)-propane-sulfonic acid; DMSO (dimethyl
sulfoxide); DTT (1,4-dithio-DL-threitol); SA (sinapinic acid
(s,5-dimethoxy-4-hydroxy cinnamic acid); TCA (trichloroacetic
acid); Glut and GSH (reduced glutathione); GSSG (oxidized
glutathione); TCEP (Tris[2-carboxyethyl]phosphine); Ci (Curies);
mCi (milliCuries); .mu.Ci (microCuries); HPLC (high pressure liquid
chromatography); RP-HPLC (reverse phase high pressure liquid
chromatography); TLC (thin layer chromatography); MALDI-TOF
(matrix-assisted laser desorption/ionization--time of flight); Ts
(tosyl); Bn (benzyl); Ph (phenyl); Ms (mesyl); Et (ethyl), Me
(methyl); Taq (Thermus aquaticus DNA polymerase); Klenow (DNA
polymerase I large (Klenow) fragment); EGTA (ethylene
glycol-bis(.beta.-aminoethyl ether)N,N,N',N'-tetraacetic acid);
EDTA (ethylenediaminetetracetic acid); bla (.beta.-lactamase or
ampicillin-resistance gene); HDL (high density liquid); MJ Research
(MJ Research, Reno, Nev.); Baseclear (Baseclear BV, Inc., Leiden,
the Netherlands); PerSeptive (PerSeptive Biosystems, Framingham,
Mass.); ThermoFinnigan (ThermoFinnigan, San Jose, Calif.); Argo
(Argo BioAnalytica, Morris Plains, N.J.); Seitz EKS (SeitzSchenk
Filtersystems GmbH, Bad Kreuznach, Germany); Pall (Pall Corp., East
Hills, N.Y. and Bad Kreuznach, Germany); Spectrum (Spectrum
Laboratories, Dominguez Rancho, Calif.); Molecular Structure
(Molecular Structure Corp., Woodlands, Tex.); Accelrys (Accelrys,
Inc., San Diego, Calif.); Chemical Computing (Chemical Computing
Corp., Montreal, Canada); New Brunswick (New Brunswick Scientific,
Co., Edison, N.J.); CFT (Center for Test Materials, Vlaardingen,
the Netherlands); Procter & Gamble (Procter & Gamble, Inc.,
Cincinnati, Ohio); GE Healthcare (GE Healthcare, Chalfont St.
Giles, United Kingdom); DNA2.0 (DNA2.0, Menlo Park, Calif.); OXOID
(Oxoid, Basingstoke, Hampshire, UK); Megazyme (Megazyme
International Ireland Ltd., Bray Business Park, Bray, Co., Wicklow,
Ireland); Finnzymes (Finnzymes Oy, Espoo, Finland); Kelco (CP
Kelco, Wilmington, Del.); Corning (Corning Life Sciences, Corning,
N.Y.); (NEN (NEN Life Science Products, Boston, Mass.); Pharma AS
(Pharma AS, Oslo, Norway); Dynal (Dynal, Oslo, Norway);
Bio-Synthesis (Bio-Synthesis, Lewisville, Tex.); ATCC (American
Type Culture Collection, Rockville, Md.); Gibco/BRL (Gibco/BRL,
Grand Island, N.Y.); Sigma (Sigma Chemical Co., St. Louis, Mo.);
Pharmacia (Pharmacia Biotech, Piscataway, N.J.); NCBI (National
Center for Biotechnology Information); Applied Biosystems (Applied
Biosystems, Foster City, Calif.); BD Biosciences and/or Clontech
(BD Biosciences CLONTECH Laboratories, Palo Alto, Calif.); Operon
Technologies (Operon Technologies, Inc., Alameda, Calif.); MWG
Biotech (MWG Biotech, High Point, N.C.); Oligos Etc (Oligos Etc.
Inc, Wilsonville, Oreg.); Bachem (Bachem Bioscience, Inc., King of
Prussia, Pa.); Difco (Difco Laboratories, Detroit, Mich.);
Mediatech (Mediatech, Herndon, Va.; Santa Cruz (Santa Cruz
Biotechnology, Inc., Santa Cruz, Calif.); Oxoid (Oxoid Inc.,
Ogdensburg, N.Y.); Worthington (Worthington Biochemical Corp.,
Freehold, N.J.); GIBCO BRL or Gibco BRL (Life Technologies, Inc.,
Gaithersburg, Md.); Millipore (Millipore, Billerica, Mass.);
Bio-Rad (Bio-Rad, Hercules, Calif.); Invitrogen (Invitrogen Corp.,
San Diego, Calif.); NEB (New England Biolabs, Beverly, Mass.);
Sigma (Sigma Chemical Co., St. Louis, Mo.); Pierce (Pierce
Biotechnology, Rockford, Ill.); Takara (Takara Bio Inc. Otsu,
Japan); Roche (Hoffmann-La Roche, Basel, Switzerland); EM Science
(EM Science, Gibbstown, N.J.); Qiagen (Qiagen, Inc., Valencia,
Calif.); Biodesign (Biodesign Intl., Saco, Maine); Aptagen
(Aptagen, Inc., Herndon, Va.); Sorvall (Sorvall brand, from Kendro
Laboratory Products, Asheville, N.C.); Molecular Devices (Molecular
Devices, Corp., Sunnyvale, Calif.); R&D Systems (R&D
Systems, Minneapolis, Minn.); Stratagene (Stratagene Cloning
Systems, La Jolla, Calif.); Marsh (Marsh Biosciences, Rochester,
N.Y.); Geneart (Geneart GmbH, Regensburg, Germany); Bio-Tek
(Bio-Tek Instruments, Winooski, Vt.); (Biacore (Biacore, Inc.,
Piscataway, N.J.); PeproTech (PeproTech, Rocky Hill, N.J.); SynPep
(SynPep, Dublin, Calif.); New Objective (New Objective brand;
Scientific Instrument Services, Inc., Ringoes, N.J.); Waters
(Waters, Inc., Milford, Mass.); Matrix Science (Matrix Science,
Boston, Mass.); Dionex (Dionex, Corp., Sunnyvale, Calif.); Monsanto
(Monsanto Co., St. Louis, Mo.); Wintershall (Wintershall AG,
Kassel, Germany); BASF (BASF Co., Florham Park, N.J.); Huntsman
(Huntsman Petrochemical Corp., Salt Lake City, Utah); Enichem
(Enichem Iberica, Barcelona, Spain); Fluka Chemie AG (Fluka Chemie
AG, Buchs, Switzerland); Gist-Brocades (Gist-Brocades, Nev., Delft,
the Netherlands); Dow Corning (Dow Corning Corp., Midland, Mich.);
and Microsoft (Microsoft, Inc., Redmond, Wash.).
[0233] As used herein, in some lists, a leading "0" is indicated,
in order to provide a three number designation for each site (e.g.,
"001" is the same as "1," so "A001C" is the same as "A1C"). In some
lists, the leading "0" is not included. In addition, as used
herein, "X" refers to any amino acid.
[0234] In the exemplified detergent compositions provided herein,
the enzymes levels are expressed by pure enzyme by weight of the
total composition and unless otherwise specified, the detergent
ingredients are expressed by weight of the total compositions. The
abbreviated component identifications therein have the following
meanings
TABLE-US-00002 Abbreviation Ingredient LAS Sodium linear
C.sub.11-13 alkyl benzene sulfonate. NaC16-17HSAS Sodium
C.sub.16-17 highly soluble alkyl sulfate TAS Sodium tallow alkyl
sulphate. CxyAS Sodium C.sub.1x-C.sub.1y alkyl sulfate. CxyEz
C.sub.1x-C.sub.1y predominantly linear primary alcohol condensed
with an average of z moles of ethylene oxide. CxyAEzS
C.sub.1x-C.sub.1y sodium alkyl sulfate condensed with an average of
z moles of ethylene oxide. Added molecule name in the examples.
Nonionic Mixed ethoxylated/propoxylated fatty alcohol e.g. Plurafac
LF404 being an alcohol with an average degree of ethoxylation of
3.8 and an average degree of propoxylation of 4.5. QAS
R.sub.2.cndot.N+(CH.sub.3).sub.2(C.sub.2H.sub.4OH) with R.sub.2 =
C.sub.12-C.sub.14. Silicate Amorphous Sodium Silicate
(SiO.sub.2:Na.sub.2O ratio = 1.6-3.2:1). Metasilicate Sodium
metasilicate (SiO.sub.2:Na.sub.2O ratio = 1.0). Zeolite A Hydrated
aluminosilicate of formula
Na.sub.12(A1O.sub.2SiO.sub.2).sub.12.cndot.27H.sub.2O SKS-6
Crystalline layered silicate of formula
.delta.-Na.sub.2Si.sub.2O.sub.5. Sulfate Anhydrous sodium sulphate.
STPP Sodium Tripolyphosphate. MA/AA Random copolymer of 4:1
acrylate/maleate, average molecular weight about 70,000-80,000. AA
Sodium polyacrylate polymer of average molecular weight 4,500.
Polycarboxylate Copolymer comprising mixture of carboxylated
monomers such as acrylate, maleate and methyacrylate with a MW
ranging between 2,000-80,000 such as Sokolan commercially available
from BASF, being a copolymer of acrylic acid, MW4,500. BB1
3-(3,4-Dihydroisoquinolinium)propane sulfonate BB2
1-(3,4-dihydroisoquinolinium)-decane-2-sulfate PB1 Sodium perborate
monohydrate. PB4 Sodium perborate tetrahydrate of nominal formula
NaBO.sub.3.cndot.4H.sub.2O. Percarbonate Sodium percarbonate of
nominal formula 2Na.sub.2CO.sub.3.cndot.3H.sub.2O.sub.2. TAED
Tetraacetyl ethylene diamine. NOBS Nonanoyloxybenzene sulfonate in
the form of the sodium salt. DTPA Diethylene triamine pentaacetic
acid. HEDP 1,1-hydroxyethane diphosphonic acid. DETPMP
Diethyltriamine penta (methylene) phosphonate, marketed by Monsanto
under the Trade name Dequest 2060. EDDS
Ethylenediamine-N,N'-disuccinic acid, (S,S) isomer in the form of
its sodium salt Diamine Dimethyl aminopropyl amine; 1,6-hezane
diamine; 1,3-propane diamine; 2-methyl-1,5-pentane diamine;
1,3-pentanediamine; 1- methyl-diaminopropane. DETBCHD
5,12-diethyl-1,5,8,12-tetraazabicyclo [6,6,2] hexadecane,
dichloride, Mn(II) SALT PAAC Pentaamine acetate cobalt(III) salt.
Paraffin Paraffin oil sold under the tradename Winog 70 by
Wintershall. Paraffin Sulfonate A Paraffin oil or wax in which some
of the hydrogen atoms have been replaced by sulfonate groups.
Aldose oxidase Oxidase enzyme sold under the tradename Aldose
Oxidase by Novozymes A/S Galactose oxidase Galactose oxidase from
Sigma nprE The recombinant form of neutral metalloprotease
expressed in Bacillus subtilis (See e.g., WO 07/044993) PMN
Purified neutral metalloprotease from Bacillus amyloliquefacients.
Amylase A suitable amylolytic enzyme, such as those sold under the
tradenames PURAFECT .RTM. Ox described in WO 94/18314, WO96/05295
sold by Genencor; NATALASE .RTM., TERMAMYL .RTM., FUNGAMYl .RTM.
and DURAMYL .TM., all available from Novozymes A/S. Lipase A
suitable lipolytic enzyme such as those sold under the tradenames
LIPEX .RTM., LIPOLASE .RTM., LIPOLASE .RTM. Ultra by Novozymes A/S
and Lipomax .TM. by Gist-Brocades. Cellulase A suitable cellulytic
enzyme such as those sold under the tradenames CAREZYME .RTM.,
CELLUZYME .RTM., and/or ENDOLASE .RTM. by Novozymes A/S. Pectin
Lyase A suitable pectin lyase, such as those sold under the
tradenames PECTAWAY .RTM. and PECTAWASH .RTM. available from
Novozymes A/S. PVP Polyvinylpyrrolidone with an average molecular
weight of 60,000 PVNO Polyvinylpyridine-N-Oxide, with an average
molecular weight of 50,000. PVPVI Copolymer of vinylimidazole and
vinylpyrrolidone, with an average molecular weight of 20,000.
Brightener 1 Disodium 4,4'-bis(2-sulphostyryl)biphenyl. Silicone
antifoam Polydimethylsiloxane foam controller with
siloxane-oxyalkylene copolymer as dispersing agent with a ratio of
said foam controller to said dispersing agent of 10:1 to 100:1.
Suds Suppressor 12% Silicone/silica, 18% stearyl alcohol, 70%
starch in granular form. SRP 1 Anionically end capped poly esters.
PEG X Polyethylene glycol of a molecular weight of x. PVP K60 .RTM.
Vinylpyrrolidone homopolymer (average MW 160,000) Jeffamine .RTM.
ED-2001 Capped polyethylene glycol from Huntsman Isachem .RTM. AS A
branched alcohol alkyl sulphate from Enichem MME PEG (2000)
Monomethyl ether polyethylene glycol (MW 2000) from Fluka Chemie
AG. DC3225C Silicone suds suppresser, mixture of Silicone oil and
Silica from Dow Corning. TEPAE Tetreaethylenepentaamine ethoxylate.
BTA Benzotriazole. Betaine (CH.sub.3).sub.3N.sup.+CH.sub.2COO.sup.-
Sugar Industry grade D-glucose or food grade sugar CFAA
C.sub.12-C.sub.14 alkyl N-methyl glucamide TPKFA C.sub.12-C.sub.14
topped whole cut fatty acids. Clay A hydrated aluminumu silicate in
a general formula Al.sub.2O.sub.3SiO.sub.2.cndot.xH.sub.2O. Types:
Kaolinite, montmorillonite, atapulgite, illite, bentonite,
halloysite. pH Measured as a 1% solution in distilled water at
20.degree. C.
Example 1
Assays
[0235] In the following Example, various assays were used as set
forth below for ease in reading. Any deviations from the protocols
provided below are indicated.
A. TCA Assay for Protein Content Determination in 96-Well
Microtiter Plates ("TCA Assay")
[0236] For BPN' (e.g., a reference protease) and variants thereof,
this assay was started using filtered culture supernatant from
microtiter plates grown 3-4 days at 33.degree. C. with shaking at
230 rpm and humidified aeration. A fresh 96-well flat bottom
microtiter plate (MTP) was used for the assay. First, 100
.mu.L/well of 0.25 N HCl was placed in each well. Then, 50 .mu.L of
filtered culture broth was added. The light scattering/absorbance
at 405 nm (use 5 sec mixing mode in the plate reader) was then
determined, in order to provide the "blank" reading. For the test,
100 .mu.L/well of 15% (w/v) trichloroacetic acid (TCA) was placed
in the plates and incubated between 5 and 30 min at room
temperature. The light scattering/absorbance at 405 nm (use 5 sec
mixing mode in the plate reader) was then determined.
[0237] The TCA assay for protein content determination of GCI-P036
and variants thereof was performed using filtered culture
supernatant from microtiter plates grown approximately 3 days at
37.degree. C. with shaking at 300 rpm and humidified aeration. In
this assay, 100 .mu.L of a 0.25 M HCl solution was added to each
well of a 96-well flat bottom microtiter plate. Subsequently, 25
.mu.L aliquots of the filtered culture supernatants (containing the
proteases) were added to wells. The light scattering/absorbance at
405 nm (using the 5 sec mixing mode in the plate reader) was then
determined, in order to provide the "blank" reading. After this
measurement, 100 .mu.L of a 30% (w/v) TCA solution was added to
each well and the microtiter plates were incubated between 5 and 15
minutes at room temperature. Finally, the resulting light
scattering/absorbance at 405 nm (using the 5 sec mixing mode in the
plate reader) was determined. The equipment used was a Biomek FX
Robot (Beckman Coulter) and a SpectraMAX (type 340; Molecular
Devices) MTP Reader; the MTP's were from Costar (type 9017).
[0238] The calculations were performed by subtracting the blank (no
TCA) from the test reading with TCA to provide a relative measure
of the protein content in the samples. If desired, a standard curve
can be created by calibrating the TCA readings with AAPF assays of
clones with known conversion factors. However, the TCA results are
linear with respect to protein concentration from 50 to 500
micrograms protein per ml (ppm) and can thus be plotted directly
against enzyme performance for the purpose of choosing
good-performing variants. The turbidity/light scatter increase in
the samples correlates to the total amount of precipitable protein
in the culture supernatant.
B. AAPF Protease Assay in 96-Well Microtiter Plates ("AAPF
Assay")
[0239] In order to determine the protease activity of the proteases
and variants thereof of the present invention, the hydrolysis of
N-succinyl-L-alanyl-L-alanyl-L-prolyl-L-phenyl-p-nitroanilide
(suc-AAPF-pNA) was measured. The reagent solutions used were: 100
mM Tris/HCl, pH 8.6, containing 0.005% TWEEN.RTM.-80 (Tris dilution
buffer); 100 mM Tris buffer, pH 8.6, containing 10 mM CaCl.sub.2
and 0.005% TWEEN.RTM.-80 (Tris/Ca buffer); and 160 mM suc-AAPF-pNA
in DMSO (suc-AAPF-pNA stock solution) (Sigma: S-7388). To prepare a
suc-AAPF-pNA working solution, 1 ml suc-AAPF-pNA stock solution was
added to 100 ml Tris/Ca buffer and mixed well for at least 10
seconds. The assay was performed by adding 10 .mu.l of diluted
protease solution to each well, immediately followed by the
addition of 190 .mu.l 1 mg/ml suc-AAPF-pNA working solution. The
solutions were mixed for 5 sec., and the absorbance change in
kinetic mode (20 readings in 5 minutes) was read at 410 nm in an
MTP reader, at 25.degree. C. The protease activity was expressed as
AU (activity=.DELTA.ODmin.sup.-1 ml.sup.-1).
AAPF Hydrolysis Method
[0240] The thermostability of serine proteases was determined by
assaying protease activity using the AAPF assay after incubation of
protease variants at 68.degree. C. for 1 hour. Under the conditions
of the assay, the residual activity of the reference protease
(e.g., wild type GG36=GCI-P036) was about 50%. The equipment used
was: F-bottom MTPs (Costar No. 9017), Biomek FX and/or Biomek FXp
Robot (Beckman Coulter), Spectramax Plus 384 MTP Reader (Molecular
Devices), iEMS Incubator/Shaker (1 mm amplitude)
(Thermo/Labsystems), Sealing tape (Nunc No. 236366), and ice bath.
Glycine buffer was prepared by dissolving 3.75 g glycine (Merck No.
1.04201.1000) in 960 mL water. 1 ml of 5% Tween 80 (Sigma No.
P-8074) and 10 ml of a stock solution of 1000 mM CaCl.sub.2 (Merck
No. 1.02382.1000) (29.4 g dissolved to 200 ml) was added to this
solution. The pH was adjusted to 10.5 with 4N NaOH and the volume
brought up to 1000 ml. Final concentrations of glycine, CaCl.sub.2
and TWEEN.RTM.-80 were: 50 mM, 10 mM and 0.005% respectively. The
incubators were set at 68.degree. C. (for incubation) and at
25.degree. C. (for the AAPF assay). 90 .mu.l and 190 .mu.l glycine
buffer was added to the empty dilution and incubation plates
respectively. 10 .mu.l of supernatant was then added to the
dilution plate, followed by addition of 10 .mu.l from the dilution
plate to the incubation plate. Then 10 .mu.l of mixture from the
incubation plate was added to a pre-warmed plate containing
suc-AAPF-pNA substrate. The suc-AAPF-pNA plate was read in MTP
Reader at 410 nm (t=0 measurement). The incubation plate was
covered with tape and incubated for 1 hour at 68.degree. C. and 400
rpm. At the end of the incubation, the plate was removed from the
incubator and cooled down on ice for at least 5 minutes. 10 .mu.l
of mixture from the incubation plate was transferred to the plate
containing suc-AAPF-pNA substrate and the plate read at 410 nm
(t=60 measurement). Percent residual activity was calculated
as:
% residual activity:(mODmin-1 at t=60)/(mODmin-1 at
t=0).times.100
C. LAS/EDTA Stability Assay ("LAS/EDTA Assay" or "LAS-EDTA Assay"
or "LAS Assay"
[0241] LAS/EDTA stability was measured after incubation of the test
protease in the presence of LAS/EDTA respectively, as a function of
residual activity determined using the AAPF assay.
[0242] The stability of protease variants in the presence of a
representative anionic surfactant (LAS=linear alkylbene sulfonate,
sodium dodecylbenzenesulfonate-DOBS) and di-sodium EDTA was
measured after incubation under defined conditions and the residual
activity was determined using the AAPF assay. The reagents used
were dodecyllbenzene sulfonate, sodium salt (DOBS, Sigma No.
D-2525), TWEEN.RTM.-80 (Sigma No. P-8074), di-sodium EDTA
(Siegfried Handel No. 164599-02), HEPES (Sigma No. H-7523),
unstress buffer: 50 mM HEPES (11.9 g/l)+0.005% TWEEN.RTM.-80, pH
8.0, Stress buffer: 50 mM HEPES (11.9 g/l), 0.1% (w/v) DOBS (1
g/l), 10 mM EDTA (3.36 g/l), pH 8.0, reference protease and
protease variant culture supernatants, containing 200-400 .mu.g/ml
protein. The equipment used was V- or U-bottom MTP as dilution
plates (Greiner 651101 and 650161 respectively), F-bottom MTP
(Corning 9017) for unstress and LAS/EDTA buffer as well as for
suc-AAPF-pNA plates, Biomek FX (Beckman Coulter), Spectramax Plus
384 MTP Reader (Molecular Devices), iEMS Incubator/Shaker (1 mm
amplitude) from Thermo Electron Corporation, sealing tape: Nunc
(236366)
[0243] The iEMS incubator/shaker (Thermo/Labsystems) was set at
29.degree. C. Culture supernatants were diluted into plates
containing unstress buffer to a concentration of .about.25 ppm
(master dilution plate). 20 .mu.l of sample from the master
dilution plate was added to plates containing 180 .mu.l unstress
buffer to give a final incubation concentration of 2.5 ppm. The
contents were mixed and kept at room temperature and a AAPF assay
was performed on this plate. 20 .mu.l of sample from the master
dilution plate was also added to plates containing 180 .mu.l stress
buffer (50 mM HEPES (11.9 g/l), 0.1% (w/v) DOBS (1 g/l), 10 mM EDTA
(3.36 g/l), pH 8.0). The solutions were mixed and immediately
placed in 29.degree. C. iEMS shaker for 30 min at 400 rpm.
Following 30 minutes of incubation, a AAPF assay was performed on
the stress plate. The stability of the samples was determined by
calculating the ration of the residual and initial AAPF activity as
follows:
Residual Activity (%)=[mODmin-1 stressed]*100/[mODmin-1
unstressed].
D. Cleaning Performance Assays
[0244] The stain removal performance of the protease variants was
determined in commercially available detergents. Heat inactivation
of commercial detergent formulas serves to destroy the enzymatic
activity of any protein components while retaining the properties
of non-enzymatic components. Thus, this method was suitable for
preparing commercially purchased detergents for use in testing the
enzyme variants of the present invention.
Microswatches:
[0245] Microswatches of 1/4'' circular diameter were ordered and
delivered by CFT (Vlaardingen, The Netherlands). Single
microswatches or two microswatches were placed vertically in each
well of a 96-well MTP to expose the whole surface area (i.e., not
flat on the bottom of the well).
BMI Microswatch Assay
[0246] Microswatches containing blood milk and ink (BMI) of 0.25
inch circular diameter were obtained from CFT Vlaardingen. Before
cutting of the swatches, the fabric (EMPA 116) was washed with
water. One microswatch was vertically placed in each well of a
96-well microtiter plate in order to expose the whole surface area
(i.e., not flat on the bottom of the well). The desired detergent
solution was prepared as described herein. After equilibrating the
Thermomixer at 25.degree. C., 190 .mu.l of detergent solution was
added to each well of the MTP, containing microswatches. To this
mixture, 10 .mu.l of the diluted enzyme solution was added so that
the final enzyme concentration was 1 .mu.g/ml (determined from BCA
assay). The MTP was sealed with tape and placed in the incubator
for 30 minutes, with agitation at 1400 rpm. Following incubation
under the appropriate conditions, 100 .mu.l of the solution from
each well was transferred into a fresh MTP. The new MTP containing
100 .mu.l of solution/well was read at 405 nm using a MTP
SpectraMax reader. Blank controls, as well as a control containing
two microswatches and detergent but no enzyme were also
included.
Baked Egg Microtiter Assay
[0247] For this assay, 96-well baked egg yolk substrate plates were
prepared from chicken egg yolks. Chicken egg yolks were separated
from the whites, released from the membrane sac, and diluted 20%
(vol/weight) with Milli-Q water. The diluted yolk was stirred for
15 min at room temperature using a magnetic stirrer. Five .mu.L was
carefully pipetted into the center of each well of a 96-well
V-bottom plate (Costar #3894) using an 8-channel pipette. The
plates were baked at 90.degree. C. for 1 hour and cooled at room
temperature. The baked egg yolk substrate plates were stored at
room temperature and used within one week of preparation. Automatic
dish detergents were prepared as described herein and pre-heated to
50.degree. C. A 190 .mu.L aliquot of detergent was added to each
well of the 96-well plate using an 8-channel pipette. Ten .mu.L of
diluted enzyme was added to each well using a 96-channel pipetting
device. The plate was carefully sealed with an adhesive foil sealer
and incubated at 50.degree. C. with shaking for 30 min. 120 .mu.L
of the reaction mixture was transferred to a new 96-well
flat-bottom plate, and the absorbance/light scattering was
determined at 405 nm. The absorbance/light scattering at 405 nm is
proportional to egg yolk removal.
Egg Yolk Microswatch Assay ("CS-38 Microswatch Assay"; or "EGG" or
"Dish")
[0248] Automatic dish detergents were prepared as described herein.
The equipment used included a New Brunswick Innova 4230
shaker/incubator and a SpectraMAX (type 340) MTP reader. The MTPs
were obtained from Costar (type 9017). Aged egg yolk with pigment
swatches (CS-38) were obtained from Center for Test Materials
(Vlaardingen, Netherlands). Before cutting 0.25-inch circular
microswatches, the fabric was washed with water. One microswatch
was placed in each well of a 96-well microtiter plate. The test
detergent was equilibrated at 50.degree. C. 190 .mu.l of detergent
solution was added to each well of the MTP, containing
microswatches. To this mixture, 10 .mu.l of the diluted enzyme
solution was added. The MTP was sealed with adhesive foil and
placed in the incubator for 30 minutes, with agitation. Following
incubation, 100 .mu.l of the solution from each well was
transferred into a fresh MTP. This MTP was read at 405 nm using a
SpectraMax MTP reader. Blank controls, as well as controls
containing microswatches and detergent but no enzyme were also
included.
"Pre-washed" Swatch
[0249] This type of microswatch was pre-washed in deionised water
for 20 minutes at ambient temperature. After the pre-washing step,
the swatches were put on top of paper towels to dry. The air-dried
swatches were then punched using a 1/4'' circular die on an
expulsion press. Finally two microswatches were put into each well
of a 96-well MTP vertically to expose the whole surface area (i.e.
not flat on the bottom of the well).
Detergents
[0250] For North American (NA) and Western European (WE) heavy duty
liquid laundry (HDL) detergents, heat inactivation was performed by
placing pre-weighed liquid detergent (in a glass bottle) in a water
bath at 95.degree. C. for 2 hours. All of the detergents used in
the Examples were commercially-available detergents purchased from
local supermarket stores. The enzymes present in these detergents
were inactivated by heat treatment, as described herein. The
incubation time for heat inactivation of North American (NA) and
Japanese (JPN) heavy duty granular laundry (HDG) detergent was 8
hours and that for Western European (WE) HDG detergent was 5 hours.
The incubation time for heat inactivation of NA and WE auto dish
washing (ADW) detergents was 8 hours. Both un-heated and heated
detergents were assayed within 5 minutes of dissolving the
detergent to accurately determine percentage deactivated. Enzyme
activity was tested by the AAPF assay.
[0251] For testing of enzyme activity in heat-inactivated
detergents, working solutions of detergents were made from the heat
inactivated stocks. Appropriate amounts of water hardness (6 gpg or
12 gpg) and buffer were added to the detergent solutions to match
the desired conditions. The solutions were mixed by vortexing or
inverting the bottles. Table 1-1 provides information regarding
some of the commercially-available detergents and test conditions
used herein. In some experiments, additional and/or other
commercially available detergents were used as described in the
following Examples.
TABLE-US-00003 TABLE 1-1 Laundry and Dish Washing Conditions Region
Form Dose Detergent* Buffer Gpg pH T (.degree. C.) Laundry (Heavy
Duty Liquid and Granular) NA HDL 0.78 g/l.sup. P&G TIDE .RTM.
2X 5 mM HEPES 6 8.0 20 WE HDL 5.0 g/L Henkel PERSIL .TM. 5 mM HEPES
12 8.2 40 WE HDG 8.0 g/L P&G ARIEL .RTM. 2 mM Na.sub.2 CO.sub.3
12 10.5 40 JPN HDG 0.7 g/L P&G TIDE .RTM. 2 mM Na.sub.2
CO.sub.3 6 10.0 20 NA HDG 1.0 g/L P&G TIDE .RTM. 2 mM Na.sub.2
CO.sub.3 6 10.0 20 Automatic Dish Washing WE ADW 3.0 g/L RB
CALGONIT .TM. 2 mM Na.sub.2 CO.sub.3 21 10.0 40 NA ADW 3.0 g/L
P&G CASCADE .RTM. 2 mM Na.sub.2 CO.sub.3 9 10.0 40
*Abbreviations: Procter & Gamble (P&G); and Reckitt
Benckiser (RB).
Enzymes and Equipment
[0252] Samples of GCI-P036 and variants thereof were obtained from
filtered culture broth of cultures grown in MTP plates. The
equipment used was a Biomek FX Robot (Beckman Coulter), a
SpectraMAX MTP Reader (type 340; Molecular Devices), an iEMS
incubator/shaker (Thermo/Labsystems); F-bottom MTPs (Costar type
9017 used for reading reaction plates after incubation); and
V-bottom MTPs (Greiner 651101 used for pre-dilution of
supernatant). In this assay, the proteases hydrolyze the substrate
and liberate pigment and insoluble particles from the substrate.
Thus the rate of turbidity is a measure of enzyme activity.
[0253] The stain removal performance of reference serine proteases
and variants therefrom on microswatches was determined on a MTP
scale in commercially available detergent (Calgonit 5 in1). CS-38
microswatches (egg-yolk with pigment, aged by heating), obtained
from CFT Vlaardingen were used as substrate. Two swatches were used
per well. ADW tablets from Calgonit 5in1 were used to prepare the
detergent solution. To inactivate the protease activity present in
the tablets, a 21 g tablet was dissolved in Milli-Q water heated in
a water bath to a temperature of 60.degree. C. The solution was
cooled to room temperature and the volume of water adjusted to 700
mL. The solution was further diluted with water to achieve a final
concentration of 3 g/l. Water hardness was adjusted to 21.degree.
GH by adding 1.46 ml of the Ca/Mg-mixture (Ca/Mg mixture [(3:1),
1.92 M CaCl.sub.2=282.3 g/L CaCl.sub.2.2H.sub.20; 0.64 M
MgCl.sub.2=130.1 g/L MgCl.sub.2.6H.sub.2O), 15000 gpg]. The enzyme
samples were prediluted in 10 mM NaCl, 0.1 mM CaCl.sub.2, 0.005%
TWEEN.RTM.-80 solution and tested at appropriate
concentrations.
[0254] The incubator was set at the desired temperature of
50.degree. C. 72 .mu.l of dilution buffer was added to the empty
V-bottom plate (i.e., a "dilution plate") followed by 8 .mu.l
supernatant. 9 .mu.l from the dilution plate was added to plates
containing the microswatches incubated in 171 .mu.l detergent
solution. 9 .mu.l from the dilution plate was added to plates
containing the microswatches to give a total dilution of
supernatant of 200.times.. The microswatch plate (with detergent
and enzyme) was covered with tape and placed in the
incubator/shaker for 30 minutes at 1400 rpm. Following incubation,
75 .mu.l of the reaction mixture was transferred to an empty
F-bottom plate and the absorbance was read in a MTP Reader at 405
nm after de-bubbling with a hair dryer. Blank controls, containing
one or two microswatches and detergent without the addition of
reference protease containing samples were also included in the
test.
[0255] The stain removal performance of reference serine proteases
and variants therefrom on microswatches was also determined on a
MTP scale in commercially available detergent (Calgonit 5in1). The
reagents used were: 5 mM HEPES, pH 8.0 or 5 mM MOPS, pH 7 buffer,
3:1 Ca:Mg for medium water hardness. (CaCl.sub.2: MgCl2.6H.sub.2O);
15000 grains per gallon (gpg) stock diluted to 6 gpg, 2 BMI
(blood/milk/ink) swatches per plate: EMPA-116 BMI cotton swatches
processed by CFT: pre-rinsed and punched 2 swatches per well, and
heat inactivated TIDE.RTM. 2.times. Coldwater off-the-shelf
detergent in which lack of protease activity was confirmed. In some
experiments described herein, the following solutions were used, as
indicated in the Examples.
TABLE-US-00004 TABLE 1-2 Working Detergent Solutions Temp Detergent
Detergent (C.) g/L pH Buffer gpg Protease TIDE .RTM. 2X Cold 16
0.98 8 5 mM 6 BPN' HEPES TIDE .RTM. 2X Cold 32 0.98 8 5 mM 6 GG36,
BPN' HEPES TIDE .RTM. 2X Cold 16 0.98 7 5 mM 6 BPN' MOPS
[0256] The incubator was set at the desired temperature (16.degree.
C. or 32.degree. C.). For the test, 10 .mu.L samples from the
master dilution plate of .about.10 ppm enzyme was added to BMI
2-swatch plates with 190 .mu.L working detergent solutions listed
above. The volume was adjusted to give final concentration of 0.5
ppm for variants in the assay plates. The plates were immediately
transferred to iEMS incubators and incubated for 30 minutes with
1400 rpm shaking at given temperature. Following incubation, 100
.mu.L of supernatant was transferred into a new 96-well plate and
the absorbance was measured in MTP Reader at 405 nm and/or 600 nm.
Control wells, containing 1 or 2 microswatches and detergent
without the addition of protease samples were also included in the
test. The measurement at 405 nm provides a higher value and tracks
pigment removal, while the measurement at 600 nm tracks turbidity
and cleaning
Calculation of the Stain Removal Activity for all Microswatch Assay
Methods:
[0257] The absorbance value obtained was corrected for the blank
value (substrate without enzyme), providing a measure of hydrolytic
activity. For each sample (variant) the performance index was
calculated. The performance index compares the performance of the
variant (actual value) and the standard enzyme (theoretical value)
at the same protein concentration. In addition, the theoretical
values can be calculated, using the parameters of the Langmuir
equation of the standard enzyme.
E. Relative Specific Activity of Proteases and Variants Thereof
[0258] In order to discriminate the protease variants, the relative
specific activity was calculated using suc-AAPF-pNA as a substrate,
which enabled the comparison and ranking of the variants versus the
wild-type or standard protease. The specific activity on the
suc-AAPF-pNA substrate was determined by dividing the proteolytic
activity by the measured TCA-values of each sample, using the
assays described above. Using these values, the relative specific
activity was calculated (specific activity of variant/specific
activity of reference protease).
F. Eglin C Inhibition Assay
[0259] As described herein, serine protease concentration and
specific activity was determined by titration with an inhibitor.
Eglin c from the leech Hirudo medicinalis is a tight-binding
protein inhibitor of subtilisins (Heinz et al., Biochemistry, 31:
8755-66, 1992), and can therefore be used to measure enzyme
concentration, which in turn permits specific activity to be
calculated. Briefly, one measures the amount of enzyme inhibition
produced by several known concentrations of eglin c. From this
information, the concentration of eglin c required for complete
inhibition is calculated. This is equivalent to the enzyme
concentration in the sample.
[0260] Protease activity was measured using the chromogenic AAPF
assay described above. The gene for eglin c was synthesized and
expressed in E. coli by standard methods. Its properties and
inhibitory potency were the same as eglin c purchased from Sigma.
The concentration of an eglin c stock solution was determined by
measuring the inhibition of a sample of Bacillus lentus subtilisin
of known specific activity. Then the calibrated eglin c sample was
used to determine the concentration and specific activity of
subtilisin variants. These values were used to create normalized
96-well enzyme stock plates, where all of the variants were diluted
to a common concentration.
G. Performance Index
[0261] The performance index compares the performance of the
variant (actual value) and the standard or reference protease
(theoretical value) at the same protein concentration. In addition,
the theoretical values can be calculated, using the parameters of
the Langmuir equation of the standard protease. A performance index
(PI) that is greater than 1 (PI>1) identifies a better variant
as compared to the standard (e.g., wild-type), while a PI of 1
(PI=1) identifies a variant that performs the same as the standard,
and a PI that is less than 1 (PI<1) identifies a variant that
performs worse than the standard. Thus, the PI identifies winners,
as well as variants that are less desirable for use under certain
circumstances.
Example 2
Production of GCI-P036 Protease in B. subtilis
[0262] In this Example, experiments conducted to produce GCI-P036
protease in B. subtilis are described. Transformation of expression
vector encoding GCI-P036 and variants thereof into B. subtilis
cells (.DELTA.aprE, .DELTA.nprE, oppA, .DELTA.spoIIE, degUHy32,
.DELTA.amyE::[xylR,pxylA-comK]) was performed as described
previously (See e.g., WO 2002/014490).
GCI-P036 Protease Production--pAC-GCI-P036ci
[0263] Exemplary methods to produce GCI-P036 (also referred to
herein as "B. lentus subtilisin" and "GG36") in B. subtilis are
provided. The expression plasmid pAC-GG36ci was assembled using the
GCI-P036 codon-improved gene fused at the eighth codon of the aprE
signal sequence under the control of the consensus aprE promoter
and the BPN' transcriptional terminator. In the sequence provided
below, bold and italicized font indicates the consensus aprE
promoter, standard font indicates the signal sequence, underlined
font indicates the pro sequence, bold font indicates DNA that
encodes the GCI-P036 mature protease, and underlined italicized
font indicates the BPN' terminator. The coding region of the
GCI-P036 mature protease is flanked by KpnI and XhoI restriction
sites for cloning purposes:
TABLE-US-00005 (SEQ ID NO: 5)
gtgagaagcaaaaaattgtggatcgtcgcgtcgaccgcattg
ctgatttctgttgcttttagctcatccatcgcatccgctgctgaagaag
caaaagaaaaatatttaattggctttaatgagcaggaagctgtcagtga
gttcgtagaacaagttgaggcaaatgacgaggtagccattctactgagg
aagaggaagtcgaaattgaattgcttcatgaatttgaaacgattcctgt
tctgtccgttgagttaagcccagaagatgtggacgcgttagagctcgat
ccagctattccttatattgaagaggatgcagaagtaactacaatggcgc
aatcggtaccatggggaattagcagagtacaagccccagctgcacataa
ccgtggattgacaggttctggtgtaaaagttgctgtccttgataccggt
atttccactcatccagacttaaatattcgtggtggagctagctttgtac
caggggaaccatccactcaagatggcaatggacatggcactcatgttgc
cggcacaatcgcggctcttaacaattcaattggtgttcttggcgtagcg
ccaagcgcagaactatacgctgttaaagtattaggagcaagcggttcag
gctctgtcagctctattgcccaaggattggaatgggcagggaacaatgg
catgcacgttgctaatcttagtttaggatctccttcgccaagtgccaca
cttgagcaagctgttaatagcgcgacttctagaggcgttcttgttgtag
cggcctctggaaattcaggtgcaggctcaatcagctatccggcccgtta
tgcgaacgctatggcagtcggagctactgaccaaaacaacaaccgcgcc
agcttttcacagtatggcgcagggcttgacattgtcgcaccaggtgtaa
acgtgcagagcacttacccaggttcaacatatgccagcttaaacggtac
atcaatggctactcctcatgttgcaggtgcggctgcacttgttaaacaa
aagaacccatcttggtccaatgtacaaatccgcaatcatcttaagaata
cggcaactagcttaggaagcacaaacttgtatggaagcggacttgtcaa
tgcagaagctgcaactcgttaaaagcttaactcgagataaaaaaccggc
cttggccccgccggttttttat.
[0264] The amino acid sequence of the GCI-P036 precursor protein is
provided below. In this sequence, the signal peptide is shown in
italics (beginning with an N-terminal formylmethionine), the
pro-sequence is underlined, and the mature GCI-P036 protease
sequence is shown in bold:
TABLE-US-00006 (SEQ ID NO: 6)
MRSKKLWIVASTALLISVAFSSSIASAAEEAKEKYLIGFNEQEAVSEFV
EQVEANDEVAILSEEEEVEIELLHEFETIPVLSVELSPEDVDALELDPA
ISYIEEDAEVTTMAQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGIS
THPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPS
AELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLE
QAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASF
SQVGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKN
PSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR.
[0265] The amino acid sequence of the mature GCI-P036 protease:
TABLE-US-00007 (SEQ ID NO: 2)
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFV
PGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSG
SVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAA
SGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQ
STYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATS
LGSTNLYGSGLVNAEAATR.
[0266] Elements of plasmid pAC-GG36ci include: pUB110=DNA fragment
from plasmid pUB110 (McKenzie et al., Plasmid 15:93-103, 1986),
pBR322=DNA fragment from plasmid pBR322 (Bolivar et al., Gene
2:95-113, 1977), pC194=DNA fragment from plasmid pC194 (Horinouchi
et al., J Bacteriol, 150:815-825, 1982). The plasmid features as
follows: On for B. subtilis=origin of replication from pUB110,
CAT=chloramphenicol resistance gene from pC194, pMB1 origin=origin
of replication from pBR322, bla=beta-lactamase from pBR322, Short
aprE promoter=consensus transcriptional promoter, Signal
Peptide=signal peptide, Pro Peptide=GCI-P036 pro region, GG36ci
Mature Peptide=mature GCI-P036 (replaced by the coding regions for
each variant expressed in this work), BPN'
Terminator=transcriptional terminator from subtilisin BPN'.
GCI-P036 Protease Production--pHPLT-GCI-P036
[0267] Additional methods to produce the GCI-P036 reference
protease in B. subtilis are described. The synthetic gene encoding
GCI-P036 protease precursor was assembled from synthetic
oligonucleotides and PCR products. The fragment was cloned into
plasmid backbone pHPLT (U.S. Pat. No. 5,024,943) using BsmBI and
HindIII restriction sites. The amino acid sequence of the mature
GCI-P036 protease (SEQ ID NO:2) of pHPLT-GCI-P036 is identical to
that of pAC-GG36ci. The pHPLT B. subtilis expression vector
contains the B. licheniformis LAT promoter (Plat), and additional
elements from pUB110 (McKenzie et al., Plasmid, 15:93-103, 1986)
including a replicase gene (reppUB), a neomycin/kanamycin
resistance gene (neo) and a bleomycin resistance marker (bleo). The
plasmid DNA was purified from transformed bacteria using Pure
Yield.TM. Plasmid Midiprep kit (Promega), and DNA concentration was
determined by UV spectroscopy as known in the art. The final vector
construct was verified by DNA sequencing of the GCI-P036 gene and
showed 100% sequence congruence to the expected sequence. The DNA
sequence of the GCI-P036 protease gene of pHPLT-GCI-P036 is shown
below with the cloning sites SacI and HindIII underlined:
TABLE-US-00008 (SEQ ID NO: 7)
GTGAGAAGCAAAAAATTGTGGATCGTCGCGTCGACCGCACTACTCAT
TTCTGTTGCTTTCAGTTCATCGATCGCATCGGCTGCTGAAGAAGCAA
AAGAAAAATATTTAATTGGCTTTAATGAGCAGGAAGCTGTCAGTGAG
TTTGTAGAACAAGTAGAGGCAAATGACGAGGTCGCCATTCTCTCTGA
GGAAGAGGAAGTCGAAATTGAATTGCTTCATGAATTTGAAACGATTC
CTGTTTTATCCGTTGAGTTAAGCCCAGAAGATGTGGACGCGCTTGAG
CTCGATCCAGCGATTTCTTATATTGAAGAGGATGCAGAAGTAACGAC
AATGGCGCAATCAGTGCCATGGGGAATTAGCCGTGTGCAAGCCCCAG
CTGCCCATAACCGTGGATTGACAGGTTCTGGTGTAAAAGTTGCTGTC
CTCGATACAGGTATTTCCACTCATCCAGACTTAAATATTCGTGGTGG
CGCTAGCTTTGTACCAGGGGAACCATCCACTCAAGATGGGAATGGGC
ATGGCACGCATGTGGCCGGGACGATTGCTGCTTTAAACAATTCGATT
GGCGTTCTTGGCGTAGCGCCGAGCGCGGAACTATACGCTGTTAAAGT
ATTAGGGGCGAGCGGTTCAGGTTCGGTCAGCTCGATTGCCCAAGGAT
TGGAATGGGCAGGGAACAATGGCATGCACGTTGCTAATTTGAGTTTA
GGAAGCCCTTCGCCAAGTGCCACACTTGAGCAAGCTGTTAATAGCGC
GACTTCTAGAGGCGTTCTTGTTGTAGCGGCATCTGGAAATTCAGGTG
CAGGCTCAATCAGCTATCCGGCCCGTTATGCGAACGCAATGGCAGTC
GGAGCTACTGACCAAAACAACAACCGCGCCAGCTTTTCACAGTATGG
CGCAGGGCTTGACATTGTCGCACCAGGTGTAAACGTGCAGAGCACAT
ACCCAGGTTCAACGTATGCCAGCTTAAACGGTACATCGATGGCTACT
CCTCATGTTGCAGGTGCAGCAGCCCTTGTTAAACAAAAGAACCCATC
TTGGTCCAATGTACAAATCCGCAATCATCTAAAGAATACGGCAACGA
GCTTAGGAAGCACGAACTTGTATGGAAGCGGACTTGTCAATGCAGAA
GCTGCAACTCGTTAAAGCTT.
Recombinant Proteases--2 ml Scale
[0268] B. subtilis clones containing protease expression vectors
were replicated with a steel 96-well replicator from glycerol
stocks into 96-well culture plates (BD, 353075) containing 200
.mu.l of LB media+25 .mu.g/ml chloramphenicol, grown overnight at
37.degree. C., 220 rpm in a humidified enclosure. A 200 .mu.l
aliquot from the overnight culture was used to inoculate 2000 .mu.l
defined media+25 .mu.m/ml chloramphenicol in 5 ml plastic culture
tubes. The cultivation media was an enriched semi-defined media
based on MOPS buffer, with urea as major nitrogen source, glucose
as the main carbon source, and supplemented with 1% soytone for
robust cell growth. Culture tubes were incubated at 37.degree. C.,
220 rpm, for 60 hours. Following this incubation, the culture
broths were centrifuged at greater than 8000.times.RCF. The
supernatant solution was decanted into 15 ml polypropylene conical
tubes for storage. No further purification or concentration was
performed. Supernatant stocks were formulated to 40% propylene
glycol final concentration for long-term stability and stored at
4.degree. C.
Recombinant Proteases--Microtiter Plate (MTP) Scale
[0269] Alternatively, the variant proteases were produced by
growing the B. subtilis transformants in 96 well microtiter plates
(MTP) in 200 .mu.L of a MOPS-based defined medium ("MBD"). MBD
medium was made essentially as known in the art (See, Neidhardt et
al., J Bacteriol, 119: 736-747, 1974), except that
NH.sub.4Cl.sub.2, FeSO.sub.4, and CaCl.sub.2 were left out of the
base medium, 3 mM K.sub.2HPO.sub.4 was used, and the base medium
was supplemented with 60 mM urea, 75 g/L glucose, and 1% soytone.
Also the micronutrients were made up as a 100.times. stock
containing in one liter, 400 mg FeSO.sub.4.7H.sub.2O, 100 mg
MnSO.sub.4.H.sub.2O, 100 mg ZnSO.sub.4.7H.sub.2O, 50 mg
CuCl.sub.2.2H.sub.2O, 100 mg CoCl.sub.2.6H.sub.2O, 100 mg
NaMoO.sub.4.2H.sub.2O, 100 mg Na.sub.2B.sub.4O.sub.7.10H.sub.2O, 10
ml of 1M CaCl.sub.2, and 10 ml of 0.5 M sodium citrate. The plates
were incubated at 37.degree. C. for 68 hours, cells were separated
by centrifugation, and proteins of interest were obtained from the
culture medium.
Example 3
Generation of GCI-P036 Variants
[0270] In this Example, methods used to produce the protease
variants are described.
Generation of GCI-P036 Site Evaluation Libraries (SELs)
[0271] SEL production was performed by GENEART using a proprietary
process (WO 2004/059556A3). Methods and devices for optimizing a
nucleotide sequence for the purpose of expression of a protein by
PCR, and the manufacture of DNA molecules utilized technology owned
by or licensed to GENEART (European Patent Nos. 0 200 362 and 0 201
184; and U.S. Pat. Nos. 4,683,195, 4,683,202 and 6,472,184). The
construction of GCI-P036 SEL described in this example was
performed by GENEART using their methods and technology platform
for gene optimization, gene synthesis and library generation and
analysis.
[0272] GCI-P036 SELs were produced by GENEART at positions
pre-selected by the inventors. The pHPLT-GCI-P036 plasmid DNA (See,
FIG. 2) was digested with SacI and HindIII restriction enzymes,
releasing a 3.9 kb fragment that was subsequently purified from an
agarose gel using a Qiagen gel purification kit. Each amino acid of
the mature sequence was mutated into at least 16 different amino
acids. To construct GCI-P036 SELs, three PCR reactions were
performed: two mutagenesis reactions to introduce the mutated codon
of interest in the mature GCI-P036 DNA sequence, and a third
reaction to fuse the two mutagenesis PCR products together to
construct the pHPLT-GCI-P036 expression vector having the desired
mutated codons in the mature GCI-P036 sequence.
[0273] The method of mutagenesis was based on the codon-specific
mutation approach in which the creation of all possible mutations
at once in a specific DNA triplet was performed using a forward and
reverse oligonucleotide primer with a length of 25 up to 45
nucleotides using a specifically designed triple DNA sequence NNS
((A,C,T or G), (A,C,T or G), (C or G)) that corresponded with the
sequence of the codon to be mutated and guarantee random
incorporation of nucleotides at the specific codon of interest. Two
additional primers that are used to construct a site evaluation
library include an upstream primer containing a SacI site, and a
downstream primer containing a HindIII site. Construction of each
SEL begins with two primary PCR amplifications using the forward
SacI primer and a specific GCI-P036 reverse mutagenesis primer, and
for the second PCR reaction the reverse HindIII primer and a
specific GCI-P036 forward mutagenesis primer (equal GCI-P036 mature
codon positions for the forward and reverse mutagenesis
primers).
[0274] The introduction of the mutations in the mature GCI-P036
sequence was performed using Phusion High-Fidelity DNA Polymerase
(Finnzymes catalog no. F-530L). All PCR reactions were executed
according to manufacturer's protocols that were supplied with the
polymerase. The PCR conditions were as follows:
for primary PCR 1: FW SacI primer and a specific GCI-P036 reverse
mutagenesis primer--both 1 .mu.L, (10 .mu.M); and for primary PCR
2: RV HindIII primer and a specific GCI-P036 forward mutagenesis
primer--both 1 .mu.L, (10 .mu.M).
[0275] The primer sequences used in this Example are provided
below:
TABLE-US-00009 CGCGCTTGAGCTCGATCCAGCGATTTC SacI-Fw (SEQ ID NO: 99)
GTCTCCAAGCTTTAACGAGTTGCAG HindIII-Rv (SEQ ID NO: 100)
GCAATTCAGATCTTCCTTCAGGTTATGACC pHPLT-BglII-Fw (SEQ ID NO: 101)
GCATCGAAGATCTGATTGCTTAACTGCTTC pHPLT-BglII-Rv (SEQ ID NO: 102)
[0276] Each reaction included: 10 .mu.L, of 5.times. Phusion HF
buffer, 1 .mu.L, of 10 mM dNTP mixture, 0.75 .mu.L, of Phusion DNA
polymerase (2 units/.mu.L), 1 .mu.L, neat DMSO, 1 .mu.L, of
pHPLT-GCI-P036 template DNA (0.1-1 ng/.mu.L), and dH2O to 50 .mu.L,
total volume.
[0277] PCR was completed using a MJ Research PTC-200 Peltier
thermal cycler with the following program: 30 seconds 98.degree.
C., 30.times. (10 seconds 98.degree. C., 20 seconds 55.degree. C.,
1 minute 72.degree. C.) and 5 min 72.degree. C. The reactions
yielded two fragments of approximately 2 to 3 kb having
approximately 30 nucleotide overlap surrounding the GCI-P036 mature
codon of interest.
[0278] Fragments were fused in a third reaction using the two
aforementioned fragments and the forward and reverse SacI-Fw and
HindIII-Rv primers. The fusion PCR reaction was carried out in a
solution containing: 1 .mu.L, each of SacI-Fw and HindIII-Rv
primers (10 .mu.M), 10 .mu.L, of 5.times. Phusion HF buffer, 1
.mu.L, of 10 mM dNTP mixture, 0.75 .mu.L of Phusion.TM. DNA
polymerase (2 units/.mu.L), 1 .mu.L of neat DMSO, 1 .mu.L, of
primary PCR 1 reaction mix, 1 .mu.L, of primary PCR 2 reaction mix,
and dH2O to adjust final volume to 50 .mu.L. The PCR fusion program
was as follows: 30 seconds 98.degree. C., 30.times. (10 seconds
98.degree. C., 20 seconds 55.degree. C., 40 seconds 72.degree. C.)
and 5 min 72.degree. C., using a MJ Research PTC-200 Peltier
thermal cycler. The amplified linear 859 bp fragment encoding the
GCI-P036 gene was purified (using QIAGEN.RTM. Qiaquick PCR
purification kit, catalog no. 28106) and digested with SacI and
HindIII restriction enzyme to create cohesive ends on both sides of
the fusion fragment. About 50 ng of plasmid pHPLT-GCI-P036 was
digested with SacI and HindIII restriction enzymes. The 3.9 kb
vector backbone fragment was isolated and ligated with 50 ng of the
digested 859 bp fragment encoding the variant enzyme, using T4 DNA
ligase (Invitrogen) following the manufacturer's protocol for
cloning of cohesive ends. Subsequently, the ligation mixture was
used to transform B. subtilis cells (.DELTA.aprE, .DELTA.nprE,
oppA, .DELTA.spoIIE, degUHy32, .DELTA.amyE::[xylR,pxylA-comK]) as
described (WO 2002/014490).
[0279] For each library, 96 single colonies were picked and grown
in TSB (tryptone and soy based broth) liquid media under neomycin
selection for subsequent DNA isolation and gene sequence analysis.
The library numbers ranged from 1 up to 269, with each number
representing the codon of the mature GCI-P036 sequence that was
mutated. Each library contained a maximum of 19 GCI-P036
variants.
Generation of GCI-P036 Multiple Mutation Libraries (MML)
[0280] Each synthetic GCI-P036 multiple mutation library contains a
mix of GCI-P036 genes in which two or more selected codons are
replaced by specific DNA sequences. Cloning of the combinatorial
GCI-P036 genes was performed by Sloning BioTechnology GmbH using
the Slonomax Technology. Tables 3-1 and 3-2 below list the
substitutions present in members of the MML numbered according to
the GCI-P036 reference sequence and the BPN' reference sequence
respectively.
TABLE-US-00010 TABLE 3-1 GCI-P036 Multiple Mutation Libraries
(GCI-P036 Numbering) Library Position (Amino Acids) Nos. Library 1
288 001 (A, K) 044 (R, F, K) 070 (I, C, V) 102 (V, I) 124 (L, F)
158 (S, F, I, Q) Library 2 288 001 (A, K) 044 (R, F, K) 070 (I, C,
V) 102 (V, I) 125 (G, Q, R, T) 157 (G, P) Library 3 1372 024 (S, H,
L, N, R, T, W) 107 (Q, I, K, L, R, T, V) 116 (G, F, K, L, R, T, V)
128 (S, N, R, Y) Library 4 5488 024 (S, H, L, N, R, T, W) 107 (Q,
I, K, L, R, T, V) 116 (G, F, K, L, R, T, V) 125 (G, Q, R, T) 128
(S, N, R, Y) Library 5 504 001 (A, K, R) 024 (S, H, L, N, R, T, W)
044 (R, F, K, N) 105 (I, V, T) 166 (A, Q) Library 6 2016 001 (A, K,
R) 024 (S, H, L, N, R, T, W) 044 (R, F, K, N) 105 (I, V, T) 125 (G,
Q, R, T) 166 (A, Q) Library 7 576 024 (S, H, L, W) 097 (S, K, Q, T)
101 (S, N, P) 116 (G, F, R, T) 130 (S, H, N) Library 8 2304 024 (S,
H, L, W) 097 (S, K, Q, T) 101 (S, N, P) 116 (G, F, R, T) 125 (G, Q,
R, T) 130 (S, H, N) Library 9 288 001 (A, K) 044 (R, F, K) 070 (I,
C, V) 102 (V, I) 124 (L, F) 158 (S, F, I, Q) with 85N, 116V, 126L,
127Q and 128A Library 10 196 024 (S, H, L, N, R, T, W) 107 (Q, I,
K, L, R, T, V) 125 (G, Q, R, T) with 85N, 116V, 126L, 127Q and 128A
Library 11 504 001 (A, K, R) 024 (S, H, L, N, R, T, W) 044 (R, F,
K, N) 105 (I, V, T) 166 (A, Q) with 85N, 116V, 126L, 127Q and 128A
Library 12 576 024 (S, H, L, W) 097 (S, K, Q, T) 101 (S, N, P) 125
(G, Q, R, T) 130 (S, H, N) with 85N, 116V, 126L, 127Q and 128A
Library 13 768 018 (N, K, Q, R) 095 (G, P) 179 (N, K, Q, R) 203 (Y,
W) 209 (A, I, R, V) 250 (S, P, W) Library 14 3456 042 (N, E, F, I,
S, T, V, W), 096 (A, E, L, N, T, V) 099 (S, E, F, N, R, T, V, Y)
115 (N, I, Y) 242 (N, I, K) Library 15 1200 051 (P, I, V) 117 (M,
F) 142 (S, T, V, W, Y) 179 (N, R, V) 203 (Y, W) 250 (S, I, P, T)
Library 16 768 018 (N, K, Q, R) 095 (G, P) 179 (N, K, Q, R) 203 (Y,
W) 209 (A, I, R, V) 250 (S, P, W) with 85N, 116V, 126L, 127Q and
128.sup.a Library 17 2880 042 (N, E, F, I, S, T, V, W), 051 (P, I,
V) 096 (A, E, L, N, T, V) 099 (S, E, F, N, R, T, V, Y) 242 (N, I,
K) with 85N, 116V, 126L, 127Q and 128A Library 18 2880 024 (S, H,
L, W) 097 (S, K, Q, T) 101 (S, N, P) 125 (G, Q, R, T) 130 (S, H, N)
with 85N, 116V, 126L, 127Q and 128A
TABLE-US-00011 TABLE 3-2 GCI-P036 Multiple Mutation Libraries (BPN'
Numbering) Library Position (Amino Acids) Nos. Library 1 288 001
(A, K) 045 (R, F, K) 072 (I, C, V) 104 (V, I) 126 (L, F) 164 (S, F,
I, Q) Library 2 288 001 (A, K) 045 (R, F, K) 072 (I, C, V) 104 (V,
I) 127 (G, Q, R, T) 163 (G, P) Library 3 1372 024 (S, H, L, N, R,
T, W) 109 (Q, I, K, L, R, T, V) 118 (G, F, K, L, R, T, V) 130 (S,
N, R, Y) Library 4 5488 024 (S, H, L, N, R, T, W) 109 (Q, I, K, L,
R, T, V) 118 (G, F, K, L, R, T, V) 127 (G, Q, R, T) 130 (S, N, R,
Y) Library 5 504 001 (A, K, R) 024 (S, H, L, N, R, T, W) 045 (R, F,
K, N) 107 (I, V, T) 172 (A, Q) Library 6 2016 001 (A, K, R) 024 (S,
H, L, N, R, T, W) 045 (R, F, K, N) 107 (I, V, T) 127 (G, Q, R, T)
172 (A, Q) Library 7 576 024 (S, H, L, W) 099 (S, K, Q, T) 103 (S,
N, P) 118 (G, F, R, T) 132 (S, H, N) Library 8 2304 024 (S, H, L,
W) 099 (S, K, Q, T) 103 (S, N, P) 118 (G, F, R, T) 127 (G, Q, R, T)
132 (S, H, N) Library 9 288 001 (A, K) 045 (R, F, K) 072 (I, C, V)
104 (V, I) 126 (L, F) 164 (S, F, I, Q) with 87N, 118V, 128L, 129Q
and 130A Library 10 196 024 (S, H, L, N, R, T, W) 109 (Q, I, K, L,
R, T, V) 127 (G, Q, R, T) with 87N, 118V, 128L, 129Q and 130A
Library 11 504 001 (A, K, R) 024 (S, H, L, N, R, T, W) 045 (R, F,
K, N) 107 (I, V, T) 172 (A, Q) with 87N, 118V, 128L, 129Q and 130A
Library 12 576 024 (S, H, L, W) 099 (S, K, Q, T) 103 (S, N, P) 127
(G, Q, R, T) 132 (S, H, N) with 87N, 118V, 128L, 129Q and 130A
Library 13 768 018 (N, K, Q, R) 097 (G, P) 185 (N, K, Q, R) 209 (Y,
W) 215 (A, I, R, V) 256 (S, P, W) Library 14 3456 043 (N, E, F, I,
S, T, V, W), 098 (A, E, L, N, T, V) 101 (S, E, F, N, R, T, V, Y)
117 (N, I, Y) 248 (N, I, K) Library 15 1200 052 (P, I, V) 119 (M,
F) 144 (S, T, V, W, Y) 185 (N, R, V) 209 (Y, W) 256 (S, I, P, T)
Library 16 768 018 (N, K, Q, R) 097 (G, P) 185 (N, K, Q, R) 209 (Y,
W) 215 (A, I, R, V) 256 (S, P, W) with 87N, 118V, 128L, 129Q and
130.sup.a Library 17 2880 043 (N, E, F, I, S, T, V, W), 052 (P, I,
V) 098 (A, E, L, N, T, V) 101 (S, E, F, N, R, T, V, Y) 248 (N, I,
K) with 87N, 118V, 128L, 129Q and 130A Library 18 2880 024 (S, H,
L, W) 099 (S, K, Q, T) 103 (S, N, P) 127 (G, Q, R, T) 132 (S, H, N)
with 87N, 118V, 128L, 129Q and 130A
Example 4
Performance of GCI-P036 variants
[0281] Experiments conducted to determine the stain removal
performance of various single substitution GCI-P036 variants in a
BMI assay (TIDE 2X.RTM. Cold; 32.degree. C., pH8) and CS-38
microswatch assay (CALGONIT.RTM.; WE ADW) are described.
Performance indices for LAS/EDTA stability, AAPF activity and
protein content were also determined. All assays were performed
using the methods of Example 1.
[0282] Table 4-1 shows performance index values for 4,210 variants
of subtilisin GCI-P036 at 269 positions. The performance of the
variant GCI-P036 was compared to the wild-type GCI-P036 enzyme.
Those variants with a performance index greater than 1 (PI>1)
have improved performance. Performance indices less than or equal
to 0.05 were fixed to 0.05 and indicated in bold italics in the
table. For the stability measure, if the performance index of
activity in the stability assays was less than or equal to 0.05,
the associated stability performance index was assigned the value
ND, for not determined. Also, variants for which the values were
not determined are listed as ND.
[0283] Performance index (PI) is the ratio of performance of the
variant to the parent or reference protease. Various terms set
forth below are used to describe the mutation: up mutations have a
PI>1; neutral mutations have a PI>0.5, non-deleterious
mutations have a PI>0.05; deleterious mutations have a PI=0.05;
combinable mutations are those mutations for which the variant has
Performance index values=0.5 for at least one property, and
>0.05 for all properties. Combinable mutations are mutations
that can be combined to deliver proteins with appropriate
performance indices for one or more desired properties. Positions
at which mutations occur are classified as follows: Non-restrictive
positions have .gtoreq.20% neutral mutations for at least one
property; and Restrictive positions have <20% neutral mutations
for activity and stability.
[0284] These data find use in engineering any subtilisin/subtilase.
Even if the subtilase to be engineered has an amino acid different
from that of subtilisin GCI-P036 at a particular position, these
data find use in finding a substitution that will alter the desired
properties by identifying the best choice for substitution(s),
including substitution(s) to the GCI-P036 wild type amino acid.
TABLE-US-00012 TABLE 4-1 Performance Index (PI) Values for Variants
of GCI-P036 for Various Tested Properties. TCA CS-38 PI BMI LAS-
AAPF POSITION GG36 Variant Assay Microswatch pH 8 EDTA Assay (BPN'
Numbering) (BPN' Numbering) PI Assay PI 32.degree. C. PI PI 1 A001C
0.93 0.87 1.14 0.62 1.11 1 A001E 1.25 0.94 1.00 1.08 1.34 1 A001F
1.15 1.18 1.01 0.53 1.24 1 A001G 1.19 1.37 1.01 0.92 1.47 1 A001H
1.33 0.97 0.93 0.83 1.43 1 A001I 1.40 0.92 0.97 0.63 1.74 1 A001K
1.24 1.13 0.76 0.63 1.30 1 A001L 1.31 1.05 0.98 0.72 1.33 1 A001N
1.38 0.96 1.02 0.68 1.55 1 A001P 0.44 1.20 0.37 0.47 1 A001Q 1.30
1.23 1.07 0.98 1.58 1 A001R 1.28 0.97 0.74 0.39 1.41 1 A001S 1.39
1.10 0.98 0.74 1.43 1 A001T 1.54 0.82 1.01 0.76 1.59 1 A001V 1.48
0.89 0.94 0.89 1.53 1 A001Y 1.42 0.86 0.79 0.70 1.34 2 Q002A 1.55
1.29 1.06 1.73 2 Q002C 1.19 0.68 0.95 1.44 2 Q002E 1.80 0.94 1.03
1.79 2 Q002G 1.67 1.22 0.92 1.70 2 Q002K 1.32 1.16 0.73 1.40 2
Q002L 1.27 1.00 1.09 1.31 2 Q002M 1.35 1.08 0.94 1.37 2 Q002N 1.57
1.11 0.91 1.67 2 Q002P 1.81 1.04 0.89 1.90 2 Q002R 1.31 1.08 0.67
1.38 2 Q002S 1.79 1.20 0.95 1.86 2 Q002T 1.55 1.04 0.89 1.33 2
Q002V 1.60 0.97 0.91 1.64 2 Q002W 1.60 1.10 0.87 1.67 2 Q002Y 1.52
0.95 0.95 1.48 3 S003D 1.36 1.01 1.09 0.43 1.55 3 S003E 1.25 0.99
1.17 1.03 1.33 3 S003F 1.07 0.98 0.90 0.23 1.10 3 S003G 1.48 1.00
0.79 1.47 3 S003H 1.40 0.90 0.91 0.87 1.42 3 S003I 1.41 0.91 0.93
1.02 1.37 3 S003L 1.24 1.00 0.86 0.57 1.27 3 S003M 1.45 0.89 0.89
0.90 1.45 3 S003N 1.42 0.97 0.94 0.71 1.45 3 S003P 1.41 0.94 0.90
1.54 3 S003R 1.27 1.09 0.75 1.44 3 S003T 1.46 0.95 0.90 1.14 1.66 3
S003V 1.37 0.99 0.81 0.95 1.39 3 S003W 1.42 0.88 0.81 0.30 1.33 3
S003Y 1.38 0.95 0.86 0.29 1.35 4 V004A 1.23 1.13 0.92 1.47 4 V004C
1.16 1.00 0.90 0.34 1.40 4 V004D 1.15 0.99 1.16 1.47 4 V004E 1.34
0.95 1.05 0.19 1.54 4 V004F 1.30 0.92 1.05 1.34 4 V004G 0.73 1.90
1.09 0.90 4 V004H 1.27 0.97 0.91 1.47 4 V004K 1.36 0.93 0.75 1.51 4
V004L 1.33 0.96 0.86 0.22 1.34 4 V004N 1.46 0.86 0.86 1.50 4 V004P
1.27 1.02 0.87 1.40 4 V004R 1.20 1.03 0.76 1.37 4 V004S 1.12 1.33
0.99 1.35 4 V004T 1.32 1.02 0.80 0.93 1.55 4 V004W 1.24 1.01 1.00
1.35 5 P005A 1.60 1.71 1.02 1.03 5 P005C 0.95 1.22 1.22 0.11 0.92 5
P005D 1.35 1.48 1.22 1.52 5 P005E 1.30 1.97 1.19 0.05 1.31 5 P005F
5 P005G 1.63 1.77 0.91 0.39 2.04 5 P005I 0.26 1.77 0.56 5 P005K 5
P005L 5 P005M 0.69 2.30 1.15 0.45 5 P005Q 1.46 1.56 0.83 0.47 5
P005R 5 P005S 1.91 1.34 0.99 0.07 1.12 5 P005T 1.40 1.85 1.00 1.88
5 P005W 0.10 3.05 0.28 5 P005Y 0.07 5.25 0.25 6 W006A 0.12 2.59
0.21 6 W006D 0.13 4.70 0.42 0.30 6 W006E 0.12 4.66 0.41 0.23 6
W006G 6 W006I 6 W006K 6 W006M 0.07 5.94 0.23 6 W006P 6 W006Q 6
W006R 6 W006S 6 W006T 6 W006V 7 G007A 1.97 1.10 1.02 1.88 7 G007C
1.77 1.12 0.92 0.08 1.76 7 G007D 1.51 0.69 1.03 1.24 7 G007E 0.24 7
G007F 0.06 7 G007H 1.93 1.08 0.96 1.68 7 G007I 0.23 7 G007K 0.58 7
G007L 0.42 7 G007M 0.17 0.62 0.11 0.09 7 G007N 2.08 0.95 0.97 0.29
1.52 7 G007P 0.12 2.42 0.35 7 G007Q 0.37 1.23 0.36 7 G007R 0.38 7
G007S 2.29 1.04 0.97 0.17 1.67 7 G007T 1.64 1.05 0.97 1.24 7 G007V
7 G007W 8 I008A 1.90 1.12 0.88 1.92 8 I008E 0.06 8 I008F 1.68 1.02
0.93 1.81 8 I008G 0.22 1.82 0.42 8 I008K 0.19 8 I008L 2.13 0.91
0.96 0.08 2.08 8 I008M 2.08 1.01 0.82 2.01 8 I008P 8 I008Q 0.80
1.03 1.03 0.98 8 I008R 0.08 8 I008T 1.79 1.35 0.98 0.46 2.15 8
I008V 2.16 0.92 0.94 1.09 2.00 8 I008W 0.14 2.66 0.50 8 I008Y 0.22
2.27 0.61 9 S009A 0.78 3.26 1.15 0.75 1.02 9 S009C 0.73 2.26 1.39
0.72 0.90 9 S009D 0.77 2.59 1.49 1.17 0.91 9 S009E 0.94 1.28 1.28
1.14 1.12 9 S009F 1.06 1.13 1.02 0.15 1.21 9 S009G 0.88 1.97 1.27
0.70 1.12 9 S009H 1.23 1.05 1.19 1.02 1.33 9 S009L 1.25 0.75 1.01
0.30 1.31 9 S009N 1.29 0.89 1.03 0.91 1.58 9 S009P 1.03 1.31 1.19
1.28 9 S009Q 1.38 0.86 0.90 0.89 1.69 9 S009R 1.27 0.99 0.77 0.09
1.49 9 S009T 0.97 1.54 1.09 0.92 1.11 9 S009V 1.18 1.05 0.98 0.57
1.22 9 S009W 1.29 0.89 0.99 0.16 1.52 9 S009Y 1.16 0.84 1.03 0.34
1.36 10 R010A 1.05 1.05 1.16 0.98 1.09 10 R010C 0.90 1.04 1.15 0.90
0.92 10 R010F 0.64 1.71 1.46 0.57 0.61 10 R010G 0.92 1.07 1.22 0.83
1.14 10 R010H 1.06 0.83 1.24 1.19 1.01 10 R010I 0.69 1.18 1.28 0.45
0.71 10 R010K 1.20 1.08 1.09 0.99 1.23 10 R010L 0.61 1.60 1.38 0.18
0.53 10 R010M 1.26 0.79 1.11 1.02 1.32 10 R010N 0.86 0.75 1.16 1.15
0.87 10 R010P 0.22 10 R010Q 0.24 2.44 1.25 0.27 10 R010S 1.00 0.94
1.29 0.99 1.04 10 R010T 1.21 0.98 0.99 1.08 1.27 10 R010V 0.78 0.74
1.19 0.74 0.77 10 R010W 0.85 0.74 1.24 0.66 0.74 10 R010Y 0.62 1.73
1.40 0.55 0.54 11 V011A 1.42 1.16 1.10 0.59 2.07 11 V011C 0.64 1.38
1.48 0.62 0.89 11 V011D 0.20 1.40 0.62 0.13 11 V011F 0.20 11 V011G
0.38 2.03 0.53 11 V011I 1.13 1.30 1.25 0.98 1.34 11 V011K 0.23 11
V011M 1.13 1.14 1.20 0.19 1.44 11 V011N 0.19 11 V011P 0.22 11 V011R
0.17 11 V011S 1.26 1.30 1.15 0.47 1.78 11 V011T 0.28 2.38 0.47 0.40
11 V011W 0.21 11 V011Y 0.17 12 Q012D 0.85 0.46 1.28 0.79 0.93 12
Q012F 1.24 1.21 1.10 0.63 1.59 12 Q012G 1.30 0.83 1.10 1.18 1.60 12
Q012H 1.21 1.23 1.00 0.60 1.46 12 Q012I 1.39 1.06 1.13 0.80 1.58 12
Q012K 1.16 1.34 0.88 0.15 1.50 12 Q012L 0.21 2.38 0.97 0.30 12
Q012M 0.57 1.67 1.40 0.98 0.76 12 Q012N 1.17 1.27 1.14 1.14 1.46 12
Q012P 0.16 0.88 1.02 0.09 12 Q012R 1.17 1.19 1.09 0.23 1.49 12
Q012S 1.59 1.10 1.01 0.96 1.74 12 Q012T 1.26 0.96 1.07 1.00 1.32 12
Q012V 1.33 1.00 1.12 0.84 1.57 12 Q012W 1.37 1.05 0.89 0.49 1.58 12
Q012Y 0.21 0.83 0.92 0.10 13 A013E 0.21 13 A013G 1.37 1.04 1.00
1.00 1.62 13 A013I 0.92 0.91 1.09 1.01 13 A013K 0.25 13 A013L 0.23
0.46 0.77 0.08 13 A013M 0.40 1.26 0.09 0.44 13 A013N 0.20 13 A013P
0.18 0.56 0.08 13 A013Q 0.62 4.03 1.33 0.09 0.72 13 A013R 0.31 13
A013T 1.14 1.24 1.00 0.24 1.29 13 A013V 1.13 1.02 0.93 0.08 1.20 13
A013Y 0.12 14 P014A 1.06 1.25 0.27 1.32 14 P014C 0.57 35.83 1.39
0.56 0.81 14 P014D 0.73 2.04 1.43 0.93 0.97 14 P014E 0.68 2.26 1.49
1.06 0.90 14 P014F 0.81 1.68 1.00 1.02 14 P014G 0.62 26.84 1.26
0.49 0.78 14 P014H 0.89 1.45 1.14 0.28 1.11 14 P014I 1.06 1.23 1.08
0.66 1.14 14 P014K 1.16 1.15 0.84 1.32 14 P014L 1.29 1.12 1.13 0.77
1.40 14 P014Q 1.20 1.07 0.91 0.62 1.32 14 P014S 0.84 1.60 1.27 0.37
1.07 14 P014T 1.06 1.25 1.13 0.80 1.18 14 P014V 1.08 1.29 1.06 0.63
1.32 14 P014Y 1.09 1.20 1.09 0.13 1.24 15 A015D 1.02 0.87 1.10 1.13
1.16 15 A015F 1.23 1.04 1.08 0.84 1.56 15 A015G 1.14 1.17 1.04 1.00
1.25 15 A015I 1.47 0.89 0.95 1.03 1.47 15 A015K 1.25 1.06 0.82 0.30
1.23 15 A015L 1.38 0.94 0.90 1.09 1.45 15 A015M 1.43 0.89 0.98 0.99
1.53 15 A015P 1.53 0.79 0.97 0.99 1.57 15 A015Q 1.40 0.92 1.00 1.08
1.42 15 A015R 1.14 1.00 0.89 0.08 1.32 15 A015S 1.35 1.07 0.84 1.14
1.33 15 A015V 1.36 0.90 0.95 1.02 1.50 15 A015W 1.44 0.80 0.87 0.87
1.41 16 A016D 0.16 1.24 0.13 16 A016E 0.20 1.39 0.09 0.19 16 A016F
0.27 16 A016G 1.28 1.13 1.02 1.00 1.51 16 A016K 0.13 0.10 16 A016L
1.19 0.90 1.10 0.53 1.50 16 A016N 1.15 1.05 1.05 0.89 1.40 16 A016P
1.41 0.92 0.98 0.87 1.55 16 A016Q 0.59 3.00 1.13 0.84 0.72 16 A016R
0.40 1.02 0.49 16 A016S 1.30 0.98 0.93 1.01 1.25 16 A016T 1.16 1.01
1.12 0.86 1.27 16 A016V 1.46 1.00 1.01 0.89 1.45 16 A016W 0.13 16
A016Y 0.12
17 H017A 0.88 1.01 1.02 0.70 1.07 17 H017D 0.31 1.81 0.57 0.39 17
H017E 0.70 1.87 1.29 0.75 0.93 17 H017F 1.40 0.91 0.93 0.69 1.60 17
H017G 0.69 2.24 1.09 0.73 0.91 17 H017I 1.28 0.91 0.91 1.01 1.37 17
H017K 0.90 1.25 0.81 1.05 17 H017M 0.92 1.26 1.00 1.04 1.05 17
H017N 1.10 0.99 1.03 0.84 1.30 17 H017P 0.13 17 H017R 0.94 1.35
0.98 0.05 1.11 17 H017S 0.97 1.32 1.01 0.60 1.16 17 H017T 0.78 1.73
1.10 0.54 0.91 17 H017V 0.81 1.38 1.13 0.52 0.88 17 H017W 1.16 0.98
1.01 0.13 1.41 17 H017Y 1.20 0.94 0.94 0.56 1.26 18 N018A 1.21 0.88
0.91 0.96 1.28 18 N018C 1.13 1.01 1.03 0.86 1.34 18 N018D 1.26 1.12
1.11 1.15 1.41 18 N018E 1.46 0.92 1.02 1.20 1.47 18 N018F 1.14 1.07
1.05 0.66 1.32 18 N018G 1.10 1.10 1.05 1.01 1.17 18 N018H 1.26 1.08
1.01 1.02 1.37 18 N018I 0.94 0.21 18 N018K 1.39 0.95 0.74 0.43 1.43
18 N018L 1.35 0.91 0.97 0.92 1.26 18 N018M 0.88 1.57 0.97 0.87 1.06
18 N018P 1.26 1.09 1.00 0.92 1.37 18 N018Q 1.32 1.01 0.92 1.02 1.44
18 N018R 1.20 1.02 0.82 0.12 1.36 18 N018S 1.02 1.19 1.07 1.03 1.08
18 N018T 1.21 1.03 0.90 0.97 1.41 18 N018V 1.32 0.92 1.09 0.86 1.36
18 N018W 1.39 0.90 0.89 0.54 1.38 18 N018Y 1.36 0.83 1.04 0.90 1.31
19 R019A 1.31 1.04 1.07 1.06 1.38 19 R019C 1.23 0.79 1.03 1.31 1.26
19 R019D 1.09 1.07 1.15 1.08 1.33 19 R019E 1.36 0.74 1.00 1.21 1.58
19 R019F 1.35 0.90 1.07 1.16 1.46 19 R019G 1.06 1.05 1.11 1.10 1.15
19 R019H 0.99 0.90 1.05 1.04 1.22 19 R019K 1.38 0.88 0.92 1.08 1.57
19 R019L 1.24 1.01 1.16 1.23 1.27 19 R019M 1.30 1.03 1.12 1.14 1.34
19 R019N 1.18 0.98 1.15 1.18 1.21 19 R019P 0.27 1.89 0.58 0.27 19
R019Q 0.36 19 R019S 0.95 1.28 1.26 1.05 1.04 19 R019T 0.71 2.30
1.34 1.06 0.86 19 R019V 1.00 1.26 1.12 1.05 1.18 19 R019W 1.22 0.94
1.11 1.17 1.13 19 R019Y 1.50 0.84 1.04 1.03 1.36 20 G020A 1.76 0.87
0.82 0.90 2.04 20 G020C 1.25 0.83 1.00 0.99 1.55 20 G020D 1.20 0.77
1.07 1.14 1.59 20 G020F 1.43 0.90 0.85 1.04 1.58 20 G020I 1.66 0.92
0.86 1.11 1.71 20 G020K 1.89 1.07 0.69 0.92 1.98 20 G020L 1.77 0.96
0.83 1.03 2.11 20 G020M 0.99 0.89 1.15 1.04 1.22 20 G020P 1.47 0.98
0.92 0.91 1.59 20 G020Q 1.95 0.96 0.76 1.02 2.27 20 G020R 1.75 0.95
0.70 0.81 1.94 20 G020S 1.25 1.32 0.95 0.92 1.66 20 G020T 1.39 0.94
0.92 1.03 1.54 20 G020V 1.68 0.95 0.86 1.04 1.77 20 G020W 1.31 0.91
0.93 0.91 1.39 20 G020Y 1.94 0.88 0.80 0.92 2.22 21 L021A 1.43 0.88
0.81 0.87 1.82 21 L021C 0.99 1.06 1.10 0.92 1.22 21 L021D 0.63 1.64
0.86 0.92 21 L021E 1.08 1.00 1.22 1.08 1.24 21 L021G 0.96 1.22 1.30
0.87 1.23 21 L021H 1.37 0.96 0.83 1.01 1.64 21 L021I 1.53 0.94 0.81
0.96 1.82 21 L021K 1.52 0.91 0.78 0.97 1.88 21 L021M 1.17 0.91 0.96
0.93 1.42 21 L021N 1.47 0.94 0.80 0.97 1.72 21 L021P 1.41 0.89 0.82
0.89 1.59 21 L021Q 1.56 0.86 0.78 0.95 2.07 21 L021R 1.46 0.98 0.79
0.79 1.68 21 L021S 1.12 1.10 1.11 0.84 1.57 21 L021T 1.44 0.97 0.78
0.95 1.86 21 L021V 1.56 0.73 0.78 0.91 2.04 21 L021W 1.58 0.86 0.69
0.98 1.84 22 T022A 1.21 1.29 0.91 0.95 1.47 22 T022C 1.15 0.97 1.18
1.09 1.27 22 T022G 1.14 1.30 1.04 0.97 1.24 22 T022I 1.26 1.04 1.03
1.13 1.46 22 T022K 1.27 0.96 0.80 0.76 1.32 22 T022L 1.36 0.88 0.93
0.95 1.35 22 T022M 1.39 1.03 0.90 0.97 1.34 22 T022N 1.28 0.95 0.88
1.20 1.43 22 T022P 1.25 0.85 0.94 1.12 1.45 22 T022Q 1.31 0.95 0.95
1.02 1.48 22 T022R 1.16 0.94 0.83 0.57 1.34 22 T022S 0.49 1.11 1.01
0.54 22 T022V 1.33 1.04 1.05 1.15 1.31 22 T022W 1.46 1.02 0.88 1.28
1.48 22 T022Y 1.30 0.93 0.82 0.58 1.40 23 G023A 1.73 1.12 0.87 0.95
1.80 23 G023C 23 G023D 23 G023E 23 G023F 23 G023I 23 G023K 23 G023L
23 G023M 23 G023Q 23 G023R 23 G023S 1.32 0.88 0.92 0.82 1.38 23
G023T 24 S024A 1.26 1.17 0.99 0.98 1.51 24 S024C 1.00 1.04 1.24
1.11 1.14 24 S024D 1.38 0.83 1.03 1.13 1.31 24 S024F 1.18 1.24 1.01
1.02 1.47 24 S024G 1.27 1.10 0.91 1.06 1.51 24 S024H 1.21 1.13 0.94
1.08 1.32 24 S024I 0.42 24 S024L 1.35 0.86 1.02 1.12 1.49 24 S024M
1.41 0.87 0.95 1.12 1.36 24 S024N 1.18 1.05 0.97 0.96 1.44 24 S024P
1.50 0.75 0.86 0.95 1.62 24 S024Q 1.34 0.94 0.95 1.05 1.52 24 S024R
1.21 1.03 0.87 1.00 1.29 24 S024T 1.40 0.95 0.98 1.01 1.40 24 S024V
1.25 1.12 1.05 1.10 1.29 24 S024W 1.01 1.05 0.98 1.11 1.08 25 G025C
0.87 1.85 1.16 0.99 1.04 25 G025D 1.16 1.03 1.10 1.13 1.32 25 G025E
1.01 1.39 1.15 1.15 1.21 25 G025F 0.90 1.80 1.18 1.02 1.15 25 G025H
0.56 1.28 1.06 0.75 25 G025K 1.17 1.05 0.88 0.99 1.36 25 G025L 1.24
0.80 0.91 1.12 1.34 25 G025M 0.98 1.39 1.12 0.98 1.15 25 G025N 0.74
4.69 1.24 1.04 0.86 25 G025Q 1.34 0.90 1.01 1.11 1.49 25 G025R 1.05
1.35 0.96 1.01 1.28 25 G025S 0.81 5.94 1.24 0.98 1.03 25 G025T 0.95
1.51 1.23 0.99 1.38 25 G025V 0.98 1.20 1.12 1.03 1.23 25 G025W 1.04
1.36 1.10 1.01 1.28 26 V026C 0.85 1.29 1.09 0.85 1.06 26 V026F 1.38
0.95 1.04 1.00 1.24 26 V026G 1.04 1.04 1.08 0.89 1.14 26 V026I 0.58
1.19 0.86 1.13 0.30 26 V026L 1.68 0.76 0.91 0.67 1.37 26 V026M 1.56
0.91 0.99 0.86 1.54 26 V026N 1.72 0.77 0.97 0.91 1.44 26 V026P 1.13
0.71 0.92 0.74 1.12 26 V026R 1.24 1.24 0.95 0.90 1.30 26 V026S 1.22
1.13 1.10 1.07 1.25 26 V026T 1.32 0.93 0.90 0.97 1.37 26 V026Y 0.29
27 K027A 1.35 0.76 1.08 0.94 1.60 27 K027C 1.07 0.55 1.10 1.14 1.31
27 K027D 1.41 0.75 1.12 1.10 1.46 27 K027F 1.04 0.63 1.23 1.11 1.19
27 K027G 1.51 0.74 0.99 1.10 1.67 27 K027H 27 K027I 0.38 1.73 0.91
0.53 27 K027L 0.97 0.57 1.18 1.08 1.21 27 K027M 0.82 1.01 1.39 0.96
1.03 27 K027N 1.85 0.81 0.90 1.14 1.86 27 K027P 1.92 0.75 0.92 1.10
1.56 27 K027R 1.79 1.11 0.78 1.02 1.85 27 K027S 1.52 1.35 0.96 0.95
1.66 27 K027T 1.18 0.86 1.10 0.96 1.22 27 K027V 0.58 4.24 1.45 0.91
0.74 27 K027W 1.06 0.65 1.02 0.94 1.12 27 K027Y 0.59 3.29 1.68 0.98
1.00 28 V028A 0.85 1.07 1.01 0.84 0.93 28 V028D 0.23 28 V028E 0.37
1.10 1.07 0.33 28 V028G 0.18 0.97 0.07 28 V028H 0.51 8.94 1.17 0.83
0.54 28 V028I 1.39 0.89 1.05 1.07 1.48 28 V028L 1.49 0.83 0.94 0.93
1.28 28 V028M 1.28 0.97 0.99 0.98 1.20 28 V028N 0.41 1.13 1.01 0.44
28 V028P 0.22 0.92 0.98 0.18 28 V028S 0.80 0.79 1.08 1.04 0.70 28
V028W 0.31 28 V028Y 0.41 1.07 0.65 0.41 29 A029C 1.00 1.28 1.04
1.04 1.24 29 A029D 0.39 29 A029E 0.39 29 A029F 0.35 29 A029G 0.98
1.11 1.09 1.00 0.93 29 A029H 0.39 29 A029I 0.17 29 A029K 0.37 1.29
29 A029L 0.17 29 A029P 0.26 29 A029Q 0.25 29 A029R 0.35 29 A029S
0.98 1.28 1.20 0.96 1.04 29 A029T 0.34 1.27 0.79 0.44 29 A029V 0.95
1.13 1.07 0.81 0.96 29 A029Y 0.32 30 V030A 0.98 0.88 0.96 0.95 0.79
30 V030C 1.17 1.00 1.01 1.14 0.94 30 V030D 0.21 1.10 0.05 30 V030E
0.41 1.23 1.09 0.35 30 V030F 0.62 1.57 1.36 0.55 0.29 30 V030G 0.22
30 V030K 0.34 30 V030L 1.14 0.64 1.05 0.97 0.87 30 V030M 1.40 0.62
0.97 0.89 0.70 30 V030Q 0.31 0.98 1.10 0.08 30 V030R 0.40 30 V030S
0.54 4.91 1.16 0.89 0.28 30 V030T 1.05 0.92 1.13 0.90 0.69 30 V030W
0.34 31 L031A 0.90 1.27 1.04 1.04 1.04 31 L031C 0.43 31 L031E 31
L031F 1.54 1.42 0.70 0.94 2.86 31 L031G 31 L031I 1.80 0.92 0.81
1.13 1.20 31 L031M 1.97 1.09 0.81 0.83 2.32 31 L031P 0.08 31 L031R
0.30 31 L031S 1.74 0.93 1.03 0.90 1.15 31 L031T 0.16 3.09 0.94 0.42
31 L031V 1.43 1.20 1.12 0.95 1.41 31 L031Y 32 D032A 0.50 32 D032C
1.09 32 D032E 0.44 32 D032F 0.49 32 D032G 1.57 32 D032H 0.46 32
D032I 0.48 32 D032L 0.39 32 D032M 0.50 32 D032N 0.46 32 D032P 0.45
32 D032R 0.42 32 D032S 0.67 32 D032T 0.58 32 D032V 0.48 32 D032W
0.51 32 D032Y 0.48 33 T033A 1.14 1.22 1.08 0.71 0.40 33 T033C 1.14
0.29 0.97 1.02 0.32 33 T033D 0.95 1.09 1.50 0.62 0.23 33 T033E 0.82
0.81 1.60 0.71 0.09
33 T033F 0.63 0.80 0.80 0.10 33 T033G 1.48 1.22 0.96 0.75 0.49 33
T033H 0.78 2.54 1.14 1.01 0.06 33 T033I 0.45 1.04 0.60 0.06 33
T033L 0.34 1.74 0.80 0.07 33 T033M 1.20 0.99 1.07 0.82 0.85 33
T033N 0.98 0.64 1.28 0.39 0.19 33 T033P 0.58 33 T033Q 0.93 0.77
1.41 0.64 0.41 33 T033R 0.72 2.46 0.93 33 T033S 2.07 0.89 0.72 0.92
1.65 33 T033V 0.43 2.28 0.17 0.06 33 T033W 0.59 0.34 33 T033Y 0.75
0.75 1.17 0.82 0.07 34 G034C 0.33 0.38 34 G034D 0.42 34 G034E 0.40
1.36 0.16 0.06 34 G034F 0.31 34 G034H 0.29 0.81 34 G034K 0.43 34
G034L 0.26 34 G034P 0.33 34 G034Q 0.30 0.98 34 G034R 0.46 34 G034S
0.28 1.18 34 G034T 0.26 0.47 34 G034V 0.27 34 G034W 0.26 34 G034Y
0.37 0.37 35 I035A 1.13 1.09 1.00 0.64 1.07 35 I035F 0.97 0.19 1.15
35 I035H 0.26 2.04 35 I035K 0.36 1.08 0.71 0.19 35 I035L 1.14 0.92
1.05 0.95 1.00 35 I035M 1.16 1.03 1.17 0.82 1.12 35 I035P 0.94 0.69
1.21 1.11 0.50 35 I035Q 0.79 0.87 1.24 0.75 0.63 35 I035R 0.37 1.00
0.77 0.18 35 I035S 0.77 2.18 1.18 0.58 0.91 35 I035Y 0.61 36 S036A
1.48 0.91 0.76 1.02 1.88 36 S036C 0.69 1.54 0.88 0.79 36 S036E 1.10
0.82 1.09 1.16 1.30 36 S036F 0.82 5.10 1.34 0.26 0.74 36 S036G 1.26
0.75 0.86 0.73 1.51 36 S036H 1.52 0.69 0.79 0.79 1.51 36 S036I 1.13
1.06 1.08 0.57 1.30 36 S036L 1.02 1.08 1.19 0.90 36 S036M 1.40 0.71
0.83 0.68 1.56 36 S036N 1.47 0.84 0.81 0.26 1.73 36 S036P 0.43 2.03
0.07 0.12 36 S036Q 1.27 0.94 0.68 0.42 1.69 36 S036R 1.12 1.00 0.75
0.46 1.32 36 S036T 1.35 0.87 0.78 0.83 1.63 36 S036V 1.31 0.82 1.03
0.80 1.56 36 S036W 0.78 17.10 1.29 0.21 0.68 36 S036Y 1.27 0.53
0.92 0.29 0.86 38 T038C 1.34 0.92 0.99 1.01 1.60 38 T038F 1.57 0.78
0.75 0.91 1.81 38 T038G 0.98 1.17 1.09 0.78 1.27 38 T038H 1.51 0.88
0.80 0.90 1.82 38 T038I 1.42 0.90 0.86 1.09 1.71 38 T038K 1.86 0.77
0.55 1.10 2.20 38 T038L 1.47 0.87 0.83 1.08 1.75 38 T038M 0.94 1.64
1.13 0.94 1.17 38 T038N 1.44 0.89 0.79 0.91 1.75 38 T038Q 1.69 0.75
0.68 0.92 1.87 38 T038R 1.80 0.70 0.51 1.22 2.04 38 T038V 1.04 1.37
1.04 1.02 1.31 38 T038W 0.72 1.41 0.99 0.91 38 T038Y 1.26 1.09 0.77
0.80 1.59 39 H039A 0.37 1.72 0.47 39 H039D 0.14 39 H039E 0.63 1.58
0.95 39 H039F 0.19 39 H039G 0.17 1.32 0.09 39 H039K 0.28 39 H039L
0.14 0.98 0.07 39 H039M 0.15 0.86 0.07 39 H039N 0.36 1.66 0.34 39
H039P 0.17 39 H039Q 0.45 1.53 0.52 39 H039R 0.30 39 H039S 0.40 1.58
0.46 39 H039T 0.13 2.04 0.10 39 H039V 0.91 1.70 1.08 1.17 39 H039W
0.21 39 H039Y 0.33 2.16 0.42 40 P040A 1.67 1.03 0.83 0.83 2.20 40
P040C 0.89 2.43 1.68 0.79 1.49 40 P040D 1.03 1.34 1.35 1.12 1.51 40
P040E 0.92 1.93 1.44 1.67 1.40 40 P040G 1.21 1.61 1.10 0.06 1.96 40
P040H 1.51 1.14 0.95 0.22 2.04 40 P040I 1.32 1.25 0.99 1.01 1.81 40
P040K 1.51 1.24 0.75 2.02 40 P040L 1.26 1.21 1.11 1.04 1.85 40
P040M 1.34 1.20 1.09 0.62 1.65 40 P040N 1.71 1.02 0.86 0.59 2.21 40
P040R 1.48 1.15 0.74 0.05 2.20 40 P040S 1.34 1.32 1.00 0.27 2.08 40
P040T 1.42 1.23 0.90 0.18 2.02 40 P040V 1.29 1.23 1.02 1.06 1.70 40
P040W 1.14 1.41 0.96 0.55 1.65 40 P040Y 0.96 1.80 1.14 0.27 1.40 41
D041A 0.19 0.05 41 D041C 0.17 1.65 0.17 41 D041E 1.11 1.19 0.99
1.29 41 D041F 0.18 41 D041G 0.45 41 D041I 0.15 41 D041K 0.13 0.05
41 D041L 0.15 41 D041M 0.19 41 D041N 0.20 1.47 0.17 41 D041P 0.41
0.88 41 D041Q 0.19 2.38 0.21 41 D041R 0.12 41 D041S 0.16 0.90 0.10
41 D041T 0.14 0.08 41 D041V 0.14 41 D041W 0.24 41 D041Y 0.16 42
L042A 0.63 1.60 0.61 42 L042C 0.82 1.99 1.29 0.11 1.08 42 L042D
0.33 42 L042E 0.27 42 L042F 0.79 2.39 1.48 0.91 42 L042G 0.30 1.64
0.24 42 L042H 1.31 0.79 0.94 0.10 1.35 42 L042I 1.56 0.96 0.76 0.63
2.08 42 L042K 0.19 0.07 42 L042M 1.77 0.89 0.66 0.78 2.27 42 L042N
1.20 0.92 1.15 0.14 1.50 42 L042P 0.57 42 L042Q 0.39 2.03 0.38 42
L042R 0.38 42 L042S 0.40 2.19 0.06 0.47 42 L042T 0.84 2.22 1.18
0.10 1.10 42 L042V 1.39 0.87 0.83 0.34 1.74 42 L042Y 0.39 2.41 0.45
43 N043A 1.28 1.01 0.97 1.12 1.71 43 N043C 0.92 1.43 1.38 1.29 1.21
43 N043D 0.98 0.85 1.27 1.29 1.25 43 N043E 1.05 0.94 1.43 1.39 1.34
43 N043F 0.97 1.26 1.23 1.00 1.45 43 N043G 1.64 0.56 0.75 1.12 2.06
43 N043I 1.69 0.82 0.87 0.91 1.92 43 N043L 1.39 0.81 0.97 0.94 1.77
43 N043M 1.70 0.83 0.80 1.16 1.96 43 N043P 1.46 0.82 0.74 1.78 43
N043R 1.47 0.78 0.64 1.84 1.67 43 N043S 1.79 0.86 0.79 1.07 2.36 43
N043T 1.52 1.03 0.87 1.09 1.90 43 N043V 1.52 0.79 0.90 0.77 1.75 43
N043W 1.25 0.85 1.06 0.98 1.62 43 N043Y 1.35 0.86 0.96 1.06 1.67 44
I044A 1.24 0.94 0.93 1.01 1.29 44 I044C 1.52 0.89 0.80 0.86 1.77 44
I044D 1.48 0.77 0.93 1.07 1.76 44 I044F 1.37 0.79 0.98 1.22 1.00 44
I044G 1.51 0.77 0.75 1.19 1.54 44 I044K 1.29 0.98 0.76 1.49 1.48 44
I044L 1.47 0.77 0.92 1.00 1.67 44 I044M 0.95 1.83 1.14 0.95 1.25 44
I044N 1.49 0.77 0.74 0.99 1.68 44 I044P 1.26 0.93 0.91 0.76 1.61 44
I044Q 1.23 0.91 0.93 0.91 1.41 44 I044R 1.05 1.08 0.76 1.57 1.04 44
I044S 1.56 0.79 0.80 1.08 1.56 44 I044T 1.07 1.06 1.13 0.93 1.38 44
I044V 1.28 1.22 0.88 0.90 1.71 44 I044W 1.01 0.52 1.24 0.74 0.12 44
I044Y 1.18 0.98 1.05 0.81 1.25 45 R045A 1.27 1.02 1.13 1.06 1.50 45
R045D 1.26 0.91 1.15 1.32 1.51 45 R045E 0.44 45 R045F 1.35 0.87
1.11 1.21 1.39 45 R045G 1.23 1.00 1.04 1.04 1.36 45 R045H 1.28 1.01
1.06 1.19 1.35 45 R045I 1.40 0.79 0.93 1.22 1.37 45 R045K 1.27 0.91
1.03 1.02 1.49 45 R045L 1.37 0.85 1.02 1.12 1.40 45 R045M 1.44 0.90
0.99 1.19 1.39 45 R045N 1.32 0.95 1.09 1.16 1.44 45 R045P 0.88 0.88
1.11 1.15 0.99 45 R045Q 1.35 1.08 0.93 1.08 1.55 45 R045S 1.28 1.04
1.07 1.10 1.63 45 R045T 1.32 0.96 1.07 1.20 1.40 45 R045V 1.32 0.85
1.09 1.06 1.39 45 R045W 1.30 0.94 1.00 1.04 1.40 45 R045Y 1.22 0.86
1.11 0.97 1.24 46 G046C 0.99 0.75 1.33 1.23 0.84 46 G046D 1.20 0.90
1.15 1.05 1.48 46 G046E 1.24 0.89 1.22 1.11 1.33 46 G046F 0.59 1.45
1.05 0.54 46 G046H 1.10 0.72 1.17 1.13 1.18 46 G046I 1.03 0.97 1.00
1.29 0.98 46 G046K 1.57 0.79 0.70 1.19 1.53 46 G046L 0.83 1.97 1.27
1.17 0.78 46 G046M 0.95 1.29 1.34 1.09 0.96 46 G046N 1.10 0.85 1.11
1.03 1.30 46 G046P 1.24 0.72 0.82 1.22 1.20 46 G046Q 1.08 0.99 1.08
1.04 1.18 46 G046R 1.19 0.92 0.83 1.27 1.35 46 G046S 1.45 0.84 1.00
1.08 1.50 46 G046T 1.26 0.89 1.01 1.03 1.33 46 G046V 1.20 0.86 1.13
1.05 1.17 46 G046W 0.79 25.56 0.96 0.90 0.71 47 G047A 0.89 1.76
1.11 0.76 0.94 47 G047C 0.58 6.57 1.19 0.61 0.45 47 G047E 0.69 1.91
1.54 0.60 0.55 47 G047F 0.92 0.87 1.15 0.59 0.79 47 G047H 0.35 1.10
0.77 0.26 47 G047K 0.61 5.82 0.96 0.57 0.54 47 G047L 0.46 1.21 0.50
0.34 47 G047M 0.62 1.38 1.09 0.54 0.44 47 G047N 0.83 0.97 1.24 0.61
0.75 47 G047P 0.20 47 G047Q 0.73 1.13 1.34 0.44 0.76 47 G047R 1.07
1.13 0.94 0.99 1.04 47 G047S 1.02 1.06 1.13 0.71 1.03 47 G047T 0.80
0.76 1.27 0.57 0.57 47 G047W 1.07 0.80 1.16 0.48 0.85 48 A048C 1.16
0.93 1.19 1.01 1.45 48 A048E 1.25 0.86 1.17 1.01 1.45 48 A048F 1.07
1.15 1.34 1.06 1.23 48 A048G 0.27 1.01 1.12 0.11 48 A048H 1.41 0.94
1.01 0.97 1.63 48 A048I 1.28 0.93 1.07 1.16 1.25 48 A048K 1.51 1.00
0.88 1.14 1.59 48 A048L 1.29 0.89 1.02 1.09 1.37 48 A048M 1.31 1.11
1.05 1.03 1.52 48 A048N 1.24 0.99 1.09 1.08 1.40 48 A048P 1.11 0.77
1.22 0.96 0.98 48 A048Q 1.32 1.15 0.99 1.05 1.55 48 A048R 1.38 1.00
0.86 1.12 1.74 48 A048S 1.26 1.08 1.13 0.94 1.51 48 A048T 1.51 0.85
1.02 1.14 1.46 48 A048V 1.09 0.84 1.11 0.97 1.05 48 A048Y 1.33 0.96
0.84 1.05 1.47 49 S049A 0.96 1.28 1.19 1.02 0.99 49 S049E 0.70 2.15
0.16 0.35 49 S049F 0.74 1.26 1.05 0.59 49 S049G 0.90 1.12 1.35 0.81
0.78 49 S049H 1.09 0.42 0.91 0.92 0.94 49 S049K 0.74 1.39 0.57 0.49
49 S049L 0.59 1.38 1.12 0.35 49 S049M 0.51 1.52 0.99 0.26 49 S049P
0.39 2.01 0.86 0.32 49 S049Q 0.70 1.48 0.62 0.39
49 S049R 0.80 3.76 1.45 0.70 0.65 49 S049T 0.93 1.81 1.16 0.94 1.23
50 F050C 0.79 1.24 1.29 1.11 0.79 50 F050D 0.25 50 F050G 0.23 50
F050H 1.04 1.03 1.16 1.23 0.92 50 F050I 0.81 1.27 1.16 1.12 0.67 50
F050L 1.13 1.12 0.99 1.21 1.07 50 F050N 0.24 1.10 0.99 0.14 50
F050P 0.32 50 F050T 1.24 1.01 1.04 1.13 1.07 50 F050V 1.33 0.96
1.02 1.13 1.01 50 F050Y 1.12 0.95 1.01 1.14 1.10 51 V051F 1.45 0.82
0.84 0.94 1.15 51 V051G 0.61 1.58 0.89 0.40 51 V051H 1.27 0.98 0.93
1.06 1.36 51 V051K 0.92 0.68 1.03 0.93 1.35 51 V051L 1.55 0.83 1.12
0.93 1.28 51 V051N 0.96 0.91 1.11 0.80 0.75 51 V051P 0.34 2.34 0.81
0.13 51 V051R 1.07 0.73 1.05 1.03 1.33 51 V051S 0.96 1.31 1.44 0.98
0.89 51 V051T 1.49 0.84 0.83 0.98 1.53 51 V051W 1.20 1.00 1.07 0.93
0.46 52 P052A 1.23 1.36 1.08 0.94 1.45 52 P052C 0.82 1.43 1.11 0.95
0.91 52 P052E 1.06 1.20 1.21 1.04 1.21 52 P052F 0.92 1.79 1.11 0.88
1.36 52 P052G 0.95 1.72 1.08 0.93 1.24 52 P052H 1.11 1.30 0.98 1.05
1.36 52 P052I 1.00 1.45 1.01 1.02 1.36 52 P052L 1.07 1.31 0.98 0.99
1.32 52 P052M 0.80 2.68 1.11 1.06 1.04 52 P052N 1.21 1.14 1.07 1.05
1.39 52 P052Q 1.15 1.36 1.08 1.00 1.55 52 P052R 1.12 1.28 0.85 0.96
1.61 52 P052T 1.07 1.51 1.18 0.99 1.34 52 P052V 1.00 1.66 1.10 1.03
1.25 52 P052W 1.00 1.74 0.89 0.94 1.31 52 P052Y 1.04 1.52 1.01 0.99
1.30 53 G053A 1.44 0.91 1.06 0.91 1.38 53 G053C 0.88 0.75 1.37 0.96
0.85 53 G053D 1.19 1.13 1.27 1.05 1.05 53 G053E 1.20 0.79 1.28 1.01
1.04 53 G053H 1.25 1.11 0.86 1.00 1.35 53 G053I 1.43 0.18 0.88 0.45
0.34 53 G053K 1.35 0.95 0.94 0.93 1.77 53 G053L 1.16 0.87 1.08 0.95
1.10 53 G053M 1.38 0.92 1.05 0.92 1.41 53 G053P 0.92 0.83 1.23 0.35
0.59 53 G053Q 1.34 0.96 1.06 0.89 1.54 53 G053R 1.37 0.82 0.86 1.00
1.69 53 G053S 1.55 0.88 0.89 0.99 1.52 53 G053T 1.36 0.84 0.97 0.98
1.36 53 G053V 0.99 0.81 1.18 0.46 0.74 53 G053W 1.28 0.97 0.88 0.92
1.10 53 G053Y 1.20 0.87 0.95 0.83 1.23 54 E054A 1.04 1.08 0.89 0.90
1.08 54 E054C 0.83 0.97 1.36 1.00 0.71 54 E054D 1.25 0.95 0.95 1.10
1.54 54 E054F 1.34 1.00 0.93 0.85 1.03 54 E054G 0.77 1.94 1.20 0.56
0.58 54 E054H 1.04 0.90 0.96 0.95 0.99 54 E054I 1.25 0.67 1.07 0.77
0.86 54 E054K 1.09 0.91 0.89 0.79 0.89 54 E054L 1.13 0.75 0.95 0.71
0.79 54 E054M 0.98 1.04 1.03 0.85 0.91 54 E054N 1.08 0.88 1.07 1.00
1.07 54 E054P 1.28 0.73 1.00 0.80 0.97 54 E054Q 1.41 0.75 0.87 1.02
1.74 54 E054R 1.09 0.65 0.79 0.44 0.81 54 E054S 1.41 0.92 0.85 0.91
1.33 54 E054V 1.10 0.73 0.91 0.80 1.16 54 E054W 0.91 0.72 0.99 0.50
0.63 54 E054Y 1.25 0.69 0.78 0.65 1.00 55 P055A 0.22 1.71 1.11 0.08
55 P055C 1.07 0.65 1.16 1.01 1.27 55 P055E 1.22 0.92 0.99 1.09 1.37
55 P055F 1.04 0.85 1.34 0.38 0.76 55 P055G 1.23 1.20 0.95 0.99 1.56
55 P055H 1.22 1.42 1.10 1.06 1.38 55 P055I 1.30 0.84 0.90 0.71 1.20
55 P055K 1.41 1.09 0.85 1.01 1.65 55 P055L 1.16 0.87 1.16 0.87 1.28
55 P055M 1.34 0.90 1.10 0.74 1.27 55 P055N 1.41 0.77 0.88 1.61 55
P055Q 1.31 0.82 0.85 0.85 1.24 55 P055R 2.15 0.49 0.59 55 P055S
1.32 1.08 1.03 0.99 1.45 55 P055T 1.12 0.99 1.07 1.03 1.27 55 P055V
0.46 55 P055W 1.20 0.84 1.07 0.80 1.22 55 P055Y 0.92 0.60 1.38 0.39
0.70 56 S056A 0.86 1.76 1.19 1.05 0.93 56 S056C 1.10 1.01 1.08 0.97
1.28 56 S056D 1.20 0.99 1.12 1.20 1.26 56 S056E 1.08 0.98 1.10 0.98
1.30 56 S056F 0.45 56 S056G 0.43 56 S056H 1.06 1.12 1.02 1.13 1.06
56 S056L 1.14 0.81 1.03 0.94 1.33 56 S056M 1.05 1.62 0.89 1.09 0.16
56 S056N 1.14 1.11 1.08 1.09 1.25 56 S056P 1.19 0.99 1.11 0.99 1.02
56 S056Q 1.18 0.81 1.03 0.85 1.38 56 S056R 1.99 0.48 0.57 56 S056T
0.80 6.42 1.22 0.89 1.01 56 S056V 1.15 0.40 0.71 57 T057A 1.08 1.18
1.11 0.59 1.38 57 T057C 0.84 1.28 1.35 1.00 1.00 57 T057E 1.35 1.14
1.04 0.97 1.65 57 T057F 0.92 1.13 1.26 0.95 1.21 57 T057G 1.10 1.17
1.08 0.85 1.12 57 T057H 1.38 0.99 1.05 1.07 1.65 57 T057I 1.47 0.92
0.90 0.96 1.72 57 T057K 1.08 1.03 1.05 0.41 1.05 57 T057L 1.52 0.95
0.96 1.07 1.50 57 T057M 1.19 1.09 0.97 0.91 1.30 57 T057N 1.45 0.86
1.00 0.96 1.63 57 T057P 1.36 0.88 0.93 1.03 1.73 57 T057Q 1.31 0.92
0.95 0.90 1.38 57 T057R 1.34 0.90 0.96 1.18 1.44 57 T057S 0.99 1.36
1.17 1.07 1.20 57 T057V 1.39 0.90 0.91 0.91 1.60 57 T057W 1.65 0.85
0.85 1.11 1.91 57 T057Y 1.38 0.97 0.86 0.95 1.22 59 Q059A 1.02 1.03
1.11 0.86 1.30 59 Q059C 0.74 1.68 1.23 0.94 0.86 59 Q059D 0.82 1.66
1.32 0.96 0.92 59 Q059E 0.79 1.41 1.48 1.14 0.97 59 Q059F 1.13 0.97
1.08 0.77 1.25 59 Q059G 1.42 0.83 0.79 0.88 1.68 59 Q059I 1.50 0.92
0.85 0.88 1.66 59 Q059K 0.67 0.94 59 Q059L 1.40 0.95 0.96 0.92 1.45
59 Q059M 1.45 0.96 1.05 0.82 1.62 59 Q059N 1.43 0.97 0.95 0.96 1.67
59 Q059P 1.49 0.89 1.04 0.80 1.47 59 Q059R 1.38 0.93 0.77 1.16 1.62
59 Q059S 1.39 0.96 0.97 0.96 1.66 59 Q059T 1.49 0.88 0.93 0.86 1.66
59 Q059V 1.65 0.81 0.92 0.86 1.61 59 Q059W 1.45 0.86 0.89 0.90 1.43
59 Q059Y 1.44 0.88 1.00 0.78 1.67 60 D060A 0.74 2.20 1.25 0.28 60
D060C 0.63 1.07 1.42 0.16 0.17 60 D060E 0.37 60 D060F 0.68 1.06
1.07 0.06 0.20 60 D060G 0.65 3.32 1.34 0.08 0.23 60 D060K 0.47 1.15
0.14 60 D060L 0.64 2.31 1.23 0.07 0.21 60 D060M 0.68 3.41 1.32 0.22
60 D060N 0.58 1.51 0.09 0.27 60 D060P 0.75 1.46 1.12 0.08 0.25 60
D060Q 0.59 1.24 0.05 0.23 60 D060R 0.35 0.66 0.12 0.06 60 D060S
0.86 1.19 1.26 0.39 60 D060T 0.52 1.42 0.24 60 D060V 0.83 0.65 1.10
0.06 0.28 60 D060W 0.59 1.04 0.28 60 D060Y 0.66 1.77 1.33 0.07 0.21
61 G061A 1.42 0.99 0.98 1.02 1.69 61 G061C 1.14 0.88 1.07 0.97 1.52
61 G061D 1.48 0.90 1.00 1.13 1.74 61 G061F 1.45 0.98 0.91 1.01 1.87
61 G061H 1.39 0.89 0.77 1.08 1.74 61 G061I 1.42 0.97 0.91 1.08 2.06
61 G061L 1.33 0.97 0.99 1.07 1.43 61 G061M 1.44 0.87 1.01 1.08 1.79
61 G061N 1.48 0.91 0.86 1.03 1.79 61 G061P 1.23 0.80 0.89 1.02 1.67
61 G061R 1.58 0.84 0.69 1.00 1.81 61 G061S 0.97 1.42 1.06 1.05 1.31
61 G061T 0.88 1.51 1.14 1.09 1.45 61 G061V 0.90 1.35 1.07 1.02 1.48
61 G061Y 0.92 1.06 1.02 0.95 1.12 62 N062C 1.51 0.94 1.02 1.09 1.25
62 N062E 1.79 1.01 1.09 1.10 1.54 62 N062F 0.90 1.18 1.16 0.89 1.00
62 N062G 1.38 1.06 1.08 0.62 0.82 62 N062H 1.14 1.21 1.21 1.07 1.26
62 N062I 1.70 0.98 0.99 1.01 1.26 62 N062K 1.94 0.90 0.73 0.98 1.21
62 N062L 1.10 1.54 1.04 0.92 1.92 62 N062M 1.30 1.08 1.06 0.98 2.03
62 N062P 1.20 1.04 1.19 0.59 0.65 62 N062Q 1.46 1.22 1.10 0.93 1.68
62 N062R 1.90 1.05 0.73 0.95 0.94 62 N062S 1.17 1.46 1.17 0.90 1.64
62 N062T 2.21 0.84 0.89 0.94 3.23 62 N062V 1.73 1.03 1.03 1.05 1.30
62 N062Y 1.31 0.96 1.05 0.73 1.30 63 G063A 1.20 1.06 1.28 0.33 1.37
63 G063C 0.91 0.58 1.35 0.39 0.80 63 G063D 0.89 0.80 1.33 0.24 0.79
63 G063E 1.23 0.84 1.30 0.43 1.00 63 G063F 0.90 1.01 1.11 0.60 63
G063H 1.10 0.77 1.21 0.11 0.95 63 G063I 0.44 1.44 0.46 63 G063K
1.22 0.80 0.83 1.59 63 G063M 0.87 1.11 1.28 0.88 63 G063P 0.44 1.46
0.22 63 G063Q 1.07 1.06 1.14 0.07 0.99 63 G063R 1.07 0.98 0.87 1.28
63 G063S 1.19 0.90 1.21 0.31 1.31 63 G063T 0.66 3.06 1.49 0.09 0.62
63 G063V 0.50 1.46 0.53 63 G063W 1.37 0.81 0.87 2.28 64 H064D 0.51
64 H064E 0.56 64 H064F 0.51 64 H064G 0.40 64 H064I 0.55 64 H064K
0.53 64 H064L 0.40 64 H064M 0.44 64 H064N 0.61 64 H064Q 0.77 64
H064R 0.44 64 H064S 0.55 64 H064T 0.53 64 H064W 0.40 65 G065C 0.39
65 G065F 0.46 65 G065H 0.36 65 G065K 0.38 65 G065L 0.37 65 G065M
0.42 65 G065N 0.37 65 G065R 0.39 65 G065T 0.35 65 G065W 0.37 66
T066A 0.25 1.76 0.09 0.06 66 T066C 0.34 2.11 0.28 0.17 66 T066D
0.28 1.69 0.12 0.09 66 T066E 0.25 1.79 0.05 66 T066F 0.21 66 T066I
0.23 2.39 0.13 0.09 66 T066K 0.17 2.46 1.03 0.12 66 T066L 0.23 1.85
0.05 0.08 66 T066N 0.21 1.28 0.05 0.09 66 T066Q 0.22 2.31 0.13 66
T066R 0.36 66 T066S 1.07 1.11 1.13 0.66 1.13 66 T066W 0.32 66 T066Y
0.25 67 H067A 1.47 0.56 0.49 0.59 0.30 67 H067C 1.24 0.73 0.59 0.07
0.22 67 H067D 0.26 67 H067E 0.54 0.58 67 H067F 0.38 1.73 0.15
67 H067G 0.65 0.79 0.05 67 H067I 0.67 0.70 67 H067L 1.71 0.40 0.32
0.37 0.08 67 H067M 1.82 0.39 0.40 0.77 0.12 67 H067N 0.40 1.12 0.05
0.10 67 H067P 1.85 0.43 0.43 0.25 0.37 67 H067Q 1.83 0.43 0.34 0.28
0.11 67 H067R 1.59 0.34 0.21 67 H067S 1.54 0.58 0.54 0.46 0.32 67
H067T 1.20 0.84 0.61 0.20 67 H067V 0.54 1.15 67 H067W 0.18 68 V068A
1.55 0.72 0.78 0.38 0.33 68 V068C 0.59 1.87 0.63 0.66 68 V068D 0.25
1.71 68 V068E 1.22 0.34 0.87 68 V068F 0.43 68 V068G 0.64 1.55 0.05
68 V068H 1.41 68 V068I 1.23 0.91 1.07 0.96 0.75 68 V068K 0.46 68
V068L 1.37 0.62 0.88 0.87 0.18 68 V068M 1.26 0.68 0.74 0.27 0.08 68
V068N 1.77 0.28 0.71 68 V068P 0.33 68 V068Q 2.13 0.16 0.38 68 V068R
0.37 68 V068S 1.80 0.57 0.71 0.27 0.11 68 V068T 1.10 1.05 1.06 0.30
0.56 68 V068W 0.46 68 V068Y 0.40 69 A069C 0.49 1.48 0.59 0.29 69
A069D 0.33 69 A069E 0.28 1.24 0.87 0.32 69 A069F 0.29 1.25 0.22
0.16 69 A069G 0.99 1.22 1.09 0.86 1.12 69 A069I 0.23 1.48 0.25 0.07
69 A069K 0.20 69 A069L 0.19 1.33 69 A069M 0.54 1.49 69 A069N 0.51
1.24 0.98 0.54 69 A069P 0.26 69 A069Q 0.21 69 A069R 0.19 69 A069S
1.10 1.13 1.08 0.90 1.21 69 A069T 0.91 1.06 1.14 1.00 0.97 69 A069V
0.40 1.40 0.67 0.46 69 A069W 0.51 1.32 0.48 0.35 69 A069Y 0.19 0.76
0.08 70 G070C 0.40 70 G070D 0.33 70 G070E 0.42 70 G070I 0.40 70
G070K 0.46 70 G070N 0.28 70 G070P 0.50 70 G070Q 0.30 70 G070R 0.48
70 G070S 0.35 70 G070V 0.35 70 G070Y 0.43 71 T071A 1.03 1.43 1.21
0.91 71 T071C 0.66 2.03 1.65 0.64 71 T071D 0.18 1.17 71 T071E 0.13
1.15 0.06 71 T071F 0.18 71 T071G 0.63 1.58 0.06 0.59 71 T071H 0.21
71 T071I 1.11 1.26 0.97 0.72 1.05 71 T071K 0.15 71 T071L 0.67 1.13
1.04 0.12 0.52 71 T071M 0.30 2.00 0.20 71 T071N 0.95 1.75 1.20 1.44
71 T071P 0.57 1.59 0.67 71 T071R 0.19 71 T071S 0.74 5.02 1.36 0.71
0.89 71 T071V 1.11 1.17 1.03 0.57 0.88 71 T071W 0.26 1.88 0.60 0.18
71 T071Y 0.31 72 I072C 0.76 1.96 1.21 0.93 0.80 72 I072D 0.27 72
I072E 0.25 0.05 72 I072F 1.17 1.17 0.84 0.72 1.23 72 I072G 0.42 72
I072H 0.34 1.26 0.74 0.28 72 I072K 0.22 72 I072L 1.48 0.89 0.87
0.98 1.24 72 I072M 1.03 1.41 1.01 0.80 1.05 72 I072N 0.33 1.29 0.71
0.26 72 I072Q 0.38 1.23 0.77 0.32 72 I072R 0.48 0.27 72 I072S 0.69
1.71 1.19 0.73 0.78 72 I072T 1.38 1.02 0.94 0.95 1.09 72 I072V 1.19
1.07 1.10 1.12 1.24 72 I072W 0.26 1.17 0.47 0.18 73 A073C 1.00 1.51
1.02 0.81 1.30 73 A073D 0.88 1.50 1.13 0.32 1.03 73 A073E 1.09 1.17
1.03 0.42 1.33 73 A073H 0.90 1.30 1.18 0.26 1.23 73 A073I 0.26 73
A073K 0.97 1.11 0.85 0.24 1.09 73 A073L 1.02 1.04 1.12 0.48 1.10 73
A073M 0.55 73 A073N 1.27 1.08 0.93 0.23 1.39 73 A073R 0.18 3.24
0.20 0.21 73 A073S 0.97 1.18 1.17 1.02 1.11 73 A073T 1.27 1.10 0.87
0.74 1.55 73 A073V 1.16 1.09 1.06 0.63 1.49 73 A073W 0.24 74 A074C
1.12 1.08 0.98 1.44 74 A074D 0.34 74 A074E 0.59 74 A074F 0.34 74
A074I 0.43 74 A074L 0.33 74 A074M 0.23 74 A074N 0.23 74 A074P 0.24
74 A074Q 0.53 74 A074R 0.36 74 A074S 1.15 1.10 1.03 0.07 1.24 74
A074T 0.47 1.10 0.59 74 A074V 0.19 74 A074W 0.26 75 L075A 0.88 2.41
1.23 1.25 75 L075C 0.52 1.50 0.32 0.83 75 L075D 0.77 3.90 1.71 1.23
75 L075E 0.77 4.37 1.70 1.10 75 L075F 0.72 3.86 1.47 1.02 75 L075G
0.72 4.00 1.53 0.40 75 L075H 0.82 2.72 1.31 0.98 75 L075I 1.12 1.13
1.19 0.11 1.43 75 L075M 1.01 1.50 1.24 0.09 1.36 75 L075N 1.04 1.52
1.08 1.52 75 L075P 0.80 2.62 1.31 1.34 75 L075Q 1.03 1.65 1.22 1.40
75 L075R 0.94 1.94 1.15 0.05 1.32 75 L075S 0.89 2.48 1.35 1.29 75
L075T 0.68 1.17 1.43 1.11 75 L075V 0.99 1.56 1.28 1.34 75 L075W
0.55 1.73 0.84 76 N076C 0.60 1.56 1.15 0.07 0.74 76 N076D 1.43 1.03
0.99 1.19 1.64 76 N076E 1.41 1.05 1.09 0.22 1.66 76 N076F 0.81 1.45
0.94 1.05 76 N076G 1.10 1.28 0.93 1.41 76 N076H 1.40 0.97 0.97 0.49
1.47 76 N076I 0.65 3.73 1.16 0.74 76 N076K 1.33 1.08 0.89 1.40 76
N076L 0.78 0.91 1.07 0.81 76 N076M 0.96 1.01 1.00 0.99 76 N076Q
1.62 0.87 0.96 0.12 1.70 76 N076R 1.30 0.97 0.72 1.27 76 N076S 1.29
0.97 0.87 1.36 76 N076T 1.07 0.92 1.04 1.08 76 N076W 1.09 1.15 0.91
1.22 76 N076Y 0.93 1.15 1.12 1.01 77 N077A 0.21 1.81 0.11 77 N077C
0.23 2.82 0.07 0.17 77 N077D 0.86 2.01 1.46 1.30 77 N077E 0.22 2.55
0.14 77 N077F 0.20 2.11 0.14 77 N077G 0.25 2.04 0.27 77 N077H 0.24
2.37 0.19 77 N077K 0.17 2.60 0.16 77 N077L 0.17 2.22 0.12 77 N077M
0.21 1.53 0.11 77 N077P 0.26 77 N077Q 0.24 2.70 0.37 77 N077R 0.20
1.43 0.16 77 N077S 0.44 2.06 0.56 77 N077T 77 N077V 0.15 2.33 0.12
77 N077Y 0.18 3.14 0.15 78 S078A 1.10 1.30 1.17 1.07 1.43 78 S078C
0.96 1.38 1.20 1.24 1.18 78 S078E 1.26 0.93 1.01 1.24 1.73 78 S078F
1.08 1.33 1.02 0.69 1.34 78 S078G 1.20 1.14 1.08 1.43 78 S078H 1.18
1.11 1.09 1.22 1.47 78 S078I 1.04 1.38 1.13 0.44 1.33 78 S078K 1.20
1.19 0.82 0.58 1.33 78 S078L 0.94 1.45 1.11 0.98 1.08 78 S078M 1.09
1.12 1.09 1.11 1.35 78 S078N 1.17 1.19 0.93 1.35 1.42 78 S078P 1.18
1.11 0.98 0.07 1.45 78 S078Q 1.18 1.05 0.91 1.14 1.46 78 S078R 1.21
1.10 0.75 0.74 1.53 78 S078T 0.87 1.81 1.64 1.31 1.09 78 S078V 0.89
1.68 1.26 0.63 1.10 78 S078W 0.70 8.50 1.31 0.33 0.91 78 S078Y 1.09
1.00 1.00 0.69 1.36 79 I079C 0.91 2.06 1.33 1.22 79 I079D 1.14 1.02
1.13 1.50 79 I079E 1.11 1.10 1.21 1.47 79 I079F 1.10 1.16 1.03 0.67
1.28 79 I079G 0.85 3.12 1.15 1.08 79 I079K 1.50 0.71 0.65 1.78 79
I079L 1.26 0.91 0.87 0.11 1.61 79 I079M 0.75 4.59 1.44 1.12 79
I079N 0.92 2.30 1.17 1.24 79 I079P 0.27 2.25 0.22 79 I079Q 1.46
0.73 0.75 1.81 79 I079R 1.19 0.96 0.83 1.48 79 I079S 0.82 6.60 1.28
1.15 79 I079T 0.85 3.62 1.42 1.28 79 I079V 1.02 1.34 0.93 1.38 79
I079W 1.05 1.20 1.07 0.12 1.32 79 I079Y 0.89 1.89 1.30 0.50 1.05 80
G080A 0.31 1.92 0.35 80 G080D 0.27 2.80 0.21 80 G080E 0.29 2.61
0.28 80 G080K 0.29 2.05 0.26 80 G080L 0.31 2.17 0.25 0.25 80 G080M
0.43 1.62 0.45 80 G080P 0.34 80 G080R 0.23 1.51 0.20 80 G080T 0.24
2.33 0.22 80 G080V 0.50 1.24 0.22 80 G080W 0.23 1.45 0.15 80 G080Y
0.66 1.33 0.73 81 V081A 0.75 2.80 1.45 0.86 81 V081C 0.86 3.09 1.28
1.01 81 V081D 0.12 1.46 0.07 0.06 81 V081E 0.29 2.85 0.30 81 V081F
1.21 0.94 0.86 0.66 81 V081G 0.90 2.53 1.23 0.54 81 V081H 1.22 0.90
1.01 0.55 81 V081I 1.44 0.69 0.73 1.22 81 V081K 0.76 0.99 1.11 0.79
81 V081L 1.19 1.03 0.98 1.43 81 V081M 1.16 1.04 1.02 1.25 81 V081P
0.38 2.50 0.52 81 V081Q 0.82 2.73 1.11 0.84 81 V081R 0.73 1.12 0.67
81 V081S 0.90 3.07 1.11 0.65 81 V081T 1.13 1.06 0.95 0.18 0.73 81
V081W 0.38 1.98 0.24 81 V081Y 1.20 0.84 0.92 0.28 0.59 82 L082A
0.92 1.23 1.23 1.02 82 L082E 0.83 1.61 1.18 0.98 82 L082F 1.06 1.07
0.94 1.27 82 L082G 0.19 0.92 82 L082H 0.37 82 L082K 1.24 1.07 0.77
1.23 82 L082M 1.21 1.22 0.99 1.37 82 L082N 0.59 1.49 0.65 82 L082P
0.17 0.05 82 L082Q 1.17 1.00 1.00 1.21 82 L082R 0.93 1.04 0.99 0.91
82 L082S 0.61 2.58 1.38 0.65
82 L082T 1.01 1.33 1.18 1.05 82 L082V 1.10 1.06 1.16 0.18 1.26 82
L082W 0.13 2.32 0.06 0.10 82 L082Y 0.92 1.45 1.32 0.94 83 G083D
0.49 83 G083F 0.45 83 G083H 0.36 83 G083I 0.55 83 G083L 0.49 83
G083N 0.49 83 G083P 0.31 83 G083R 0.27 83 G083S 1.20 0.99 1.00 1.37
83 G083V 0.44 84 V084C 1.04 1.00 1.01 0.90 1.18 84 V084E 0.90 1.04
1.05 0.18 0.85 84 V084F 0.77 1.42 1.03 0.88 84 V084G 1.21 0.99 1.12
0.88 1.29 84 V084H 0.18 1.25 0.10 0.18 84 V084I 1.28 0.86 1.03 0.84
1.34 84 V084L 1.19 1.00 1.02 0.67 1.33 84 V084M 1.32 0.94 0.92 0.91
1.35 84 V084N 0.98 1.31 0.97 0.57 1.11 84 V084P 0.16 0.72 0.17 0.07
84 V084Q 0.45 1.35 0.52 84 V084R 0.28 84 V084S 0.23 0.80 0.74 0.14
84 V084T 1.06 1.16 1.01 0.76 1.20 84 V084W 0.23 84 V084Y 0.21 85
A085C 0.66 3.56 1.30 0.86 0.77 85 A085E 0.28 85 A085F 0.28 85 A085G
0.26 85 A085I 0.87 4.15 0.78 85 A085L 0.22 1.08 0.08 0.16 85 A085M
0.20 85 A085N 0.15 0.86 0.27 0.09 85 A085Q 0.22 85 A085R 0.38 85
A085W 0.26 86 P086A 1.02 0.91 1.09 0.74 1.14 86 P086C 1.01 0.96
1.01 1.00 1.03 86 P086D 0.62 3.78 1.39 1.23 0.74 86 P086E 0.68 1.77
1.27 0.84 0.86 86 P086G 0.89 1.22 1.13 0.07 1.06 86 P086I 0.68 1.55
1.07 0.15 0.71 86 P086L 0.50 1.23 0.63 86 P086M 86 P086R 0.22 0.83
0.22 86 P086S 1.00 1.31 1.01 0.79 1.19 86 P086V 0.80 1.35 1.07 0.09
0.95 86 P086W 0.89 1.44 1.02 0.57 1.17 86 P086Y 0.96 1.38 0.93 0.77
1.20 87 S087A 1.20 1.19 1.03 0.82 1.36 87 S087C 1.21 1.04 1.05 0.93
1.32 87 S087D 1.26 1.15 1.14 1.17 1.46 87 S087E 1.38 1.01 1.02 1.14
1.57 87 S087F 0.95 1.17 1.19 0.62 1.06 87 S087G 1.35 1.01 0.99 0.92
1.33 87 S087I 1.37 0.89 0.97 0.57 1.37 87 S087K 1.35 0.99 0.92 0.84
1.18 87 S087L 1.37 0.93 0.99 0.97 1.34 87 S087N 1.37 0.97 0.98 0.95
1.50 87 S087P 0.22 1.01 0.60 0.17 87 S087T 1.33 1.01 1.00 0.79 1.39
87 S087V 1.40 0.96 1.00 0.96 1.44 87 S087Y 1.35 0.92 0.95 0.62 1.42
88 A088C 0.87 2.13 1.31 0.92 1.12 88 A088D 0.82 5.32 1.41 0.74 1.23
88 A088E 0.72 5.29 1.46 0.75 1.05 88 A088F 0.24 88 A088G 1.68 0.57
0.82 0.96 1.93 88 A088H 0.22 1.88 0.69 0.23 88 A088K 0.24 2.99 0.69
0.33 88 A088M 0.48 1.97 0.78 0.59 88 A088Q 0.96 1.63 1.33 0.68 1.28
88 A088R 0.12 2.18 0.10 0.09 88 A088S 0.92 1.85 1.44 1.00 1.17 88
A088V 0.78 4.36 88 A088W 0.23 2.85 0.93 0.26 88 A088Y 0.18 89 E089A
0.91 1.97 1.09 0.85 1.15 89 E089C 0.79 3.65 1.19 1.00 0.96 89 E089D
1.06 1.19 1.07 1.00 1.37 89 E089F 0.63 1.27 0.92 0.89 89 E089G 1.01
1.64 1.04 0.90 1.41 89 E089H 1.02 1.50 1.00 0.97 1.31 89 E089I 0.92
1.36 1.09 0.97 1.13 89 E089L 0.66 1.10 1.03 0.78 89 E089M 0.27 89
E089N 1.15 1.39 0.94 0.86 1.64 89 E089P 1.30 0.94 0.95 0.80 1.46 89
E089Q 1.30 1.11 0.89 0.96 1.47 89 E089R 0.92 1.81 0.87 1.13 1.21 89
E089S 1.12 1.33 1.06 0.86 1.51 89 E089T 0.90 1.82 1.02 0.89 1.08 89
E089V 0.78 3.34 1.14 0.93 0.86 89 E089W 0.93 1.35 1.07 0.99 1.03 90
L090A 0.97 1.08 0.98 0.75 1.25 90 L090C 0.81 0.98 1.06 0.97 0.90 90
L090D 0.26 90 L090E 0.41 1.38 0.79 0.47 90 L090F 0.84 1.16 1.27
0.48 0.95 90 L090G 0.43 1.27 0.82 0.52 90 L090I 1.31 0.91 0.97 1.21
1.31 90 L090K 0.30 1.08 0.82 0.28 90 L090M 1.51 0.98 0.86 1.01 1.72
90 L090P 0.40 1.15 0.74 0.36 90 L090Q 1.09 0.93 0.91 0.97 1.25 90
L090R 0.25 90 L090T 1.23 1.02 0.88 0.93 1.31 90 L090V 1.06 1.25
1.04 0.97 1.39 90 L090W 0.36 1.63 0.26 0.21 90 L090Y 0.72 1.79 1.22
0.49 0.89 91 Y091C 0.69 45.17 1.24 0.99 0.96 91 Y091D 1.09 1.12
1.07 0.94 1.39 91 Y091F 1.07 1.23 1.13 0.92 1.49 91 Y091I 1.00 1.26
1.22 1.03 1.19 91 Y091K 0.22 1.32 1.14 0.14 91 Y091L 0.55 1.49 1.11
0.66 91 Y091M 0.74 6.69 1.32 1.01 0.97 91 Y091N 1.05 1.12 1.06 0.96
1.26 91 Y091P 0.43 91 Y091Q 0.32 1.84 0.96 0.39 91 Y091R 0.24 1.29
1.03 0.20 91 Y091S 0.90 1.40 1.23 0.90 1.02 91 Y091T 0.68 1.72 1.19
0.92 0.86 91 Y091V 1.07 1.11 1.19 1.09 1.15 91 Y091W 1.10 1.15 1.04
1.03 1.25 92 A092C 0.54 1.75 0.31 0.37 92 A092D 1.17 0.83 1.31 0.44
0.48 92 A092E 0.60 1.91 0.08 0.21 92 A092F 0.49 1.83 92 A092G 1.07
1.23 1.28 0.94 1.27 92 A092H 0.21 2.34 92 A092I 0.74 2.38 1.45 0.75
0.67 92 A092K 0.28 1.98 0.65 0.21 92 A092L 0.21 2.22 0.05 92 A092N
1.02 1.05 1.12 0.62 0.89 92 A092P 1.52 0.70 1.10 1.12 1.46 92 A092Q
0.34 2.14 0.10 0.28 92 A092R 0.94 1.10 0.95 1.00 0.96 92 A092T 0.87
1.74 1.32 0.80 0.93 92 A092V 0.93 1.48 1.25 0.82 1.11 92 A092W 0.27
2.43 0.34 0.23 92 A092Y 0.35 2.14 0.46 0.25 93 V093A 0.97 1.22 1.06
0.89 0.87 93 V093C 1.03 1.17 1.08 1.02 1.02 93 V093D 0.26 0.87 1.00
0.11 93 V093F 0.20 0.60 1.09 0.10 93 V093G 0.95 1.00 1.15 0.92 0.87
93 V093H 0.28 93 V093K 0.46 93 V093L 1.26 0.89 1.00 1.11 1.38 93
V093M 0.91 0.74 1.06 1.00 0.85 93 V093N 0.22 0.57 1.09 0.09 93
V093P 0.25 93 V093R 0.46 93 V093S 0.34 1.42 0.99 0.24 93 V093T 1.45
0.82 0.91 1.05 1.22 93 V093W 0.31 0.83 93 V093Y 0.33 1.41 1.11 0.29
94 K094A 0.30 1.53 0.25 0.07 94 K094D 0.36 1.33 94 K094E 0.63 1.54
0.10 0.20 94 K094F 0.40 94 K094G 0.27 1.83 94 K094H 0.46 2.33 0.09
0.08 94 K094I 0.31 2.52 0.05 94 K094L 0.24 1.48 94 K094M 0.25 2.47
0.35 0.07 94 K094N 1.01 0.97 1.21 0.77 0.39 94 K094P 0.23 94 K094Q
0.80 1.10 1.49 0.10 0.39 94 K094R 1.01 1.35 1.23 0.86 0.86 94 K094S
0.42 94 K094T 0.53 94 K094V 0.55 1.77 0.14 0.23 94 K094W 0.31 94
K094Y 0.28 95 V095A 1.56 0.92 0.88 0.98 1.47 95 V095C 1.08 0.93
1.21 1.10 1.04 95 V095D 0.47 95 V095E 0.25 95 V095F 0.32 95 V095G
0.44 1.23 1.07 0.40 95 V095H 0.48 95 V095I 1.21 1.33 1.19 0.98 0.37
95 V095K 0.46 1.64 0.95 0.33 95 V095L 0.35 1.80 95 V095M 0.34 1.28
95 V095P 0.37 95 V095Q 0.40 95 V095R 0.55 1.49 0.98 0.38 95 V095S
1.07 1.00 1.04 0.99 0.70 95 V095T 0.97 1.50 1.06 0.79 0.77 95 V095W
0.19 1.87 0.98 0.10 95 V095Y 0.44 96 L096A 1.93 0.78 0.72 96 L096C
0.47 96 L096D 0.60 0.56 96 L096E 1.41 0.14 1.06 96 L096F 2.15 0.76
0.85 0.92 0.32 96 L096G 2.30 0.36 0.58 96 L096H 2.15 0.53 0.85 96
L096I 1.47 1.20 0.98 1.11 1.47 96 L096M 1.12 1.36 1.17 1.09 1.14 96
L096P 0.41 96 L096Q 2.16 0.58 0.76 1.03 0.32 96 L096R 1.62 0.10
0.50 96 L096S 1.92 0.74 0.84 96 L096T 1.65 1.01 0.98 96 L096W 0.77
1.52 0.78 96 L096Y 1.17 0.27 0.79 97 G097A 1.06 1.29 1.23 0.93 1.32
97 G097D 1.00 1.76 1.38 1.12 0.45 97 G097E 1.29 1.13 1.15 1.10 0.89
97 G097F 1.31 0.86 0.91 1.05 0.71 97 G097H 1.17 1.20 1.10 1.07 1.13
97 G097I 0.76 1.49 1.50 1.12 0.34 97 G097K 1.24 0.92 0.88 1.15 2.02
97 G097L 1.71 0.70 0.83 1.13 1.13 97 G097M 1.48 0.71 0.93 0.90 1.26
97 G097N 1.41 0.96 0.93 0.99 1.18 97 G097P 2.33 0.78 0.60 1.23 5.70
97 G097Q 1.02 0.95 1.20 1.01 1.34 97 G097R 1.08 0.99 0.87 1.10 2.25
97 G097S 1.32 1.03 1.00 0.92 1.50 97 G097T 1.06 1.26 1.21 0.95 1.13
97 G097V 1.03 1.11 1.33 1.05 0.68 97 G097W 1.24 0.91 0.88 0.91 0.60
97 G097Y 1.33 1.10 0.98 1.12 0.74 98 A098C 0.82 8.98 1.36 1.05 0.92
98 A098D 0.98 1.11 1.49 1.13 1.14 98 A098E 0.91 2.10 1.60 1.12 1.33
98 A098F 0.84 4.17 1.40 0.96 1.30 98 A098G 1.10 1.08 1.19 1.03 1.00
98 A098K 1.62 0.78 0.73 1.13 1.97 98 A098L 1.17 1.02 1.12 1.19 1.61
98 A098N 1.29 0.91 0.98 0.99 1.92 98 A098P 1.25 0.68 1.09 0.95 1.23
98 A098Q 1.47 0.86 0.87 1.03 2.08 98 A098R 1.45 0.96 0.70 0.95 2.03
98 A098S 1.31 1.02 0.98 1.05 1.58 98 A098T 1.39 0.81 0.95 0.94 2.17
98 A098V 1.09 1.29 1.13 1.07 1.62 98 A098Y 1.13 0.99 1.06 0.99 1.41
99 S099A 1.26 1.17 1.04 0.98 1.42 99 S099C 0.84 1.38 1.19 0.91 0.69
99 S099E 0.40
99 S099F 1.03 0.86 0.92 0.97 1.10 99 S099G 1.19 1.31 1.07 0.88 1.41
99 S099K 1.33 1.10 0.88 1.05 1.60 99 S099L 99 S099M 1.34 0.90 1.09
1.01 1.34 99 S099P 1.17 0.89 1.12 1.11 0.61 99 S099Q 1.34 0.96 1.04
1.08 1.33 99 S099R 1.24 0.96 0.75 1.05 1.48 99 S099T 1.24 1.14 1.06
1.00 1.18 99 S099V 1.28 0.84 0.98 1.09 1.40 99 S099Y 1.24 0.76 0.97
1.00 1.26 100 G100D 1.63 0.69 1.05 1.06 0.31 100 G100E 2.32 0.74
0.84 1.01 1.02 100 G100F 1.12 0.50 0.73 100 G100I 1.65 1.01 0.86
1.16 1.68 100 G100K 2.67 0.83 0.55 1.00 0.20 100 G100L 2.51 0.78
0.66 1.11 0.19 100 G100M 2.79 0.60 0.67 0.96 0.17 100 G100N 2.75
0.86 0.65 0.94 0.91 100 G100P 0.62 1.01 0.98 0.10 100 G100Q 3.36
0.55 0.60 1.01 0.50 100 G100R 2.68 0.86 0.63 1.07 0.15 100 G100S
2.34 0.84 0.84 1.04 1.17 100 G100T 1.91 0.92 0.81 0.93 0.67 100
G100V 1.07 1.17 0.81 1.03 0.15 100 G100W 0.69 9.51 0.84 100 G100Y
0.94 1.31 1.10 1.00 0.13 101 S101A 1.11 1.35 0.95 1.04 1.25 101
S101C 0.96 0.44 0.85 0.87 0.19 101 S101D 1.29 1.36 1.22 1.05 0.62
101 S101E 1.46 1.31 1.10 1.08 0.66 101 S101F 1.39 1.23 0.87 1.16
2.18 101 S101G 1.32 0.96 1.06 1.06 1.45 101 S101H 1.34 1.24 1.06
1.21 1.65 101 S101I 1.45 1.11 0.79 1.11 1.29 101 S101K 1.39 1.32
0.91 1.23 1.77 101 S101N 1.34 1.18 1.11 1.07 1.42 101 S101P 1.51
0.89 1.15 1.33 2.74 101 S101Q 1.49 1.15 1.02 1.03 1.37 101 S101R
1.35 1.34 0.73 1.10 2.15 101 S101T 1.37 1.30 1.07 1.10 1.29 101
S101V 1.47 1.17 0.80 1.07 1.22 101 S101W 0.28 101 S101Y 1.38 1.36
0.77 1.04 2.11 102 G102A 1.46 1.05 1.05 1.02 0.59 102 G102C 1.04
0.21 1.08 102 G102D 0.61 1.42 0.99 0.06 102 G102E 0.57 1.65 102
G102F 0.68 1.09 0.44 102 G102H 0.58 1.34 102 G102I 0.56 102 G102K
0.48 102 G102L 0.63 0.24 102 G102M 0.58 0.74 1.22 102 G102N 0.74
1.25 1.47 1.08 0.21 102 G102P 0.50 102 G102S 0.52 102 G102T 1.21
0.97 1.12 1.00 0.26 102 G102V 0.49 0.33 102 G102Y 0.79 0.50 0.72
103 S103A 1.08 1.18 1.17 1.10 1.29 103 S103C 0.96 0.63 0.88 1.07
0.52 103 S103D 0.93 0.81 1.32 1.09 0.47 103 S103E 0.73 0.80 1.13
1.12 0.27 103 S103F 1.22 0.83 0.83 0.98 1.24 103 S103G 0.84 1.22
1.09 0.91 0.71 103 S103I 0.85 1.20 0.95 0.98 0.72 103 S103L 1.28
0.93 0.98 1.06 1.52 103 S103N 1.25 1.08 1.06 1.08 0.84 103 S103P
1.05 1.10 1.00 1.09 1.20 103 S103Q 1.15 1.09 1.10 1.02 1.25 103
S103R 1.37 0.88 0.82 1.03 1.93 103 S103T 1.28 1.20 1.08 0.95 1.16
103 S103V 0.93 1.15 0.98 0.89 1.01 103 S103W 1.03 0.96 0.88 0.93
0.97 103 S103Y 1.12 0.95 0.81 0.72 1.18 104 V104A 0.73 2.15 0.99
0.89 0.27 104 V104C 1.24 0.41 1.02 1.03 0.21 104 V104D 0.50 1.18
1.13 0.11 104 V104E 0.60 1.43 1.41 1.11 0.16 104 V104F 1.05 0.94
0.90 1.31 4.30 104 V104G 0.30 0.68 0.89 0.06 104 V104H 1.22 0.91
0.97 1.02 1.25 104 V104I 1.32 0.90 1.05 1.23 2.84 104 V104L 1.33
0.88 1.00 0.95 3.16 104 V104P 0.60 1.16 1.08 1.16 0.07 104 V104R
1.11 1.11 0.85 0.96 1.00 104 V104S 1.01 1.04 0.98 0.83 0.57 104
V104T 1.01 1.09 1.04 1.07 1.23 104 V104W 0.96 0.67 0.88 0.96 4.85
104 V104Y 0.98 1.07 0.77 1.03 3.89 105 S105A 1.29 0.88 0.97 1.00
1.62 105 S105C 1.13 0.44 1.00 1.04 0.89 105 S105D 1.02 0.56 1.26
1.02 1.04 105 S105E 1.13 0.62 1.25 1.00 1.11 105 S105F 0.90 1.10
0.97 1.00 1.08 105 S105G 0.87 1.23 1.33 0.96 1.12 105 S105H 0.79
1.40 1.08 1.10 0.74 105 S105I 0.45 1.58 0.99 0.63 105 S105K 1.60
1.03 0.70 0.93 2.20 105 S105L 1.00 0.83 0.97 1.05 1.21 105 S105M
0.80 0.76 0.67 1.12 0.36 105 S105N 1.10 0.73 1.01 1.06 1.14 105
S105P 0.31 105 S105Q 1.41 0.72 0.98 0.92 1.51 105 S105R 1.43 0.78
0.72 0.94 1.57 105 S105T 1.62 0.88 0.83 0.92 1.77 105 S105V 0.85
1.28 1.11 0.89 1.26 105 S105W 0.28 1.15 0.94 0.36 105 S105Y 0.49
1.31 0.84 0.61 106 S106A 1.35 1.16 0.82 0.96 1.94 106 S106D 1.37
0.78 1.15 1.00 1.57 106 S106E 1.53 0.89 1.14 1.02 1.05 106 S106F
0.43 1.42 1.05 0.53 106 S106G 1.18 1.18 1.11 1.04 1.65 106 S106I
0.99 1.13 1.16 1.09 1.43 106 S106L 1.16 1.33 1.16 1.02 1.10 106
S106M 0.80 2.04 1.07 1.07 1.15 106 S106N 0.49 106 S106P 0.29 1.12
1.06 0.24 106 S106R 1.11 1.16 0.78 0.98 1.15 106 S106T 1.40 0.98
0.99 1.09 0.74 106 S106V 0.89 1.19 1.08 1.19 1.36 106 S106W 1.00
1.07 0.94 1.20 1.42 107 I107A 2.12 1.08 0.57 0.82 0.50 107 I107C
1.72 0.96 0.45 0.93 0.89 107 I107D 0.57 107 I107E 0.71 5.00 0.96
107 I107F 2.25 1.15 0.72 0.87 0.22 107 I107G 0.39 0.77 107 I107H
0.73 1.65 1.19 107 I107K 0.50 107 I107L 1.32 1.50 0.45 0.92 1.35
107 I107M 2.15 1.09 0.73 0.84 0.45 107 I107P 0.35 107 I107Q 1.02
1.22 1.18 1.11 0.06 107 I107R 0.55 107 I107S 1.47 1.53 0.49 0.91
0.38 107 I107T 2.29 1.01 0.43 0.85 0.59 107 I107V 1.05 1.29 0.51
0.93 2.10 107 I107W 0.73 2.83 0.70 107 I107Y 2.08 0.58 0.65 108
A108C 1.00 0.80 0.98 0.99 0.97 108 A108D 0.36 108 A108E 0.56 108
A108F 0.22 108 A108G 0.61 2.14 1.20 0.96 0.62 108 A108H 0.26 108
A108I 1.12 1.02 1.01 0.95 1.41 108 A108L 0.91 1.07 0.82 0.40 0.91
108 A108M 0.74 1.26 0.94 0.61 0.73 108 A108P 0.40 108 A108Q 0.25
108 A108R 0.40 108 A108S 0.84 1.94 1.12 0.86 0.72 108 A108T 0.96
1.40 0.85 0.86 0.72 108 A108V 1.26 0.92 0.87 1.00 1.38 108 A108W
0.25 109 Q109A 1.29 1.11 0.85 0.98 1.39 109 Q109C 0.70 31.03 1.35
0.97 0.84 109 Q109E 0.84 1.41 1.16 0.95 1.15 109 Q109F 0.93 1.78
0.98 1.06 1.28 109 Q109G 0.96 1.62 1.10 0.96 1.06 109 Q109H 1.01
1.10 0.86 1.01 1.19 109 Q109I 0.91 1.85 1.19 1.11 1.33 109 Q109K
1.65 0.81 0.74 0.93 1.93 109 Q109L 1.19 1.12 1.07 1.12 1.60 109
Q109M 1.28 1.19 1.03 1.04 1.73 109 Q109N 0.93 1.10 1.06 0.98 0.87
109 Q109P 0.23 0.82 1.00 0.17 109 Q109R 1.43 0.95 0.73 1.00 1.78
109 Q109S 1.08 1.19 1.12 0.98 1.16 109 Q109T 0.91 1.62 1.14 0.97
1.15 109 Q109V 109 Q109W 0.92 1.21 0.95 0.91 1.22 109 Q109Y 0.93
1.47 0.99 1.00 1.18 110 G110A 1.25 1.29 0.81 0.95 1.36 110 G110D
0.62 110 G110E 0.70 110 G110H 0.58 110 G110I 0.53 110 G110K 0.54
110 G110L 0.28 110 G110M 0.44 110 G110N 0.54 110 G110P 0.54 110
G110Q 0.46 110 G110R 0.41 110 G110S 0.39 1.26 0.89 0.28 110 G110T
0.52 110 G110V 0.40 110 G110W 0.37 110 G110Y 0.39 111 L111A 0.24
0.90 0.83 0.11 111 L111C 0.31 1.85 0.86 0.40 111 L111E 0.24 1.35
0.86 0.07 111 L111F 0.96 1.41 1.28 0.89 0.16 111 L111G 0.41 111
L111I 1.02 1.60 1.41 0.80 0.69 111 L111K 0.39 111 L111M 0.90 1.69
1.31 0.84 0.94 111 L111P 0.21 0.54 0.05 111 L111Q 0.37 111 L111R
0.28 111 L111S 0.30 111 L111T 0.20 0.98 0.92 0.07 111 L111V 1.05
1.37 1.13 0.80 0.76 111 L111W 0.29 111 L111Y 0.30 1.36 1.05 0.07
112 E112A 0.69 5.15 1.16 0.93 0.86 112 E112C 0.59 1.40 0.98 0.57
112 E112D 1.25 0.93 1.01 1.00 1.48 112 E112F 0.26 1.08 0.98 0.20
112 E112G 0.27 1.42 1.04 0.26 112 E112I 1.09 1.13 0.91 1.08 1.09
112 E112K 0.20 112 E112L 0.78 2.81 1.29 1.05 0.87 112 E112M 0.37
112 E112N 0.26 1.42 1.04 0.27 112 E112Q 0.82 3.22 1.15 0.93 1.03
112 E112R 0.16 112 E112S 0.28 1.38 0.92 0.34 112 E112T 0.42 1.51
0.95 0.46 112 E112V 0.85 1.77 1.18 0.99 0.83 112 E112W 0.19 1.58
0.92 0.13 112 E112Y 0.21 1.23 0.94 0.16 113 W113A 0.20 113 W113C
0.20 0.48 0.05 113 W113D 0.31 113 W113E 0.22 113 W113G 0.38 113
W113I 0.29 113 W113K 0.32 113 W113L 0.19 0.89 1.03 0.10 113 W113M
0.28 0.84 1.01 0.14 113 W113N 0.26 113 W113R 0.29 113 W113S 0.23
113 W113V 0.22 114 A114C 1.22 1.12 0.93 0.96 1.56 114 A114F 0.44
114 A114G 0.50 1.34 1.05 0.60 114 A114K 0.41 114 A114M 0.34 114
A114Q 0.31 114 A114R 0.30 114 A114S 114 A114T 0.76 2.09 1.10 0.85
0.85 114 A114W 0.40 114 A114Y 0.40 115 G115C 0.90 1.79 1.22 0.93
1.32
115 G115E 1.06 1.11 1.22 0.99 1.33 115 G115F 1.45 0.99 0.95 0.70
1.92 115 G115H 1.50 1.01 0.92 0.71 2.33 115 G115I 1.19 1.16 0.96
0.79 1.93 115 G115K 1.63 0.88 0.75 0.37 1.80 115 G115L 1.21 1.09
1.04 0.80 1.71 115 G115M 1.19 1.04 1.09 0.96 1.50 115 G115N 1.08
1.02 0.98 0.16 1.33 115 G115P 1.03 1.28 1.10 1.06 1.24 115 G115Q
1.13 1.22 1.06 0.89 1.66 115 G115R 1.28 1.24 0.86 0.12 1.50 115
G115S 0.97 1.63 1.15 1.00 1.45 115 G115T 1.06 1.10 1.15 0.93 1.51
115 G115V 0.19 2.21 0.86 0.43 115 G115W 1.46 0.86 0.82 1.01 1.98
115 G115Y 1.31 1.03 0.97 0.87 1.68 116 N116A 1.26 1.07 1.01 0.92
1.44 116 N116C 1.10 0.83 1.20 0.91 1.20 116 N116D 1.28 0.93 1.24
0.91 1.70 116 N116F 1.09 1.40 1.08 0.97 1.33 116 N116G 0.99 1.89
1.27 0.91 1.32 116 N116I 0.86 1.60 1.40 1.00 1.00 116 N116K 1.41
0.95 0.83 1.04 1.56 116 N116L 1.30 0.77 1.06 1.10 1.40 116 N116M
1.39 0.82 0.99 0.99 1.36 116 N116Q 1.27 0.89 1.08 1.01 1.49 116
N116S 1.22 1.07 1.01 0.92 1.45 116 N116T 1.33 0.89 1.09 0.96 1.56
116 N116V 1.21 1.00 1.13 0.85 1.59 116 N116W 0.88 2.02 1.24 0.99
1.08 117 N117A 1.21 1.43 1.00 0.96 1.29 117 N117C 0.91 1.30 1.19
0.93 1.15 117 N117D 0.74 1.58 1.08 1.02 1.01 117 N117F 0.79 1.47
1.01 1.03 0.95 117 N117G 0.65 4.40 1.20 1.01 0.84 117 N117I 0.78
1.42 1.25 1.05 1.01 117 N117P 0.22 117 N117Q 1.22 0.92 0.84 1.08
1.38 117 N117R 1.03 1.34 0.84 1.01 1.40 117 N117T 1.05 1.15 0.93
1.04 1.24 117 N117Y 1.09 1.00 1.02 1.12 1.16 118 G118A 1.50 1.01
0.98 0.98 1.48 118 G118C 0.86 1.29 1.20 1.00 0.91 118 G118D 1.02
1.16 1.19 1.03 1.09 118 G118E 1.11 1.22 1.07 1.04 1.20 118 G118F
1.08 1.23 1.03 1.00 1.12 118 G118I 0.74 1.45 1.07 1.18 0.73 118
G118K 1.17 1.08 0.81 0.96 1.20 118 G118L 0.79 1.51 1.23 1.09 0.84
118 G118M 1.01 1.33 1.08 1.04 1.05 118 G118N 0.87 1.13 1.05 1.08
0.95 118 G118P 0.20 1.54 1.06 0.18 118 G118Q 118 G118R 1.08 1.09
0.95 1.07 1.06 118 G118S 1.06 1.42 1.04 1.05 1.12 118 G118T 0.71
1.74 1.04 1.02 0.80 118 G118V 0.81 1.20 1.02 1.03 0.90 118 G118W
0.85 1.07 1.04 1.01 0.85 119 M119A 0.94 1.33 0.95 0.94 1.08 119
M119C 0.64 1.90 1.13 0.99 0.85 119 M119E 0.24 119 M119F 1.07 1.08
1.13 1.08 1.14 119 M119G 0.22 1.00 0.07 119 M119H 0.49 1.36 1.08
0.60 119 M119K 0.22 119 M119N 0.30 1.45 1.12 0.29 119 M119P 0.21
119 M119Q 0.72 0.52 1.11 1.13 0.80 119 M119R 0.29 119 M119T 1.07
0.95 0.81 0.97 1.19 119 M119W 0.16 1.88 1.03 0.15 120 H120A 1.14
1.12 0.97 0.93 1.81 120 H120C 0.92 1.36 1.12 1.04 1.21 120 H120E
1.12 1.17 1.12 1.11 1.30 120 H120F 1.05 1.16 1.01 1.09 1.31 120
H120G 1.08 1.56 1.07 0.99 1.33 120 H120I 1.06 0.93 0.92 1.17 1.24
120 H120L 1.04 1.17 1.20 1.13 1.32 120 H120M 1.19 1.12 1.08 0.97
1.50 120 H120N 1.21 1.04 1.04 1.08 1.43 120 H120R 1.05 1.13 0.98
0.91 1.49 120 H120S 1.19 1.16 1.07 1.11 1.61 120 H120T 1.19 1.05
0.98 1.12 1.53 120 H120W 0.95 1.07 1.07 1.01 1.08 121 V121A 1.09
0.96 1.07 0.91 1.52 121 V121C 0.85 1.67 1.41 0.97 1.08 121 V121E
0.82 2.12 1.37 0.79 0.99 121 V121F 1.01 1.42 1.29 0.95 1.12 121
V121G 0.46 2.16 0.96 0.59 121 V121I 1.40 0.90 1.11 0.95 1.58 121
V121K 0.30 121 V121L 1.15 0.99 1.05 0.99 1.31 121 V121M 1.04 1.18
1.37 1.05 1.24 121 V121P 0.48 121 V121Q 0.71 0.71 1.49 1.08 0.79
121 V121R 0.48 121 V121S 1.18 1.00 1.09 0.95 1.52 121 V121T 0.91
1.64 1.40 1.04 1.12 121 V121Y 0.27 2.38 0.87 0.24 122 A122C 0.80
2.00 1.17 0.87 1.03 122 A122G 0.81 1.60 1.16 0.88 0.91 122 A122H
032 122 A122I 0.95 1.04 1.14 0.58 0.79 122 A122L 1.12 0.71 1.05
0.69 0.72 122 A122N 0.18 122 A122Q 0.23 122 A122R 0.32 122 A122S
1.04 1.17 1.18 0.87 1.41 122 A122T 1.04 1.13 1.10 0.72 1.62 122
A122V 1.05 1.09 1.20 0.82 0.98 122 A122Y 0.26 123 N123E 1.48 0.68
0.89 0.35 0.06 123 N123F 0.49 123 N123G 1.71 0.82 1.15 0.53 0.43
123 N123H 0.47 123 N123I 1.04 0.23 0.82 123 N123L 1.17 0.27 0.81
123 N123M 0.97 0.42 0.86 123 N123P 0.91 0.52 0.93 123 N123R 0.44
123 N123S 1.15 1.13 1.12 0.48 0.45 123 N123V 0.93 0.25 0.94 123
N123W 0.44 124 L124D 0.50 124 L124E 0.40 0.62 124 L124G 1.31 1.26
1.05 0.98 1.72 124 L124H 0.43 1.28 124 L124K 0.28 124 L124N 0.44
1.97 124 L124P 0.47 124 L124Q 0.38 1.89 124 L124R 0.44 124 L124S
0.74 3.78 1.36 0.80 0.25 124 L124T 1.32 1.11 1.14 0.85 0.70 124
L124Y 0.78 0.87 0.86 125 S125A 1.12 1.13 0.80 0.73 0.32 125 S125C
2.09 0.45 0.84 125 S125E 0.54 125 S125G 2.41 0.17 0.17 125 S125H
0.47 125 S125I 0.49 125 S125K 0.35 125 S125L 0.45 125 S125M 0.46
125 S125N 0.74 125 S125P 0.93 125 S125R 0.47 125 S125T 1.75 0.07
0.14 125 S125W 0.45 125 S125Y 0.46 126 L126A 1.08 1.68 0.81 0.82
0.26 126 L126C 1.09 126 L126E 2.16 0.90 126 L126F 1.30 1.15 0.93
1.07 0.47 126 L126G 2.16 0.49 0.42 0.88 0.07 126 L126H 2.49 0.43
0.73 126 L126I 1.60 0.88 0.88 0.94 0.25 126 L126K 0.82 0.36 0.81
126 L126M 1.55 0.92 0.93 1.03 0.13 126 L126N 2.30 0.56 0.92 126
L126P 0.63 126 L126Q 2.51 0.34 0.73 126 L126R 0.24 126 L126S 2.36
0.58 0.68 0.86 0.07 126 L126T 2.24 0.53 0.73 126 L126V 1.54 0.84
0.94 0.85 0.16 126 L126W 2.63 0.32 0.59 126 L126Y 2.76 0.10 0.30
127 G127A 0.77 127 G127D 1.85 0.93 0.87 127 G127F 0.83 2.63 0.40
127 G127I 1.88 1.02 0.69 127 G127L 1.68 0.87 0.58 127 G127P 0.44
127 G127Q 2.00 0.96 0.78 127 G127R 1.65 1.14 0.63 127 G127S 1.41
1.37 1.03 127 G127T 1.76 1.17 0.89 127 G127V 2.00 0.93 0.70 127
G127W 0.35 0.28 128 S128A 1.30 0.87 0.97 1.02 1.46 128 S128C 1.69
0.14 0.66 1.10 0.06 128 S128D 2.83 0.72 0.64 1.03 0.33 128 S128F
2.91 0.62 0.58 0.96 1.59 128 S128G 0.95 1.33 1.11 1.01 1.32 128
S128H 2.62 0.73 0.63 1.06 0.54 128 S128I 2.96 0.72 0.58 1.12 3.27
128 S128K 2.21 0.96 0.48 1.01 1.44 128 S128L 3.03 0.69 0.62 1.08
2.47 128 S128M 2.62 0.77 0.63 1.10 5.64 128 S128N 1.38 1.16 1.09
0.95 0.51 128 S128P 1.28 0.14 0.48 128 S128Q 2.70 0.80 0.56 1.10
1.17 128 S128R 1.39 1.10 0.66 1.11 1.55 128 S128T 1.48 1.02 0.82
1.13 2.85 128 S128W 1.47 0.69 1.03 1.09 0.18 128 S128Y 2.90 0.62
0.54 1.06 0.58 129 P129A 1.37 0.86 0.82 0.82 2.33 129 P129E 1.09
0.80 1.32 1.16 1.26 129 P129F 1.23 0.71 0.94 0.89 2.01 129 P129G
1.61 0.91 0.88 0.86 2.57 129 P129I 0.96 0.59 1.13 0.74 1.30 129
P129L 1.45 0.51 0.86 0.79 1.56 129 P129M 1.70 0.75 0.80 0.92 1.83
129 P129N 1.57 0.93 0.81 0.99 2.66 129 P129R 1.22 1.03 0.77 0.98
3.28 129 P129S 1.68 0.87 0.88 0.92 2.68 129 P129T 1.34 0.54 0.93
0.58 1.98 129 P129V 1.28 0.36 0.84 0.65 1.36 129 P129W 1.12 0.77
0.86 0.74 1.21 129 P129Y 1.08 0.77 1.16 0.91 1.90 130 S130C 1.18
0.44 1.12 0.98 0.74 130 S130K 1.62 0.86 0.82 1.11 2.07 130 S130L
1.25 1.12 0.83 1.07 1.29 130 S130N 1.33 1.03 1.02 1.14 1.53 130
S130P 1.00 0.16 0.91 0.05 130 S130Q 1.31 1.00 1.05 1.10 1.17 130
S130R 1.43 0.87 0.70 0.93 2.06 130 S130V 1.08 1.21 0.95 0.93 1.29
130 S130W 1.33 0.92 0.83 0.91 1.18 130 S130Y 1.31 1.12 0.96 0.87
1.37 131 P131A 1.15 1.21 1.02 0.89 1.16 131 P131D 1.29 0.87 1.20
1.04 1.35 131 P131E 1.35 0.77 1.16 1.07 1.13 131 P131F 1.23 0.77
0.98 0.91 1.30 131 P131G 1.12 1.34 1.06 0.84 0.90 131 P131I 1.04
0.47 1.01 0.68 0.87 131 P131K 1.43 0.74 0.80 0.91 1.33 131 P131L
0.88 0.83 1.16 0.64 0.73 131 P131M 1.06 0.86 0.96 0.77 0.99 131
P131Q 1.33 0.76 0.93 0.94 1.18 131 P131R 1.30 0.87 0.79 0.78 1.54
131 P131V 0.96 0.94 1.07 0.55 0.99 132 S132A 1.04 1.07 1.08 0.98
1.00 132 S132E 0.72 3.77 1.51 0.92 0.57 132 S132F 0.72 8.36 1.05
1.05 1.08 132 S132H 0.89 1.54 1.04 0.97 1.01 132 S132I 0.83 1.39
1.09 0.89 0.86 132 S132L 0.75 3.33 1.21 0.83 1.35 132 S132M 0.73
4.11 1.32 0.91 1.20 132 S132N 0.82 2.12 1.19 0.99 1.06 132 S132Q
1.04 0.88 1.08 0.88 0.87 132 S132R 0.93 0.76 0.92 0.90 0.57 132
S132T 1.24 0.79 0.91 0.82 1.45 132 S132W 0.67 1.28 0.99 0.91 1.12
133 A133F 1.17 1.05 0.92 0.88 1.30 133 A133K 1.44 0.96 0.86 1.11
1.56 133 A133L 0.39 1.38 1.14 0.23 133 A133N 1.13 0.97 1.11 1.15
1.20 133 A133P 1.42 0.95 1.04 1.17 1.26 133 A133Q 0.62 1.20 1.00
0.71
133 A133S 1.15 1.06 0.97 1.01 1.14 133 A133T 1.14 0.95 1.09 0.94
1.24 133 A133V 1.11 1.18 1.12 0.95 1.21 133 A133Y 1.37 0.97 0.89
0.90 1.45 134 T134A 0.85 2.30 1.32 1.00 1.07 134 T134D 0.34 134
T134F 0.40 1.52 0.98 0.36 134 T134H 0.24 134 T134I 0.44 1.40 1.11
0.47 134 T134L 0.26 1.59 1.02 0.26 134 T134M 0.31 1.73 0.94 0.32
134 T134N 0.26 134 T134P 0.25 2.25 1.05 0.19 134 T134S 1.08 1.28
1.32 0.81 1.21 134 T134V 0.81 2.14 1.36 0.99 0.99 134 T134Y 0.21
135 L135A 0.41 1.25 0.29 0.21 135 L135C 0.49 1.52 0.86 0.24 135
L135D 0.35 135 L135E 0.42 1.35 1.02 0.20 135 L135F 0.57 1.03 0.19
0.91 135 L135G 0.27 0.13 0.09 135 L135M 1.02 1.40 0.98 0.84 1.91
135 L135N 0.26 135 L135Q 0.33 1.66 0.41 0.32 135 L135R 0.39 135
L135S 0.23 0.75 0.09 0.12 135 L135T 0.61 1.24 0.53 0.64 135 L135W
1.48 0.66 1.09 0.92 3.30 136 E136A 1.12 1.05 0.80 0.78 1.28 136
E136D 0.69 0.38 1.24 0.42 0.66 136 E136F 1.08 1.19 0.78 0.43 1.34
136 E136G 0.78 1.90 0.80 0.78 0.89 136 E136I 0.65 0.57 0.58 0.37
136 E136K 1.16 0.71 0.63 0.22 1.34 136 E136L 0.38 136 E136M 0.45
0.83 0.69 0.46 136 E136N 0.62 1.05 0.49 0.47 136 E136P 0.36 136
E136Q 1.13 1.07 0.92 0.84 1.46 136 E136R 1.01 0.71 0.37 0.15 1.41
136 E136S 0.96 1.05 0.74 0.78 0.92 136 E136T 0.46 0.45 0.55 0.20
136 E136V 0.82 1.04 0.68 0.57 0.76 136 E136W 0.84 1.47 0.49 0.18
1.03 136 E136Y 1.08 1.03 0.81 0.52 1.23 137 Q137A 1.28 1.38 1.15
1.00 1.42 137 Q137C 0.82 1.20 1.17 1.02 0.96 137 Q137E 1.16 0.84
1.19 1.07 1.22 137 Q137G 0.71 2.29 1.12 0.91 0.89 137 Q137H 1.25
1.00 1.01 0.99 1.33 137 Q137K 1.40 0.77 0.79 0.92 1.44 137 Q137L
1.22 1.12 1.04 1.01 1.31 137 Q137M 1.27 1.14 0.92 1.07 1.30 137
Q137P 0.19 137 Q137R 1.19 0.99 0.80 0.88 1.28 137 Q137S 1.07 1.57
1.03 0.97 1.13 137 Q137V 0.82 1.70 1.12 0.79 1.15 137 Q137W 1.27
1.18 0.81 0.81 1.47 138 A138C 0.68 2.54 1.24 0.60 0.62 138 A138D
0.19 138 A138E 0.18 1.52 0.80 0.11 138 A138G 0.48 1.35 0.88 0.86
138 A138H 0.14 138 A138K 0.22 138 A138L 0.61 1.35 1.01 0.07 0.43
138 A138M 1.07 1.02 0.98 0.53 0.79 138 A138P 0.16 138 A138Q 0.23
1.45 0.63 0.21 138 A138R 0.23 1.65 1.02 0.35 138 A138S 0.31 138
A138V 0.90 1.33 0.80 0.17 0.64 138 A138W 0.16 139 V139A 1.06 1.01
1.22 0.26 0.88 139 V139C 0.92 1.91 1.34 0.84 1.09 139 V139D 0.37
139 V139E 0.34 1.74 0.33 0.12 139 V139F 0.66 1.32 0.10 139 V139G
0.40 1.41 0.06 0.21 139 V139I 1.27 0.80 1.13 0.92 1.56 139 V139L
0.41 139 V139M 0.85 1.99 1.38 0.22 0.86 139 V139Q 0.59 1.51 0.27
139 V139R 0.44 139 V139S 0.74 0.22 1.34 0.12 0.46 139 V139T 0.95
2.01 1.32 0.72 0.95 139 V139W 0.40 139 V139Y 0.35 1.74 140 N140A
1.28 0.73 0.98 0.80 1.25 140 N140C 0.89 1.48 1.34 0.72 0.93 140
N140D 1.31 0.85 1.13 1.09 1.57 140 N140E 1.32 0.95 1.04 0.96 1.28
140 N140F 0.86 1.32 1.24 0.57 1.01 140 N140G 1.09 1.19 1.19 0.62
1.32 140 N140I 1.10 0.82 1.22 0.65 1.16 140 N140K 0.22 2.81 0.15
140 N140L 1.03 1.18 1.18 0.56 1.13 140 N140M 1.10 0.81 1.16 0.62
1.15 140 N140P 0.33 140 N140Q 1.16 0.96 1.10 0.73 1.15 140 N140R
1.03 1.02 0.91 0.27 1.01 140 N140S 1.10 1.10 1.10 0.64 1.27 140
N140T 1.05 1.17 1.25 0.60 1.41 140 N140V 0.96 1.39 1.29 0.39 1.20
140 N140Y 0.91 1.54 1.20 0.39 0.98 141 S141D 1.17 0.71 1.06 1.12
1.19 141 S141E 0.87 0.75 1.10 0.95 0.99 141 S141G 1.06 1.29 1.12
0.99 1.21 141 S141H 1.11 1.08 1.07 1.03 1.17 141 S141I 1.19 1.02
0.95 0.97 1.29 141 S141K 1.29 1.12 0.87 0.99 1.36 141 S141L 0.80
0.83 1.12 1.01 0.90 141 S141N 1.05 1.07 1.10 1.09 1.15 141 S141P
0.36 141 S141Q 1.04 0.92 0.93 0.97 1.16 141 S141R 1.19 1.01 0.84
1.01 1.40 141 S141V 1.33 0.90 0.86 0.86 1.42 141 S141Y 1.02 1.08
1.13 1.02 0.93 142 A142C 0.91 2.30 1.25 0.94 1.08 142 A142D 0.30
142 A142E 0.34 1.71 0.49 0.33 142 A142F 0.27 142 A142G 0.43 1.70
0.17 0.51 142 A142H 0.24 142 A142I 0.72 1.08 0.42 0.50 142 A142K
0.36 142 A142L 1.05 1.04 1.01 0.08 0.70 142 A142M 0.71 16.35 1.04
0.48 142 A142N 0.40 1.58 0.18 0.43 142 A142P 0.23 142 A142Q 0.78
9.76 1.11 0.24 0.67 142 A142R 0.30 142 A142S 0.77 6.91 1.35 0.72
1.19 142 A142T 0.87 2.44 1.18 0.70 1.12 142 A142V 1.15 1.20 0.99
0.94 1.36 142 A142W 0.18 0.07 0.06 142 A142Y 0.33 2.25 0.84 0.41
143 T143C 1.24 0.85 1.15 0.87 1.46 143 T143D 1.10 1.05 1.11 0.96
1.19 143 T143F 1.20 0.80 1.10 0.98 1.20 143 T143G 0.94 1.12 1.04
0.31 0.95 143 T143H 1.26 0.93 0.96 1.08 1.18 143 T143I 0.95 0.92
1.04 0.46 0.98 143 T143K 1.25 0.95 0.84 0.08 1.45 143 T143L 1.10
0.74 1.09 0.18 1.19 143 T143M 0.90 1.12 1.10 0.52 1.05 143 T143N
1.25 0.91 1.09 0.94 1.39 143 T143R 0.55 1.00 0.61 143 T143S 0.94
1.31 1.22 0.75 1.09 143 T143V 1.27 0.86 0.96 0.77 1.63 143 T143W
1.37 0.79 1.03 0.79 1.38 143 T143Y 0.97 1.15 1.20 0.77 1.09 144
S144A 1.29 1.04 0.98 1.02 1.45 144 S144C 1.08 0.75 1.15 1.00 1.31
144 S144D 1.36 0.82 1.11 1.05 1.55 144 S144E 0.40 144 S144G 1.19
1.13 0.98 1.03 1.41 144 S144H 1.21 0.94 0.85 1.04 1.43 144 S144I
1.15 1.01 1.05 0.97 1.41 144 S144K 0.37 144 S144L 0.97 0.98 1.04
0.92 1.23 144 S144M 1.28 0.88 0.93 1.01 1.46 144 S144N 1.32 0.90
1.08 0.96 1.53 144 S144P 0.25 0.54 0.10 144 S144Q 0.62 1.29 0.94
0.74 144 S144R 1.30 0.86 0.91 0.92 1.46 144 S144T 1.21 1.01 1.00
0.86 1.63 144 S144V 1.25 1.06 1.09 0.92 1.44 144 S144W 0.98 1.31
1.04 0.55 1.22 144 S144Y 1.03 1.26 1.04 0.87 1.17 145 R145A 1.46
0.85 0.99 1.01 1.51 145 R145C 0.98 1.03 1.24 1.04 1.06 145 R145D
1.08 0.84 1.10 1.04 1.20 145 R145E 0.65 12.81 1.54 0.92 0.87 145
R145F 0.83 1.06 1.31 1.01 0.94 145 R145G 0.69 2.91 1.42 0.99 0.80
145 R145I 0.49 145 R145K 1.30 1.03 1.06 1.08 1.37 145 R145L 1.01
1.06 1.20 1.06 1.20 145 R145M 0.73 1.73 1.50 1.02 0.87 145 R145N
1.12 1.09 1.13 0.98 1.32 145 R145P 0.26 145 R145Q 1.51 0.87 1.06
1.00 1.68 145 R145S 0.57 1.56 0.95 0.79 145 R145T 0.77 1.06 1.21
1.04 0.93 145 R145W 0.64 2.55 1.28 0.95 0.85 145 R145Y 0.69 3.13
1.39 1.04 0.82 146 G146A 0.84 2.28 1.33 0.58 0.88 146 G146C 0.68
1.56 0.85 0.74 146 G146D 1.15 1.10 1.23 1.03 1.39 146 G146E 0.80
2.87 1.31 0.71 0.93 146 G146F 0.43 1.66 0.42 0.45 146 G146I 0.22
1.14 0.37 0.19 146 G146K 0.83 1.83 1.15 0.07 0.91 146 G146L 0.37
1.61 0.56 0.36 146 G146M 0.58 1.65 0.74 0.66 146 G146P 0.30 146
G146Q 0.89 1.43 1.02 0.72 1.08 146 G146R 0.70 1.06 0.86 146 G146S
0.59 1.44 0.54 0.75 146 G146T 0.27 1.86 0.08 0.25 146 G146V 0.18
0.79 0.11 0.09 146 G146W 0.19 1.80 0.44 0.18 146 G146Y 0.30 2.16
0.45 0.31 147 V147D 0.31 147 V147F 0.27 1.86 0.72 0.17 147 V147G
0.31 1.85 0.51 0.24 147 V147H 0.24 147 V147I 1.07 1.28 0.93 1.09
1.66 147 V147L 1.19 0.85 0.92 0.90 1.54 147 V147M 1.18 0.93 1.03
0.73 1.43 147 V147P 0.27 1.25 0.13 147 V147Q 0.53 1.30 0.51 0.82
147 V147R 0.27 147 V147S 0.35 147 V147T 1.28 0.92 0.85 0.87 1.30
148 L148A 1.29 0.83 1.01 0.76 1.48 148 L148C 0.90 2.31 1.04 0.94
0.99 148 L148D 0.20 148 L148E 0.24 1.80 0.89 0.19 148 L148F 1.06
1.25 1.07 0.69 1.08 148 L148G 0.71 1.25 0.73 0.82 148 L148H 0.91
1.65 1.18 0.77 1.30 148 L148I 0.98 1.54 1.05 0.95 1.21 148 L148K
0.17 148 L148M 1.12 1.24 1.00 0.92 1.29 148 L148N 1.17 0.98 0.94
0.91 1.16 148 L148P 0.26 148 L148R 0.25 148 L148S 1.29 0.92 0.91
0.70 1.33 148 L148T 1.61 0.81 0.72 0.76 1.66 148 L148V 0.94 1.76
1.04 0.84 1.17 148 L148W 0.16 1.23 0.09 0.08 148 L148Y 1.25 1.02
0.86 0.13 1.05 149 V149A 0.50 1.94 0.89 0.72 149 V149C 0.81 1.23
1.66 1.04 1.22 149 V149D 0.22 149 V149E 0.18 149 V149F 0.29 2.43
0.05 149 V149G 0.16 1.51 0.55 0.13 149 V149H 0.21 2.36 0.27 0.22
149 V149I 1.07 0.94 1.17 1.02 1.48 149 V149K 0.21 149 V149L 0.98
1.18 1.27 1.04 1.19 149 V149M 0.81 1.06 1.18 0.76 0.99 149 V149P
0.46 1.91 1.21 0.59 149 V149Q 0.21 2.42 0.78 0.36 149 V149R 0.24
149 V149S 0.39 2.27 0.89 0.59 149 V149T 0.83 0.84 1.48 0.77 1.04
149 V149W 0.15
150 V150A 0.84 1.16 1.42 0.82 1.20 150 V150D 0.18 150 V150E 0.21
1.09 0.14 0.08 150 V150F 0.99 1.22 1.14 1.01 150 V150G 0.23 2.66
0.49 0.27 150 V150H 0.20 2.79 0.20 0.27 150 V150K 0.17 150 V150L
1.23 1.15 0.92 0.89 1.37 150 V150P 0.13 1.71 0.61 0.14 150 V150Q
0.16 3.34 0.39 0.19 150 V150R 0.26 150 V150S 0.75 1.27 1.43 0.62
0.89 150 V150T 1.18 0.90 1.01 0.97 1.54 150 V150W 0.14 151 A151D
0.42 151 A151E 0.45 151 A151F 0.47 151 A151G 0.85 1.54 1.08 0.35
0.81 151 A151H 0.52 151 A151L 0.70 0.42 151 A151M 1.05 0.13 0.59
151 A151P 0.19 151 A151R 0.42 151 A151S 1.26 0.93 1.01 0.87 1.13
151 A151T 1.27 0.38 0.93 0.64 0.44 151 A151V 1.19 0.59 0.92 0.36
0.82 151 A151W 0.42 152 A152C 1.48 0.34 0.70 152 A152D 0.66 152
A152E 0.60 152 A152K 0.46 152 A152L 0.46 152 A152M 0.62 152 A152P
2.74 0.23 0.56 152 A152R 0.45 1.07 152 A152S 0.88 2.71 0.70 0.84
0.37 152 A152T 1.08 0.07 0.68 152 A152V 0.96 0.70 0.69 152 A152W
0.44 152 A152Y 0.44 153 S153A 1.06 0.90 1.16 0.72 1.65 153 S153E
0.89 153 S153F 0.94 153 S153G 0.92 0.60 1.07 0.62 0.70 153 S153I
1.02 0.33 0.66 0.08 0.15 153 S153K 0.55 153 S153M 1.03 0.35 0.42
153 S153N 0.84 0.54 0.70 0.27 153 S153P 0.46 153 S153Q 1.10 153
S153R 0.59 153 S153V 0.99 0.95 1.03 0.78 2.29 153 S153Y 0.85 0.48
154 G154A 0.90 154 G154C 0.97 0.53 0.20 154 G154D 0.61 0.37 154
G154F 0.38 154 G154H 0.47 154 G154I 0.31 154 G154M 0.42 154 G154N
0.99 154 G154P 0.52 154 G154Q 0.64 3.28 154 G154R 0.43 154 G154S
0.89 0.50 154 G154T 0.29 154 G154V 0.34 154 G154W 0.34 154 G154Y
0.42 155 N155A 1.66 0.13 155 N155D 1.55 0.10 155 N155E 0.86 155
N155F 1.25 0.18 0.81 0.06 155 N155I 1.01 0.14 155 N155L 0.93 155
N155M 0.70 0.55 155 N155P 2.00 0.19 155 N155Q 1.11 0.10 0.16 155
N155R 1.65 0.07 0.12 155 N155S 2.02 0.08 155 N155T 1.59 155 N155V
1.08 0.11 155 N155Y 1.22 0.12 156 S156A 1.01 0.79 1.05 0.62 0.83
156 S156C 0.26 1.28 0.94 0.10 156 S156D 1.06 0.38 1.12 0.84 0.62
156 S156E 0.91 0.49 1.32 0.83 0.44 156 S156F 0.80 1.37 1.16 0.82
0.38 156 S156G 1.26 0.71 0.98 0.52 0.83 156 S156I 0.90 0.30 0.84
0.50 0.31 156 S156K 1.45 0.60 0.74 0.67 0.93 156 S156L 1.12 1.01
0.95 0.99 0.69 156 S156M 1.05 0.55 1.02 0.74 0.56 156 S156N 1.35
0.84 0.98 0.94 1.40 156 S156P 1.21 0.06 0.21 0.70 0.11 156 S156Q
1.26 0.46 0.81 0.44 0.71 156 S156R 1.12 0.96 0.72 0.57 0.69 156
S156T 1.34 0.83 0.96 0.93 1.21 156 S156V 0.97 0.17 0.66 0.32 0.31
156 S156W 0.54 0.58 0.70 0.15 156 S156Y 0.68 0.99 0.55 0.22 157
G157A 0.93 0.35 0.96 0.16 0.77 157 G157C 0.80 0.42 1.00 0.34 0.35
157 G157D 0.97 0.13 0.69 0.09 0.13 157 G157F 0.76 0.34 0.15 0.18
157 G157K 0.99 0.22 0.33 0.14 0.14 157 G157L 1.00 0.12 157 G157M
0.73 0.43 0.09 0.19 157 G157N 0.79 0.34 0.65 0.06 0.29 157 G157Q
0.90 0.20 0.52 0.19 157 G157R 0.89 0.21 0.16 0.13 0.11 157 G157S
0.85 0.69 0.94 0.19 0.75 157 G157T 0.74 0.33 0.52 0.18 157 G157V
1.07 0.11 0.16 157 G157Y 0.62 0.42 0.17 0.18 158 A158C 1.14 0.83
1.15 1.00 1.13 158 A158E 1.22 0.98 1.10 1.17 1.11 158 A158F 1.11
0.88 0.86 0.87 1.24 158 A158H 1.31 1.03 0.92 1.21 1.34 158 A158K
1.44 0.86 0.72 1.02 1.61 158 A158L 1.34 0.86 0.91 0.93 1.58 158
A158M 1.35 0.89 1.00 1.02 1.36 158 A158P 1.67 0.07 0.21 158 A158Q
1.46 0.88 0.85 0.96 1.58 158 A158R 1.24 1.06 0.74 0.90 1.47 158
A158S 0.85 1.04 1.07 0.88 0.95 158 A158T 1.07 0.99 1.01 0.94 1.21
158 A158V 1.16 0.92 0.98 0.89 1.32 158 A158W 1.10 0.97 0.86 0.75
1.00 159 G159A 1.15 1.04 1.12 0.96 1.34 159 G159C 1.01 0.85 1.02
1.06 1.01 159 G159D 0.26 159 G159E 1.29 0.77 1.11 1.20 1.36 159
G159F 0.30 159 G159H 1.19 0.81 0.93 0.86 1.15 159 G159I 0.71 0.76
0.78 0.21 159 G159L 0.85 0.36 0.58 0.85 0.19 159 G159M 0.89 0.71
1.06 0.97 0.77 159 G159P 1.50 0.74 0.89 1.07 1.66 159 G159Q 1.15
0.64 1.01 0.73 1.20 159 G159R 1.17 0.63 0.73 0.79 1.04 159 G159S
1.17 1.22 1.23 0.91 1.47 159 G159T 0.37 159 G159V 0.74 5.22 0.78
0.62 0.23 159 G159W 0.82 1.05 0.81 0.72 0.65 159 G159Y 0.80 1.09
0.86 0.70 0.35 160 S160A 1.12 1.14 1.00 0.92 1.23 160 S160C 0.93
1.29 1.27 1.21 0.93 160 S160D 1.10 0.98 1.24 1.03 1.17 160 S160F
1.23 0.99 0.96 1.08 1.56 160 S160G 1.08 0.82 1.11 0.60 1.06 160
S160I 1.29 0.81 0.87 1.13 1.58 160 S160L 1.19 0.88 0.94 0.99 1.53
160 S160M 1.11 1.06 0.97 0.99 1.40 160 S160N 1.23 0.92 0.98 0.99
1.53 160 S160Q 1.24 0.91 0.91 1.05 1.60 160 S160R 1.03 1.29 0.76
0.76 1.72 160 S160T 1.19 0.98 1.01 1.11 1.60 160 S160V 1.26 0.86
0.93 1.08 1.68 160 S160W 0.24 160 S160Y 1.23 0.91 1.00 1.10 1.58
165 I165A 0.92 0.12 165 I165C 0.64 0.89 0.41 0.18 165 I165D 1.72
0.23 165 I165E 1.38 0.10 165 I165F 1.45 0.14 165 I165G 1.53 165
I165H 1.54 165 I165K 1.53 0.06 165 I165L 0.95 0.63 1.17 1.08 0.79
165 I165M 0.92 0.31 0.53 0.76 0.14 165 I165P 0.92 0.29 0.94 0.09
0.72 165 I165R 1.54 165 I165S 0.91 0.20 0.30 165 I165T 0.80 1.12
0.81 0.15 0.32 165 I165V 1.20 1.07 0.95 0.99 1.41 165 I165W 1.53
0.12 165 I165Y 1.28 166 S166A 1.22 1.25 1.05 0.89 1.80 166 S166C
1.15 0.69 1.08 0.94 0.34 166 S166D 1.19 1.12 1.24 1.23 0.16 166
S166E 1.14 1.23 1.00 1.16 0.22 166 S166F 0.90 0.47 0.67 0.40 0.09
166 S166H 0.95 1.53 1.10 0.85 0.14 166 S166I 0.98 0.36 0.72 1.07
0.07 166 S166L 1.13 0.37 0.76 166 S166M 1.02 1.13 0.90 0.95 0.23
166 S166N 1.23 1.08 1.01 166 S166P 1.02 0.44 0.18 166 S166R 1.08
0.95 0.74 0.63 0.06 166 S166T 1.22 0.68 0.98 0.83 0.13 166 S166V
1.27 0.82 0.64 166 S166W 1.27 0.86 0.71 166 S166Y 0.95 0.49 1.00
0.55 0.13 167 Y167A 1.25 0.13 0.88 0.17 0.31 167 Y167C 0.88 0.24
1.01 0.29 0.07 167 Y167D 1.04 0.11 1.18 0.06 167 Y167E 1.54 0.14
1.01 0.10 0.17 167 Y167F 1.32 0.88 0.95 0.93 1.35 167 Y167G 1.18
0.06 0.46 167 Y167H 0.92 0.29 0.94 0.13 0.60 167 Y167I 1.06 0.10
0.98 0.15 0.56 167 Y167K 0.91 167 Y167L 0.98 0.16 0.73 0.23 167
Y167M 0.91 0.18 0.49 0.07 0.11 167 Y167N 0.97 0.13 0.57 0.10 167
Y167P 1.02 0.21 1.10 0.18 0.24 167 Y167Q 1.26 0.35 167 Y167R 0.87
167 Y167S 0.82 0.24 0.64 0.07 0.10 167 Y167T 0.91 0.21 0.74 0.07
0.11 167 Y167V 0.91 0.33 1.12 0.20 0.45 167 Y167W 1.19 0.88 1.05
0.73 1.49 168 P168A 0.84 0.36 0.32 168 P168C 0.84 168 P168D 0.44
168 P168E 0.48 168 P168F 1.07 0.35 168 P168G 0.57 0.48 168 P168H
0.47 0.49 168 P168I 1.28 0.07 0.39 168 P168K 0.49 0.49 168 P168L
0.35 168 P168M 1.01 0.26 168 P168N 0.83 0.56 168 P168Q 0.62 168
P168R 0.49 168 P168S 0.82 0.24 168 P168T 0.91 0.23 0.20 168 P168V
0.90 0.70 168 P168W 0.76 0.29 169 A169C 0.72 1.61 169 A169D 0.41
169 A169E 0.30 169 A169F 0.48 169 A169G 1.08 1.21 1.08 0.80 0.56
169 A169H 0.51 169 A169I 0.33 169 A169K 0.50 169 A169L 0.24 169
A169M 0.39 169 A169N 0.42 169 A169P 0.37 169 A169Q 0.55 169 A169R
0.26 169 A169S 1.03 1.12 1.00 0.57 0.97 169 A169T 0.40 169 A169V
0.30 169 A169W 0.50 0.45 169 A169Y 0.25 170 R170A 1.18 0.82 1.09
1.06 1.15
170 R170D 0.85 0.49 1.29 0.89 0.43 170 R170E 0.87 0.44 1.29 0.85
0.53 170 R170G 0.97 1.73 1.19 1.13 0.98 170 R170H 0.95 0.68 1.32
0.92 0.84 170 R170K 0.89 2.15 1.29 1.05 1.18 170 R170L 0.19 1.19
0.97 0.06 170 R170N 0.20 0.91 0.91 0.07 170 R170P 0.45 1.50 0.93
0.31 170 R170Q 1.09 0.67 1.14 1.01 1.03 170 R170S 0.98 0.68 1.19
0.85 0.85 170 R170V 0.88 1.07 1.39 0.88 0.93 170 R170W 0.90 0.56
1.23 0.80 0.68 170 R170Y 1.05 0.82 1.19 0.94 0.93 171 Y171A 0.70
1.25 1.26 0.12 0.38 171 Y171C 0.97 0.89 1.19 0.81 0.83 171 Y171D
0.65 1.24 0.09 0.41 171 Y171E 0.61 0.92 0.10 0.17 171 Y171F 1.24
0.86 1.07 0.60 1.40 171 Y171G 0.77 2.68 1.25 0.52 171 Y171H 0.77
1.78 1.27 0.33 0.82 171 Y171I 0.67 1.18 0.45 171 Y171K 0.30 171
Y171L 1.03 0.66 0.94 0.23 1.08 171 Y171M 0.85 0.90 0.51 171 Y171N
0.86 1.24 1.14 0.28 1.00 171 Y171P 0.42 171 Y171Q 0.67 1.20 0.40
171 Y171R 0.21 171 Y171S 0.77 2.64 1.21 0.34 0.86 171 Y171T 0.59
1.23 0.08 0.39 171 Y171V 0.60 0.89 0.06 0.35 171 Y171W 0.69 1.22
1.30 0.14 0.46 172 A172C 1.15 0.88 1.11 1.13 1.18 172 A172D 1.17
1.09 1.10 1.12 1.24 172 A172F 1.16 0.99 0.93 0.77 1.34 172 A172G
1.12 1.23 1.07 0.92 1.32 172 A172I 1.21 0.95 0.98 1.00 1.30 172
A172K 0.91 1.12 0.82 0.92 1.16 172 A172L 1.22 0.85 1.04 0.93 1.26
172 A172M 1.08 1.04 0.97 1.02 1.14 172 A172P 1.37 1.02 1.10 1.03
1.60 172 A172Q 1.27 1.05 1.12 0.88 1.48 172 A172R 1.27 0.98 0.75
0.82 1.52 172 A172S 1.08 0.87 1.03 0.85 1.18 172 A172T 0.92 1.47
1.14 0.79 1.24 172 A172V 1.08 1.24 1.00 0.91 1.26 172 A172W 0.96
0.86 0.91 0.61 0.92 172 A172Y 1.29 1.07 0.89 0.84 1.33 173 N173A
1.23 1.03 0.92 0.96 1.37 173 N173C 0.89 0.87 1.13 1.01 0.94 173
N173D 0.93 0.78 1.07 1.01 0.94 173 N173E 0.79 1.09 1.14 1.01 0.79
173 N173F 1.38 0.90 0.95 0.59 1.19 173 N173G 1.02 1.23 1.09 0.78
1.01 173 N173H 1.11 0.95 1.04 0.96 1.17 173 N173I 1.06 0.37 0.87
0.05 0.43 173 N173K 1.26 1.08 0.89 0.49 1.36 173 N173L 1.80 0.73
0.92 0.78 1.48 173 N173M 1.02 0.96 1.01 0.81 1.21 173 N173P 1.04
0.67 0.94 0.64 0.86 173 N173Q 1.23 1.04 0.98 0.89 1.49 173 N173R
1.14 1.01 0.78 0.51 1.28 173 N173S 0.36 173 N173T 1.09 1.06 0.95
0.88 1.13 173 N173V 1.31 0.59 0.80 0.63 1.01 173 N173W 1.30 0.82
0.87 0.41 1.10 173 N173Y 1.01 0.99 0.88 0.42 0.99 174 A174D 0.28
174 A174E 0.46 174 A174F 0.52 174 A174G 0.83 1.66 1.24 0.09 0.77
174 A174H 0.33 174 A174I 1.17 0.11 0.85 0.27 0.39 174 A174K 0.39
174 A174L 0.31 174 A174M 0.58 174 A174N 0.23 1.27 0.16 174 A174P
0.39 1.37 0.19 174 A174Q 0.39 174 A174R 0.39 174 A174S 1.32 0.99
0.98 0.92 1.70 174 A174T 1.22 1.29 0.87 0.99 1.40 174 A174V 1.10
1.15 0.94 1.01 1.46 174 A174W 0.47 174 A174Y 0.42 175 M175A 1.18
1.16 1.02 0.12 1.22 175 M175C 0.87 1.95 1.21 0.47 1.11 175 M175E
0.41 1.57 0.42 175 M175G 0.19 2.33 0.05 175 M175H 0.35 1.08 0.32
175 M175I 1.16 1.12 0.70 0.70 1.09 175 M175K 0.18 1.04 0.08 0.11
175 M175L 1.28 1.22 1.05 0.92 1.18 175 M175P 0.41 175 M175Q 0.98
1.06 0.99 1.14 175 M175R 0.40 175 M175S 0.70 3.33 1.16 0.79 175
M175T 1.78 0.80 0.93 0.54 1.63 175 M175V 1.31 0.94 0.97 0.89 1.32
175 M175W 0.54 0.93 0.41 175 M175Y 1.38 0.97 0.97 0.08 1.03 176
A176C 0.77 3.85 1.32 0.58 0.84 176 A176D 0.68 0.23 176 A176E 2.03
0.21 176 A176G 1.29 0.85 0.94 0.55 1.59 176 A176H 0.61 176 A176I
1.08 0.18 0.19 176 A176K 0.98 176 A176L 0.57 176 A176N 0.61 176
A176P 0.35 1.66 0.14 176 A176R 0.75 176 A176S 1.25 1.07 1.10 0.92
1.50 176 A176T 1.63 0.34 176 A176V 1.30 0.07 0.25 176 A176W 0.64
176 A176Y 0.61 177 V177A 1.27 0.96 1.10 0.17 1.35 177 V177C 1.06
1.17 1.10 0.81 1.18 177 V177D 0.35 177 V177F 0.31 177 V177G 0.23
0.05 177 V177H 0.45 177 V177I 1.14 1.02 1.10 0.57 1.19 177 V177K
0.49 177 V177L 0.25 177 V177M 0.23 177 V177N 0.25 0.06 177 V177Q
0.40 177 V177R 0.47 177 V177S 0.48 177 V177T 1.67 0.78 0.93 0.33
1.59 177 V177W 0.38 177 V177Y 0.36 178 G178A 1.08 0.53 1.01 0.92
178 G178C 0.38 0.69 0.21 178 G178D 0.47 178 G178E 0.53 178 G178F
0.27 178 G178I 0.40 178 G178L 0.20 0.12 178 G178M 0.30 178 G178N
0.30 0.42 0.16 178 G178P 0.42 178 G178R 0.37 178 G178S 0.72 1.66
0.89 1.02 178 G178T 0.55 0.93 0.80 178 G178V 0.22 178 G178W 0.44
178 G178Y 0.31 179 A179C 0.41 1.20 0.47 179 A179D 0.47 0.46 0.60
0.08 179 A179E 0.40 179 A179F 0.25 179 A179G 0.87 1.38 1.08 0.20
0.95 179 A179H 0.41 0.74 0.91 0.18 179 A179I 0.30 0.85 0.92 0.12
179 A179K 0.36 179 A179L 0.31 179 A179M 0.71 0.30 0.25 179 A179P
0.44 0.07 0.07 179 A179Q 0.28 179 A179R 0.31 179 A179T 0.16 0.61
0.10 180 T180C 0.95 0.87 1.08 0.52 0.92 180 T180D 0.30 180 T180F
0.19 180 T180G 0.21 2.09 0.18 180 T180H 0.21 1.55 0.16 180 T180I
1.25 0.87 0.78 0.78 1.27 180 T180K 0.21 180 T180L 0.96 0.81 1.04
0.18 0.92 180 T180N 0.27 1.75 0.29 180 T180P 0.35 180 T180Q 0.13
1.32 0.05 0.09 180 T180R 0.27 180 T180S 1.01 1.16 1.04 0.58 1.18
180 T180V 1.23 0.93 0.98 0.83 1.24 180 T180W 0.26 181 D181A 0.66
1.70 0.93 0.18 0.70 181 D181E 0.57 6.09 0.27 0.14 181 D181F 0.11
0.21 0.07 181 D181G 0.55 20.14 0.89 0.15 0.65 181 D181H 0.21 0.99
0.26 0.21 181 D181K 0.56 0.64 0.43 0.58 181 D181L 0.61 5.03 0.64
0.50 181 D181M 0.80 0.96 0.69 0.84 181 D181N 1.20 0.74 0.71 0.15
1.15 181 D181P 0.34 181 D181R 0.31 0.39 0.34 181 D181V 0.27 0.56
0.28 182 Q182A 1.26 1.00 0.92 0.86 1.57 182 Q182D 1.15 0.95 1.21
1.11 1.47 182 Q182E 1.12 1.00 1.21 1.14 1.66 182 Q182F 1.21 1.14
0.94 0.43 1.48 182 Q182G 1.16 0.92 0.95 0.49 1.34 182 Q182H 1.15
0.94 0.95 0.73 1.36 182 Q182I 1.28 0.89 0.80 0.48 1.56 182 Q182K
1.25 0.99 0.77 0.08 1.54 182 Q182L 1.20 0.98 0.96 0.20 1.53 182
Q182M 1.55 0.87 0.65 0.75 1.83 182 Q182N 1.20 1.01 0.88 0.73 1.33
182 Q182P 1.12 0.93 0.95 0.51 1.27 182 Q182R 1.08 1.06 0.75 0.06
1.24 182 Q182S 1.30 0.96 0.97 0.74 1.68 182 Q182T 1.23 1.09 1.03
0.66 1.61 182 Q182V 1.18 1.04 0.95 0.57 1.32 182 Q182W 1.57 0.80
0.63 0.09 1.61 182 Q182Y 1.31 0.91 0.83 0.78 1.30 183 N183A 1.30
1.01 0.98 0.82 1.21 183 N183D 0.97 1.08 1.22 1.15 1.10 183 N183F
1.12 1.00 0.93 0.27 1.27 183 N183G 1.16 1.26 0.99 0.69 1.28 183
N183H 1.43 0.88 0.90 0.75 1.36 183 N183I 1.28 0.81 0.89 1.31 183
N183K 1.52 0.98 0.75 0.06 1.40 183 N183L 1.48 0.84 0.91 0.28 1.34
183 N183M 1.30 0.76 0.89 0.57 1.35 183 N183P 0.16 1.75 0.15 183
N183Q 1.51 0.93 0.83 0.89 1.65 183 N183R 1.43 0.91 0.60 1.42 183
N183S 1.05 1.20 1.07 0.90 1.22 183 N183T 1.26 0.93 0.98 0.67 1.31
183 N183V 1.34 0.80 0.90 0.14 1.29 183 N183W 1.44 0.93 0.73 0.19
1.37 183 N183Y 1.32 0.83 0.89 0.65 1.32 184 N184A 0.22 1.48 0.15
184 N184C 0.60 5.16 1.27 0.25 0.53 184 N184D 1.31 0.99 1.09 1.18
1.51 184 N184E 0.50 1.44 0.58 0.43 184 N184F 0.23 0.91 0.11 184
N184G 0.78 1.45 1.26 0.05 0.77 184 N184H 0.31 1.31 0.14 0.19 184
N184I 0.15 0.70 184 N184K 0.14 184 N184L 0.50 1.18 0.35 184 N184M
0.40 1.36 0.07 0.25 184 N184P 0.23 184 N184R 0.13 0.11 0.06 184
N184S 0.50 1.30 0.51 184 N184T 0.21 1.46 0.17 184 N184V 0.39 184
N184W 0.15 0.94 0.05 0.09 184 N184Y 0.23 1.25 0.13 185 N185A 1.10
1.00 0.91 1.01 1.04 185 N185C 1.09 0.68 1.18 1.09 1.04 185 N185E
1.38 0.93 1.05 1.23 1.45 185 N185F 1.09 0.89 0.99 0.36 1.13 185
N185G 1.03 1.38 1.10 0.68 1.24 185 N185H 1.39 1.00 0.89 0.98 1.22
185 N185I 1.35 0.80 0.81 0.76 1.22
185 N185K 1.72 0.85 0.80 0.90 1.78 185 N185L 1.36 0.96 1.11 0.73
1.43 185 N185M 1.29 0.88 0.95 0.81 1.45 185 N185Q 1.47 1.00 0.96
1.19 1.41 185 N185R 1.36 0.92 0.74 0.59 1.51 185 N185S 0.95 1.26
1.10 0.73 1.19 185 N185T 1.19 0.80 1.06 0.95 1.12 185 N185V 1.01
0.99 1.01 0.89 1.03 185 N185W 0.28 185 N185Y 1.06 0.95 0.86 0.61
1.13 186 R186A 0.73 0.35 1.10 0.68 0.39 186 R186C 0.56 0.99 0.56
0.20 186 R186F 0.74 0.27 0.52 186 R186G 0.38 1.02 0.38 0.14 186
R186H 0.80 0.99 1.11 1.05 0.74 186 R186I 0.85 0.46 1.12 1.19 0.62
186 R186K 1.29 1.05 1.01 1.10 1.55 186 R186L 0.99 0.57 1.09 1.17
1.00 186 R186M 0.62 1.33 0.97 0.80 0.29 186 R186N 0.52 0.85 0.22
0.12 186 R186P 0.78 0.22 0.81 0.69 0.17 186 R186Q 0.43 1.19 0.79
0.18 186 R186S 0.55 0.94 0.55 0.21 186 R186T 0.39 1.15 0.71 0.22
186 R186V 0.28 186 R186W 0.76 0.74 1.22 0.77 0.44 186 R186Y 0.54
0.71 0.63 0.06 187 A187C 1.13 0.72 0.91 0.87 0.65 187 A187D 0.75
0.76 0.99 0.06 0.06 187 A187E 0.45 1.13 0.12 187 A187F 1.58 0.42
0.68 0.21 187 A187G 0.76 1.54 0.97 0.63 187 A187H 1.30 0.18 0.64
0.11 187 A187I 1.04 0.14 0.41 0.13 0.13 187 A187K 0.52 187 A187L
0.90 0.27 0.93 0.15 0.34 187 A187M 0.66 2.14 0.77 0.10 0.19 187
A187N 0.36 0.95 0.10 187 A187P 1.42 0.76 0.90 0.55 1.01 187 A187Q
0.57 0.92 0.11 187 A187R 0.55 187 A187S 0.90 0.80 0.93 0.07 0.79
187 A187T 0.86 0.80 0.82 0.28 0.71 187 A187V 0.89 0.26 0.65 0.29
0.30 187 A187W 1.42 1.24 0.93 0.53 0.80 187 A187Y 2.08 0.69 0.87
0.32 0.40 188 S188A 1.39 0.80 0.87 0.96 1.38 188 S188D 1.25 0.86
1.11 1.11 1.36 188 S188E 1.24 0.84 0.98 1.12 1.27 188 S188F 1.10
0.59 0.78 0.87 1.03 188 S188G 1.29 0.90 0.92 0.80 1.40 188 S188H
1.28 0.74 0.92 0.98 1.23 188 S188I 1.39 0.86 0.78 0.89 1.64 188
S188K 1.53 0.81 0.72 0.95 1.40 188 S188L 1.41 0.73 0.91 0.86 1.51
188 S188P 1.55 0.71 0.97 1.16 1.29 188 S188Q 1.45 0.82 0.94 0.90
1.50 188 S188R 1.38 0.71 0.72 0.80 1.25 188 S188T 1.31 0.82 0.92
0.90 1.19 188 S188V 1.42 0.80 0.87 0.80 1.56 188 S188W 1.46 0.56
0.73 0.80 1.23 188 S188Y 1.40 0.59 0.81 0.74 1.31 189 F189A 0.50
1.04 0.07 0.07 189 F189C 2.04 0.43 0.86 0.77 0.20 189 F189E 2.15
0.54 0.92 0.24 0.28 189 F189G 2.00 0.50 0.90 0.16 0.45 189 F189H
1.28 0.29 0.81 0.08 0.21 189 F189K 1.82 0.34 0.64 0.07 0.32 189
F189L 1.79 0.58 0.99 0.11 0.49 189 F189M 2.27 0.63 0.92 0.49 0.47
189 F189N 2.35 0.51 0.89 0.07 0.67 189 F189P 1.12 0.19 0.69 0.05
0.10 189 F189Q 2.29 0.48 0.97 0.06 0.47 189 F189R 1.51 0.48 0.70
0.12 0.30 189 F189S 1.85 0.50 0.91 0.15 0.65 189 F189T 1.64 0.58
0.93 0.11 0.57 189 F189V 1.97 0.26 0.67 0.05 0.16 189 F189Y 0.97
0.29 0.91 0.19 0.85 190 S190A 0.86 0.30 0.89 0.11 0.44 190 S190C
0.77 0.22 190 S190D 1.97 190 S190E 1.51 190 S190F 1.74 0.15 190
S190G 1.01 0.10 0.55 0.10 0.19 190 S190H 1.84 0.19 190 S190I 1.40
190 S190K 1.15 190 S190L 1.60 0.15 190 S190M 1.56 0.18 190 S190N
1.86 0.14 190 S190P 1.58 190 S190Q 1.92 0.23 190 S190R 1.10 0.09
190 S190T 0.80 0.33 0.61 0.05 0.24 190 S190V 1.50 0.18 190 S190W
1.45 0.06 190 S190Y 1.33 0.07 0.20 191 Q191A 1.08 0.54 0.91 0.96
0.60 191 Q191D 1.33 0.54 1.22 0.96 0.70 191 Q191E 0.95 0.15 0.93
0.24 0.58 191 Q191F 1.64 0.24 191 Q191G 0.31 191 Q191H 1.79 0.38
0.76 0.21 0.39 191 Q191I 1.94 0.34 191 Q191K 1.72 191 Q191L 1.63
0.27 191 Q191P 2.08 0.19 0.47 191 Q191R 0.94 0.35 0.48 0.53 0.38
191 Q191S 1.14 0.54 0.90 1.01 0.59 191 Q191T 0.81 0.20 0.63 0.51
0.11 191 Q191V 1.82 0.06 0.34 191 Q191W 1.80 0.17 191 Q191Y 1.39
0.09 0.35 192 Y192C 0.96 0.14 0.71 0.29 0.13 192 Y192D 1.89 0.27
192 Y192E 1.95 0.42 192 Y192G 0.87 0.50 0.37 0.11 192 Y192H 1.07
0.78 0.97 0.56 1.00 192 Y192I 0.88 0.16 0.35 192 Y192K 0.88 0.15
0.21 192 Y192L 1.56 0.22 192 Y192M 1.06 0.15 0.46 0.59 0.07 192
Y192N 0.89 0.36 0.54 0.14 192 Y192P 2.31 192 Y192Q 1.39 0.06 0.35
192 Y192R 1.01 0.10 0.18 192 Y192S 0.82 0.35 0.72 0.08 0.20 192
Y192T 0.60 5.73 0.94 0.12 0.24 192 Y192V 1.09 0.11 0.43 0.82 0.08
192 Y192W 0.91 1.15 1.05 0.73 0.89 193 G193A 1.01 0.47 0.14 0.17
193 G193D 1.15 0.49 0.17 0.07 193 G193E 1.13 0.49 0.10 193 G193F
2.15 193 G193H 1.66 193 G193I 1.82 0.24 193 G193K 1.95 0.14 193
G193L 1.81 193 G193M 0.39 193 G193R 1.87 193 G193S 1.00 0.31 0.12
0.08 193 G193T 2.32 0.10 193 G193V 2.17 0.51 193 G193W 1.65 193
G193Y 1.94 0.06 194 A194C 1.47 0.72 0.93 1.07 1.56 194 A194D 1.78
0.81 0.98 1.07 2.13 194 A194E 1.64 0.93 1.00 1.10 2.02 194 A194F
1.37 1.19 0.86 0.95 1.73 194 A194G 1.64 0.62 0.78 0.55 1.53 194
A194H 1.78 0.96 0.71 1.01 2.06 194 A194I 1.72 1.09 0.73 1.06 2.17
194 A194L 1.57 0.83 0.84 0.95 1.77 194 A194M 1.66 1.01 0.83 0.95
2.14 194 A194P 1.48 0.67 0.89 1.07 1.58 194 A194Q 1.29 0.89 1.00
0.97 1.62 194 A194R 1.48 0.87 0.68 0.83 2.03 194 A194S 1.62 0.90
0.77 0.84 1.98 194 A194T 1.03 1.04 1.09 0.90 1.32 194 A194V 0.52
1.84 0.92 0.73 194 A194W 1.06 1.17 0.99 0.81 1.31 194 A194Y 1.19
1.12 0.95 0.92 1.53 195 G195A 0.81 1.51 1.06 0.61 0.81 195 G195C
0.98 1.06 1.29 0.90 1.00 195 G195D 1.07 0.51 1.15 1.09 0.83 195
G195E 1.00 1.11 1.32 1.03 1.13 195 G195F 0.90 0.43 0.92 0.59 0.70
195 G195I 0.83 0.50 0.08 0.11 195 G195K 1.04 0.28 0.83 0.42 0.68
195 G195L 0.90 0.38 0.98 0.25 0.45 195 G195P 0.76 0.68 0.57 0.14
0.15 195 G195Q 0.92 1.07 1.08 0.80 0.91 195 G195R 0.77 1.49 0.87
0.59 0.52 195 G195S 0.78 2.14 1.11 0.57 0.87 195 G195T 0.73 2.97
1.22 0.54 0.56 195 G195V 0.15 2.20 0.22 0.17 195 G195W 0.80 0.67
0.93 0.36 0.55 195 G195Y 0.84 0.50 1.06 0.52 0.64 196 L196A 1.22
196 L196D 1.61 0.17 196 L196E 1.23 0.11 0.28 196 L196F 0.75 1.57
0.24 196 L196G 0.29 196 L196H 0.52 0.41 196 L196I 1.25 0.49 0.90
0.49 0.99 196 L196M 1.19 1.08 1.06 0.47 1.29 196 L196P 2.27 196
L196Q 0.46 1.22 0.21 196 L196R 0.39 196 L196T 0.68 1.03 0.05 0.29
196 L196V 0.98 0.62 0.23 0.18 196 L196Y 0.84 197 D197A 1.36 1.15
1.03 1.59 197 D197C 1.25 0.84 1.27 0.48 1.26 197 D197E 0.78 1.16
1.36 0.87 1.02 197 D197F 0.49 1.32 1.52 0.58 197 D197G 1.16 0.93
1.04 1.29 197 D197H 0.58 1.45 1.60 0.48 197 D197I 0.41 1.39 0.48
197 D197L 0.31 1.72 0.32 197 D197M 0.61 1.06 1.60 0.63 197 D197N
1.67 0.93 1.00 1.95 197 D197P 0.43 197 D197Q 1.30 0.97 1.13 1.34
197 D197R 0.16 0.90 0.05 0.11 197 D197S 1.86 1.00 0.94 2.10 197
D197T 1.41 1.16 1.01 1.71 197 D197V 0.73 1.17 1.50 0.93 197 D197W
0.60 1.20 1.47 0.66 197 D197Y 0.35 1.56 0.41 198 I198A 1.25 1.07
1.02 0.41 1.71 198 I198D 0.25 1.44 0.18 0.17 198 I198E 0.51 1.58
0.08 0.59 198 I198F 1.97 0.78 0.61 1.93 198 I198G 2.10 0.77 0.64
2.40 198 I198H 1.78 0.71 0.76 1.52 198 I198L 1.66 0.80 0.67 0.86
1.97 198 I198M 1.04 1.02 1.13 0.71 1.43 198 I198N 1.62 0.71 0.74
1.54 198 I198P 0.62 198 I198Q 0.51 1.10 0.11 0.43 198 I198R 0.22
1.40 0.88 0.10 198 I198S 2.18 0.82 0.53 2.46 198 I198T 2.02 0.84
0.63 0.31 2.07 198 I198V 0.27 0.33 0.07 198 I198W 0.30 1.22 0.22
198 I198Y 1.31 0.62 0.82 1.12 199 V199A 1.01 1.52 0.93 0.41 1.05
199 V199C 1.21 1.02 0.99 0.94 1.19 199 V199D 0.30 1.40 0.24 199
V199E 0.18 1.60 0.06 0.12 199 V199F 0.52 1.05 0.31 0.20 199 V199G
0.76 1.38 1.09 0.14 0.83 199 V199H 0.40 0.96 0.31 199 V199I 0.86
1.13 1.32 0.87 199 V199K 0.44 199 V199L 0.57 1.15 0.51 199 V199M
1.46 0.93 0.98 1.03 1.36 199 V199P 0.37 199 V199Q 0.32 1.35 0.30
199 V199R 0.21 199 V199S 1.38 0.95 1.03 1.01 1.42 199 V199T 1.21
1.10 0.94 0.53 1.36 199 V199W 0.49 0.82 0.12 0.18 200 A200C 1.06
1.02 1.12 1.14 200 A200E 0.18 0.06 200 A200G 0.93 1.14 1.05 0.28
0.93 200 A200H 0.29 1.47 200 A200I 0.51 1.30 0.37 0.53 200 A200L
0.43 200 A200P 0.24
200 A200R 0.51 200 A200S 1.17 1.13 0.99 0.16 1.31 200 A200W 0.46
200 A200Y 0.44 201 P201A 0.44 201 P201C 0.70 3.09 1.11 0.91 201
P201D 0.22 201 P201E 0.26 201 P201F 0.19 201 P201G 0.48 1.43 0.65
201 P201I 0.19 0.06 201 P201K 0.33 201 P201L 0.17 201 P201M 0.18
201 P201N 0.22 201 P201Q 0.21 201 P201R 0.32 201 P201S 0.75 1.98
1.20 0.95 201 P201T 0.25 1.21 0.31 201 P201V 0.21 1.59 0.26 202
G202A 0.29 0.71 0.13 202 G202C 0.40 202 G202D 0.42 202 G202E 0.38
202 G202F 1.11 202 G202H 0.45 202 G202K 0.48 202 G202L 0.49 202
G202M 0.47 202 G202N 0.46 202 G202P 0.48 202 G202Q 0.47 202 G202R
0.36 202 G202S 0.17 202 G202T 0.40 202 G202V 0.40 202 G202W 0.43
202 G202Y 0.39 203 V203A 0.86 1.14 1.10 0.38 0.94 203 V203C 0.84
0.94 1.19 0.97 0.75 203 V203E 0.82 1.06 1.25 1.07 0.88 203 V203F
0.71 0.58 1.25 0.54 203 V203G 0.17 1.58 0.16 203 V203H 0.45 1.27
0.09 0.31 203 V203I 1.43 0.93 1.04 0.65 1.27 203 V203K 1.09 0.79
0.81 0.89 203 V203L 1.09 0.92 1.01 0.25 1.00 203 V203N 0.50 1.42
0.10 0.52 203 V203P 0.16 0.08 0.06 203 V203R 0.76 0.60 0.88 0.60
203 V203S 0.82 0.90 1.04 0.43 0.72 203 V203T 1.29 1.10 0.87 1.02
1.42 203 V203W 0.70 0.76 1.18 0.47 203 V203Y 0.71 0.74 1.19 0.14
0.52 204 N204A 1.32 1.10 0.89 0.82 1.34 204 N204C 1.27 0.72 0.81
0.85 1.27 204 N204E 1.52 0.86 1.06 1.08 1.56 204 N204F 1.50 0.82
0.80 0.33 1.44 204 N204G 1.38 1.04 0.95 0.91 1.43 204 N204I 1.27
0.71 0.85 0.13 1.23 204 N204K 1.62 0.89 0.72 0.08 1.48 204 N204L
1.43 0.87 0.96 0.56 1.39 204 N204P 0.21 1.41 0.19 204 N204R 1.42
0.74 0.66 1.21 204 N204S 1.23 1.02 0.94 0.82 1.26 204 N204T 1.17
1.06 0.99 0.51 1.19 204 N204W 1.27 0.86 0.83 0.21 1.16 204 N204Y
1.34 0.78 0.87 0.38 1.31 205 V205A 0.61 3.19 0.98 0.64 205 V205D
0.08 205 V205E 0.25 205 V205F 0.27 0.43 1.07 0.07 205 V205G 0.23
1.16 0.12 205 V205I 0.31 1.52 1.08 0.25 205 V205K 0.22 205 V205L
0.40 1.34 0.25 205 V205M 0.27 1.14 0.15 205 V205P 0.34 205 V205Q
1.07 0.81 0.92 0.84 205 V205R 0.37 205 V205T 1.03 1.22 1.05 0.73
1.41 205 V205W 0.35 205 V205Y 0.29 206 Q206A 0.91 0.87 1.16 0.77
1.15 206 Q206C 0.78 0.95 1.51 1.11 1.06 206 Q206D 0.92 1.06 1.40
1.14 1.31 206 Q206E 0.90 1.12 1.39 1.05 1.33 206 Q206F 0.51 1.68
0.37 0.65 206 Q206G 0.98 0.90 1.03 0.11 1.22 206 Q206H 1.40 0.82
0.97 0.99 1.50 206 Q206I 1.56 0.96 0.80 0.31 1.71 206 Q206K 1.69
0.87 0.71 0.14 2.04 206 Q206L 1.63 0.70 0.83 0.81 1.75 206 Q206N
1.11 0.91 1.10 0.93 1.52 206 Q206P 1.05 0.97 1.07 0.42 1.28 206
Q206R 1.62 0.94 0.71 0.39 1.85 206 Q206S 0.93 1.68 1.20 0.91 1.35
206 Q206T 0.95 1.03 1.25 0.79 1.25 206 Q206V 0.96 0.88 1.02 0.44
1.17 206 Q206W 1.13 0.96 0.82 0.08 1.26 206 Q206Y 0.95 1.05 1.18
0.65 1.16 207 S207A 0.95 1.71 1.09 1.05 207 S207C 0.19 207 S207D
0.36 207 S207E 0.36 207 S207F 0.34 207 S207G 0.74 12.54 1.05 0.42
207 S207H 0.37 0.98 207 S207I 0.36 207 S207K 0.38 207 S207L 0.36
207 S207M 0.29 207 S207N 0.21 207 S207P 0.24 207 S207R 0.34 207
S207T 0.34 0.78 207 S207V 0.32 207 S207W 0.44 207 S207Y 0.35 208
T208A 0.71 2.56 1.42 0.93 208 T208C 0.93 1.15 1.37 0.65 1.31 208
T208D 0.19 208 T208E 0.35 208 T208F 0.30 0.68 0.10 208 T208G 0.20
0.05 208 T208H 0.22 208 T208K 0.27 208 T208L 1.01 0.92 1.21 1.23
208 T208M 0.21 208 T208N 0.22 1.51 0.12 208 T208P 0.28 2.26 0.39
208 T208Q 0.31 208 T208R 0.43 208 T208S 1.15 1.04 1.05 1.49 208
T208V 0.89 1.57 1.24 1.18 208 T208W 0.29 208 T208Y 0.21 209 Y209A
0.81 1.59 1.37 0.64 1.12 209 Y209C 1.19 0.80 1.21 0.78 1.72 209
Y209D 0.44 1.57 0.33 209 Y209E 0.72 1.68 1.58 1.09 209 Y209F 1.26
1.02 1.05 0.89 1.80 209 Y209G 0.93 1.29 1.29 0.11 1.15 209 Y209H
1.07 1.30 1.08 0.29 1.39 209 Y209I 1.25 0.86 1.04 0.63 2.04 209
Y209K 1.32 0.98 0.87 2.11 209 Y209L 1.03 0.83 1.14 0.23 1.79 209
Y209M 0.94 1.41 1.24 0.87 1.73 209 Y209N 1.02 1.11 1.14 1.33 209
Y209P 0.33 209 Y209R 1.07 1.18 0.98 1.23 209 Y209S 0.96 1.05 1.38
0.54 1.56 209 Y209T 0.76 1.83 1.32 0.59 1.49 209 Y209V 0.83 1.30
1.35 0.77 1.61 209 Y209W 0.89 1.61 1.24 0.87 1.45 210 P210A 0.97
1.80 1.26 1.08 1.55 210 P210C 0.85 1.50 1.54 0.94 1.39 210 P210D
0.67 2.94 1.79 0.24 0.86 210 P210E 0.82 1.78 1.52 0.71 1.01 210
P210F 0.79 2.14 1.40 0.57 1.14 210 P210G 1.03 1.75 1.24 0.55 1.53
210 P210H 0.89 2.43 1.34 0.79 1.44 210 P210I 1.06 1.77 1.23 1.20
1.58 210 P210L 0.81 1.93 1.45 1.03 1.23 210 P210M 1.01 1.78 1.37
1.08 1.41 210 P210N 1.01 1.62 1.25 0.84 1.64 210 P210Q 0.69 4.64
1.58 0.76 1.17 210 P210R 0.85 2.12 1.17 0.29 1.39 210 P210S 0.67
5.84 1.68 0.95 1.21 210 P210V 0.64 9.61 1.78 1.05 1.05 210 P210W
0.61 14.30 1.57 0.14 1.07 210 P210Y 0.71 3.88 1.55 0.82 1.17 211
G211A 1.05 1.55 1.13 0.89 1.21 211 G211C 1.10 0.93 1.10 0.92 1.24
211 G211E 1.26 1.08 1.17 1.06 1.48 211 G211F 1.01 1.41 0.87 0.54
1.25 211 G211H 1.22 1.22 1.01 1.11 1.27 211 G211I 1.13 1.16 1.22
0.91 1.30 211 G211L 1.31 0.95 0.85 0.78 1.37 211 G211M 1.25 1.09
0.96 0.81 1.44 211 G211P 1.12 1.04 0.93 1.17 1.25 211 G211Q 1.34
0.83 1.14 0.99 1.50 211 G211R 1.30 0.90 0.85 0.57 1.37 211 G211T
1.29 0.99 1.10 0.81 1.53 211 G211V 1.13 1.08 0.97 0.95 1.32 211
G211W 1.18 1.05 0.80 0.39 1.28 211 G211Y 0.79 1.53 1.03 0.84 0.86
212 S212C 1.14 1.57 1.21 1.10 1.57 212 S212F 1.25 1.54 0.88 1.04
1.78 212 S212G 1.12 1.35 1.08 0.95 1.77 212 S212H 1.38 1.00 0.97
1.09 1.75 212 S212I 1.06 1.61 1.19 0.53 1.51 212 S212M 1.14 1.36
1.14 1.03 1.59 212 S212N 1.55 0.97 0.88 1.10 2.11 212 S212P 1.56
0.94 0.85 0.65 2.14 212 S212R 1.44 1.03 0.70 0.85 1.84 212 S212T
1.28 0.96 1.06 0.62 1.79 212 S212V 1.32 0.93 1.06 0.58 1.76 212
S212W 0.22 212 S212Y 1.57 0.78 0.75 0.96 1.94 213 T213A 1.36 1.05
0.98 0.94 1.94 213 T213C 1.07 1.18 1.35 0.65 1.60 213 T213D 1.31
1.05 1.17 0.87 1.94 213 T213E 1.40 1.02 1.20 0.93 1.97 213 T213F
1.27 1.10 0.87 2.00 213 T213G 1.34 0.74 0.99 0.72 1.86 213 T213I
1.57 0.88 0.82 0.56 2.08 213 T213K 1.69 0.96 0.75 0.24 2.28 213
T213L 1.45 1.07 0.89 0.48 2.10 213 T213M 1.54 0.99 0.90 0.62 2.16
213 T213N 1.58 0.96 0.92 0.99 2.20 213 T213P 0.70 1.62 0.87 213
T213Q 1.57 0.82 0.90 0.95 2.32 213 T213R 1.59 0.86 0.66 0.12 2.08
213 T213S 1.53 0.93 0.92 1.05 2.14 213 T213V 1.60 0.92 0.94 0.56
2.23 213 T213W 1.52 0.81 0.74 2.07 213 T213Y 1.33 1.14 0.82 1.71
214 Y214A 0.23 1.09 0.10 214 Y214C 0.74 4.58 1.42 0.10 1.00 214
Y214E 0.67 2.33 1.49 0.87 214 Y214F 1.10 1.24 1.08 1.37 214 Y214G
0.19 2.32 0.17 214 Y214H 0.62 1.39 0.09 0.62 214 Y214I 0.77 6.29
1.24 0.79 214 Y214K 0.41 1.09 0.35 214 Y214L 1.15 1.12 1.09 0.08
1.27 214 Y214M 0.73 5.63 1.26 0.79 214 Y214N 0.35 1.71 0.34 214
Y214P 0.22 1.41 0.17 214 Y214Q 0.56 1.56 0.58 214 Y214R 0.23 1.10
0.16 214 Y214S 0.28 2.05 0.25 214 Y214T 0.60 1.48 0.79 214 Y214V
0.73 2.05 1.17 0.83 214 Y214W 1.14 0.98 1.05 1.40 215 A215C 0.96
1.27 1.30 1.04 1.30 215 A215D 1.22 0.93 1.26 1.00 1.32 215 A215E
1.09 0.78 1.35 1.30 1.14 215 A215F 1.40 1.28 1.06 0.71 1.70 215
A215G 1.50 0.93 0.99 0.49 1.89 215 A215H 1.24 1.43 1.14 1.12 1.46
215 A215I 1.53 1.07 1.01 1.31 2.23 215 A215K 1.47 1.51 0.95 0.85
1.80 215 A215M 1.54 0.89 0.95 1.08 1.81 215 A215N 1.25 0.96 1.14
0.90 1.50 215 A215P 1.13 0.66 1.18 1.88 215 A215R 1.17 1.08 0.90
0.60 1.45 215 A215S 1.13 1.22 1.27 0.88 1.47 215 A215T 1.12 0.70
1.14 1.18 1.40 215 A215V 1.02 1.18 1.13 1.27 1.46
215 A215W 1.27 1.02 0.97 0.58 1.40 215 A215Y 1.13 1.28 1.12 0.99
1.29 216 S216A 1.13 1.26 1.02 0.87 1.52 216 S216C 1.03 1.06 1.15
1.04 1.11 216 S216D 1.14 1.15 1.17 0.96 1.40 216 S216E 1.13 1.05
1.17 1.11 1.43 216 S216F 1.31 0.98 0.88 1.02 1.54 216 S216G 1.05
1.11 1.04 0.26 1.23 216 S216H 1.08 1.30 1.04 1.06 1.24 216 S216I
1.24 1.01 0.86 1.04 1.50 216 S216K 1.24 1.00 0.82 0.08 1.35 216
S216L 1.20 0.96 0.95 0.93 1.23 216 S216M 1.12 1.23 1.00 0.95 1.24
216 S216N 1.19 1.06 0.95 0.90 1.50 216 S216P 1.26 1.00 0.91 0.73
1.33 216 S216Q 1.10 1.34 1.04 0.91 1.23 216 S216R 1.15 1.07 0.93
0.28 1.43 216 S216V 1.18 0.80 1.03 0.84 1.29 216 S216W 1.24 0.95
0.95 0.97 1.57 216 S216Y 1.06 1.25 1.12 1.08 1.18 217 L217A 0.85
3.15 0.95 0.84 0.42 217 L217C 0.95 1.63 1.08 1.05 0.34 217 L217D
1.78 0.93 0.89 0.95 0.09 217 L217E 0.84 4.61 1.44 0.98 0.10 217
L217F 1.22 1.09 0.79 0.87 1.06 217 L217G 0.90 2.21 0.78 0.66 0.58
217 L217I 0.98 1.92 0.93 0.06 0.50 217 L217K 1.31 1.06 0.79 1.08
0.59 217 L217M 0.81 4.01 1.10 1.09 0.56 217 L217N 0.79 5.86 1.31
0.60 0.26 217 L217P 0.19 217 L217Q 0.91 2.34 1.18 1.05 0.44 217
L217S 0.60 1.55 0.75 0.27 217 L217T 0.74 13.21 1.19 0.13 0.27 217
L217V 0.77 7.00 1.13 0.25 217 L217Y 0.77 2.80 0.78 0.36 0.55 218
N218C 0.97 1.46 1.09 1.08 1.76 218 N218D 1.21 1.15 1.11 1.25 1.22
218 N218E 1.14 1.28 1.10 1.15 1.28 218 N218F 1.00 1.64 0.89 1.19
218 N218G 1.04 1.29 0.97 0.49 2.03 218 N218H 1.03 1.61 1.11 0.67
1.49 218 N218I 0.95 1.27 0.99 1.32 218 N218L 0.78 3.74 1.20 1.35
218 N218M 0.91 1.72 1.07 0.25 1.51 218 N218P 0.67 1.36 0.69 218
N218Q 1.11 1.09 1.11 0.82 1.58 218 N218R 1.17 0.97 0.80 1.80 218
N218S 0.65 1.55 0.97 1.24 218 N218T 0.63 1.45 1.03 1.34 218 N218V
1.00 1.26 1.08 1.76 218 N218W 0.77 4.67 1.01 0.18 0.55 218 N218Y
0.81 3.45 1.24 0.25 1.05 219 G219A 1.33 0.17 219 G219E 0.56 219
G219F 0.58 219 G219H 0.67 219 G219I 0.51 219 G219K 0.61 219 G219L
0.44 219 G219M 0.64 219 G219P 0.51 219 G219Q 0.55 219 G219R 0.51
219 G219S 0.92 219 G219T 0.52 219 G219V 0.47 219 G219W 0.47 219
G219Y 0.52 220 T220A 1.82 0.21 0.71 0.20 0.11 220 T220C 0.86 0.30
0.75 220 T220D 0.44 220 T220E 0.66 0.64 220 T220F 0.54 220 T220G
1.75 0.27 0.66 220 T220H 0.65 3.46 0.68 220 T220M 0.37 220 T220N
1.83 0.19 220 T220P 0.74 0.71 220 T220R 0.48 220 T220S 1.18 0.74
1.05 0.23 0.35 220 T220V 1.70 0.23 0.66 0.07 0.10 220 T220W 0.46
220 T220Y 0.45 221 S221A 0.62 221 S221C 0.79 221 S221E 0.65 221
S221F 0.51 221 S221G 1.23 221 S221H 0.50 221 S221K 0.51 221 S221L
0.47 221 S221M 0.51 221 S221N 0.72 221 S221P 0.48 221 S221R 0.48
221 S221T 0.98 221 S221V 0.39 221 S221W 0.53 221 S221Y 0.65 222
M222A 1.17 1.05 0.80 0.77 0.08 222 M222C 1.19 0.85 0.89 1.10 0.48
222 M222E 1.76 0.63 0.76 222 M222F 1.23 0.80 0.91 222 M222G 1.63
0.60 0.58 0.32 0.10 222 M222I 2.14 0.45 0.64 222 M222K 2.31 0.37
0.20 222 M222L 1.84 0.52 0.65 0.05 0.38 222 M222N 2.01 0.60 0.77
0.84 0.24 222 M222P 1.90 0.34 0.59 0.29 0.09 222 M222Q 1.32 1.13
1.01 0.05 222 M222R 2.15 0.14 0.10 222 M222S 1.53 0.86 0.74 0.91
0.11 222 M222T 1.85 0.50 0.53 0.89 0.18 222 M222V 1.75 0.51 0.68
0.56 0.09 222 M222W 2.41 0.33 0.36 222 M222Y 0.26 0.64 223 A223C
1.25 0.37 0.76 0.21 223 A223D 0.46 223 A223F 0.43 223 A223G 1.11
1.17 1.12 0.09 0.98 223 A223H 0.48 223 A223I 0.49 223 A223K 0.40
223 A223L 0.42 223 A223M 0.48 1.05 223 A223N 0.42 0.31 223 A223P
0.52 223 A223Q 0.43 223 A223R 0.40 223 A223S 1.35 0.84 0.98 0.97
1.09 223 A223T 0.40 0.90 0.18 223 A223V 0.22 223 A223W 0.44 223
A223Y 0.35 224 T224A 1.41 0.88 0.93 1.01 2.56 224 T224D 0.32 1.86
0.25 224 T224E 0.54 1.15 224 T224F 0.51 224 T224G 0.89 1.72 1.21
0.41 0.87 224 T224H 0.38 224 T224I 1.23 0.09 0.67 0.09 224 T224K
0.39 224 T224L 1.09 1.05 1.03 0.08 0.59 224 T224M 0.63 0.80 224
T224N 1.52 0.87 0.90 0.84 1.56 224 T224P 2.00 0.41 0.37 0.08 224
T224Q 0.49 224 T224R 0.36 224 T224S 1.15 1.15 1.04 1.10 1.90 224
T224W 0.39 224 T224Y 0.31 225 P225A 1.92 0.49 0.64 1.26 0.09 225
P225C 0.81 2.26 0.79 0.57 0.12 225 P225E 0.37 225 P225F 0.42 225
P225G 1.81 0.56 0.73 0.05 225 P225H 0.41 225 P225I 0.68 0.84 225
P225K 0.41 225 P225L 0.36 225 P225M 0.45 225 P225N 1.14 0.30 0.40
225 P225Q 0.38 225 P225R 0.37 225 P225S 1.76 0.57 0.67 0.99 0.08
225 P225T 1.32 0.73 0.65 0.18 0.17 225 P225V 1.39 0.62 0.69 225
P225W 0.31 225 P225Y 0.39 226 H226C 0.91 1.50 1.05 0.94 226 H226D
0.14 0.60 226 H226F 1.16 0.89 1.10 0.54 226 H226G 0.49 1.33 0.49
226 H226I 0.70 2.09 1.17 0.64 226 H226K 0.23 0.68 0.15 226 H226L
0.57 1.68 1.18 0.61 226 H226M 0.87 1.69 1.17 0.83 226 H226N 0.51
1.46 0.54 226 H226P 0.20 226 H226R 0.19 1.16 0.14 226 H226S 0.78
1.83 1.36 0.72 226 H226T 0.47 1.34 0.47 226 H226V 0.86 1.33 1.02
1.01 226 H226W 0.17 226 H226Y 0.71 2.12 1.18 0.32 227 V227A 1.15
1.15 1.06 0.91 1.23 227 V227C 0.88 1.63 1.36 0.95 1.08 227 V227E
0.31 227 V227F 0.56 1.39 0.48 227 V227G 1.08 0.67 1.03 0.79 0.97
227 V227H 0.25 227 V227I 1.17 1.12 1.12 0.70 1.46 227 V227L 1.22
1.07 1.04 0.26 1.30 227 V227M 1.53 0.78 0.88 1.63 227 V227P 0.21
227 V227Q 0.18 1.02 227 V227R 0.40 227 V227S 1.15 1.00 0.90 0.33
1.22 227 V227T 1.55 0.60 0.78 0.44 1.80 227 V227W 0.29 227 V227Y
0.16 1.27 0.06 0.09 228 A228C 0.76 33.67 1.52 0.89 1.06 228 A228D
0.37 228 A228E 0.46 228 A228F 0.37 228 A228G 1.51 0.79 0.89 1.03
1.72 228 A228H 0.46 228 A228I 1.86 0.59 0.70 0.64 2.03 228 A228K
0.50 228 A228L 0.45 1.92 0.41 0.55 228 A228M 0.34 2.16 228 A228N
0.23 228 A228P 0.29 228 A228Q 0.37 228 A228R 0.45 228 A228S 1.42
0.93 0.90 1.01 1.81 228 A228V 1.47 0.71 0.82 0.90 1.98 228 A228Y
0.47 229 G229A 0.88 1.72 1.27 0.65 1.09 229 G229C 0.22 229 G229D
0.41 229 G229E 0.41 229 G229F 0.46 229 G229H 0.45 229 G229K 0.42
229 G229L 0.40 229 G229P 0.22 2.34 0.96 0.21 229 G229R 0.54 229
G229S 1.06 1.36 1.02 0.28 1.38 229 G229T 0.18 229 G229V 0.29 229
G229W 0.51 229 G229Y 0.43 230 A230D 1.23 0.88 1.03 0.45 1.30 230
A230E 1.08 1.44 1.15 0.42 1.35 230 A230F 0.22 2.16 0.20 230 A230G
1.46 0.66 0.92 1.01 1.67 230 A230H 1.14 1.19 1.18 0.32 1.16 230
A230I 1.02 1.20 1.04 0.64 1.23 230 A230L 0.97 1.45 1.19 0.26 1.21
230 A230N 1.84 0.64 0.76 0.93 1.81 230 A230P 0.80 4.61 1.39 0.20
0.62 230 A230Q 1.29 0.86 1.01 1.46 230 A230R 0.27 230 A230S 0.98
1.57 1.25 0.93 1.30 230 A230T 0.86 2.87 1.31 0.92 1.06 230 A230V
0.97 1.62 1.25 0.82 1.14 230 A230W 0.28 1.29 0.21 230 A230Y 0.19
2.62 0.16 0.19 231 A231C 1.01 1.48 1.21 0.82 1.19
231 A231D 0.45 231 A231E 0.37 231 A231F 1.90 1.07 0.84 0.80 1.88
231 A231G 1.43 0.85 0.96 1.02 1.67 231 A231H 0.21 1.13 0.91 0.12
231 A231I 1.76 1.01 0.86 0.71 1.40 231 A231K 0.50 231 A231L 2.24
0.84 0.74 0.53 1.55 231 A231P 0.37 231 A231Q 0.29 231 A231R 0.42
231 A231S 1.83 0.90 0.86 0.81 2.21 231 A231T 1.63 1.07 0.91 0.63
1.79 231 A231W 0.18 1.48 0.19 0.08 231 A231Y 1.71 0.86 0.85 0.62
1.80 232 A232C 0.41 232 A232G 0.42 1.48 0.98 0.51 232 A232H 0.56
1.19 0.83 0.59 232 A232K 0.17 0.59 0.05 232 A232L 0.98 1.33 1.17
0.97 1.22 232 A232M 1.24 1.15 1.05 1.01 1.36 232 A232P 0.23 232
A232S 0.55 1.20 0.90 0.65 232 A232V 1.14 1.14 1.20 0.77 1.28 232
A232Y 0.19 233 L233A 0.93 2.14 1.18 0.91 1.32 233 L233C 0.81 3.18
1.15 0.97 1.12 233 L233E 0.86 2.51 1.33 1.00 1.22 233 L233F 0.95
1.84 1.14 0.42 1.26 233 L233G 1.14 1.26 1.06 0.97 1.28 233 L233I
1.15 1.14 1.09 0.97 1.42 233 L233M 0.96 2.01 1.14 0.73 1.38 233
L233N 0.87 2.53 1.31 0.92 1.16 233 L233P 0.19 1.85 0.90 0.14 233
L233Q 1.07 1.37 1.14 0.97 1.36 233 L233R 0.17 2.14 233 L233S 0.99
1.73 1.15 0.95 1.27 233 L233T 1.06 1.31 1.12 1.00 1.23 233 L233V
1.07 1.33 1.11 0.98 1.36 233 L233W 0.59 233 L233Y 0.67 14.92 1.58
0.90 0.95 234 V234D 0.53 1.52 0.93 0.66 234 V234F 1.36 0.97 0.91
0.56 1.77 234 V234G 0.61 1.43 0.97 0.74 234 V234H 1.33 0.92 0.95
0.51 1.50 234 V234L 1.19 1.25 1.05 1.14 1.23 234 V234M 1.08 1.21
1.06 0.92 1.18 234 V234N 1.15 0.97 1.00 0.90 1.57 234 V234P 0.32
2.03 0.74 0.40 234 V234Q 1.76 0.71 0.74 0.92 1.88 234 V234S 1.20
1.10 1.07 0.91 1.43 234 V234T 1.05 1.32 1.12 0.95 1.39 234 V234Y
1.67 0.86 0.82 0.47 1.73 235 K235C 1.24 1.11 1.04 0.97 1.63 235
K235D 0.26 1.32 1.12 0.15 235 K235E 0.69 7.13 1.34 1.07 0.80 235
K235F 1.50 1.05 1.11 1.05 1.76 235 K235G 1.65 0.95 0.98 0.85 2.12
235 K235H 1.22 1.25 1.09 1.06 1.44 235 K235I 1.05 1.62 1.23 1.01
1.37 235 K235L 1.21 1.00 1.13 1.10 1.39 235 K235M 1.47 1.01 1.02
0.91 1.58 235 K235N 1.69 0.76 1.05 1.02 2.05 235 K235Q 1.22 1.13
1.06 1.14 1.41 235 K235R 1.19 1.24 1.11 0.96 1.39 235 K235S 1.56
0.91 1.06 1.04 1.65 235 K235V 1.59 0.97 1.02 0.98 2.22 235 K235W
1.41 1.06 1.06 0.94 1.63 235 K235Y 1.77 0.74 1.00 0.97 1.94 236
Q236A 1.02 1.33 1.16 0.85 1.19 236 Q236C 0.87 2.36 1.37 0.89 1.14
236 Q236E 1.00 1.36 1.41 1.25 1.14 236 Q236F 0.98 1.58 1.22 0.95
1.12 236 Q236G 0.78 6.07 1.53 0.77 0.93 236 Q236H 1.01 1.31 1.17
1.02 1.39 236 Q236K 1.12 1.20 0.95 0.69 1.39 236 Q236L 0.72 1.99
1.56 0.71 0.57 236 Q236N 1.04 1.13 1.24 0.95 1.24 236 Q236P 0.17
2.71 0.81 0.17 236 Q236R 1.05 1.26 1.01 0.69 1.28 236 Q236S 0.89
2.14 1.28 0.86 1.03 236 Q236T 1.16 1.16 1.12 0.90 1.36 236 Q236V
0.45 2.14 0.92 0.62 236 Q236W 0.82 4.08 1.39 0.75 1.01 236 Q236Y
1.22 1.02 1.07 0.81 1.49 237 K237A 1.25 1.26 1.19 1.00 1.57 237
K237C 0.97 1.73 1.34 1.19 1.17 237 K237D 0.57 237 K237F 1.19 1.25
1.13 0.92 1.58 237 K237G 1.25 0.83 1.03 1.11 1.45 237 K237H 1.28
1.02 1.09 1.18 1.45 237 K237I 1.23 1.05 1.13 1.11 1.53 237 K237L
1.27 1.14 1.17 1.12 1.46 237 K237M 1.11 1.04 1.07 1.03 1.42 237
K237P 0.36 1.60 0.93 0.42 237 K237Q 1.42 0.96 1.05 1.00 1.82 237
K237R 1.05 1.86 1.25 1.02 1.48 237 K237S 1.15 1.20 1.20 0.98 1.54
237 K237T 1.49 1.06 1.01 1.13 1.61 237 K237V 1.26 1.02 1.03 1.12
1.34 237 K237W 1.65 0.83 1.04 1.08 1.87 237 K237Y 1.17 1.05 1.19
0.99 1.43 238 N238C 1.24 1.08 1.13 1.12 1.45 238 N238D 1.23 1.03
1.04 1.02 1.51 238 N238E 1.14 1.31 1.02 1.09 1.35 238 N238F 1.26
1.16 1.10 1.02 1.56 238 N238G 1.05 1.36 1.21 0.94 1.33 238 N238H
1.17 1.08 0.99 1.01 1.37 238 N238I 1.47 1.01 0.95 1.10 1.75 238
N238K 1.47 0.95 0.89 0.99 1.60 238 N238L 1.59 0.89 0.98 1.11 1.68
238 N238M 1.03 1.17 1.11 0.92 1.28 238 N238P 0.28 238 N238Q 1.29
0.94 1.03 0.94 1.50 238 N238R 1.10 1.14 1.06 0.90 1.34 238 N238S
1.15 1.34 1.02 0.91 1.33 238 N238T 1.32 1.04 1.06 1.03 1.33 238
N238V 0.94 1.62 1.02 0.96 1.15 238 N238Y 1.19 0.88 1.09 0.90 1.28
239 P239C 1.00 1.38 1.18 1.05 1.37 239 P239D 1.18 1.14 1.12 1.10
1.37 239 P239F 1.12 1.51 1.18 1.08 1.35 239 P239G 1.11 1.38 1.09
1.05 1.55 239 P239H 1.07 1.50 1.12 1.06 1.51 239 P239I 1.62 0.99
0.80 2.27 239 P239K 1.13 1.25 0.91 0.98 1.55 239 P239L 1.13 1.09
1.06 1.11 1.37 239 P239M 0.96 1.58 1.21 0.99 1.30 239 P239N 1.43
1.00 1.00 1.08 1.64 239 P239Q 1.53 0.93 0.99 1.04 1.61 239 P239R
0.99 1.78 0.96 1.03 1.13 239 P239S 1.06 1.34 1.18 1.00 1.28 239
P239T 1.11 1.29 1.10 1.00 1.32 239 P239V 1.04 1.45 1.09 1.05 1.21
239 P239W 0.94 1.48 1.25 0.97 1.15 239 P239Y 1.02 1.14 1.18 0.94
1.21 240 S240A 1.04 1.52 1.11 0.97 1.46 240 S240C 1.04 1.55 1.23
1.00 1.30 240 S240E 1.09 1.15 1.24 1.04 1.37 240 S240F 1.26 1.24
1.06 0.96 1.59 240 S240I 1.10 1.00 1.02 0.95 1.50 240 S240K 1.24
1.13 0.88 0.97 1.59 240 S240L 0.67 12.41 1.50 1.07 0.92 240 S240M
0.91 1.59 1.18 0.95 1.20 240 S240N 0.94 1.57 1.27 0.95 1.29 240
S240Q 1.03 1.06 1.17 1.00 1.32 240 S240R 1.02 1.23 0.97 0.87 1.31
240 S240T 1.06 1.29 0.91 0.93 1.35 240 S240W 1.18 1.02 1.01 0.97
1.41 240 S240Y 1.34 0.97 0.97 0.98 1.46 241 W241A 1.52 1.23 0.86
0.98 1.96 241 W241C 1.72 0.93 0.86 1.07 2.04 241 W241D 1.29 1.00
1.15 1.07 1.68 241 W241E 1.13 1.08 1.12 1.01 1.56 241 W241F 0.94
1.41 1.28 1.02 1.25 241 W241G 0.87 2.18 1.40 0.97 1.21 241 W241H
1.94 0.93 0.74 1.04 2.21 241 W241I 1.84 1.02 0.84 1.15 1.99 241
W241K 1.83 0.93 0.75 1.03 2.19 241 W241L 1.26 1.13 1.02 1.17 1.52
241 W241M 1.38 1.01 0.93 0.95 1.79 241 W241N 1.52 1.10 0.91 1.04
1.89 241 W241P 0.22 1.52 0.84 0.14 241 W241Q 1.59 0.96 0.87 1.03
2.06 241 W241R 1.55 1.05 0.78 0.96 1.80 241 W241S 1.55 1.13 0.87
0.91 2.00 241 W241T 1.14 1.24 1.14 1.05 1.47 241 W241V 1.95 0.79
0.75 1.06 2.07 241 W241Y 1.14 1.06 1.09 0.95 1.52 242 S242A 1.08
1.20 1.16 1.04 1.36 242 S242C 0.98 1.15 1.33 1.02 1.24 242 S242D
0.93 1.51 1.45 1.11 1.12 242 S242F 1.35 0.58 0.88 0.73 1.66 242
S242G 0.94 1.71 1.31 1.14 1.19 242 S242H 1.65 0.73 0.73 0.97 1.88
242 S242I 1.55 0.73 0.85 1.02 1.82 242 S242L 1.37 0.79 0.91 0.97
1.64 242 S242M 1.65 0.73 0.80 0.94 1.75 242 S242P 1.72 0.72 0.79
1.00 1.88 242 S242Q 1.32 0.90 0.98 1.04 1.45 242 S242R 1.29 0.90
0.86 0.63 1.42 242 S242T 0.93 1.70 1.30 0.88 1.28 242 S242V 1.49
0.80 0.88 0.98 1.62 242 S242W 1.14 0.91 0.99 0.65 1.22 243 N243A
0.60 243 N243C 0.94 1.35 1.26 1.00 1.20 243 N243D 1.64 0.69 0.91
0.92 1.58 243 N243E 1.46 1.02 0.96 1.11 1.48 243 N243F 1.71 0.90
0.82 0.93 1.46 243 N243G 1.36 1.02 1.00 1.03 1.68 243 N243H 1.30
1.11 0.94 1.13 1.47 243 N243I 1.27 0.99 1.01 0.97 1.42 243 N243K
1.66 0.74 0.82 0.07 1.62 243 N243L 1.21 1.42 1.06 0.90 1.51 243
N243M 1.14 1.28 1.06 0.99 1.48 243 N243P 1.63 0.90 0.78 0.96 2.05
243 N243Q 1.28 0.97 0.92 1.12 1.44 243 N243R 1.88 0.96 0.68 0.29
1.83 243 N243S 1.20 1.35 1.14 1.02 1.42 243 N243T 1.21 1.00 1.03
0.96 1.40 243 N243V 1.06 1.03 1.21 1.04 1.32 243 N243W 1.54 0.98
0.81 1.05 1.31 244 V244A 1.10 1.53 1.00 0.34 1.25 244 V244D 1.38
0.92 0.96 1.07 1.47 244 V244E 1.12 1.11 1.07 1.09 1.34 244 V244F
1.39 0.97 0.91 1.02 1.72 244 V244H 1.05 1.63 1.13 1.11 1.29 244
V244I 1.19 1.13 1.07 1.01 1.54 244 V244L 1.09 1.12 1.11 1.04 1.35
244 V244M 0.99 1.15 1.12 1.00 1.11 244 V244N 1.11 1.09 1.01 1.07
1.28 244 V244P 1.75 0.86 0.80 0.66 1.87 244 V244Q 0.99 1.05 1.15
1.01 1.28 244 V244R 1.08 1.14 0.88 0.63 1.31 244 V244S 1.34 1.13
0.87 0.89 1.71 244 V244T 1.16 1.11 1.05 1.09 1.24 244 V244W 1.13
0.80 0.97 0.97 1.29 244 V244Y 0.66 2.52 1.19 0.92 0.56 245 Q245A
1.26 1.15 1.04 0.95 1.81 245 Q245C 0.97 1.09 1.29 1.04 1.25 245
Q245E 1.25 1.02 1.01 1.03 1.61 245 Q245G 1.00 1.66 1.24 1.03 1.31
245 Q245H 1.23 1.02 0.99 1.10 1.58 245 Q245K 1.39 0.89 0.80 0.85
1.80 245 Q245L 1.11 1.05 1.08 1.14 1.28 245 Q245P 0.93 1.47 1.26
0.99 1.14 245 Q245R 1.24 1.08 0.84 0.76 1.62 245 Q245S 1.09 1.10
1.05 1.01 1.40 245 Q245V 1.15 0.98 0.99 0.92 1.59 245 Q245W 1.42
0.71 0.81 0.90 1.62 245 Q245Y 1.14 1.12 1.06 0.96 1.28 246 I246A
1.62 0.94 0.81 0.90 2.10 246 I246C 1.86 0.87 0.79 0.98 2.20 246
I246E 0.22 5.52 1.10 0.06 246 I246F 0.29 2.87 0.84 0.30 246 I246G
0.22 2.38 1.00 0.11 246 I246H 0.18 1.09 0.85 0.08 246 I246L 1.21
1.05 1.06 1.03 1.66 246 I246M 2.23 0.74 0.64 0.95 2.51 246 I246N
0.77 1.66 1.37 1.11 0.92 246 I246P 0.42 1.82 246 I246Q 0.74 1.14
1.54 0.99 0.94 246 I246R 0.24 4.38 246 I246S 0.74 3.01 1.38 0.96
0.92 246 I246T 2.16 0.72 0.74 0.99 2.45 246 I246V 1.33 0.94 1.04
0.90 1.97 246 I246W 0.35 2.29 1.02 0.47 246 I246Y 0.34 2.59 0.89
0.38 247 R247A 1.13 1.23 1.03 0.87 1.44 247 R247C 1.25 1.05 1.10
1.02 1.30 247 R247D 1.40 0.96 0.96 0.65 1.46
247 R247E 0.95 1.63 1.29 0.68 1.06 247 R247F 1.15 1.08 0.99 0.93
1.35 247 R247G 1.52 0.97 0.96 0.95 1.77 247 R247H 1.71 1.15 0.92
1.03 1.58 247 R247I 1.42 1.02 0.97 0.79 1.25 247 R247K 1.35 1.13
0.93 1.12 1.24 247 R247L 1.56 0.99 0.92 0.93 1.33 247 R247M 1.07
1.57 1.09 0.82 1.26 247 R247N 1.82 0.83 0.83 1.09 1.55 247 R247P
0.31 1.90 0.87 0.20 247 R247Q 1.65 0.88 0.81 0.78 1.65 247 R247S
1.20 1.58 1.07 0.91 1.28 247 R247T 0.97 1.78 1.26 0.88 0.93 247
R247V 1.01 1.15 1.13 0.90 0.95 247 R247W 0.96 1.02 1.27 0.87 1.04
247 R247Y 1.10 1.21 1.10 0.98 1.22 248 N248C 0.89 1.59 1.43 1.00
1.30 248 N248D 1.20 0.96 1.21 0.99 1.41 248 N248E 1.28 0.86 0.92
1.04 1.57 248 N248G 1.22 0.83 1.06 1.00 1.68 248 N248H 1.33 1.05
1.03 1.01 1.79 248 N248I 1.07 1.57 1.15 0.92 1.61 248 N248K 1.38
1.03 0.96 0.76 2.01 248 N248L 1.08 1.26 1.15 0.93 1.56 248 N248M
0.55 2.27 248 N248P 1.21 0.72 1.04 0.95 1.57 248 N248R 1.39 0.98
0.79 0.87 1.79 248 N248S 1.50 0.99 0.94 0.98 2.10 248 N248T 1.28
1.02 1.03 1.03 1.76 248 N248V 1.11 1.46 1.02 0.95 1.68 248 N248W
1.22 1.06 1.06 0.77 1.74 248 N248Y 1.19 1.04 0.98 0.90 1.65 249
H249A 1.12 1.09 1.08 0.88 1.54 249 H249D 1.84 0.76 0.83 1.10 2.01
249 H249E 1.57 1.02 0.94 1.03 2.03 249 H249F 0.98 0.84 1.20 1.01
1.32 249 H249G 2.16 0.75 0.72 1.00 2.26 249 H249I 1.34 1.03 0.92
1.13 1.63 249 H249K 1.65 0.91 0.78 0.96 1.95 249 H249L 1.53 0.77
0.89 0.98 1.87 249 H249M 1.64 0.93 0.85 0.93 1.85 249 H249N 0.90
0.89 1.33 1.01 1.15 249 H249P 0.38 249 H249Q 1.33 0.93 0.89 1.07
1.53 249 H249R 1.25 1.03 0.88 0.80 1.58 249 H249S 1.89 0.87 0.76
0.81 2.30 249 H249T 1.36 1.09 0.95 0.97 1.69 249 H249V 1.69 0.84
0.74 0.76 2.27 249 H249W 1.71 0.81 0.87 0.91 1.90 249 H249Y 1.44
0.97 0.91 0.90 1.82 250 L250A 0.45 2.21 0.87 0.67 250 L250C 1.57
0.99 0.78 0.95 2.04 250 L250D 0.50 0.62 250 L250E 0.27 1.41 250
L250F 1.17 0.89 1.09 1.30 250 L250G 0.32 3.73 250 L250H 0.29 3.38
250 L250I 1.33 1.05 1.03 0.93 1.86 250 L250M 1.47 0.92 0.94 0.98
1.76 250 L250N 0.32 3.47 250 L250P 0.43 250 L250Q 0.25 2.72 0.80
0.25 250 L250R 0.43 250 L250S 0.23 1.96 0.89 0.10 250 L250V 0.81
1.45 1.42 0.82 1.06 250 L250W 0.24 250 L250Y 0.19 4.27 0.10 0.07
251 K251A 1.16 1.15 1.08 0.86 1.41 251 K251D 1.10 1.13 0.96 1.05
1.41 251 K251E 1.18 1.01 1.01 1.06 1.29 251 K251F 1.55 0.84 0.89
0.98 1.58 251 K251G 1.74 1.03 0.99 0.94 2.15 251 K251L 1.16 0.91
1.07 1.17 1.24 251 K251M 0.96 1.03 1.35 1.14 1.04 251 K251P 0.37
1.80 0.48 0.30 251 K251Q 1.48 0.81 0.96 1.17 1.58 251 K251R 1.08
1.11 1.12 0.87 1.41 251 K251S 0.66 0.79 1.14 0.23 251 K251T 0.94
1.47 1.37 1.23 1.02 251 K251V 0.98 0.83 1.15 0.92 1.15 251 K251Y
1.31 0.94 1.08 0.96 1.37 252 N252A 1.23 1.15 1.02 1.01 1.61 252
N252C 0.91 1.34 1.29 1.12 1.16 252 N252D 1.12 0.85 1.09 1.19 1.34
252 N252F 1.18 1.25 0.85 1.10 1.46 252 N252G 1.10 1.17 0.89 1.03
1.66 252 N252H 1.21 1.19 1.02 1.02 1.62 252 N252I 1.19 1.43 0.89
1.24 1.50 252 N252K 1.47 1.08 0.88 0.92 1.92 252 N252L 1.31 1.22
0.99 1.17 1.66 252 N252M 1.12 1.19 1.00 0.90 1.64 252 N252P 0.56
1.26 0.57 252 N252R 1.19 1.15 0.85 0.87 1.64 252 N252S 1.12 1.10
0.89 1.11 1.34 252 N252V 0.98 1.03 0.92 1.00 1.34 252 N252W 1.18
1.04 0.81 0.91 1.56 252 N252Y 0.49 1.65 1.05 0.63 253 T253A 1.13
1.28 1.20 0.84 1.50 253 T253D 1.13 0.67 0.93 0.39 1.17 253 T253E
1.33 0.61 1.04 1.00 1.64 253 T253F 0.91 1.45 1.25 0.74 1.27 253
T253G 1.78 0.88 0.78 0.61 1.86 253 T253H 1.55 0.85 0.84 0.91 1.79
253 T253I 1.05 0.92 1.01 0.21 1.16 253 T253K 1.51 0.76 0.84 0.74
1.93 253 T253M 0.99 1.33 0.97 0.91 1.28 253 T253P 0.15 253 T253R
1.32 1.00 0.81 0.60 1.69 253 T253S 1.40 0.95 0.90 0.84 1.91 253
T253V 1.17 1.01 0.84 0.60 1.34 253 T253W 1.24 0.77 1.01 0.83 1.40
254 A254C 0.81 8.81 1.48 0.69 1.16 254 A254D 0.20 1.90 0.80 0.17
254 A254E 0.81 0.53 254 A254F 0.14 254 A254G 1.02 1.02 1.08 0.40
1.22 254 A254H 0.11 254 A254K 0.15 0.13 254 A254L 0.11 254 A254M
0.13 254 A254N 0.29 1.84 0.29 254 A254P 0.28 2.02 0.24 254 A254Q
0.13 0.05 0.07 254 A254R 0.18 0.19 254 A254S 1.20 1.12 0.99 0.79
1.66 254 A254T 0.97 1.59 1.23 0.39 1.37 254 A254V 0.71 1.56 0.90
254 A254W 0.10 254 A254Y 0.11 255 T255A 1.44 0.88 0.98 0.81 1.85
255 T255C 1.37 0.89 1.01 1.04 1.84 255 T255D 1.58 0.88 0.99 1.31
2.04 255 T255E 1.59 0.84 0.95 1.29 1.87 255 T255F 1.28 1.13 1.05
0.78 1.75 255 T255G 0.20 255 T255H 1.40 0.93 0.98 1.85 255 T255I
1.71 0.93 0.85 1.09 2.21 255 T255L 1.46 1.05 0.89 1.00 1.89 255
T255N 1.51 1.22 0.92 0.88 2.03 255 T255P 1.57 0.92 0.80 0.13 2.11
255 T255Q 1.67 0.85 0.81 0.99 2.11 255 T255R 1.58 1.02 0.63 2.13
255 T255S 1.24 1.08 1.03 0.75 1.81 255 T255V 1.54 0.94 0.92 1.02
1.96 255 T255W 1.65 0.90 0.77 0.52 2.13 255 T255Y 1.54 0.89 0.88
0.81 1.93 256 S256A 0.89 1.75 1.13 1.05 1.15 256 S256C 1.12 1.09
0.89 1.06 1.39 256 S256D 1.24 1.07 1.15 1.15 1.58 256 S256E 1.28
0.92 1.06 1.13 1.48 256 S256G 0.94 1.06 1.22 0.98 1.09 256 S256H
1.16 1.14 0.96 1.03 1.34 256 S256I 1.16 1.02 0.92 0.91 1.53 256
S256K 1.46 0.94 0.76 0.80 1.71 256 S256L 1.20 1.00 0.86 0.93 1.42
256 S256M 0.99 1.23 1.15 0.91 1.26 256 S256N 0.99 1.46 1.09 1.07
1.21 256 S256P 1.26 1.09 0.94 0.93 1.59 256 S256R 1.37 0.99 0.73
0.60 1.76 256 S256T 0.92 1.75 1.40 0.76 1.32 256 S256V 0.91 1.43
1.31 0.82 1.24 256 S256W 1.09 1.09 0.93 0.91 1.15 256 S256Y 1.02
1.22 0.88 0.90 1.19 257 L257A 0.80 2.90 1.28 0.05 1.06 257 L257C
0.89 1.29 1.32 0.57 0.96 257 L257E 0.26 2.35 0.33 257 L257F 0.92
1.42 1.17 1.04 257 L257G 0.55 1.48 0.73 257 L257H 0.61 1.56 0.79
257 L257I 1.38 0.96 0.82 0.77 1.59 257 L257K 0.92 2.29 0.98 1.33
257 L257M 1.02 1.11 1.03 0.64 1.29 257 L257P 0.42 1.82 0.50 257
L257S 0.50 1.76 0.69 257 L257T 0.60 1.65 0.83 257 L257V 0.95 1.32
1.29 0.43 1.28 257 L257W 0.46 1.58 0.57 257 L257Y 0.60 1.38 0.82
258 G258A 1.04 1.01 1.11 0.26 1.25 258 G258C 1.01 0.92 1.17 0.60
1.24 258 G258D 1.02 0.99 1.33 0.93 1.28 258 G258E 0.79 1.18 1.52
0.90 0.99 258 G258F 1.23 0.90 0.95 1.40 258 G258H 1.27 0.83 0.97
0.28 1.45 258 G258I 0.85 1.11 1.27 0.08 0.97 258 G258L 0.95 1.08
1.14 0.08 1.35 258 G258M 1.09 0.91 1.07 0.16 1.20 258 G258P 0.99
0.81 1.19 0.05 1.11 258 G258Q 1.12 0.77 1.10 0.34 1.40 258 G258R
1.15 1.07 0.86 1.31 258 G258S 1.25 1.21 1.00 0.28 1.49 258 G258T
0.90 1.07 1.16 1.14 258 G258V 0.85 1.03 1.32 0.96 258 G258W 0.88
1.31 1.02 1.02 258 G258Y 0.99 1.01 1.18 0.15 1.21 259 S259A 1.27
1.24 0.76 0.98 1.49 259 S259C 0.88 1.08 1.38 0.98 1.18 259 S259E
0.99 1.15 1.32 1.08 1.36 259 S259G 1.15 1.03 1.11 0.58 1.37 259
S259I 0.94 1.18 1.12 0.41 1.16 259 S259L 0.81 1.65 1.26 0.41 1.21
259 S259M 0.88 1.47 1.17 0.52 1.11 259 S259P 0.96 1.53 1.33 1.00
1.40 259 S259Q 0.92 1.76 1.22 0.87 1.15 259 S259R 0.97 1.64 0.83
0.26 1.29 259 S259T 0.98 1.25 1.19 0.75 1.25 259 S259V 1.05 1.07
1.18 0.45 1.30 260 T260A 1.52 1.06 0.98 0.88 1.66 260 T260D 0.89
1.30 1.45 1.01 1.11 260 T260E 0.93 1.15 1.26 1.11 1.11 260 T260F
1.03 1.22 1.05 0.47 1.29 260 T260H 1.37 1.19 0.90 0.81 1.79 260
T260I 1.23 1.27 1.09 0.95 1.42 260 T260L 1.36 1.09 1.09 0.54 1.59
260 T260M 1.30 1.17 1.14 0.77 1.59 260 T260N 1.29 0.99 1.00 0.94
1.73 260 T260P 1.32 1.01 1.11 1.15 1.53 260 T260R 1.19 1.25 0.89
0.60 1.65 260 T260S 1.07 1.34 1.19 0.94 1.38 260 T260V 0.97 1.32
1.06 0.93 1.24 260 T260Y 1.07 0.89 0.99 0.76 1.30 261 N261A 1.26
1.33 1.04 0.98 1.70 261 N261C 0.93 1.06 1.38 1.15 1.12 261 N261E
1.01 1.10 1.34 1.11 1.33 261 N261F 1.05 1.13 1.05 1.08 1.41 261
N261G 1.42 0.76 0.92 0.73 1.70 261 N261I 1.37 1.10 0.99 1.14 1.72
261 N261K 1.59 1.05 0.80 0.88 1.91 261 N261L 1.34 1.01 1.00 1.27
1.44 261 N261P 1.40 0.96 1.04 0.97 1.70 261 N261Q 1.13 1.17 1.06
1.11 1.35 261 N261R 1.26 1.05 0.75 0.78 1.71 261 N261S 1.32 1.06
1.06 1.00 1.53 261 N261T 0.91 1.44 1.06 1.09 1.23 261 N261V 0.96
1.27 1.08 1.14 1.23 261 N261W 1.15 1.02 0.89 1.16 1.42 261 N261Y
0.97 1.19 0.95 1.18 1.13 262 L262A 1.24 1.31 1.02 0.85 1.66 262
L262C 1.22 0.90 1.16 1.04 1.60 262 L262D 1.07 1.09 1.33 1.20 1.38
262 L262F 1.21 1.12 1.05 1.03 1.60 262 L262G 0.99 0.89 1.06 0.39
1.31 262 L262H 1.34 0.98 0.96 1.21 1.60 262 L262I 1.40 1.00 0.97
1.06 1.78 262 L262K 1.32 0.99 0.72 0.62 1.67 262 L262M 1.42 1.05
0.96 0.99 1.80 262 L262P 0.62 1.53 0.06 0.86 262 L262Q 1.19 1.05
1.00 1.09 1.46 262 L262R 1.29 1.11 0.62 0.19 1.47 262 L262S 1.14
1.16 1.04 0.75 1.52 262 L262T 1.05 1.18 1.19 0.85 1.31
262 L262V 1.10 1.32 1.06 0.91 1.52 262 L262W 1.10 1.08 1.11 0.72
1.36 262 L262Y 1.16 1.13 1.04 0.90 1.63 263 Y263A 0.64 19.07 1.22
0.89 263 Y263C 0.84 0.62 1.19 0.38 0.85 263 Y263D 0.32 1.75 0.19
263 Y263F 1.35 1.10 1.13 0.69 1.84 263 Y263G 0.26 1.31 0.18 263
Y263H 0.71 4.21 1.15 0.48 0.98 263 Y263I 0.53 1.31 0.67 263 Y263K
0.54 0.84 0.60 263 Y263L 0.84 2.05 1.28 0.06 1.20 263 Y263M 0.53
1.44 0.13 0.63 263 Y263N 0.59 1.27 1.42 0.09 0.86 263 Y263P 0.33
1.27 0.07 0.09 263 Y263Q 0.36 1.68 0.43 263 Y263R 0.30 1.00 0.25
263 Y263W 0.45 1.36 0.44 264 G264A 0.92 1.99 1.10 0.05 1.18 264
G264C 0.27 2.39 0.06 0.22 264 G264E 0.28 1.97 0.05 0.07 264 G264F
0.21 1.36 0.06 0.08 264 G264H 0.15 1.36 0.13 0.06 264 G264I 0.21
1.07 264 G264L 0.22 0.98 0.07 0.06 264 G264P 0.24 1.06 0.09 264
G264Q 0.22 1.38 0.08 0.07 264 G264R 0.15 0.10 0.06 264 G264S 0.62
1.47 0.74 264 G264T 0.22 0.96 0.18 0.07 264 G264V 0.22 1.10 0.05
264 G264Y 0.24 1.16 0.09 0.06 265 S265A 1.21 1.49 1.05 0.86 1.65
265 S265C 0.79 1.85 1.22 0.99 1.06 265 S265D 1.02 1.07 1.17 1.04
1.16 265 S265F 1.02 1.32 1.09 0.26 1.25 265 S265G 0.94 1.76 1.05
0.31 1.22 265 S265H 1.11 1.17 1.07 0.73 1.59 265 S265I 0.34 1.45
0.33 265 S265K 1.46 1.12 0.83 0.16 2.00 265 S265L 0.77 3.33 1.18
0.90 265 S265M 1.02 1.45 1.16 0.55 1.42 265 S265N 0.37 265 S265P
0.26 1.23 0.16 265 S265Q 1.06 1.00 1.20 0.79 1.26 265 S265R 1.03
1.99 0.86 1.56 265 S265T 0.87 2.15 1.20 0.39 1.26 265 S265V 0.75
4.75 1.34 0.97 265 S265W 0.93 1.08 1.29 0.31 1.17 265 S265Y 0.97
1.17 1.19 0.49 1.22 266 G266A 0.19 0.62 0.05 266 G266C 0.25 0.72
0.09 266 G266D 0.24 0.78 0.08 0.07 266 G266E 0.22 0.55 266 G266H
0.23 0.53 0.06 0.06 266 G266I 0.17 0.06 266 G266K 0.17 0.69 0.06
0.09 266 G266L 0.22 0.75 0.08 266 G266M 0.20 266 G266N 0.21 0.59
0.12 0.06 266 G266Q 0.19 0.62 0.05 266 G266R 0.18 0.06 0.09 266
G266S 0.20 0.06 266 G266T 0.11 266 G266V 0.11 0.07 266 G266W 0.12
1.08 0.10 266 G266Y 0.13 0.95 0.05 0.10 267 L267A 0.77 3.80 1.43
1.03 267 L267C 0.55 1.63 0.75 267 L267D 0.20 1.41 0.12 267 L267E
0.15 2.22 0.16 0.16 267 L267F 0.70 0.89 1.47 0.87 267 L267G 0.85
2.17 1.08 1.18 267 L267H 0.65 1.29 0.88 267 L267I 1.32 1.05 0.96
0.90 1.54 267 L267K 0.76 1.17 1.21 1.24 267 L267M 0.87 2.12 1.22
0.58 1.12 267 L267N 0.92 1.55 1.08 1.37 267 L267P 0.19 0.09 0.06
267 L267S 0.58 1.74 0.85 267 L267T 0.46 1.81 0.63 267 L267V 0.94
1.50 0.93 0.08 1.26 267 L267W 0.17 0.24 267 L267Y 0.48 1.38 0.64
268 V268A 1.29 0.89 1.12 0.81 1.42 268 V268D 0.70 1.39 0.26 0.79
268 V268E 0.65 1.45 0.65 0.72 268 V268G 1.54 0.79 0.93 0.08 1.77
268 V268H 0.88 1.38 1.13 0.83 268 V268K 0.59 1.43 0.32 0.73 268
V268L 1.28 0.99 0.99 0.87 1.62 268 V268M 1.00 1.17 0.97 0.60 1.35
268 V268N 1.33 0.87 0.96 0.14 1.72 268 V268P 1.67 0.56 0.81 0.20
1.70 268 V268Q 1.39 0.89 0.93 0.35 1.69 268 V268R 0.33 2.81 268
V268S 1.18 0.92 0.94 0.33 1.47 268 V268W 0.16 2.12 0.06 0.06 268
V268Y 0.15 2.50 0.12 269 N269C 0.67 3.47 1.37 0.99 1.06 269 N269D
0.95 1.22 1.39 1.12 1.39 269 N269F 1.33 1.35 1.10 0.07 1.96 269
N269G 1.29 1.00 1.08 0.43 1.61 269 N269H 1.04 1.72 1.17 0.94 1.41
269 N269I 1.59 1.14 1.04 0.44 2.15 269 N269L 1.68 0.99 1.03 0.19
2.17 269 N269M 1.18 1.31 1.18 0.75 1.61 269 N269Q 1.38 1.02 1.00
0.99 1.80 269 N269R 0.95 1.47 0.91 1.33 269 N269S 0.97 1.45 1.25
0.81 1.26 269 N269T 1.19 1.27 1.23 0.48 1.55 269 N269V 1.11 1.28
1.06 0.42 1.72 270 A270C 1.25 1.31 1.19 0.99 1.76 270 A270D 1.19
1.29 1.18 0.60 1.54 270 A270E 0.22 1.54 0.26 270 A270F 0.72 4.90
1.17 0.98 270 A270G 1.09 1.22 1.14 0.97 1.39 270 A270H 0.57 1.34
0.05 0.65 270 A270I 1.13 1.27 1.15 0.81 1.39 270 A270K 0.19 270
A270L 0.97 1.66 1.19 0.86 1.30 270 A270M 1.19 1.20 1.18 0.54 1.52
270 A270N 0.92 1.84 1.20 0.82 1.33 270 A270P 0.80 1.50 1.25 0.25
1.05 270 A270Q 0.49 1.53 0.12 0.59 270 A270S 1.10 1.07 1.06 0.85
1.61 270 A270T 0.94 1.64 1.04 0.96 1.30 270 A270V 0.90 1.63 1.21
0.94 1.34 270 A270W 0.14 271 E271A 1.52 1.14 0.79 0.42 1.81 271
E271C 1.20 1.09 1.21 0.88 1.61 271 E271F 1.13 1.44 0.91 0.22 1.56
271 E271G 1.22 1.40 0.89 0.36 1.73 271 E271H 1.18 1.73 1.00 0.52
1.63 271 E271I 1.23 1.04 0.98 0.06 1.60 271 E271K 1.21 1.28 0.70
0.06 1.62 271 E271L 0.98 1.53 0.93 0.29 1.24 271 E271M 1.21 1.35
0.92 0.39 1.65 271 E271N 1.01 1.35 0.93 0.33 1.32 271 E271P 0.95
1.43 0.94 1.21 271 E271T 0.94 1.64 1.05 0.30 1.32 271 E271V 0.95
1.25 1.00 0.13 1.57 271 E271Y 0.98 1.22 0.86 0.44 1.27 272 A272C
1.00 1.21 1.08 0.97 1.28 272 A272D 0.98 1.25 1.09 1.04 1.37 272
A272E 0.98 1.40 1.13 1.02 1.37 272 A272F 1.06 1.40 0.95 0.95 1.44
272 A272G 1.26 0.79 1.00 0.95 1.66 272 A272H 1.29 0.96 0.88 0.92
1.68 272 A272K 1.31 0.99 0.87 0.64 1.53 272 A272L 1.38 0.85 1.00
1.07 1.75 272 A272M 1.17 1.06 1.09 0.97 1.58 272 A272N 1.10 1.15
1.02 0.98 1.36 272 A272P 1.43 0.85 0.94 0.95 1.96 272 A272R 0.96
1.24 1.04 0.65 1.33 272 A272S 0.86 2.78 1.26 0.92 1.20 272 A272T
1.02 1.35 1.06 0.97 1.38 272 A272W 1.16 0.92 1.02 0.94 1.35 272
A272Y 1.03 1.08 1.17 1.02 1.28 273 A273C 1.01 1.38 1.14 0.99 1.23
273 A273D 0.95 1.36 1.11 1.23 273 A273E 0.99 1.31 1.15 1.31 273
A273F 1.14 1.09 1.08 1.28 273 A273G 0.99 1.43 1.01 1.03 1.24 273
A273H 0.99 1.19 1.10 0.08 1.19 273 A273I 0.97 1.61 1.04 0.17 1.12
273 A273K 0.65 1.18 0.85 273 A273L 1.12 1.08 1.01 0.40 1.41 273
A273R 0.68 1.12 0.76 273 A273S 0.89 2.21 1.06 0.82 1.29 273 A273T
0.81 4.52 1.09 0.53 1.06 273 A273V 1.07 1.22 1.03 0.62 1.36 273
A273W 0.38 1.70 0.48 273 A273Y 0.54 1.39 0.64 274 T274A 1.09 1.29
1.05 0.97 1.40 274 T274C 1.06 1.26 1.01 1.01 1.18 274 T274D 0.86
2.23 1.27 0.69 1.00 274 T274E 0.91 1.44 1.33 0.21 1.14 274 T274G
0.92 1.55 1.20 0.87 1.16 274 T274H 1.03 1.42 1.07 0.21 1.34 274
T274K 0.76 3.48 1.19 0.10 1.00 274 T274L 1.28 0.97 0.97 0.97 1.55
274 T274M 1.17 1.01 1.04 0.90 1.26 274 T274N 1.05 1.20 1.12 0.92
1.27 274 T274P 0.88 1.60 1.25 1.05 274 T274Q 1.23 0.97 1.03 0.49
1.38 274 T274R 0.89 1.52 1.06 1.09 274 T274S 1.33 0.98 0.97 1.02
1.44 274 T274W 1.09 1.27 1.14 0.13 1.27 275 R275A 0.51 1.62 1.06
0.67 275 R275C 0.46 1.37 1.06 0.62 275 R275D 1.12 1.25 0.94 1.07
1.70 275 R275E 1.26 0.92 1.19 1.12 1.65 275 R275F 1.12 1.02 1.03
1.16 1.42 275 R275G 0.64 1.42 1.10 0.90 275 R275H 1.15 1.06 1.05
1.13 1.46 275 R275K 1.30 0.95 1.02 1.07 1.59 275 R275L 0.82 2.73
1.25 1.08 1.13 275 R275M 0.81 5.83 1.31 1.16 1.03 275 R275P 1.05
0.94 1.09 0.90 1.38 275 R275Q 1.21 0.90 0.86 1.09 1.51 275 R275V
0.75 3.80 1.21 0.99 0.99 275 R275W 0.79 10.11 1.31 0.96 1.20
Example 5
Comparative Evaluation of GCI-P036 Variant Data
[0285] In this Example, results of experiments conducted to
determine protein expression, stain removal activity, LAS/EDTA
stability, and AAPF activity (tests of properties of interest) of
GCI-P036 and GCI-P036 variants are compared. As described
throughout, functionality of the GCI-P036 variants is quantified as
a performance index (PI), which is the ratio of performance of a
variant to a reference protease. PI classifications used herein
include: Up mutations (PI>1.0); Neutral mutations (PI>0.5);
Non-deleterious mutations (PI>0.05); and Deleterious mutations
(PI.ltoreq.0.05).
[0286] In initial screens of GCI-P036 variants, at least one
mutation in the following positions was associated with a
performance index greater than 1.0 (PI>1.0) for at least one
property: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16,
17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33,
34, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51,
52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 63, 66, 67, 68, 69, 71, 72,
73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89,
90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104,
105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117,
118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130,
131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143,
144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156,
157, 158, 159, 160, 165, 166, 167, 168, 169, 170, 171, 172, 173,
174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186,
187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199,
200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 210, 211, 212,
213, 214, 215, 216, 217, 218, 219, 220, 221, 222, 223, 224, 225,
226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237, 238,
239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250, 251,
252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263, 264,
265, 266, 267, 268, 269, 270, 271, 272, 273, 274, and 275 (e.g., Up
mutations). Mutations at these positions may be combined to improve
activity or stability or expression.
[0287] In particular, the following substitutions in GCI-P036 were
associated with a favorable outcome in at least one test of
interest (e.g., better than the wild type enzyme). These mutations
are especially useful to improve individual properties. As
indicated elsewhere herein, in this list, the leading "0" is
included to provide a three number designation for each site (e.g.,
"001" is the same as "1," so "A001C" is the same as "A1C"). In
addition, as indicated elsewhere herein, "X" refers to any amino
acid residue. X001A, X001C, X001E, X001F, X001G, X001H, X001I,
X001K, X001L, X001N, X001P, X001Q, X001R, X001S, X001T, X001V,
X001Y, X002A, X002C, X002E, X002G, X002K, X002L, X002M, X002N,
X002P, X002Q, X002R, X002S, X002T, X002V, X002W, X002Y, X003D,
X003E, X003F, X003G, X003H, X003I, X003L, X003M, X003N, X003P,
X003R, X003S, X003T, X003V, X003W, X003Y, X004A, X004C, X004D,
X004E, X004F, X004G, X004H, X004K, X004L, X004N, X004P, X004R,
X004S, X004T, X004V, X004W, X005A, X005C, X005D, X005E, X005G,
X005I, X005M, X005P, X005Q, X005S, X005T, X005W, X005Y, X006A,
X006D, X006E, X006M, X006W, X007A, X007C, X007D, X007G, X007H,
X007N, X007P, X007Q, X007S, X007T, X008A, X008F, X008G, X008I,
X008L, X008M, X008Q, X008T, X008V, X008W, X008Y, X009A, X009C,
X009D, X009E, X009F, X009G, X009H, X009L, X009N, X009P, X009Q,
X009R, X009S, X009T, X009V, X009W, X009Y, X010A, X010C, X010F,
X010G, X010H, X010I, X010K, X010L, X010M, X010N, X010Q, X010R,
X010S, X010T, X010V, X010W, X010Y, X011A, X011C, X011D, X011G,
X011I, X011M, X011S, X011T, X011V, X012D, X012F, X012G, X012H,
X012I, X012K, X012L, X012M, X012N, X012P, X012Q, X012R, X012S,
X012T, X012V, X012W, X013A, X013G, X013I, X013M, X013Q, X013T,
X013V, X014A, X014C, X014D, X014E, X014F, X014G, X014H, X014I,
X014K, X014L, X014P, X014Q, X014S, X014T, X014V, X014Y, X015A,
X015D, X015F, X015G, X015I, X015K, X015L, X015M, X015P, X015Q,
X015R, X015S, X015V, X015W, X016A, X016D, X016E, X016G, X016L,
X016N, X016P, X016Q, X016R, X016S, X016T, X016V, X017A, X017D,
X017E, X017F, X017G, X017H, X017I, X017K, X017M, X017N, X017R,
X017S, X017T, X017V, X017W, X017Y, X018A, X018C, X018D, X018E,
X018F, X018G, X018H, X018K, X018L, X018M, X018N, X018P, X018Q,
X018R, X018S, X018T, X018V, X018W, X018Y, X019A, X019C, X019D,
X019E, X019F, X019G, X019H, X019K, X019L, X019M, X019N, X019P,
X019R, X019S, X019T, X019V, X019W, X019Y, X020A, X020C, X020D,
X020F, X020G, X020I, X020K, X020L, X020M, X020P, X020Q, X020R,
X020S, X020T, X020V, X020W, X020Y, X021A, X021C, X021D, X021E,
X021G, X021H, X021I, X021K, X021L, X021M, X021N, X021P, X021Q,
X021R, X021S, X021T, X021V, X021W, X022A, X022C, X022G, X022I,
X022K, X022L, X022M, X022N, X022P, X022Q, X022R, X022S, X022T,
X022V, X022W, X022Y, X023A, X023G, X023S, X024A, X024C, X024D,
X024F, X024G, X024H, X024L, X024M, X024N, X024P, X024Q, X024R,
X024S, X024T, X024V, X024W, X025C, X025D, X025E, X025F, X025G,
X025H, X025K, X025L, X025M, X025N, X025Q, X025R, X025S, X025T,
X025V, X025W, X026C, X026F, X026G, X026I, X026L, X026M, X026N,
X026P, X026R, X026S, X026T, X026V, X027A, X027C, X027D, X027F,
X027G, X027I, X027K, X027L, X027M, X027N, X027P, X027R, X027S,
X027T, X027V, X027W, X027Y, X028A, X028E, X028H, X028I, X028L,
X028M, X028N, X028S, X028V, X028Y, X029A, X029C, X029G, X029K,
X029S, X029T, X029V, X030C, X030D, X030E, X030F, X030L, X030M,
X030Q, X030S, X030T, X030V, X031A, X031F, X031I, X031L, X031M,
X031S, X031T, X031V, X032C, X032D, X032G, X033A, X033C, X033D,
X033E, X033G, X033H, X033I, X033L, X033M, X033N, X033Q, X033R,
X033S, X033T, X033V, X033Y, X034E, X034G, X034S, X035A, X035F,
X035H, X035I, X035K, X035L, X035M, X035P, X035Q, X035R, X035S,
X036A, X036C, X036E, X036F, X036G, X036H, X036I, X036L, X036M,
X036N, X036P, X036Q, X036R, X036S, X036T, X036V, X036W, X036Y,
X038C, X038F, X038G, X038H, X038I, X038K, X038L, X038M, X038N,
X038Q, X038R, X038T, X038V, X038W, X038Y, X039A, X039E, X039G,
X039H, X039N, X039Q, X039S, X039T, X039V, X039Y, X040A, X040C,
X040D, X040E, X040G, X040H, X040I, X040K, X040L, X040M, X040N,
X040P, X040R, X040S, X040T, X040V, X040W, X040Y, X041C, X041D,
X041E, X041N, X041Q, X042A, X042C, X042F, X042G, X042H, X042I,
X042L, X042M, X042N, X042Q, X042S, X042T, X042V, X042Y, X043A,
X043C, X043D, X043E, X043F, X043G, X043I, X043L, X043M, X043N,
X043P, X043R, X043S, X043T, X043V, X043W, X043Y, X044A, X044C,
X044D, X044F, X044G, X044I, X044K, X044L, X044M, X044N, X044P,
X044Q, X044R, X044S, X044T, X044V, X044W, X044Y, X045A, X045D,
X045F, X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P,
X045Q, X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D,
X046E, X046F, X046G, X046H, X046I, X046K, X046L, X046M, X046N,
X046P, X046Q, X046R, X046S, X046T, X046V, X046W, X047A, X047C,
X047E, X047F, X047G, X047H, X047K, X047L, X047M, X047N, X047Q,
X047R, X047S, X047T, X047W, X048A, X048C, X048E, X048F, X048G,
X048H, X048I, X048K, X048L, X048M, X048N, X048P, X048Q, X048R,
X048S, X048T, X048V, X048Y, X049A, X049E, X049F, X049G, X049H,
X049K, X049L, X049M, X049P, X049Q, X049R, X049S, X049T, X050C,
X050F, X050H, X050I, X050L, X050N, X050T, X050V, X050Y, X051F,
X051G, X051H, X051K, X051L, X051N, X051P, X051R, X051S, X051T,
X051V, X051W, X052A, X052C, X052E, X052F, X052G, X052H, X052I,
X052L, X052M, X052N, X052P, X052Q, X052R, X052T, X052V, X052W,
X052Y, X053A, X053C, X053D, X053E, X053G, X053H, X053I, X053K,
X053L, X053M, X053P, X053Q, X053R, X053S, X053T, X053V, X053W,
X053Y, X054A, X054C, X054D, X054E, X054F, X054G, X054H, X054I,
X054K, X054L, X054M, X054N, X054P, X054Q, X054R, X054S, X054V,
X054Y, X055A, X055C, X055E, X055F, X055G, X055H, X055I, X055K,
X055L, X055M, X055N, X055P, X055Q, X055R, X055S, X055T, X055W,
X055Y, X056A, X056C, X056D, X056E, X056H, X056L, X056M, X056N,
X056P, X056Q, X056R, X056S, X056T, X056V, X057A, X057C, X057E,
X057F, X057G, X057H, X057I, X057K, X057L, X057M, X057N, X057P,
X057Q, X057R, X057S, X057T, X057V, X057W, X057Y, X059A, X059C,
X059D, X059E, X059F, X059G, X059I, X059L, X059M, X059N, X059P,
X059Q, X059R, X059S, X059T, X059V, X059W, X059Y, X060A, X060C,
X060D, X060F, X060G, X060K, X060L, X060M, X060N, X060P, X060Q,
X060S, X060T, X060V, X060W, X060Y, X061A, X061C, X061D, X061F,
X061G, X061H, X061I, X061L, X061M, X061N, X061P, X061R, X061S,
X061T, X061V, X061Y, X062C, X062E, X062F, X062G, X062H, X062I,
X062K, X062L, X062M, X062N, X062P, X062Q, X062R, X062S, X062T,
X062V, X062Y, X063A, X063C, X063D, X063E, X063F, X063G, X063H,
X063I, X063K, X063M, X063P, X063Q, X063R, X063S, X063T, X063V,
X063W, X066A, X066C, X066D, X066E, X066I, X066K, X066L, X066N,
X066Q, X066S, X066T, X067A, X067C, X067F, X067H, X067L, X067M,
X067N, X067P, X067Q, X067R, X067S, X067T, X067V, X068A, X068C,
X068D, X068E, X068G, X068H, X068I, X068L, X068M, X068N, X068Q,
X068S, X068T, X068V, X069A, X069C, X069E, X069F, X069G, X069I,
X069L, X069M, X069N, X069S, X069T, X069V, X069W, X071A, X071C,
X071D, X071E, X071G, X071I, X071L, X071M, X071N, X071P, X071S,
X071T, X071V, X071W, X072C, X072F, X072H, X072I, X072L, X072M,
X072N, X072Q, X072S, X072T, X072V, X072W, X073A, X073C, X073D,
X073E, X073H, X073K, X073L, X073N, X073R, X073S, X073T, X073V,
X074A, X074C, X074S, X074T, X075A, X075C, X075D, X075E, X075F,
X075G, X075H, X075I, X075L, X075M, X075N, X075P, X075Q, X075R,
X075S, X075T, X075V, X075W, X076C, X076D, X076E, X076F, X076G,
X076H, X076I, X076K, X076L, X076M, X076N, X076Q, X076R, X076S,
X076T, X076W, X076Y, X077A, X077C, X077D, X077E, X077F, X077G,
X077H, X077K, X077L, X077M, X077N, X077Q, X077R, X077S, X077V,
X077Y, X078A, X078C, X078E, X078F, X078G, X078H, X078I, X078K,
X078L, X078M, X078N, X078P, X078Q, X078R, X078S, X078T, X078V,
X078W, X078Y, X079C, X079D, X079E, X079F, X079G, X079I, X079K,
X079L, X079M, X079N, X079P, X079Q, X079R, X079S, X079T, X079V,
X079W, X079Y, X080A, X080D, X080E, X080G, X080K, X080L, X080M,
X080R, X080T, X080V, X080W, X080Y, X081A, X081C, X081D, X081E,
X081F, X081G, X081H, X081I, X081K, X081L, X081M, X081P, X081Q,
X081R, X081S, X081T, X081V, X081W, X081Y, X082A, X082E, X082F,
X082K, X082L, X082M, X082N, X082Q, X082R, X082S, X082T, X082V,
X082W, X082Y, X083G, X083S, X084C, X084E, X084F, X084G, X084H,
X084I, X084L, X084M, X084N, X084Q, X084T, X084V, X085A, X085C,
X085I, X085L, X086A, X086C, X086D, X086E, X086G, X086I, X086L,
X086P, X086S, X086V, X086W, X086Y, X087A, X087C, X087D, X087E,
X087F, X087G, X087I, X087K, X087L, X087N, X087P, X087S, X087T,
X087V, X087Y, X088A, X088C, X088D, X088E, X088G, X088H, X088K,
X088M, X088Q, X088R, X088S, X088V, X088W, X089A, X089C, X089D,
X089E, X089F, X089G, X089H, X089I, X089L, X089N, X089P, X089Q,
X089R, X089S, X089T, X089V, X089W, X090A, X090C, X090E, X090F,
X090G, X090I, X090K, X090L, X090M, X090P, X090Q, X090T, X090V,
X090W, X090Y, X091C, X091D, X091F, X091I, X091K, X091L, X091M,
X091N, X091Q, X091R, X091S, X091T, X091V, X091W, X091Y, X092A,
X092C, X092D, X092E, X092F, X092G, X092H, X092I, X092K, X092L,
X092N, X092P, X092Q, X092R, X092T, X092V, X092W, X092Y, X093A,
X093C, X093D, X093F, X093G, X093L, X093M, X093N, X093S, X093T,
X093V, X093Y, X094A, X094D, X094E, X094G, X094H, X094I, X094K,
X094L, X094M, X094N, X094Q, X094R, X094V, X095A, X095C, X095G,
X095I, X095K, X095L, X095M, X095R, X095S, X095T, X095V, X095W,
X096A, X096E, X096F, X096G, X096H, X096I, X096L, X096M, X096Q,
X096R, X096S, X096T, X096W, X096Y, X097A, X097D, X097E, X097F,
X097G, X097H, X097I, X097K, X097L, X097M, X097N, X097P, X097Q,
X097R, X097S, X097T, X097V, X097W, X097Y, X098A, X098C, X098D,
X098E, X098F, X098G, X098K, X098L, X098N, X098P, X098Q, X098R,
X098S, X098T, X098V, X098Y, X099A, X099C, X099F, X099G, X099K,
X099M, X099P, X099Q, X099R, X099S, X099T, X099V, X099Y, X100D,
X100E, X100F, X100G, X100I, X100K, X100L, X100M, X100N, X100P,
X100Q, X100R, X100S, X100T, X100V, X100W, X100Y, X101A, X101D,
X101E, X101F, X101G, X101H, X101I, X101K, X101N, X101P, X101Q,
X101R, X101S, X101T, X101V, X101Y, X102A, X102C, X102D, X102E,
X102F, X102G, X102H, X102M, X102N, X102T, X103A, X103C, X103D,
X103E, X103F, X103G, X103I, X103L, X103N, X103P, X103Q, X103R,
X103S, X103T, X103V, X103W, X103Y, X104A, X104C, X104D, X104E,
X104F, X104H, X104I, X104L, X104P, X104R, X104S, X104T, X104V,
X104W, X104Y, X105A, X105C, X105D, X105E, X105F, X105G, X105H,
X105I, X105K, X105L, X105M, X105N, X105Q, X105R, X105S, X105T,
X105V, X105W, X105Y, X106A, X106D, X106E, X106F, X106G, X106I,
X106L, X106M, X106P, X106R, X106S, X106T, X106V, X106W, X107A,
X107C, X107E, X107F, X107H, X107I, X107L, X107M, X107Q, X107S,
X107T, X107V, X107W, X107Y, X108A, X108C, X108G, X108I, X108L,
X108M, X108S, X108T, X108V, X109A, X109C, X109E, X109F, X109G,
X109H, X109I, X109K, X109L, X109M, X109N, X109P, X109Q, X109R,
X109S, X109T, X109W, X109Y, X110A, X110G, X110S, X111C, X111E,
X111F, X111I, X111L, X111M, X111V, X111Y, X112A, X112C, X112D,
X112E, X112F, X112G, X112I, X112L, X112N, X112Q, X112S, X112T,
X112V, X112W, X112Y, X113L, X113M, X113W, X114A, X114C, X114G,
X114T, X115C, X115E, X115F, X115G, X115H, X115I, X115K, X115L,
X115M, X115N, X115P, X115Q, X115R, X115S, X115T, X115V, X115W,
X115Y, X116A, X116C, X116D, X116F, X116G, X116I, X116K, X116L,
X116M, X116N, X116Q, X116S, X116T, X116V, X116W, X117A, X117C,
X117D, X117F, X117G, X117I, X117N, X117Q, X117R, X117T, X117Y,
X118A, X118C, X118D, X118E, X118F, X118G, X118I, X118K, X118L,
X118M, X118N, X118P, X118R, X118S, X118T, X118V, X118W, X119A,
X119C, X119F, X119G, X119H, X119M, X119N, X119Q, X119T, X119W,
X120A, X120C, X120E, X120F, X120G, X120H, X120I, X120L, X120M,
X120N, X120R, X120S, X120T, X120W, X121A, X121C, X121E, X121F,
X121G, X121I, X121L, X121M, X121Q, X121S, X121T, X121V, X121Y,
X122A, X122C, X122G, X122I, X122L, X122S, X122T, X122V, X123E,
X123G, X123I, X123L, X123N, X123S, X124G, X124H, X124L, X124N,
X124Q, X124S, X124T, X125A, X125C, X125G, X125S, X125T, X126A,
X126C, X126E, X126F, X126G, X126H, X126I, X126L, X126M, X126N,
X126Q, X126S, X126T, X126V, X126W, X126Y, X127D, X127F, X127G,
X127I, X127L, X127Q, X127R, X127S, X127T, X127V, X128A, X128C,
X128D, X128F, X128G, X128H, X128I, X128K, X128L, X128M, X128N,
X128P, X128Q, X128R, X128S, X128T, X128W, X128Y, X129A, X129E,
X129F, X129G, X129I, X129L, X129M, X129N, X129P, X129R, X129S,
X129T, X129V, X129W, X129Y, X130C, X130K, X130L, X130N, X130Q,
X130R, X130S, X130V, X130W, X130Y, X131A, X131D, X131E, X131F,
X131G, X131I, X131K, X131L, X131M, X131P, X131Q, X131R, X131V,
X132A, X132E, X132F, X132H, X132I, X132L, X132M, X132N, X132Q,
X132S, X132T, X132W, X133A, X133F, X133K, X133L, X133N, X133P,
X133Q, X133S, X133T, X133V, X133Y, X134A, X134F, X134I, X134L,
X134M, X134P, X134S, X134T, X134V, X135A, X135C, X135E, X135F,
X135L, X135M, X135Q, X135T, X135W, X136A, X136D, X136E, X136F,
X136G, X136K, X136N, X136Q, X136R, X136S, X136V, X136W, X136Y,
X137A, X137C, X137E, X137G, X137H, X137K, X137L, X137M, X137Q,
X137R, X137S, X137V, X137W, X138A, X138C, X138E, X138G, X138L,
X138M, X138Q, X138R, X138V, X139A, X139C, X139E, X139F, X139G,
X139I, X139M, X139Q, X139S, X139T, X139V, X139Y, X140A, X140C,
X140D, X140E, X140F, X140G, X140I, X140K, X140L, X140M, X140N,
X140Q, X140R, X140S, X140T, X140V, X140Y, X141D, X141E, X141G,
X141H, X141I, X141K, X141L, X141N, X141Q, X141R, X141S, X141V,
X141Y, X142A, X142C, X142E, X142G, X142I, X142L, X142M, X142N,
X142Q, X142S, X142T, X142V, X142Y, X143C, X143D, X143F, X143G,
X143H, X143I, X143K, X143L, X143M, X143N, X143S, X143T, X143V,
X143W, X143Y, X144A, X144C, X144D, X144G, X144H, X144I, X144L,
X144M, X144N, X144Q, X144R, X144S, X144T, X144V, X144W, X144Y,
X145A, X145C, X145D, X145E, X145F, X145G, X145K, X145L, X145M,
X145N, X145Q, X145R, X145S, X145T, X145W, X145Y, X146A, X146C,
X146D, X146E, X146F, X146G, X146I, X146K, X146L, X146M, X146Q,
X146R, X146S, X146T, X146W, X146Y, X147F, X147G, X147I, X147L,
X147M, X147P, X147Q, X147T, X147V, X148A, X148C, X148E, X148F,
X148G, X148H, X148I, X148L, X148M, X148N, X148S, X148T, X148V,
X148W, X148Y, X149A, X149C, X149F, X149G, X149H, X149I, X149L,
X149M, X149P, X149Q, X149S, X149T, X149V, X150A, X150E, X150F,
X150G, X150H, X150L, X150P, X150Q, X150S, X150T, X150V, X151A,
X151G, X151M, X151S, X151T, X151V, X152A, X152C, X152P, X152R,
X152S, X152T, X153A, X153G, X153I, X153M, X153Q, X153S, X153V,
X154G, X154Q, X155A, X155D, X155F, X155I, X155N, X155P, X155Q,
X155R, X155S, X155T, X155V, X155Y, X156A, X156C, X156D, X156E,
X156F, X156G, X156K, X156L, X156M, X156N, X156P, X156Q, X156R,
X156S, X156T, X157G, X157L, X157V, X158A, X158C, X158E, X158F,
X158H, X158K, X158L, X158M, X158P, X158Q, X158R, X158S, X158T,
X158V, X158W, X159A, X159C, X159E, X159G, X159H, X159M, X159P,
X159Q, X159R, X159S, X159V, X159W, X159Y, X160A, X160C, X160D,
X160F, X160G, X160I, X160L, X160M, X160N, X160Q, X160R, X160S,
X160T, X160V, X160Y, X165D, X165E, X165F, X165G, X165H, X165I,
X165K, X165L, X165R, X165T, X165V, X165W, X165Y, X166A, X166C,
X166D, X166E, X166H, X166I, X166L, X166M, X166N, X166P, X166R,
X166S, X166T, X166V, X166W, X167A, X167C, X167D, X167E, X167F,
X167G, X167I, X167P, X167Q, X167V, X167W, X167Y, X168F, X168I,
X168M, X168P, X169A, X169C, X169G, X169S, X170A, X170D, X170E,
X170G, X170H, X170K, X170L, X170P, X170Q, X170R, X170S, X170V,
X170W, X170Y, X171A, X171C, X171D, X171F, X171G, X171H, X171I,
X171L, X171N, X171Q, X171S, X171T, X171W, X171Y, X172A, X172C,
X172D, X172F, X172G, X172I, X172K, X172L, X172M, X172P, X172Q,
X172R, X172S, X172T, X172V, X172Y, X173A, X173C, X173D, X173E,
X173F, X173G, X173H, X173I, X173K, X173L, X173M, X173N, X173P,
X173Q, X173R, X173T, X173V, X173W, X173Y, X174A, X174G, X174I,
X174N, X174P, X174S, X174T, X174V, X175A, X175C, X175E, X175G,
X175H, X175I, X175K, X175L, X175M, X175Q, X175S, X175T, X175V,
X175Y, X176A, X176C, X176E, X176G, X176I, X176P, X176S, X176T,
X176V, X177A, X177C, X177I, X177T, X177V, X178A, X178G, X178S,
X179A, X179C, X179G, X180C, X180G, X180H, X180I, X180L, X180N,
X180Q, X180S, X180T, X180V, X181A, X181D, X181E, X181G, X181L,
X181N, X182A, X182D, X182E, X182F, X182G, X182H, X182I, X182K,
X182L, X182M, X182N, X182P, X182Q, X182R, X182S, X182T, X182V,
X182W, X182Y, X183A, X183D, X183F, X183G, X183H, X183I, X183K,
X183L, X183M, X183N, X183P, X183Q, X183R, X183S, X183T, X183V,
X183W, X183Y, X184A, X184C, X184D, X184E, X184G, X184H, X184L,
X184M, X184N, X184S, X184T, X184Y, X185A, X185C, X185E, X185F,
X185G, X185H, X185I, X185K, X185L, X185M, X185N, X185Q, X185R,
X185S, X185T, X185V, X185Y, X186A, X186G, X186H, X186I, X186K,
X186L, X186M, X186Q, X186R, X186T, X186W, X187A, X187C, X187E,
X187F, X187G, X187H, X187I, X187M, X187P, X187W, X187Y, X188A,
X188D, X188E, X188F, X188G, X188H, X188I, X188K, X188L, X188P,
X188Q, X188R, X188S, X188T, X188V, X188W, X188Y, X189A, X189C,
X189E, X189F, X189G, X189H, X189K, X189L, X189M, X189N, X189P,
X189Q, X189R, X189S, X189T, X189V, X190D, X190E, X190F, X190G,
X190H, X190I, X190K, X190L, X190M, X190N, X190P, X190Q, X190R,
X190S, X190V, X190W, X190Y, X191A, X191D, X191F, X191H, X191I,
X191K, X191L, X191P, X191Q, X191S, X191V, X191W, X191Y, X192D,
X192E, X192H, X192L, X192M, X192P, X192Q, X192R, X192T, X192V,
X192W, X192Y, X193A, X193D, X193E, X193F, X193G, X193H, X193I,
X193K, X193L, X193R, X193T, X193V, X193W, X193Y, X194A, X194C,
X194D, X194E, X194F, X194G, X194H, X194I, X194L, X194M, X194P,
X194Q, X194R, X194S, X194T, X194V, X194W, X194Y, X195A, X195C,
X195D, X195E, X195G, X195K, X195Q, X195R, X195S, X195T, X195V,
X195Y, X196A, X196D, X196E, X196F, X196I, X196L, X196M, X196P,
X196Q, X196T, X197A, X197C, X197D, X197E, X197F, X197G, X197H,
X197I, X197L, X197M, X197N, X197Q, X197S, X197T, X197V, X197W,
X197Y, X198A, X198D, X198E, X198F, X198G, X198H,
X198I, X198L, X198M, X198N, X198Q, X198R, X198S, X198T, X198W,
X198Y, X199A, X199C, X199D, X199E, X199F, X199G, X199I, X199L,
X199M, X199Q, X199S, X199T, X199V, X200A, X200C, X200G, X200H,
X200I, X200S, X201C, X201G, X201P, X201S, X201T, X201V, X202F,
X202G, X203A, X203C, X203E, X203F, X203G, X203H, X203I, X203K,
X203L, X203N, X203S, X203T, X203V, X203W, X203Y, X204A, X204C,
X204E, X204F, X204G, X204I, X204K, X204L, X204N, X204P, X204R,
X204S, X204T, X204W, X204Y, X205A, X205F, X205G, X205I, X205L,
X205M, X205Q, X205T, X205V, X206A, X206C, X206D, X206E, X206F,
X206G, X206H, X206I, X206K, X206L, X206N, X206P, X206Q, X206R,
X206S, X206T, X206V, X206W, X206Y, X207A, X207G, X207S, X208A,
X208C, X208L, X208N, X208P, X208S, X208T, X208V, X209A, X209C,
X209D, X209E, X209F, X209G, X209H, X209I, X209K, X209L, X209M,
X209N, X209R, X209S, X209T, X209V, X209W, X209Y, X210A, X210C,
X210D, X210E, X210F, X210G, X210H, X210I, X210L, X210M, X210N,
X210P, X210Q, X210R, X210S, X210V, X210W, X210Y, X211A, X211C,
X211E, X211F, X211G, X211H, X211I, X211L, X211M, X211P, X211Q,
X211R, X211T, X211V, X211W, X211Y, X212C, X212F, X212G, X212H,
X212I, X212M, X212N, X212P, X212R, X212S, X212T, X212V, X212Y,
X213A, X213C, X213D, X213E, X213F, X213G, X213I, X213K, X213L,
X213M, X213N, X213P, X213Q, X213R, X213S, X213T, X213V, X213W,
X213Y, X214A, X214C, X214E, X214F, X214G, X214H, X214I, X214K,
X214L, X214M, X214N, X214P, X214Q, X214R, X214S, X214T, X214V,
X214W, X214Y, X215A, X215C, X215D, X215E, X215F, X215G, X215H,
X215I, X215K, X215M, X215N, X215P, X215R, X215S, X215T, X215V,
X215W, X215Y, X216A, X216C, X216D, X216E, X216F, X216G, X216H,
X216I, X216K, X216L, X216M, X216N, X216P, X216Q, X216R, X216S,
X216V, X216W, X216Y, X217A, X217C, X217D, X217E, X217F, X217G,
X217I, X217K, X217L, X217M, X217N, X217Q, X217S, X217T, X217V,
X217Y, X218C, X218D, X218E, X218F, X218G, X218H, X218I, X218L,
X218M, X218N, X218P, X218Q, X218R, X218S, X218T, X218V, X218W,
X218Y, X219A, X219G, X220A, X220G, X220H, X220N, X220S, X220T,
X220V, X221G, X221S, X222A, X222C, X222E, X222F, X222G, X222I,
X222K, X222L, X222M, X222N, X222P, X222Q, X222R, X222S, X222T,
X222V, X222W, X223A, X223C, X223G, X223M, X223S, X224A, X224D,
X224E, X224G, X224I, X224L, X224N, X224P, X224S, X224T, X225A,
X225C, X225G, X225N, X225P, X225S, X225T, X225V, X226C, X226F,
X226G, X226H, X226I, X226L, X226M, X226N, X226R, X226S, X226T,
X226V, X226Y, X227A, X227C, X227F, X227G, X227I, X227L, X227M,
X227Q, X227S, X227T, X227V, X227Y, X228A, X228C, X228G, X228I,
X228L, X228M, X228S, X228V, X229A, X229G, X229P, X229S, X230A,
X230D, X230E, X230F, X230G, X230H, X230I, X230L, X230N, X230P,
X230Q, X230S, X230T, X230V, X230W, X230Y, X231A, X231C, X231F,
X231G, X231H, X231I, X231L, X231S, X231T, X231W, X231Y, X232A,
X232G, X232H, X232L, X232M, X232S, X232V, X233A, X233C, X233E,
X233F, X233G, X233I, X233L, X233M, X233N, X233P, X233Q, X233R,
X233S, X233T, X233V, X233Y, X234D, X234F, X234G, X234H, X234L,
X234M, X234N, X234P, X234Q, X234S, X234T, X234V, X234Y, X235C,
X235D, X235E, X235F, X235G, X235H, X235I, X235K, X235L, X235M,
X235N, X235Q, X235R, X235S, X235V, X235W, X235Y, X236A, X236C,
X236E, X236F, X236G, X236H, X236K, X236L, X236N, X236P, X236Q,
X236R, X236S, X236T, X236V, X236W, X236Y, X237A, X237C, X237F,
X237G, X237H, X237I, X237K, X237L, X237M, X237P, X237Q, X237R,
X237S, X237T, X237V, X237W, X237Y, X238C, X238D, X238E, X238F,
X238G, X238H, X238I, X238K, X238L, X238M, X238N, X238Q, X238R,
X238S, X238T, X238V, X238Y, X239C, X239D, X239F, X239G, X239H,
X239I, X239K, X239L, X239M, X239N, X239P, X239Q, X239R, X239S,
X239T, X239V, X239W, X239Y, X240A, X240C, X240E, X240F, X240I,
X240K, X240L, X240M, X240N, X240Q, X240R, X240S, X240T, X240W,
X240Y, X241A, X241C, X241D, X241E, X241F, X241G, X241H, X241I,
X241K, X241L, X241M, X241N, X241P, X241Q, X241R, X241S, X241T,
X241V, X241W, X241Y, X242A, X242C, X242D, X242F, X242G, X242H,
X242I, X242L, X242M, X242P, X242Q, X242R, X242S, X242T, X242V,
X242W, X243C, X243D, X243E, X243F, X243G, X243H, X243I, X243K,
X243L, X243M, X243N, X243P, X243Q, X243R, X243S, X243T, X243V,
X243W, X244A, X244D, X244E, X244F, X244H, X244I, X244L, X244M,
X244N, X244P, X244Q, X244R, X244S, X244T, X244V, X244W, X244Y,
X245A, X245C, X245E, X245G, X245H, X245K, X245L, X245P, X245Q,
X245R, X245S, X245V, X245W, X245Y, X246A, X246C, X246E, X246F,
X246G, X246H, X246I, X246L, X246M, X246N, X246P, X246Q, X246R,
X246S, X246T, X246V, X246W, X246Y, X247A, X247C, X247D, X247E,
X247F, X247G, X247H, X247I, X247K, X247L, X247M, X247N, X247P,
X247Q, X247R, X247S, X247T, X247V, X247W, X247Y, X248C, X248D,
X248E, X248G, X248H, X248I, X248K, X248L, X248M, X248N, X248P,
X248R, X248S, X248T, X248V, X248W, X248Y, X249A, X249D, X249E,
X249F, X249G, X249H, X249I, X249K, X249L, X249M, X249N, X249Q,
X249R, X249S, X249T, X249V, X249W, X249Y, X250A, X250C, X250E,
X250F, X250G, X250H, X250I, X250L, X250M, X250N, X250Q, X250S,
X250V, X250Y, X251A, X251D, X251E, X251F, X251G, X251K, X251L,
X251M, X251P, X251Q, X251R, X251S, X251T, X251V, X251Y, X252A,
X252C, X252D, X252F, X252G, X252H, X252I, X252K, X252L, X252M,
X252N, X252P, X252R, X252S, X252V, X252W, X252Y, X253A, X253D,
X253E, X253F, X253G, X253H, X253I, X253K, X253M, X253R, X253S,
X253T, X253V, X253W, X254A, X254C, X254D, X254G, X254N, X254P,
X254S, X254T, X254V, X255A, X255C, X255D, X255E, X255F, X255H,
X255I, X255L, X255N, X255P, X255Q, X255R, X255S, X255T, X255V,
X255W, X255Y, X256A, X256C, X256D, X256E, X256G, X256H, X256I,
X256K, X256L, X256M, X256N, X256P, X256R, X256S, X256T, X256V,
X256W, X256Y, X257A, X257C, X257E, X257F, X257G, X257H, X257I,
X257K, X257L, X257M, X257P, X257S, X257T, X257V, X257W, X257Y,
X258A, X258C, X258D, X258E, X258F, X258G, X258H, X258I, X258L,
X258M, X258P, X258Q, X258R, X258S, X258T, X258V, X258W, X258Y,
X259A, X259C, X259E, X259G, X259I, X259L, X259M, X259P, X259Q,
X259R, X259S, X259T, X259V, X260A, X260D, X260E, X260F, X260H,
X260I, X260L, X260M, X260N, X260P, X260R, X260S, X260T, X260V,
X260Y, X261A, X261C, X261E, X261F, X261G, X261I, X261K, X261L,
X261N, X261P, X261Q, X261R, X261S, X261T, X261V, X261W, X261Y,
X262A, X262C, X262D, X262F, X262G, X262H, X262I, X262K, X262L,
X262M, X262P, X262Q, X262R, X262S, X262T, X262V, X262W, X262Y,
X263A, X263C, X263D, X263F, X263G, X263H, X263I, X263L, X263M,
X263N, X263P, X263Q, X263R, X263W, X263Y, X264A, X264C, X264E,
X264F, X264G, X264H, X264I, X264P, X264Q, X264S, X264V, X264Y,
X265A, X265C, X265D, X265F, X265G, X265H, X265I, X265K, X265L,
X265M, X265P, X265Q, X265R, X265S, X265T, X265V, X265W, X265Y,
X266G, X266W, X267A, X267C, X267D, X267E, X267F, X267G, X267H,
X267I, X267K, X267L, X267M, X267N, X267S, X267T, X267V, X267Y,
X268A, X268D, X268E, X268G, X268H, X268K, X268L, X268M, X268N,
X268P, X268Q, X268R, X268S, X268V, X268W, X268Y, X269C, X269D,
X269F, X269G, X269H, X269I, X269L, X269M, X269N, X269Q, X269R,
X269S, X269T, X269V, X270A, X270C, X270D, X270E, X270F, X270G,
X270H, X270I, X270L, X270M, X270N, X270P, X270Q, X270S, X270T,
X270V, X271A, X271C, X271E, X271F, X271G, X271H, X271I, X271K,
X271L, X271M, X271N, X271P, X271T, X271V, X271Y, X272A, X272C,
X272D, X272E, X272F, X272G, X272H, X272K, X272L, X272M, X272N,
X272P, X272R, X272S, X272T, X272W, X272Y, X273A, X273C, X273D,
X273E, X273F, X273G, X273H, X273I, X273K, X273L, X273R, X273S,
X273T, X273V, X273W, X273Y, X274A, X274C, X274D, X274E, X274G,
X274H, X274K, X274L, X274M, X274N, X274P, X274Q, X274R, X274S,
X274T, X274W, X275A, X275C, X275D, X275E, X275F, X275G, X275H,
X275K, X275L, X275M, X275P, X275Q, X275R, X275V, X275W, X275W. In
contrast, there were no mutations identified in initial screens of
positions 64, 65 and 70 that were associated with a performance
index greater than 1.0 (PI>1.0) for at least one property.
[0288] In screens of GCI-P036 variants, at least one mutation in
the following 248 positions was associated with a performance index
greater than 1 for either BMI, CS-38 microswatch assay or AAPF
activity and had a performance index of greater than 0.8 for LAS
stability or in a TCA assay: 1, 2, 3, 4, 5, 7, 8, 9, 10, 11, 12,
13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29,
30, 31, 33, 35, 36, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49,
50, 51, 52, 53, 54, 55, 56, 57, 59, 60, 61, 62, 63, 66, 68, 69, 71,
72, 73, 74, 75, 76, 77, 78, 79, 81, 82, 83, 84, 85, 86, 87, 88, 89,
90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104,
105, 106, 107, 108, 109, 110, 111, 112, 114, 115, 116, 117, 118,
119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131,
132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144,
145, 146, 147, 148, 149, 150, 151, 152, 153, 156, 158, 159, 160,
165, 166, 167, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178,
179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 191, 192, 194,
195, 196, 197, 198, 199, 200, 203, 204, 205, 206, 207, 208, 209,
210, 211, 212, 213, 214, 215, 216, 217, 218, 220, 222, 223, 224,
225, 226, 227, 228, 229, 230, 231, 232, 233, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250,
251, 252, 253, 254, 255, 256, 257, 258, 259, 260, 261, 262, 263,
264, 265, 267, 268, 269, 270, 271, 272, 273, 274, and 275.
Mutations at these positions can be combined to improve activity
while maintaining either stability or expression. Mutations at
these positions can also be combined to produce variants with
improved stability or expression, while retaining or enhancing
activity.
[0289] The following list provides the substitutions with a
performance index greater than 1 for either BMI, CS-38 microswatch
assay, or AAPF activity and that had a performance index of greater
than 0.8 for LAS stability or in a TCA assay (as used herein, "X"
refers to any amino acid). These variants can be combined to
improve activity while maintaining or enhancing stability or
expression, or to improve stability or expression, while
maintaining or enhancing activity: X001A, X001C, X001E, X001F,
X001G, X001H, X001I, X001K, X001L, X001N, X001Q, X001R, X001S,
X001T, X001V, X001Y, X002A, X002C, X002E, X002G, X002K, X002L,
X002M, X002N, X002P, X002Q, X002R, X002S, X002T, X002V, X002W,
X002Y, X003D, X003E, X003F, X003G, X003H, X003I, X003L, X003M,
X003N, X003P, X003R, X003S, X003T, X003V, X003W, X003Y, X004A,
X004C, X004D, X004E, X004F, X004H, X004K, X004L, X004N, X004P,
X004R, X004S, X004T, X004V, X004W, X005A, X005C, X005D, X005E,
X005G, X005P, X005Q, X005S, X005T, X007A, X007C, X007D, X007G,
X007H, X007N, X007S, X007T, X008A, X008F, X008I, X008L, X008M,
X008T, X008V, X009D, X009E, X009F, X009G, X009H, X009L, X009N,
X009P, X009Q, X009R, X009S, X009T, X009V, X009W, X009Y, X010A,
X010C, X010G, X010H, X010K, X010M, X010N, X010Q, X010R, X010S,
X010T, X010W, X011A, X011I, X011M, X011S, X011V, X012D, X012F,
X012G, X012H, X012I, X012K, X012L, X012M, X012N, X012Q, X012R,
X012S, X012T, X012V, X012W, X013A, X013G, X013I, X013T, X013V,
X014A, X014D, X014E, X014F, X014H, X014I, X014K, X014L, X014P,
X014Q, X014S, X014T, X014V, X014Y, X015A, X015D, X015F, X015G,
X015I, X015K, X015L, X015M, X015P, X015Q, X015R, X015S, X015V,
X015W, X016A, X016G, X016L, X016N, X016P, X016Q, X016S, X016T,
X016V, X017A, X017F, X017H, X017I, X017K, X017M, X017N, X017R,
X017S, X017V, X017W, X017Y, X018A, X018C, X018D, X018E, X018F,
X018G, X018H, X018K, X018L, X018M, X018N, X018P, X018Q, X018R,
X018S, X018T, X018V, X018W, X018Y, X019A, X019C, X019D, X019E,
X019F, X019G, X019H, X019K, X019L, X019M, X019N, X019R, X019S,
X019T, X019V, X019W, X019Y, X020A, X020C, X020D, X020F, X020G,
X020I, X020K, X020L, X020M, X020P, X020Q, X020R, X020S, X020T,
X020V, X020W, X020Y, X021A, X021C, X021D, X021E, X021G, X021H,
X021I, X021K, X021L, X021M, X021N, X021P, X021Q, X021R, X021S,
X021T, X021V, X021W, X022A, X022C, X022G, X022I, X022K, X022L,
X022M, X022N, X022P, X022Q, X022R, X022S, X022T, X022V, X022W,
X022Y, X023A, X023G, X023S, X024A, X024C, X024D, X024F, X024G,
X024H, X024L, X024M, X024N, X024P, X024Q, X024R, X024S, X024T,
X024V, X024W, X025C, X025D, X025E, X025F, X025G, X025H, X025K,
X025L, X025M, X025N, X025Q, X025R, X025S, X025T, X025V, X025W,
X026C, X026F, X026G, X026I, X026L, X026M, X026N, X026P, X026R,
X026S, X026T, X026V, X027A, X027C, X027D, X027F, X027G, X027I,
X027K, X027L, X027M, X027N, X027P, X027R, X027S, X027T, X027V,
X027W, X027Y, X028A, X028E, X028H, X028I, X028L, X028M, X028N,
X028S, X028V, X029A, X029C, X029G, X029S, X029V, X030C, X030E,
X030L, X030S, X030T, X030V, X031A, X031F, X031I, X031L, X031M,
X031S, X031T, X031V, X033A, X033D, X033E, X033G, X033H, X033M,
X033N, X033Q, X033S, X033T, X033Y, X035A, X035F, X035I, X035L,
X035M, X035P, X036A, X036C, X036E, X036F, X036G, X036H, X036I,
X036L, X036M, X036N, X036Q, X036R, X036S, X036T, X036V, X038C,
X038F, X038G, X038H, X038I, X038K, X038L, X038M, X038N, X038Q,
X038R, X038T, X038V, X038W, X038Y, X039H, X039V, X040A, X040C,
X040D, X040E, X040G, X040H, X040I, X040K, X040L, X040M, X040N,
X040P, X040R, X040S, X040T, X040V, X040W, X040Y, X041D, X041E,
X042C, X042H, X042I, X042L, X042M, X042N, X042T, X042V, X043A,
X043C, X043D, X043E, X043F, X043G, X043I, X043L, X043M, X043N,
X043P, X043R, X043S, X043T, X043V, X043W, X043Y, X044A, X044C,
X044D, X044G, X044I, X044K, X044L, X044M, X044N, X044P, X044Q,
X044R, X044S, X044T, X044V, X044W, X044Y, X045A, X045D, X045F,
X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P, X045Q,
X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D, X046E,
X046F, X046G, X046H, X046I, X046K, X046L, X046M, X046N, X046P,
X046Q, X046R, X046S, X046T, X046V, X046W, X047A, X047F, X047G,
X047N, X047R, X047S, X047T, X047W, X048A, X048C, X048E, X048F,
X048G, X048H, X048I, X048K, X048L, X048M, X048N, X048P, X048Q,
X048R, X048S, X048T, X048V, X048Y, X049A, X049F, X049G, X049L,
X049M, X049P, X049S, X049T, X050C, X050F, X050H, X050I, X050L,
X050N, X050T, X050V, X050Y, X051F, X051G, X051H, X051K, X051L,
X051N, X051P, X051R, X051S, X051T, X051V, X051W, X052A, X052C,
X052E, X052F, X052G, X052H, X052I, X052L, X052M, X052N, X052P,
X052Q, X052R, X052T, X052V, X052W, X052Y, X053A, X053C, X053D,
X053E, X053G, X053H, X053K, X053L, X053M, X053P, X053Q, X053R,
X053S, X053T, X053V, X053W, X053Y, X054A, X054C, X054D, X054E,
X054F, X054I, X054M, X054N, X054Q, X054S, X054V, X055A, X055C,
X055E, X055F, X055G, X055H, X055I, X055K, X055L, X055M, X055N,
X055P, X055Q, X055S, X055T, X055W, X055Y, X056A, X056C, X056D,
X056E, X056H, X056L, X056M, X056N, X056P, X056Q, X056S, X056T,
X057A, X057C, X057E, X057F, X057G, X057H, X057I, X057K, X057L,
X057M, X057N, X057P, X057Q, X057R, X057S, X057T, X057V, X057W,
X057Y, X059A, X059C, X059D, X059E, X059F, X059G, X059I, X059L,
X059M, X059N, X059P, X059Q, X059R, X059S, X059T, X059V, X059W,
X059Y, X060D, X060S, X060V, X061A, X061C, X061D, X061F, X061G,
X061H, X061I, X061L, X061M, X061N, X061P, X061R, X061S, X061T,
X061V, X061Y, X062C, X062E, X062F, X062G, X062H, X062I, X062K,
X062L, X062M, X062N, X062P, X062Q, X062R, X062S, X062T, X062V,
X062Y, X063A, X063C, X063D, X063E, X063F, X063G, X063H, X063K,
X063M, X063Q, X063R, X063S, X063W, X066K, X066S, X066T, X068I,
X068T, X068V, X069A, X069E, X069G, X069N, X069S, X069T, X071A,
X071I, X071N, X071T, X071V, X072C, X072F, X072I, X072L, X072M,
X072T, X072V, X073A, X073C, X073D, X073E, X073H, X073K, X073L,
X073N, X073S, X073T, X073V, X074A, X074C, X074S, X075A, X075H,
X075I, X075L, X075M, X075N, X075P, X075Q, X075R, X075S, X075V,
X076D, X076E, X076F, X076G, X076H, X076K, X076M, X076N, X076Q,
X076R, X076S, X076T, X076W, X076Y, X077D, X077N, X078A, X078C,
X078E, X078F, X078G, X078H, X078I, X078K, X078L, X078M, X078N,
X078P, X078Q, X078R, X078S, X078T, X078V, X078Y, X079C, X079D,
X079E, X079F, X079G, X079I, X079K, X079L, X079N, X079Q, X079R,
X079S, X079T, X079V, X079W, X079Y, X081C, X081G, X081H, X081I,
X081L, X081M, X081Q, X081S, X081T, X081V, X082A, X082E, X082F,
X082K, X082L, X082M, X082Q, X082R, X082T, X082V, X082Y, X083G,
X083S, X084C, X084E, X084G, X084I, X084L, X084M, X084N, X084T,
X084V, X085A, X085C, X085I, X086A, X086C, X086D, X086E, X086G,
X086P, X086S, X086W, X086Y, X087A, X087C, X087D, X087E, X087F,
X087G, X087I, X087K, X087L, X087N, X087S, X087T, X087V, X087Y,
X088A, X088C, X088D, X088G, X088Q, X088S, X088W, X089A, X089C,
X089D, X089E, X089F, X089G, X089H, X089I, X089L, X089N, X089P,
X089Q, X089R, X089S, X089T, X089V, X089W, X090A, X090C, X090F,
X090G, X090I, X090K, X090L, X090M, X090Q, X090T, X090V, X091C,
X091D, X091F, X091I, X091K, X091L, X091M, X091N, X091Q, X091R,
X091S, X091T, X091V, X091W, X091Y, X092A, X092D, X092G, X092N,
X092P, X092R, X092T, X092V, X093A, X093C, X093G, X093L, X093M,
X093S, X093T, X093V, X093Y, X094K, X094N, X094Q, X094R, X095A,
X095C, X095G, X095I, X095K, X095R, X095S, X095T, X095V, X095W,
X096E, X096I, X096L, X096M, X096T, X097A, X097D, X097E, X097G,
X097H, X097I, X097K, X097L, X097M, X097N, X097P, X097Q, X097R,
X097S, X097T, X097V, X097Y, X098A, X098C, X098D, X098E, X098F,
X098G, X098K, X098L, X098N, X098P, X098Q, X098R, X098S, X098T,
X098V, X098Y, X099A, X099C, X099F, X099G, X099K, X099M, X099P,
X099Q, X099R, X099S, X099T, X099V, X099Y, X100D, X100E, X100G,
X100I, X100P, X100S, X100V, X100Y, X101A, X101D, X101E, X101F,
X101G, X101H, X101I, X101K, X101N, X101P, X101Q, X101R, X101S,
X101T, X101V, X101Y, X102A, X102C, X102D, X102G, X102N, X102T,
X103A, X103D, X103E, X103F, X103G, X103I, X103L, X103N, X103P,
X103Q, X103R, X103S, X103T, X103V, X103Y, X104A, X104C, X104D,
X104E, X104F, X104H, X104I, X104L, X104P, X104R, X104S, X104T,
X104V, X104W, X104Y, X105A, X105C, X105D, X105E, X105F, X105G,
X105H, X105I, X105K, X105L, X105N, X105Q, X105R, X105S, X105T,
X105V, X105W, X105Y, X106A, X106D, X106E, X106F, X106G, X106I,
X106L, X106M, X106P, X106R, X106S, X106V, X106W, X107A, X107F,
X107I, X107L, X107M, X107Q, X107S, X107T, X107V, X108A, X108G,
X108I, X108L, X108S, X108T, X108V, X109A, X109C, X109E, X109F,
X109G, X109H, X109I, X109K, X109L, X109M, X109N, X109Q, X109R,
X109S, X109T, X109W, X109Y, X110A, X110G, X110S, X111C, X111E,
X111F, X111I, X111L, X111M, X111V, X111Y, X112A, X112C, X112D,
X112E, X112F, X112G, X112I, X112L, X112N, X112Q, X112S, X112T,
X112V, X112W, X112Y, X114A, X114C, X114G, X114T, X115C, X115E,
X115F, X115G, X115H, X115I, X115K, X115L, X115M, X115N, X115P,
X115Q, X115R, X115S, X115T, X115V, X115W, X115Y, X116A, X116C,
X116D, X116F, X116G, X116I, X116K, X116L, X116M, X116N, X116Q,
X116S, X116T, X116V, X116W, X117A, X117C, X117D, X117F, X117G,
X117I, X117N, X117Q, X117R, X117T, X117Y, X118A, X118C, X118D,
X118E, X118F, X118G, X118I, X118K, X118L, X118M, X118N, X118P,
X118R, X118S, X118T, X118V, X118W, X119A, X119C, X119F, X119H,
X119M, X119N, X119Q, X119T, X119W, X120A, X120C, X120E, X120F,
X120G, X120H, X120I, X120L, X120M, X120N, X120R, X120S, X120T,
X120W, X121A, X121C, X121E, X121F, X121G, X121I, X121L, X121M,
X121Q, X121S, X121T, X121V, X121Y, X122A, X122C, X122G, X122I,
X122L, X122S, X122T, X122V, X123G, X123N, X123S, X124G, X124L,
X124S, X124T, X125A, X125S, X126A, X126F, X126L, X127F, X127G,
X127I, X127R, X127S, X127T, X128A, X128F, X128G, X128I, X128K,
X128L, X128M, X128N, X128Q, X128R, X128S, X128T, X128W, X129A,
X129E, X129F, X129G, X129I, X129L, X129M, X129N, X129P, X129R,
X129S, X129T, X129V, X129W, X129Y, X130C, X130K, X130L, X130N,
X130Q, X130R, X130S, X130V, X130W, X130Y, X131A, X131D, X131E,
X131F, X131G, X131I, X131K, X131L, X131P, X131Q, X131R, X131V,
X132A, X132E, X132F, X132H, X132I, X132L, X132M, X132N, X132Q,
X132S, X132T, X132W, X133A, X133F, X133K, X133L, X133N, X133P,
X133Q, X133S, X133T, X133V, X133Y, X134A, X134F, X134I, X134L,
X134M, X134P, X134S, X134T, X134V, X135C, X135E, X135L, X135M,
X135W, X136A, X136E, X136F, X136K, X136Q, X136R, X136S, X136V,
X136W, X136Y, X137A, X137C, X137E, X137G, X137H, X137K, X137L,
X137M, X137Q, X137R, X137S, X137V, X137W, X138A, X138G, X138M,
X138R, X138V, X139A, X139C, X139I, X139M, X139T, X139V, X140A,
X140C, X140D, X140E, X140F, X140G, X140I, X140L, X140M, X140N,
X140Q, X140R, X140S, X140T, X140V, X140Y, X141D, X141E, X141G,
X141H, X141I, X141K, X141L, X141N, X141Q, X141R, X141S, X141V,
X141Y, X142A, X142C, X142L, X142T, X142V, X142Y, X143C, X143D,
X143F, X143G, X143H, X143I, X143K, X143L, X143M, X143N, X143S,
X143T, X143V, X143W, X143Y, X144A, X144C, X144D, X144G, X144H,
X144I, X144L, X144M, X144N, X144Q, X144R, X144S, X144T, X144V,
X144W, X144Y, X145A, X145C, X145D, X145E, X145F, X145G, X145K,
X145L, X145M, X145N, X145Q, X145R, X145S, X145T, X145W, X145Y,
X146A, X146C, X146D, X146E, X146G, X146K, X146Q, X147I, X147L,
X147M, X147T, X147V, X148A, X148C, X148E, X148F, X148H, X148I,
X148L, X148M, X148N, X148S, X148T, X148V, X148Y, X149A, X149C,
X149I, X149L, X149M, X149P, X149S, X149T, X149V, X150A, X150F,
X150L, X150T, X150V, X151A, X151G, X151S, X152A, X152S, X153A,
X153G, X153S, X153V, X156A, X156C, X156D, X156E, X156F, X156L,
X156M, X156N, X156S, X156T, X158A, X158C, X158E, X158F, X158H,
X158K, X158L, X158M, X158Q, X158R, X158S, X158T, X158V, X158W,
X159A, X159C, X159E, X159G, X159H, X159M, X159P, X159Q, X159R,
X159S, X159W, X160A, X160C, X160D, X160F, X160G, X160I, X160L,
X160M, X160N, X160Q, X160R, X160S, X160T, X160V, X160Y, X165I,
X165L, X165T, X165V, X166A, X166C, X166D, X166E, X166H, X166M,
X166N, X166S, X167C, X167D, X167E, X167F, X167P, X167V, X167W,
X167Y, X169A, X169G, X169S, X170A, X170D, X170E, X170G, X170H,
X170K, X170L, X170P, X170Q, X170R, X170S, X170V, X170W, X170Y,
X171C, X171F, X171L, X171N, X171Y, X172A, X172C, X172D, X172F,
X172G, X172I, X172K, X172L, X172M, X172P, X172Q, X172R, X172S,
X172T, X172V, X172Y, X173A, X173C, X173D, X173E, X173F, X173G,
X173H, X173K, X173L, X173M, X173N, X173Q, X173R, X173T, X173V,
X173W, X174A, X174G, X174S, X174T, X174V, X175A, X175C, X175I,
X175L, X175M, X175Q, X175T, X175V, X175Y, X176A, X176G, X176S,
X177A, X177C, X177I, X177T, X177V, X178A, X178G, X179A, X179G,
X180C, X180I, X180L, X180S, X180T, X180V, X181D, X181N, X182A,
X182D, X182E, X182F, X182G, X182H, X182I, X182K, X182L, X182M,
X182N, X182P, X182Q, X182R, X182S, X182T, X182V, X182W, X182Y,
X183A, X183D, X183F, X183G, X183H, X183I, X183K, X183L, X183M,
X183N, X183Q, X183R, X183S, X183T, X183V, X183W, X183Y, X184D,
X184N, X185A, X185C, X185E, X185F, X185G, X185H, X185I, X185K,
X185L, X185M, X185N, X185Q, X185R, X185S, X185T, X185V, X185Y,
X186H, X186I, X186K, X186L, X186R, X187A, X187P, X187W, X188A,
X188D, X188E, X188F, X188G, X188H, X188I, X188K, X188L, X188P,
X188Q, X188R, X188S, X188T, X188V, X188W, X188Y, X191D, X191Q,
X192W, X192Y, X194A, X194C, X194D, X194E, X194F, X194G, X194H,
X194I, X194L, X194M, X194P, X194Q, X194R, X194S, X194T, X194V,
X194W, X194Y, X195A, X195C, X195D, X195E, X195G, X195Q, X195Y,
X196L, X196M, X197A, X197C, X197D, X197E, X197G, X197N, X197Q,
X197S, X197T, X198A, X198F, X198G, X198H, X198I, X198L, X198M,
X198N, X198R, X198S, X198T, X198Y, X199A, X199C, X199I, X199M,
X199S, X199T, X199V, X200A, X200C, X200G, X200S, X203A, X203C,
X203E, X203I, X203L, X203S, X203T, X203V, X204A, X204C, X204E,
X204F, X204G, X204I, X204K, X204L, X204N, X204R, X204S, X204T,
X204W, X204Y, X205I, X205T, X205V, X206A, X206C, X206D, X206E,
X206G, X206H, X206I, X206K, X206L, X206N, X206P, X206Q, X206R,
X206S, X206T, X206V, X206W, X206Y, X207A, X207S, X208C, X208L,
X208S, X208T, X208V, X209A, X209C, X209F, X209G, X209H, X209I,
X209K, X209L, X209M, X209N, X209R, X209S, X209V, X209W, X209Y,
X210A, X210C, X210E, X210G, X210H, X210I, X210L, X210M, X210N,
X210P, X210R, X210 S, X210V, X210Y, X211A, X211C, X211E, X211F,
X211G, X211H, X211I, X211L, X211M, X211P, X211Q, X211R, X211T,
X211V, X211W, X211Y, X212C, X212F, X212G, X212H, X212I, X212M,
X212N, X212P, X212R, X212S, X212T, X212V, X212Y, X213A, X213C,
X213D, X213E, X213F, X213G, X213I, X213K, X213L, X213M, X213N,
X213Q, X213R, X213S, X213T, X213V, X213W, X213Y, X214F, X214L,
X214W, X214Y, X215A, X215C, X215D, X215E, X215F, X215G, X215H,
X215I, X215K, X215M, X215N, X215P, X215R, X215S, X215T, X215V,
X215W, X215Y, X216A, X216C, X216D, X216E, X216F, X216G, X216H,
X216I, X216K, X216L, X216M, X216N, X216P, X216Q, X216R, X216S,
X216V, X216W, X216Y, X217A, X217C, X217E, X217F, X217G, X217I,
X217K, X217L, X217M, X217Q, X218C, X218D, X218E, X218F, X218G,
X218H, X218I, X218M, X218N, X218Q, X218R, X218S, X218T, X218V,
X218Y, X220S, X220T, X222A, X222M, X222Q, X223A, X223G, X223S,
X224A, X224G, X224L, X224N, X224S, X224T, X225C, X225P, X226C,
X226F, X226H, X226M, X226V, X227A, X227C, X227G, X227I, X227L,
X227M, X227S, X227T, X227V, X228A, X228C, X228G, X228I, X228S,
X228V, X229A, X229G, X229P, X229S, X230A, X230D, X230E, X230G,
X230H, X230I, X230L, X230N, X230Q, X230S, X230T, X230V, X231A,
X231C, X231F, X231G, X231H, X231I, X231L, X231S, X231T, X231Y,
X232A, X232G, X232H, X232L, X232M, X232S, X232V, X233A, X233C,
X233E, X233F, X233G, X233I, X233L, X233M, X233N, X233P, X233Q,
X233S, X233T, X233V, X233Y, X234D, X234F, X234G, X234H, X234L,
X234M, X234N, X234Q, X234S, X234T, X234V, X234Y, X235C, X235D,
X235E, X235F, X235G, X235H, X235I, X235K, X235L, X235M, X235N,
X235Q, X235R, X235S, X235V, X235W, X235Y, X236A, X236C, X236E,
X236F, X236H, X236K, X236N, X236P, X236Q, X236R, X236S, X236T,
X236V, X236W, X236Y, X237A, X237C, X237F, X237G, X237H, X237I,
X237K, X237L, X237M, X237P, X237Q, X237R, X237S, X237T, X237V,
X237W, X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I,
X238K, X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V,
X238Y, X239C, X239D, X239F, X239G, X239H, X239I, X239K, X239L,
X239M, X239N, X239P, X239Q, X239R, X239S, X239T, X239V, X239W,
X239Y, X240A, X240C, X240E, X240F, X240I, X240K, X240L, X240M,
X240N, X240Q, X240R, X240S, X240T, X240W, X240Y, X241A, X241C,
X241D, X241E, X241F, X241G, X241H, X241I, X241K, X241L, X241M,
X241N, X241P, X241Q, X241R, X241S, X241T, X241V, X241W, X241Y,
X242A, X242C, X242D, X242F, X242G, X242H, X242I, X242L, X242M,
X242P, X242Q, X242R, X242S, X242T, X242V, X242W, X243C, X243D,
X243E, X243F, X243G, X243H, X243I, X243K, X243L, X243M, X243N,
X243P, X243Q, X243R, X243S, X243T, X243V, X243W, X244A, X244D,
X244E, X244F, X244H, X244I, X244L, X244M, X244N, X244P, X244Q,
X244R, X244S, X244T, X244V, X244W, X244Y, X245A, X245C, X245E,
X245G, X245H, X245K, X245L, X245P, X245Q, X245R, X245S, X245V,
X245W, X245Y, X246A, X246C, X246E, X246F, X246G, X246H, X246I,
X246L, X246M, X246N, X246Q, X246S, X246T, X246V, X246W, X246Y,
X247A, X247C, X247D, X247E, X247F, X247G, X247H, X247I, X247K,
X247L, X247M, X247N, X247P, X247Q, X247R, X247S, X247T, X247V,
X247W, X247Y, X248C, X248D, X248E, X248G, X248H, X248I, X248K,
X248L, X248N, X248P, X248R, X248S, X248T, X248V, X248W, X248Y,
X249A, X249D, X249E, X249F, X249G, X249H, X249I, X249K, X249L,
X249M, X249N, X249Q, X249R, X249S, X249T, X249V, X249W, X249Y,
X250A, X250C, X250F, X250I, X250L, X250M, X250Q, X250S, X250V,
X251A, X251D, X251E, X251F, X251G, X251K, X251L, X251M, X251Q,
X251R, X251T, X251V, X251Y, X252A, X252C, X252D, X252F, X252G,
X252H, X252I, X252K, X252L, X252M, X252N, X252R, X252S, X252V,
X252W, X252Y, X253A, X253D, X253E, X253F, X253G, X253H, X253I,
X253K, X253M, X253R, X253S, X253T, X253V, X253W, X254A,
X254C, X254G, X254S, X254T, X255A, X255C, X255D, X255E, X255F,
X255H, X255I, X255L, X255N, X255P, X255Q, X255R, X255S, X255T,
X255V, X255W, X255Y, X256A, X256C, X256D, X256E, X256G, X256H,
X256I, X256K, X256L, X256M, X256N, X256P, X256R, X256S, X256T,
X256V, X256W, X256Y, X257C, X257F, X257I, X257K, X257L, X257M,
X257V, X258A, X258C, X258D, X258E, X258F, X258G, X258H, X258I,
X258L, X258M, X258P, X258Q, X258R, X258S, X258T, X258V, X258W,
X258Y, X259A, X259C, X259E, X259G, X259I, X259L, X259M, X259P,
X259Q, X259R, X259S, X259T, X259V, X260A, X260D, X260E, X260F,
X260H, X260I, X260L, X260M, X260N, X260P, X260R, X260S, X260T,
X260V, X260Y, X261A, X261C, X261E, X261F, X261G, X261I, X261K,
X261L, X261N, X261P, X261Q, X261R, X261S, X261T, X261V, X261W,
X261Y, X262A, X262C, X262D, X262F, X262G, X262H, X262I, X262K,
X262L, X262M, X262Q, X262R, X262S, X262T, X262V, X262W, X262Y,
X263C, X263F, X263L, X263Y, X264A, X264G, X265A, X265C, X265D,
X265F, X265G, X265H, X265K, X265M, X265Q, X265R, X265S, X265T,
X265W, X265Y, X267G, X267I, X267L, X267M, X267N, X267V, X268A,
X268G, X268H, X268L, X268M, X268N, X268P, X268Q, X268S, X268V,
X269C, X269D, X269F, X269G, X269H, X269I, X269L, X269M, X269N,
X269Q, X269R, X269S, X269T, X269V, X270A, X270C, X270D, X270G,
X270I, X270L, X270M, X270N, X270S, X270T, X270V, X271A, X271C,
X271E, X271F, X271G, X271H, X271I, X271K, X271L, X271M, X271N,
X271P, X271T, X271V, X271Y, X272A, X272C, X272D, X272E, X272F,
X272G, X272H, X272K, X272L, X272M, X272N, X272P, X272R, X272S,
X272T, X272W, X272Y, X273A, X273C, X273D, X273E, X273F, X273G,
X273H, X273I, X273L, X273S, X273T, X273V, X274A, X274C, X274D,
X274E, X274G, X274H, X274L, X274M, X274N, X274P, X274Q, X274R,
X274S, X274T, X274W, X275A, X275C, X275D, X275E, X275F, X275G,
X275H, X275K, X275L, X275M, X275P, X275Q, X275R, X275V, and
X275W.
[0290] In screens of GCI-P036 variants, at least one mutation in
the following 204 positions was associated with a performance index
greater than 0.8 for either BMI, EGG or AAPF activity and had a
performance index of greater than 0.8 both LAS stability and in a
TCA assay: 1, 3, 4, 8, 9, 10, 11, 12, 13, 15, 16, 17, 18, 19, 20,
21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 33, 35, 36, 38, 40, 43,
44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 59, 61, 62,
68, 69, 72, 73, 76, 78, 84, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95,
96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109,
110, 111, 112, 114, 115, 116, 117, 118, 119, 120, 121, 122, 124,
126, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 139, 140,
141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 156,
158, 159, 160, 165, 166, 167, 170, 171, 172, 173, 174, 175, 176,
177, 180, 182, 183, 184, 185, 186, 187, 188, 191, 194, 195, 198,
199, 203, 204, 206, 209, 210, 211, 212, 213, 215, 216, 217, 218,
222, 223, 224, 227, 228, 230, 231, 232, 233, 234, 235, 236, 237,
238, 239, 240, 241, 242, 243, 244, 245, 246, 247, 248, 249, 250,
251, 252, 253, 255, 256, 258, 259, 260, 261, 262, 265, 267, 268,
269, 270, 271, 272, 273, 274, and 275.
[0291] Mutations at these positions can be combined to improve
activity while maintaining either stability and/or expression.
Mutations at these positions can also be combined to produce
variants with improved stability and/or expression, while retaining
or enhancing activity.
[0292] The following list provides the substitutions with a
performance index greater than 0.8 for either BMI, CS-38
microswatch assay or AAPF activity assay, and that had a
performance index of greater than 0.8 for LAS stability and in a
TCA assay (as used herein, "X" refers to any amino acid). These
variants can be combined to improve activity while maintaining or
enhancing stability and/or expression, or to improve stability
and/or expression, while maintaining or enhancing activity: X001A,
X001E, X001G, X001H, X001Q, X001V, X003E, X003H, X003I, X003M,
X003S, X003T, X003V, X004T, X004V, X008I, X008V, X009E, X009H,
X009N, X009Q, X009S, X009T, X010A, X010C, X010G, X010H, X010K,
X010M, X010N, X010R, X010S, X010T, X011I, X011V, X012G, X012I,
X012N, X012Q, X012S, X012T, X012V, X013A, X013G, X015A, X015D,
X015F, X015G, X015I, X015L, X015M, X015P, X015Q, X015S, X015V,
X015W, X016A, X016G, X016N, X016P, X016S, X016T, X016V, X017H,
X017I, X017M, X017N, X018A, X018C, X018D, X018E, X018G, X018H,
X018L, X018M, X018N, X018P, X018Q, X018S, X018T, X018V, X018Y,
X019A, X019C, X019D, X019E, X019F, X019G, X019H, X019K, X019L,
X019M, X019N, X019R, X019S, X019V, X019W, X019Y, X020A, X020C,
X020D, X020F, X020G, X020I, X020K, X020L, X020M, X020P, X020Q,
X020R, X020S, X020T, X020V, X020W, X020Y, X021A, X021C, X021E,
X021G, X021H, X021I, X021K, X021L, X021M, X021N, X021P, X021Q,
X021S, X021T, X021V, X021W, X022A, X022C, X022G, X022I, X022L,
X022M, X022N, X022P, X022Q, X022T, X022V, X022W, X023A, X023G,
X023S, X024A, X024C, X024D, X024F, X024G, X024H, X024L, X024M,
X024N, X024P, X024Q, X024R, X024S, X024T, X024V, X024W, X025C,
X025D, X025E, X025F, X025G, X025K, X025L, X025M, X025Q, X025R,
X025S, X025T, X025V, X025W, X026C, X026F, X026G, X026M, X026N,
X026R, X026S, X026T, X026V, X027A, X027C, X027D, X027F, X027G,
X027K, X027L, X027M, X027N, X027P, X027R, X027S, X027T, X027W,
X028A, X028I, X028L, X028M, X028V, X029A, X029C, X029G, X029S,
X029V, X030A, X030C, X030L, X030M, X030T, X030V, X031A, X031F,
X031I, X031L, X031M, X031S, X031V, X033C, X033M, X033S, X033T,
X035I, X035L, X035M, X035P, X036A, X036E, X036S, X036T, X036V,
X038C, X038F, X038H, X038I, X038K, X038L, X038M, X038N, X038Q,
X038R, X038T, X038V, X038Y, X040A, X040D, X040E, X040I, X040L,
X040P, X040V, X043A, X043C, X043D, X043E, X043F, X043G, X043I,
X043L, X043M, X043N, X043R, X043S, X043T, X043W, X043Y, X044A,
X044C, X044D, X044F, X044G, X044I, X044K, X044L, X044M, X044N,
X044Q, X044R, X044S, X044T, X044V, X044Y, X045A, X045D, X045F,
X045G, X045H, X045I, X045K, X045L, X045M, X045N, X045P, X045Q,
X045R, X045S, X045T, X045V, X045W, X045Y, X046C, X046D, X046E,
X046G, X046H, X046I, X046K, X046L, X046M, X046N, X046P, X046Q,
X046R, X046S, X046T, X046V, X047G, X047R, X048A, X048C, X048E,
X048F, X048H, X048I, X048K, X048L, X048M, X048N, X048P, X048Q,
X048R, X048S, X048T, X048V, X048Y, X049A, X049G, X049H, X049S,
X049T, X050F, X050H, X050I, X050L, X050T, X050V, X050Y, X051F,
X051H, X051K, X051L, X051R, X051S, X051T, X051V, X051W, X052A,
X052C, X052E, X052F, X052G, X052H, X052I, X052L, X052M, X052N,
X052P, X052Q, X052R, X052T, X052V, X052W, X052Y, X053A, X053C,
X053D, X053E, X053G, X053H, X053K, X053L, X053M, X053Q, X053R,
X053S, X053T, X053W, X053Y, X054A, X054C, X054D, X054E, X054F,
X054H, X054M, X054N, X054Q, X054S, X055C, X055E, X055G, X055H,
X055K, X055L, X055P, X055Q, X055S, X055T, X055W, X056A, X056C,
X056D, X056E, X056H, X056L, X056M, X056N, X056P, X056Q, X056S,
X056T, X057C, X057E, X057F, X057G, X057H, X057I, X057L, X057M,
X057N, X057P, X057Q, X057R, X057S, X057T, X057V, X057W, X057Y,
X059A, X059D, X059G, X059I, X059L, X059M, X059N, X059Q, X059R,
X059S, X059T, X059V, X059W, X061A, X061C, X061D, X061F, X061G,
X061H, X061I, X061L, X061M, X061N, X061P, X061R, X061S, X061T,
X061V, X061Y, X062C, X062E, X062F, X062H, X062I, X062K, X062L,
X062M, X062N, X062Q, X062R, X062S, X062T, X062V, X068I, X068L,
X068V, X069A, X069G, X069S, X069T, X072I, X072L, X072T, X072V,
X073A, X073C, X073S, X076D, X076N, X078A, X078C, X078E, X078H,
X078L, X078M, X078N, X078Q, X078S, X078T, X084C, X084G, X084I,
X084M, X084V, X086C, X086P, X087A, X087C, X087D, X087E, X087G,
X087K, X087L, X087N, X087S, X087V, X088A, X088C, X088G, X088S,
X089A, X089D, X089E, X089G, X089H, X089I, X089N, X089Q, X089R,
X089S, X089T, X089W, X090C, X090I, X090L, X090M, X090Q, X090T,
X090V, X091D, X091F, X091I, X091N, X091S, X091V, X091W, X091Y,
X092A, X092G, X092P, X092R, X092V, X093A, X093C, X093G, X093L,
X093M, X093T, X093V, X094K, X094R, X095A, X095C, X095I, X095S,
X095V, X096F, X096I, X096L, X096M, X097A, X097D, X097E, X097F,
X097G, X097H, X097K, X097L, X097M, X097N, X097P, X097Q, X097R,
X097S, X097T, X097V, X097W, X097Y, X098A, X098C, X098D, X098E,
X098F, X098G, X098K, X098L, X098N, X098P, X098Q, X098R, X098S,
X098T, X098V, X098Y, X099A, X099C, X099F, X099G, X099K, X099M,
X099P, X099Q, X099R, X099S, X099T, X099V, X099Y, X100D, X100E,
X100G, X100I, X100K, X100N, X100R, X100S, X100T, X100V, X100Y,
X101A, X101C, X101D, X101E, X101F, X101G, X101H, X101I, X101K,
X101N, X101P, X101Q, X101R, X101S, X101T, X101V, X101Y, X102A,
X102G, X102T, X103A, X103C, X103D, X103F, X103G, X103I, X103L,
X103N, X103P, X103Q, X103R, X103S, X103T, X103V, X103W, X104C,
X104F, X104H, X104I, X104L, X104R, X104S, X104T, X104V, X104W,
X104Y, X105A, X105C, X105D, X105E, X105F, X105G, X105K, X105L,
X105N, X105Q, X105R, X105S, X105T, X105V, X106A, X106D, X106E,
X106G, X106I, X106L, X106R, X106S, X106T, X106V, X106W, X107A,
X107C, X107F, X107I, X107L, X107M, X107Q, X107S, X107T, X107V,
X108A, X108C, X108I, X108S, X108T, X108V, X109A, X109E, X109F,
X109G, X109H, X109I, X109K, X109L, X109M, X109N, X109Q, X109R,
X109S, X109T, X109W, X109Y, X110A, X110G, X111F, X111I, X111L,
X111M, X112D, X112E, X112I, X112Q, X112V, X114A, X114C, X115C,
X115E, X115G, X115L, X115M, X115P, X115Q, X115S, X115T, X115W,
X115Y, X116A, X116C, X116D, X116F, X116G, X116I, X116K, X116L,
X116M, X116N, X116Q, X116S, X116T, X116V, X116W, X117A, X117C,
X117N, X117Q, X117R, X117T, X117Y, X118A, X118C, X118D, X118E,
X118F, X118G, X118K, X118M, X118N, X118R, X118S, X118V, X118W,
X119A, X119F, X119M, X119T, X120A, X120C, X120E, X120F, X120G,
X120H, X120I, X120L, X120M, X120N, X120R, X120S, X120T, X120W,
X121A, X121C, X121F, X121I, X121L, X121M, X121S, X121T, X121V,
X122A, X122G, X122S, X122V, X124G, X124L, X124T, X126A, X126F,
X126I, X126L, X126M, X126V, X128A, X128F, X128G, X128I, X128K,
X128L, X128M, X128N, X128Q, X128R, X128S, X128T, X128W, X129A,
X129E, X129F, X129G, X129M, X129N, X129P, X129R, X129S, X129Y,
X130C, X130K, X130L, X130N, X130Q, X130R, X130S, X130V, X130W,
X130Y, X131A, X131D, X131E, X131F, X131G, X131K, X131P, X131Q,
X132A, X132H, X132I, X132N, X132Q, X132R, X132S, X132T, X133A,
X133F, X133K, X133N, X133P, X133S, X133T, X133V, X133Y, X134A,
X134S, X134T, X134V, X135L, X135M, X135W, X136E, X136Q, X137A,
X137C, X137E, X137H, X137K, X137L, X137M, X137Q, X137R, X137S,
X137W, X139C, X139I, X139V, X140D, X140E, X140N, X141D, X141E,
X141G, X141H, X141I, X141K, X141L, X141N, X141Q, X141R, X141S,
X141V, X141Y, X142A, X142C, X142V, X143C, X143D, X143F, X143H,
X143N, X143T, X144A, X144C, X144D, X144G, X144H, X144I, X144L,
X144M, X144N, X144R, X144S, X144T, X144V, X144Y, X145A, X145C,
X145D, X145F, X145K, X145L, X145N, X145Q, X145R, X146D, X146G,
X147I, X147L, X147T, X147V, X148C, X148I, X148L, X148M, X148N,
X148V, X149C, X149I, X149L, X149V, X150A, X150L, X150T, X150V,
X151A, X151S, X152A, X152S, X156D, X156E, X156L, X156N, X156S,
X156T, X158A, X158C, X158E, X158F, X158H, X158K, X158L, X158M,
X158Q, X158R, X158S, X158T, X158V, X159A, X159C, X159E, X159G,
X159H, X159M, X159P, X159S, X160A, X160C, X160D, X160F, X160I,
X160L, X160M, X160N, X160Q, X160S, X160T, X160V, X160Y, X165I,
X165L, X165V, X166A, X166C, X166D, X166E, X166H, X166M, X166S,
X166T, X167F, X167Y, X170A, X170D, X170E, X170G, X170H, X170K,
X170Q, X170R, X170S, X170V, X170Y, X171C, X171Y, X172A, X172C,
X172D, X172G, X172I, X172K, X172L, X172M, X172P, X172Q, X172R,
X172S, X172V, X172Y, X173A, X173C, X173D, X173H, X173M, X173N,
X173Q, X173T, X174A, X174S, X174T, X174V, X175L, X175M, X175V,
X176A, X176S, X177C, X177V, X180T, X180V, X182A, X182D, X182E,
X182Q, X183A, X183D, X183N, X183Q, X183S, X184D, X184N, X185A,
X185C, X185E, X185H, X185K, X185M, X185N, X185Q, X185T, X185V,
X186I, X186K, X186L, X186R, X187A, X187C, X188A, X188D, X188E,
X188F, X188H, X188I, X188K, X188L, X188P, X188Q, X188S, X188T,
X191A, X191D, X191Q, X191S, X194A, X194C, X194D, X194E, X194F,
X194H, X194I, X194L, X194M, X194P, X194Q, X194R, X194S, X194T,
X194W, X194Y, X195C, X195D, X195E, X195G, X195Q, X198I, X198L,
X199C, X199M, X199S, X199V, X203C, X203E, X203T, X203V, X204A,
X204C, X204E, X204G, X204N, X204S, X206D, X206E, X206H, X206L,
X206N, X206Q, X206S, X209F, X209M, X209W, X209Y, X210A, X210C,
X210I, X210L, X210M, X210N, X210P, X211A, X211C, X211E, X211G,
X211H, X211I, X211M, X211P, X211Q, X211T, X211V, X212C, X212F,
X212G, X212H, X212M, X212N, X212R, X212S, X212Y, X213A, X213D,
X213E, X213N, X213Q, X213S, X213T, X215A, X215C, X215D, X215E,
X215H, X215I, X215K, X215M, X215N, X215S, X215T, X215V, X215Y,
X216A, X216C, X216D, X216E, X216F, X216H, X216I, X216L, X216M,
X216N, X216Q, X216S, X216V, X216W, X216Y, X217A, X217C, X217D,
X217E, X217F, X217K, X217L, X217M, X217Q, X218C, X218D, X218E,
X218N, X218Q, X222C, X222M, X222S, X223A, X223S, X224A, X224N,
X224S, X224T, X227A, X227C, X227V, X228A, X228G, X228S, X228V,
X230A, X230G, X230N, X230S, X230T, X230V, X231A, X231C, X231F,
X231G, X231S, X232A, X232L, X232M, X233A, X233C, X233E, X233G,
X233I, X233L, X233N, X233Q, X233S, X233T, X233V, X234L, X234M,
X234N, X234Q, X234S, X234T, X234V, X235C, X235F, X235G, X235H,
X235I, X235K, X235L, X235M, X235N, X235Q, X235R, X235S, X235V,
X235W, X235Y, X236A, X236C, X236E, X236F, X236H, X236N, X236Q,
X236S, X236T, X236Y, X237A, X237C, X237F, X237G, X237H, X237I,
X237K, X237L, X237M, X237Q, X237R, X237S, X237T, X237V, X237W,
X237Y, X238C, X238D, X238E, X238F, X238G, X238H, X238I, X238K,
X238L, X238M, X238N, X238Q, X238R, X238S, X238T, X238V, X238Y,
X239C, X239D, X239F, X239G, X239H, X239K, X239L, X239M, X239N,
X239P, X239Q, X239R, X239S, X239T, X239V, X239W, X239Y, X240A,
X240C, X240E, X240F, X240I, X240K, X240M, X240N, X240Q, X240R,
X240S, X240T, X240W, X240Y, X241A, X241C, X241D, X241E, X241F,
X241G, X241H, X241I, X241K, X241L, X241M, X241N, X241Q, X241R,
X241S, X241T, X241V, X241W, X241Y, X242A, X242C, X242D, X242G,
X242H, X242I, X242L, X242M, X242P, X242Q, X242S, X242T, X242V,
X243C, X243D, X243E, X243F, X243G, X243H, X243I, X243L, X243M,
X243N, X243P, X243Q, X243S, X243T, X243V, X243W, X244D, X244E,
X244F, X244H, X244I, X244L, X244M, X244N, X244Q, X244S, X244T,
X244V, X244W, X245A, X245C, X245E, X245G, X245H, X245K, X245L,
X245P, X245Q, X245S, X245V, X245W, X245Y, X246A, X246C, X246I,
X246L, X246M, X246T, X246V, X247A, X247C, X247F, X247G, X247H,
X247K, X247L, X247M, X247N, X247R, X247S, X247T, X247V, X247W,
X247Y, X248C, X248D, X248E, X248G, X248H, X248I, X248L, X248N,
X248P, X248R, X248S, X248T, X248V, X248Y, X249A, X249D, X249E,
X249F, X249G, X249H, X249I, X249K, X249L, X249M, X249N, X249Q,
X249S, X249T, X249W, X249Y, X250C, X250I, X250L, X250M, X250V,
X251A, X251D, X251E, X251F, X251G, X251K, X251L, X251M, X251Q,
X251R, X251T, X251V, X251Y, X252A, X252C, X252D, X252F, X252G,
X252H, X252I, X252K, X252L, X252M, X252N, X252R, X252S, X252V,
X252W, X253A, X253E, X253H, X253M, X253S, X253T, X253W, X255A,
X255C, X255D, X255E, X255I, X255L, X255N, X255Q, X255T, X255V,
X255Y, X256A, X256C, X256D, X256E, X256G, X256H, X256I, X256K,
X256L, X256M, X256N, X256P, X256S, X256V, X256W, X256Y, X258D,
X258G, X259A, X259C, X259E, X259P, X259Q, X259S, X260A, X260D,
X260E, X260H, X260I, X260N, X260P, X260S, X260T, X260V, X261A,
X261C, X261E, X261F, X261I, X261K, X261L, X261N, X261P, X261Q,
X261S, X261T, X261V, X261W, X261Y, X262A, X262C, X262D, X262F,
X262H, X262I, X262L, X262M, X262Q, X262T, X262V, X262Y, X265A,
X265D, X265S, X267I, X267L, X268A, X268L, X268V, X269D, X269H,
X269N, X269Q, X269S, X270A, X270C, X270G, X270I, X270L, X270N,
X270S, X270T, X270V, X271C, X271E, X272A, X272C, X272D, X272E,
X272F, X272G, X272H, X272L, X272M, X272N, X272P, X272S, X272T,
X272W, X272Y, X273A, X273C, X273G, X273S, X274A, X274C, X274G,
X274L, X274M, X274N, X274S, X274T, X275D, X275E, X275F, X275H,
X275K, X275L, X275M, X275P, X275Q, X275R.
Example 6
Comparative Evaluation of Variant Protease Data
[0293] In this Example, results of experiments conducted to
determine cleaning performance, LAS/EDTA stability, AAPF activity
and protein content (tests of properties of interest) of BPN',
GCI-P036 and variant proteases are compared. The detergents used
and conditions used are provided in Example 1. In the following
Tables, the "EGG" results refer to CS-38 microswatch assay results
in CALGONIT.RTM. (WE ADW) as described in Table 1-1. As described
throughout functionality of the variant proteases is quantified as
a performance index (PI), which is the ratio of performance of a
variant to a referencet protease. PI classifications used herein
include: Up mutations (PI>1.0); Neutral mutations (PI>0.5);
Non-deleterious mutations (PI>0.05); and Deleterious mutations
(PI.ltoreq.0.05). BPN' variants were produced and assayed as
described in PCT/09/046,066 and PCT/US09/046,156, incorporated
herein by reference in their entirety.
[0294] "Productive sites" are those having at least one Up mutation
for any property. "Productive, non-restrictive" sites are those
having .gtoreq.20% neutral mutations (PI>0.5) and at least one
Up mutation (PI>1.0) for any property tested (besides protein
expression). In Table 6-1 below, the results for variants that
contain sites that meet the definition of a productive,
non-restrictive site are shown as a percentage (%) of variants
tested that meet the definition of an Up mutation (PI>1).
TABLE-US-00013 TABLE 6-1 Productive, Non-Restrictive Sites for BPN'
and GG36 Position BPN' WT # BPN' BPN' TCA BPN' BMI BPN' BMI BPN'
BMI BPN' LAS/ BPN' AAPF (BPN' #) Residue Variants Assay
pH7/16.degree. C. pH8/16.degree. C. pH7/32.degree. ETDA Assay Assay
1 A 19 63 21 47 32 26 32 2 Q 19 11 32 26 58 0 0 3 S 19 84 21 32 32
21 26 4 V 19 26 26 74 26 5 42 5 P 19 0 42 37 42 0 11 6 Y 19 58 63
37 11 11 11 7 G 15 0 7 7 27 0 0 8 V 16 0 38 13 75 0 0 9 S 19 74 11
11 5 16 42 10 Q 19 74 11 21 11 5 26 11 I 19 16 37 26 21 5 16 12 K
19 79 11 16 16 79 16 13 A 19 11 37 21 16 11 11 14 P 19 68 0 63 16 0
79 15 A 19 79 0 0 26 42 21 16 L 19 32 5 79 58 11 11 17 H 19 26 11
42 47 0 5 18 S 19 89 0 84 37 32 5 19 Q 19 21 42 26 11 21 42 20 G 19
16 0 84 58 21 26 21 Y 17 41 0 6 35 35 12 22 T 18 78 44 0 78 83 39
24 S 16 56 75 13 81 88 50 25 N 19 47 0 84 63 37 37 26 V 17 6 35 12
76 59 18 27 K 19 21 11 84 42 58 42 28 V 16 13 38 25 56 44 6 29 A 17
0 35 29 35 18 12 30 V 18 11 50 50 50 17 0 31 I 19 11 68 58 58 79 53
33 S 15 0 60 0 20 7 7 34 G 19 0 5 11 5 0 0 35 I 19 0 5 53 47 0 11
36 D 18 11 17 11 22 0 0 37 S 19 47 58 26 5 16 37 38 S 19 74 42 53
74 68 16 39 H 19 5 11 53 47 0 26 40 P 19 47 74 74 84 16 89 41 D 19
0 37 16 26 0 0 42 L 19 5 16 16 26 0 5 43 K 19 16 0 74 0 74 79 44 V
19 0 21 74 68 0 16 45 A 16 81 31 6 31 81 94 46 G 17 0 59 18 59 18
41 47 G 19 0 26 42 68 5 0 48 A 17 65 35 12 29 65 24 49 S 18 0 22 22
39 6 0 50 M 17 6 82 6 41 65 65 51 V 19 0 42 68 63 26 0 52 P 19 0 74
95 89 5 0 53 S 19 74 37 63 26 53 16 54 E 19 0 53 53 47 0 0 55 T 19
53 21 42 0 79 47 56 N 19 5 68 74 63 5 0 57 P 19 5 68 84 63 0 0 58 F
19 11 63 89 32 11 16 59 Q 19 68 68 84 53 47 16 60 D 19 5 5 58 32 0
0 61 N 19 100 53 53 21 68 68 62 N 19 74 58 42 26 74 16 63 S 19 89
47 21 21 32 32 66 T 19 5 0 0 0 0 0 67 H 14 79 0 0 0 0 0 68 V 19 26
42 26 26 11 0 69 A 19 0 58 11 26 5 5 71 T 19 5 32 47 47 0 5 72 V 17
6 65 71 53 6 0 73 A 17 6 59 59 65 0 18 74 A 19 11 68 5 11 0 0 75 L
19 32 11 11 63 0 68 76 N 19 32 11 5 42 5 58 77 N 19 0 63 11 21 0 0
78 S 19 84 74 16 26 42 32 79 I 19 74 0 74 42 5 21 80 G 19 0 11 21
32 0 0 81 V 19 16 79 5 74 0 0 82 L 18 0 78 72 83 0 17 84 V 19 21 0
0 5 0 26 85 A 15 0 20 13 7 0 0 86 P 14 0 79 71 93 0 57 87 S 16 69
94 38 69 25 25 88 A 16 0 69 88 50 6 44 89 S 19 5 58 74 53 16 32 90
L 14 0 79 71 71 7 14 91 Y 19 5 26 74 63 58 5 92 A 15 7 53 53 60 7 0
93 V 15 0 40 40 40 20 7 94 K 16 0 25 44 19 13 0 95 V 18 6 17 6 11
17 11 96 L 17 0 71 29 53 12 0 97 G 17 35 94 53 94 59 6 98 A 19 42 0
63 63 32 47 99 D 18 11 83 0 61 50 0 100 G 19 16 79 68 79 21 0 101 S
16 56 100 19 50 75 56 102 G 14 7 29 14 14 14 0 103 Q 16 50 63 38 19
69 19 104 Y 17 0 47 59 65 47 6 105 S 19 0 47 42 32 53 11 106 W 19 0
74 63 74 26 0 107 I 15 0 40 33 27 13 7 108 I 19 5 37 42 32 5 0 109
N 19 11 32 11 68 58 42 110 G 16 0 19 25 19 0 0 111 I 19 5 37 21 42
11 0 112 E 19 0 42 21 53 63 0 113 W 19 0 5 42 21 26 0 114 A 18 0 33
33 33 11 17 115 I 19 0 79 42 79 26 16 116 A 19 53 47 42 47 26 74
117 N 19 5 53 47 68 58 47 118 N 19 32 26 42 32 58 68 119 M 18 0 50
56 28 33 17 120 D 19 47 47 68 37 68 5 121 V 19 5 5 16 5 21 0 122 I
19 0 42 42 47 32 5 123 N 19 0 58 58 47 0 0 124 M 18 17 50 44 39 11
0 126 L 14 21 57 36 43 14 0 127 G 17 53 24 0 0 0 0 128 G 17 12 41
35 29 6 0 129 P 19 58 63 37 53 16 32 130 S 19 74 11 16 11 53 42 131
G 19 5 0 32 11 16 32 132 S 19 5 53 53 47 16 0 133 A 19 21 21 5 0 63
58 134 A 19 0 42 26 26 58 21 135 L 13 8 62 46 46 15 0 136 K 19 5 68
42 26 21 26 137 A 19 21 47 16 16 53 89 138 A 19 0 63 53 74 0 32 139
V 19 5 16 16 32 11 11 140 D 19 5 5 11 0 0 21 141 K 19 21 21 89 79
74 79 142 A 19 0 42 32 32 5 26 143 V 19 16 11 47 37 26 47 144 A 19
53 68 16 26 42 58 145 S 19 47 16 84 74 53 74 146 G 19 5 32 74 47 21
58 147 V 16 6 88 94 50 56 38 148 V 17 0 47 65 65 18 6 149 V 16 0 44
69 63 88 19 150 V 18 0 17 44 50 28 11 151 A 17 0 18 35 35 6 0 152 A
15 40 7 7 13 0 0 153 A 19 0 26 26 21 0 0 154 G 19 0 0 0 0 0 0 155 N
17 35 0 0 0 0 0 156 E 16 44 0 0 6 13 56 157 G 19 0 5 0 0 0 0 158 T
19 16 74 16 16 16 11 159 S 19 37 74 63 63 32 21 160 G 19 11 11 53
11 5 5 161 S 19 53 58 74 32 37 47 162 S 19 32 63 11 16 37 37 163 S
19 5 21 5 5 0 0 164 T 17 0 12 29 29 0 0 165 V 15 0 7 13 33 7 0 166
G 16 63 0 6 6 69 0 167 Y 19 5 58 84 74 0 0 169 G 18 6 11 6 11 6 6
170 K 18 11 100 83 50 11 11 171 Y 18 0 33 22 33 0 0 172 P 17 0 88
71 76 24 76 173 S 19 0 68 37 74 5 26 174 V 19 0 32 21 42 0 16 175 I
19 0 42 26 37 5 11 176 A 19 5 11 5 21 11 5 177 V 19 0 5 11 26 0 0
178 G 17 0 0 6 12 0 0 179 A 19 0 11 5 16 0 0 180 V 19 11 32 16 53 0
16 181 D 19 5 5 5 32 0 16 182 S 19 32 53 79 42 16 53 183 S 19 53 42
58 42 32 42 184 N 19 5 53 74 47 11 53 185 Q 19 11 47 63 53 16 84
186 R 19 0 89 95 79 5 0 187 A 19 11 68 74 26 0 11 188 S 19 47 32 84
26 11 32 189 F 17 29 24 12 29 0 0 190 S 19 0 21 26 16 0 0 191 Q 19
5 5 11 11 0 0 192 Y 19 0 32 53 26 0 5 193 G 19 0 21 11 0 0 0 194 P
19 0 74 47 68 0 68 195 E 19 0 32 11 21 0 0 196 L 19 0 21 21 26 5 5
197 D 15 0 27 40 47 0 0 198 V 18 0 6 33 33 11 17 199 M 18 0 50 28
33 0 6 200 A 19 0 42 16 32 0 16 201 P 18 0 44 44 78 0 22 203 V 18 0
33 78 67 17 50 204 S 16 0 13 38 0 31 44 205 I 19 0 16 11 32 5 11
206 Q 19 68 53 32 84 26 16 207 S 19 0 5 5 0 0 0 208 T 19 0 37 37 37
0 21 209 L 19 5 32 21 37 0 32 210 P 19 0 74 42 68 0 11 211 G 19 5
79 79 53 21 37 212 N 19 26 42 42 32 5 16 213 K 17 47 94 100 18 94
29 214 Y 18 0 72 50 44 0 0 215 G 19 11 68 26 32 11 0 216 A 19 42 32
42 37 53 21 217 Y 19 32 47 26 58 53 58 218 N 19 5 26 11 16 16 32
219 G 19 5 0 0 0 16 0 220 T 19 0 5 5 5 0 0 222 M 18 67 0 0 17 28 6
223 A 19 5 11 0 0 0 0 224 S 19 11 37 26 42 5 5 225 P 19 16 0 0 0 0
0 226 H 19 0 58 53 63 0 16 227 V 19 5 32 47 26 5 0 228 A 16 0 25 25
38 6 0 229 G 19 5 0 5 5 0 5 230 A 19 11 21 47 58 11 21 231 A 19 0
47 58 58 5 5 232 A 13 0 38 54 23 38 15 233 L 11 0 19 36 18 27 0 234
I 19 32 37 32 26 21 32 235 L 19 47 32 37 47 68 32 236 S 19 42 32 21
32 26 42 237 K 19 79 26 37 26 37 58 238 H 19 0 37 47 42 58 26 239 P
19 0 58 16 47 84 53 240 N 19 42 68 11 47 79 42 241 W 19 0 68 21 79
63 58 242 T 19 32 16 74 32 89 21 243 N 19 11 11 63 37 21 16 244 T
19 47 16 74 53 68 37 245 Q 19 16 11 79 26 84 32 246 V 17 6 18 35 18
18 12 247 R 19 0 53 74 42 0 0 248 S 19 47 37 79 42 32 58 249 S 19
42 5 68 37 5 42 250 L 19 0 26 32 26 0 16
251 E 19 0 37 11 63 0 0 252 N 19 21 58 37 74 53 42 253 T 19 16 53
58 68 11 16 254 T 19 16 53 47 63 11 5 255 T 19 26 58 53 37 0 42 256
K 19 11 89 95 58 0 68 257 L 19 0 47 53 32 0 16 258 G 17 0 47 82 94
0 0 259 D 19 21 5 0 11 0 89 260 S 19 26 63 63 37 0 47 261 F 19 0 0
32 11 5 0 262 Y 19 11 26 26 37 0 0 263 Y 19 5 37 32 26 0 5 264 G 19
0 5 5 16 0 0 265 K 19 21 84 84 58 47 11 266 G 19 0 0 5 5 0 0 267 L
18 0 61 83 89 11 56 268 I 19 0 26 37 37 0 5 269 N 19 5 32 26 63 11
5 270 V 18 17 11 50 33 17 6 271 Q 19 53 32 32 79 47 26 272 A 19 26
16 68 32 37 16 273 A 13 0 69 85 100 0 0 274 A 19 5 42 0 53 16 26
275 Q 19 26 47 53 47 58 26 Position GG36 WT # GG36 GG36 BMI GG36
GG36 LAS/ GG36 AAPF GG36 TCA (BPN' #) Residue Variants
pH8/32.degree. C. EGG EDTA Assay Assay Assay 1 A 16 44 38 6 94 88 2
Q 15 20 73 0 100 100 3 S 15 13 20 20 100 100 4 V 15 33 53 0 93 93 5
P 16 56 56 0 38 44 6 W 13 31 0 0 0 0 7 G 18 22 28 0 39 39 8 I 14 29
36 7 43 43 9 S 16 75 63 19 88 63 10 R 17 88 47 29 41 35 11 V 15 53
33 0 27 27 12 Q 16 69 63 25 69 69 13 A 13 31 31 0 31 23 14 P 15 73
100 7 73 53 15 A 13 23 31 54 100 100 16 A 15 60 33 7 47 47 17 H 16
56 56 13 63 31 18 N 19 47 58 32 95 89 19 R 18 89 44 89 83 67 20 G
16 19 13 50 100 94 21 L 17 29 18 12 94 82 22 T 15 33 40 53 93 93 24
S 16 31 56 75 94 94 25 G 15 80 80 67 87 47 26 V 12 33 42 17 83 75
27 K 17 65 29 47 82 65 28 V 13 54 15 31 23 23 29 A 16 38 25 6 13 0
30 V 14 50 21 29 0 29 31 L 13 31 31 15 46 38 33 T 18 61 28 11 6 28
34 G 15 13 0 0 0 0 35 I 11 82 27 9 27 27 36 S 17 47 24 12 65 76 37
-- -- -- -- -- -- -- 38 T 14 29 29 43 93 79 39 H 17 53 6 0 6 0 40 P
17 53 100 29 100 82 41 D 18 17 6 0 6 6 42 L 18 50 17 0 39 28 43 N
16 31 25 63 100 81 44 I 17 24 24 47 88 94 45 R 18 78 22 89 89 89 46
G 17 71 18 94 65 70 47 G 15 80 53 0 13 20 48 A 17 76 35 76 88 94 49
S 12 92 33 25 8 8 50 F 11 64 45 73 36 45 51 V 11 73 9 18 55 55 52 P
16 75 100 38 94 69 53 G 17 53 12 12 76 82 54 E 18 28 17 22 39 78 55
P 18 56 22 33 72 83 56 S 15 67 40 33 60 73 57 T 18 44 44 39 100 83
58 -- -- -- -- -- -- -- 59 Q 18 44 22 11 78 78 60 D 17 88 53 0 0 0
61 G 15 47 27 87 100 73 62 N 16 75 69 31 75 94 63 G 16 81 31 0 31
50 66 T 14 71 7 7 7 7 67 H 17 18 0 0 0 53 68 V 19 26 5 0 0 53 69 A
18 67 17 0 11 6 71 T 18 67 39 0 11 17 72 I 16 50 38 13 31 31 73 A
14 57 71 7 71 36 74 A 15 13 13 0 13 13 75 L 17 100 88 0 76 24 76 N
16 38 63 6 75 63 77 N 17 88 6 0 6 0 78 S 18 67 89 44 94 72 79 I 17
71 71 0 94 53 80 G 12 92 0 0 0 0 81 V 18 72 44 0 22 39 82 L 16 56
69 0 44 38 84 V 16 56 31 0 44 38 85 A 11 18 18 0 0 0 86 P 13 77 62
15 46 15 87 S 14 50 50 14 93 86 88 A 14 71 43 0 43 7 89 E 17 71 76
12 71 41 90 L 16 56 31 13 38 31 91 Y 15 93 67 47 47 33 92 A 17 94
35 12 18 24 93 V 16 38 19 56 19 19 94 K 18 67 11 0 0 11 95 V 18 56
11 22 11 22 96 L 16 13 25 31 13 75 97 G 18 50 50 67 61 89 98 A 15
60 53 60 93 73 99 S 14 50 36 50 71 79 100 G 16 19 25 56 19 81 101 S
17 47 76 88 76 88 102 G 16 50 19 19 0 19 103 S 16 50 50 56 56 63
104 V 15 40 47 60 53 53 105 S 19 53 26 37 63 53 106 S 14 64 57 71
71 57 107 I 18 11 61 6 11 56 108 A 16 19 38 0 13 19 109 Q 18 50 78
39 78 39 110 G 17 6 6 0 6 6 111 L 16 44 25 6 0 13 112 E 17 76 29 24
18 12 113 W 13 0 0 46 0 0 114 A 11 18 18 9 9 9 115 G 17 53 76 18 94
82 116 N 14 86 43 29 100 79 117 N 11 64 73 73 73 45 118 G 17 76 88
76 47 47 119 M 13 46 23 69 23 15 120 H 13 69 92 69 100 85 121 V 15
80 33 27 53 40 122 A 12 58 50 0 25 33 123 N 12 17 8 0 0 42 124 L 12
50 25 0 8 17 126 L 18 0 11 22 0 83 127 G 12 8 42 8 0 67 128 S 17 18
24 82 59 94 129 P 14 21 7 7 100 93 130 S 10 30 40 40 80 90 131 P 12
58 17 17 58 83 132 S 12 75 75 8 58 25 133 A 10 60 30 50 80 80 134 T
12 67 25 25 17 8 135 L 13 54 8 8 15 15 136 E 17 12 47 0 41 35 137 Q
13 62 69 38 77 69 138 A 14 43 29 14 0 7 139 V 15 73 27 0 13 13 140
N 17 82 53 6 76 65 141 S 13 54 54 46 69 77 142 A 19 58 37 0 21 11
143 T 15 73 33 7 80 60 144 S 18 50 39 33 78 67 145 R 17 82 65 53 41
35 146 G 17 88 29 6 12 6 147 V 12 42 8 8 33 33 148 L 18 56 39 0 56
39 149 V 17 71 18 24 24 6 150 V 14 64 29 0 29 14 151 A 13 15 8 0 8
31 152 A 13 8 8 0 0 26 153 S 13 23 0 0 15 31 154 G 16 0 6 0 0 0 155
N 14 0 0 0 0 79 156 S 18 33 11 0 11 61 157 G 14 0 0 0 0 14 158 A 14
29 21 36 86 93 159 -- -- -- -- -- -- -- 160 -- -- -- -- -- -- --
161 -- -- -- -- -- -- -- 162 -- -- -- -- -- -- -- 163 G 17 35 29 18
47 47 164 S 15 27 27 53 87 87 165 I 17 6 12 6 6 59 166 S 16 38 38
19 6 75 167 Y 19 32 0 0 11 47 169 A 19 11 16 0 0 11 170 R 14 93 21
29 21 21 171 Y 19 63 32 0 16 11 172 A 16 56 56 25 94 81 173 N 19 32
37 16 63 79 174 A 18 17 17 6 17 22 175 M 16 50 38 0 50 38 176 A 16
19 13 0 13 38 177 V 17 18 12 0 24 24 178 G 16 6 6 0 6 6 179 A 14 14
7 0 0 0 180 T 15 47 7 0 20 20 181 D 12 0 33 0 8 8 182 Q 18 17 33 11
100 100 183 N 17 18 29 6 94 88 184 N 18 61 11 6 6 6 185 N 17 41 24
24 94 88 186 R 17 53 12 24 12 6 187 A 19 5 16 0 5 37 188 S 16 6 0
19 100 100 189 F 16 6 0 0 0 88 190 S 19 0 0 0 0 84 191 Q 16 6 0 13
0 75 192 Y 17 6 12 6 0 53 193 G 15 0 0 0 0 87 194 A 17 18 35 35 94
94 195 G 16 56 44 13 13 19 196 L 14 21 14 0 7 43 197 D 18 83 50 0
44 39 198 I 17 41 12 0 59 59 199 V 17 47 29 12 29 29 200 A 11 36 27
0 18 18 201 P 16 31 13 0 0 0 203 V 16 75 19 13 19 25 204 N 14 14 29
7 93 93 205 V 15 33 13 13 7 13 206 Q 18 67 28 17 94 44 207 S 18 11
11 0 6 0 208 T 18 39 22 0 22 11 209 Y 18 83 67 0 89 44 210 P 17 100
100 29 94 24 211 G 15 53 67 20 93 93 212 S 13 46 46 38 92 92 213 T
18 22 39 6 94 94 214 Y 18 100 39 0 22 17 215 A 17 71 59 41 100 94
216 S 18 56 72 33 100 100 217 L 16 50 81 25 6 19 218 N 17 76 76 24
88 35 219 G 16 0 0 0 0 6 220 T 15 7 7 0 0 33 222 M 17 6 12 12 0 94
223 A 18 11 6 0 6 17 224 T 17 29 18 12 18 35 225 P 18 0 6 11 0 33
226 H 16 75 44 0 6 6 227 V 16 50 25 0 44 44 228 A 17 18 6 12 29 24
229 G 15 20 13 0 13 7 230 A 16 81 50 6 69 44 231 A 16 19 25 6 50 50
232 A 10 60 30 20 30 20
233 L 16 94 81 6 75 31 234 V 12 58 33 8 75 75 235 K 16 88 63 56 88
88 236 Q 16 94 88 13 75 50 237 K 17 94 71 65 88 82 238 N 17 71 71
47 94 88 239 P 17 71 82 65 100 82 240 S 14 71 93 14 93 79 241 W 19
42 63 63 95 84 242 S 15 33 33 47 100 73 243 N 18 39 50 39 94 89 244
V 16 56 75 63 94 81 245 Q 13 62 77 46 100 77 246 I 17 76 24 29 35
35 247 R 19 53 68 21 84 79 248 N 16 69 56 31 94 88 249 H 18 17 28
39 94 83 250 L 17 65 12 0 29 24 251 K 14 64 50 50 86 64 252 N 16 38
81 63 88 75 253 T 14 36 29 7 93 79 254 A 18 39 22 0 22 11 255 T 17
18 29 35 94 94 256 S 17 47 82 35 100 65 257 L 15 87 40 0 40 13 258
G 17 82 59 0 82 53 259 S 12 83 100 8 100 25 260 T 14 64 86 21 100
79 261 N 16 56 88 63 100 75 262 L 17 71 71 35 94 88 263 Y 15 93 33
0 13 7 264 G 14 79 7 0 7 0 265 S 18 83 83 6 72 44 266 G 17 6 0 0 0
0 267 L 17 76 41 0 41 6 268 V 15 53 13 0 53 47 269 N 13 85 85 8 100
69 270 A 17 88 71 0 65 35 271 E 14 29 100 0 100 64 272 A 16 69 63
25 100 69 273 A 15 100 73 7 73 27 274 T 15 87 80 13 87 60 275 R 14
86 50 79 71 50
[0295] "Highly productive" sites are those having .gtoreq.20% Up
mutations (PI>1) for at least one property other than protein
expression (e.g., as indicated in a TCA assay). In Table 6-2 below,
the results for variants that contain sites that meet the
definition of a highly productive site are shown as a percentage
(%) of variants tested that meet the definition of an Up mutation
(PI>1).
TABLE-US-00014 TABLE 6-2 Highly Productive Sites for BPN' and GG36
Position BPN' # BPN' BPN' TCA BPN' BMI BPN' BMI BPN' BMI BPN' LAS/
BPN' AAPF (BPN' #) WT Residue Variants Assay pH7/16.degree. C.
pH8/16.degree. C. pH8/32.degree. ETDA Assay Assay 1 A 19 63 21 47 3
26 32 2 Q 19 11 32 26 58 0 0 3 S 19 84 21 32 32 21 26 4 V 19 26 26
74 26 5 42 5 P 19 0 42 37 42 0 11 6 Y 19 58 63 37 11 11 11 7 G 15 0
7 7 27 0 0 8 V 16 0 38 13 75 0 0 9 S 19 74 11 11 5 16 42 10 Q 19 74
11 21 11 5 26 11 I 19 16 37 26 21 5 16 12 K 19 79 11 16 16 79 16 13
A 19 11 37 21 16 11 11 14 P 19 68 0 63 16 0 79 15 A 19 79 0 0 26 42
21 16 L 19 32 5 79 58 11 11 17 H 19 26 11 42 47 0 5 18 S 19 89 0 84
37 32 5 19 Q 19 21 42 26 11 21 42 20 G 19 16 0 84 58 21 26 21 Y 17
41 0 6 35 35 12 22 T 18 78 44 0 78 83 39 24 S 16 56 75 13 81 88 50
25 N 19 47 0 84 63 37 37 26 V 17 6 35 12 76 59 18 27 K 19 21 11 84
42 58 42 28 V 16 13 38 25 56 44 6 29 A 17 0 35 29 35 18 12 30 V 18
11 50 50 50 17 0 31 I 19 11 68 58 58 79 53 33 S 15 0 60 0 20 7 7 35
I 19 0 5 53 47 0 11 36 D 18 11 17 11 22 0 0 37 S 19 47 58 26 5 16
37 38 S 19 74 42 53 74 68 16 39 H 19 5 11 53 47 0 26 40 P 19 47 47
74 84 16 89 41 D 19 0 37 16 26 0 0 42 L 19 5 16 16 26 0 5 43 K 19
16 0 74 0 74 79 44 V 19 0 21 74 68 0 16 45 A 16 81 31 6 31 81 94 46
G 17 0 59 18 59 18 41 47 G 19 0 26 42 68 5 0 48 A 17 65 35 12 29 65
24 49 S 18 0 22 22 39 6 0 50 M 17 6 82 6 41 65 65 51 V 19 0 42 68
63 26 0 52 P 19 0 74 95 89 5 0 53 S 19 74 37 63 26 53 16 54 E 19 0
53 53 47 0 0 55 T 19 53 21 42 0 79 47 56 N 19 5 68 74 63 5 0 57 P
19 5 68 84 63 0 0 58 F 19 11 63 89 32 11 16 59 Q 19 68 68 84 53 47
16 60 D 19 5 5 58 32 0 0 61 N 19 100 53 53 21 68 68 62 N 19 74 58
42 26 74 16 63 S 19 89 47 21 21 32 32 66 T 19 5 0 0 0 0 0 67 H 14
79 0 0 0 0 0 68 V 19 26 42 26 26 11 0 69 A 19 0 58 11 26 5 5 71 T
19 5 32 47 47 0 5 72 V 17 6 65 71 53 6 0 73 A 17 6 59 59 65 0 18 74
A 19 11 68 5 11 0 0 75 L 19 32 11 11 63 0 68 76 N 19 32 11 5 42 5
58 77 N 19 0 63 11 21 0 0 78 S 19 84 74 16 26 42 32 79 I 19 74 0 74
42 5 21 80 G 19 0 11 21 32 0 0 81 V 19 16 79 5 74 0 0 82 L 18 0 78
72 83 0 17 84 V 19 21 0 0 5 0 26 85 A 15 0 20 13 7 0 0 86 P 14 0 79
71 93 0 57 87 S 16 69 94 38 69 25 25 88 A 16 0 69 88 50 6 44 89 S
19 5 58 74 53 16 32 90 L 14 0 79 71 71 7 14 91 Y 19 5 26 74 63 58 5
92 A 15 7 53 53 60 7 0 93 V 15 0 40 40 40 20 7 94 K 16 0 25 44 19
13 0 95 V 18 6 17 6 11 17 11 96 L 17 0 71 29 53 12 0 97 G 17 35 94
53 94 59 6 98 A 19 42 0 63 63 32 47 99 D 18 11 83 0 61 50 0 100 G
19 16 79 68 79 21 0 101 S 16 56 100 19 50 75 56 102 G 14 7 29 14 14
14 0 103 Q 16 50 63 38 19 69 19 104 Y 17 0 47 59 65 47 6 105 S 19 0
47 42 32 53 11 106 W 19 0 74 63 74 26 0 107 I 15 0 40 33 27 13 7
108 I 19 5 37 42 32 5 0 109 N 19 11 32 11 68 58 42 110 G 16 0 19 25
19 0 0 111 I 19 5 37 21 42 11 0 112 E 19 0 42 21 53 63 0 113 W 19 0
5 42 21 26 0 114 A 18 0 33 33 33 11 17 115 I 19 0 79 42 79 26 16
116 A 19 53 47 42 47 26 74 117 N 19 5 53 47 68 58 47 118 N 19 32 26
42 32 58 68 119 M 18 0 50 56 28 33 17 120 D 19 47 47 68 37 68 5 121
V 19 5 5 16 5 21 0 122 I 19 0 42 42 47 32 5 123 N 19 0 58 58 47 0 0
124 M 18 17 50 44 39 11 0 126 L 14 21 57 36 43 14 0 127 G 17 53 24
0 0 0 0 128 G 17 12 41 35 29 6 0 129 P 19 58 63 37 53 16 32 130 S
19 74 11 16 11 53 42 131 G 19 5 0 32 11 16 32 132 S 19 5 53 53 47
16 0 133 A 19 21 21 5 0 63 58 134 A 19 0 42 26 26 58 21 135 L 13 8
62 46 46 15 0 136 K 19 5 68 42 26 21 26 137 A 19 21 47 16 16 53 89
138 A 19 0 63 53 74 0 32 139 V 19 5 16 16 32 11 11 140 D 19 5 5 11
0 0 21 141 K 19 21 21 89 79 74 79 142 A 19 0 42 32 32 5 26 143 V 19
16 11 47 37 26 47 144 A 19 53 68 16 26 42 58 145 S 19 47 16 84 74
53 74 146 G 19 5 32 74 47 21 58 147 V 16 6 88 94 50 56 38 148 V 17
0 47 65 65 18 6 149 V 16 0 44 69 63 88 19 150 V 18 0 17 44 50 28 11
151 A 17 0 18 35 35 6 0 152 A 15 40 7 7 13 0 0 153 A 19 0 26 26 21
0 0 155 N 17 35 0 0 0 0 0 156 E 16 44 0 0 6 13 56 158 T 19 16 74 16
16 16 11 159 S 19 37 74 63 63 32 21 160 G 19 11 11 53 11 5 5 161 S
19 53 58 74 32 37 47 162 S 19 32 63 11 16 37 37 163 S 19 5 21 5 5 0
0 164 T 17 0 12 29 29 0 0 165 V 15 0 7 13 33 7 0 166 G 16 63 0 6 6
69 0 167 Y 19 5 58 84 74 0 0 170 K 18 11 100 83 50 11 11 171 Y 18 0
33 22 33 0 0 172 P 17 0 88 71 76 24 76 173 S 19 0 68 37 74 5 26 174
V 19 0 32 21 42 0 16 175 I 19 0 42 26 37 5 11 176 A 19 5 11 5 21 11
5 177 V 19 0 5 11 26 0 0 180 V 19 11 32 16 53 0 16 181 D 19 5 5 5
32 0 16 182 S 19 32 53 79 42 16 53 183 S 19 53 42 58 42 32 42 184 N
19 5 53 74 47 11 53 185 Q 19 11 47 63 53 16 84 186 R 19 0 89 95 79
5 0 187 A 19 11 68 74 26 0 11 188 S 19 47 32 84 26 11 32 189 F 17
29 24 12 29 0 0 190 S 19 0 21 26 16 0 0 191 Q 19 5 5 11 11 0 0 192
Y 19 0 32 53 26 0 5 193 G 19 0 21 11 0 0 0 194 P 19 0 74 47 68 0 68
195 E 19 0 32 11 21 0 0 196 L 19 0 21 21 26 5 5 197 D 15 0 27 40 47
0 0 198 V 18 0 6 33 33 11 17 199 M 18 0 50 28 33 0 6 200 A 19 0 42
16 32 0 16 201 P 18 0 44 44 78 0 22 203 V 18 0 33 78 67 17 50 204 S
16 0 13 38 0 31 44 205 I 19 0 16 11 32 5 11 206 Q 19 68 53 32 84 26
16 208 T 19 0 37 37 37 0 21 209 L 19 5 32 21 37 0 32 210 P 19 0 74
42 68 0 11 211 G 19 5 79 79 53 21 37 212 N 19 26 42 42 32 5 16 213
K 17 47 94 100 18 94 29 214 Y 18 0 72 50 44 0 0 215 G 19 11 68 26
32 11 0 216 A 19 42 32 42 37 53 21 217 Y 19 32 47 26 58 53 58 218 N
19 5 26 11 16 16 32 220 T 19 0 5 5 5 0 0 222 M 18 67 0 0 17 28 6
224 S 19 11 37 26 42 5 5 225 P 19 16 0 0 0 0 0 226 H 19 0 58 53 63
0 16 227 V 19 5 32 47 26 5 0 228 A 16 0 25 25 38 6 0 229 G 19 5 0 5
5 0 5 230 A 19 11 21 47 58 11 21 231 A 19 0 47 58 58 5 5 232 A 13 0
38 54 23 38 15 233 L 11 0 18 36 18 27 0 234 I 19 32 37 32 26 21 32
235 L 19 47 32 37 47 68 32 236 S 19 42 32 21 32 26 42 237 K 19 79
26 37 26 37 58 238 H 19 0 37 47 42 58 26 239 P 19 0 58 16 47 84 53
240 N 19 42 68 11 47 79 42 241 W 19 0 68 21 79 63 58 242 T 19 32 16
74 32 89 21 243 N 19 11 11 63 37 21 16 244 T 19 47 16 74 53 68 37
245 Q 19 16 11 79 26 84 32 246 V 17 6 18 35 18 18 12 247 R 19 0 53
74 42 0 0 248 S 19 47 37 79 42 32 58 249 S 19 42 5 68 37 5 42 250 L
19 0 26 32 26 0 16 251 E 19 0 37 11 63 0 0 252 N 19 21 58 37 74 53
42 253 T 19 16 53 58 68 11 16 254 T 19 16 53 47 63 11 5 255 T 19 26
58 53 37 0 42 256 K 19 11 89 95 58 0 68 257 L 19 0 47 53 32 0 16
258 G 17 0 47 82 94 0 0 259 D 19 21 5 0 11 0 89
260 S 19 26 63 63 37 0 47 261 F 19 0 0 32 11 5 0 262 Y 19 11 26 26
37 0 0 263 Y 19 5 37 32 26 0 5 264 G 19 0 5 5 16 0 0 265 K 19 21 84
84 58 47 11 267 L 18 0 61 83 89 11 56 268 I 19 0 26 37 37 0 5 269 N
19 5 32 26 63 11 5 270 V 18 17 11 50 33 17 6 271 Q 19 53 32 32 79
47 26 272 A 19 26 16 68 32 37 16 273 A 13 0 69 85 100 0 0 274 A 19
5 42 0 53 16 26 275 Q 19 26 47 53 47 58 26 Position GG36 WT # GG36
GG36 BMI GG36 GG36 LAS/ GG36 AAPF GG36 TCA (BPN' #) Residue
Variants pH8/32.degree. C. EGG EDTA Assay Assay Assay 1 A 16 44 38
6 94 88 2 Q 15 20 73 0 100 100 3 S 15 13 20 20 100 100 4 V 15 33 53
0 93 93 5 P 16 56 56 0 38 44 6 W 13 31 0 0 0 0 7 G 18 22 28 0 39 39
8 I 14 29 36 7 43 43 9 S 16 75 63 19 88 63 10 R 17 88 47 29 41 35
11 V 15 53 33 0 27 27 12 Q 16 69 63 25 69 69 13 A 13 31 31 0 31 23
14 P 15 73 100 7 73 53 15 A 13 23 31 54 100 100 16 A 15 60 33 7 47
47 17 H 16 56 56 13 63 31 18 N 19 47 58 32 95 89 19 R 18 89 44 89
83 67 20 G 16 19 13 50 100 94 21 L 17 29 18 12 94 82 22 T 15 33 40
53 93 93 24 S 16 31 56 75 94 94 25 G 15 80 80 67 87 47 26 V 12 33
42 17 83 75 27 K 17 65 29 47 82 65 28 V 13 54 15 31 23 23 29 A 16
38 25 6 13 0 30 V 14 50 21 29 0 29 31 L 13 31 31 15 46 38 33 T 18
16 28 11 6 28 35 I 11 82 27 9 27 27 36 S 17 47 24 12 65 76 37 -- --
-- -- -- -- -- 38 T 14 29 29 43 93 79 39 H 17 53 6 0 6 0 40 P 17 53
100 29 100 82 41 D 18 17 6 0 6 6 42 L 18 50 17 0 39 28 43 N 16 31
25 63 100 81 44 I 17 24 24 47 88 94 45 R 18 78 22 89 89 89 46 G 17
71 18 94 65 71 47 G 15 80 53 0 13 20 48 A 17 76 35 76 88 94 49 S 12
92 33 25 8 8 50 F 11 64 45 73 36 45 51 V 11 73 9 18 55 55 52 P 16
75 100 38 94 69 53 G 17 53 12 12 76 82 54 E 18 28 17 22 39 78 55 P
18 56 22 33 72 83 56 S 15 67 40 33 60 73 57 T 18 44 44 39 100 83 58
-- -- -- -- -- -- -- 59 Q 18 44 22 11 78 78 60 D 17 88 53 0 0 0 61
G 15 47 27 87 100 73 62 N 16 75 69 31 75 94 63 G 16 81 31 0 31 50
66 T 14 71 7 7 7 7 67 H 17 18 0 0 0 53 68 V 19 26 5 0 0 53 69 A 18
67 17 0 11 6 71 T 18 67 39 0 11 17 72 I 16 50 38 13 31 31 73 A 14
57 71 7 71 36 74 A 15 13 13 0 13 13 75 L 17 100 88 0 76 24 76 N 16
38 63 6 75 63 77 N 17 88 6 0 6 0 78 S 18 67 89 44 94 72 79 I 17 71
71 0 94 53 80 G 12 92 0 0 0 0 81 V 18 72 44 0 22 39 82 L 16 56 69 0
44 38 84 V 16 56 31 0 44 38 85 A 11 18 18 0 0 0 86 P 13 77 62 15 46
15 87 S 14 50 50 14 93 86 88 A 14 71 43 0 43 7 89 E 17 71 76 12 71
41 90 L 16 56 31 13 38 31 91 Y 15 93 67 47 47 33 92 A 17 94 35 12
18 24 93 V 16 38 19 56 19 19 94 K 18 67 11 0 0 11 95 V 18 56 11 22
11 22 96 L 16 13 25 31 13 75 97 G 18 50 50 67 61 89 98 A 15 60 53
60 93 73 99 S 14 50 36 50 71 79 100 G 16 19 25 56 19 81 101 S 17 47
76 88 76 88 102 G 16 50 19 19 0 19 103 S 16 50 50 56 56 63 104 V 15
40 47 60 53 53 105 S 19 53 26 37 63 53 106 S 14 64 57 71 71 57 107
I 18 11 61 6 11 56 108 A 16 19 38 0 13 19 109 Q 18 50 78 39 78 39
110 G 17 6 6 0 6 6 111 L 16 44 25 6 0 13 112 E 17 76 29 24 18 12
113 W 13 0 0 46 0 0 114 A 11 18 18 9 9 9 115 G 17 53 76 18 94 82
116 N 14 86 43 29 100 79 117 N 11 64 73 73 73 45 118 G 17 76 88 76
47 47 119 M 13 46 23 69 23 15 120 H 13 69 92 69 100 85 121 V 15 80
33 27 53 40 122 A 12 58 50 0 25 33 123 N 12 17 8 0 0 42 124 L 12 50
25 0 8 17 126 L 18 0 11 22 0 83 127 G 12 8 42 8 0 67 128 S 17 18 24
82 59 94 129 P 14 21 7 7 100 93 130 S 10 30 40 40 80 90 131 P 12 58
17 17 58 83 132 S 12 75 75 8 58 25 133 A 10 60 30 50 80 80 134 T 12
67 25 25 17 8 135 L 13 54 8 8 15 15 136 E 17 12 47 0 41 35 137 Q 13
62 69 38 77 69 138 A 14 43 29 14 0 7 139 V 15 73 27 0 13 13 140 N
17 82 53 6 76 65 141 S 13 54 54 46 69 77 142 A 19 58 37 0 21 11 143
T 15 73 33 7 80 60 144 S 18 50 39 33 78 67 145 R 17 82 65 53 41 35
146 G 17 88 29 6 12 6 147 V 12 42 8 8 33 33 148 L 18 56 39 0 56 39
149 V 17 71 18 24 24 6 150 V 14 64 29 0 29 14 151 A 13 15 8 0 8 31
152 A 13 8 8 0 0 23 153 S 13 23 0 0 15 31 155 N 14 0 0 0 0 79 156 S
18 33 11 0 11 61 158 A 14 29 21 36 86 93 159 -- -- -- -- -- -- --
160 -- -- -- -- -- -- -- 161 -- -- -- -- -- -- -- 162 -- -- -- --
-- -- -- 163 G 17 35 29 18 47 47 164 S 15 27 27 53 87 87 165 I 17 6
12 6 6 59 166 S 16 38 38 19 6 75 167 Y 19 32 0 0 11 47 170 R 14 93
21 29 21 21 171 Y 19 63 32 0 16 11 172 A 16 56 56 25 94 81 173 N 19
32 37 16 63 79 174 A 18 17 17 6 17 22 175 M 16 50 38 0 50 38 176 A
16 19 13 0 13 38 177 V 17 18 12 0 24 24 180 T 15 47 7 0 20 20 181 D
12 0 33 0 8 8 182 Q 18 17 33 11 100 100 183 N 17 18 29 6 94 88 184
N 18 61 11 6 6 6 185 N 17 41 24 24 94 88 186 R 17 53 12 24 12 6 187
A 19 5 16 0 5 37 188 S 16 6 0 19 100 100 189 F 16 6 0 0 0 88 190 S
19 0 0 0 0 84 191 Q 16 6 0 13 0 75 192 Y 17 6 12 6 0 53 193 G 15 0
0 0 0 87 194 A 17 18 35 35 94 94 195 G 16 56 44 13 13 19 196 L 14
21 14 0 7 43 197 D 18 83 50 0 44 39 198 I 17 41 12 0 59 59 199 V 17
47 29 12 29 29 200 A 11 36 27 0 18 18 201 P 16 31 13 0 0 0 203 V 16
75 19 13 19 25 204 N 14 14 29 7 93 93 205 V 15 33 13 13 7 13 206 Q
18 67 28 17 94 44 208 T 18 39 22 0 22 11 209 Y 18 83 67 0 89 44 210
P 17 100 100 29 94 24 211 G 15 53 67 20 93 93 212 S 13 46 46 38 92
92 213 T 18 22 39 6 94 94 214 Y 18 100 39 0 22 17 215 A 17 71 59 41
100 94 216 S 18 56 72 33 100 100 217 L 16 50 81 25 6 19 218 N 17 76
76 24 88 35 220 T 15 7 7 0 0 33 222 M 17 6 12 12 0 94 224 T 17 29
18 12 18 35 225 P 18 0 6 11 0 33 226 H 16 75 44 0 6 6 227 V 16 50
25 0 44 44 228 A 17 18 6 12 29 24 229 G 15 20 13 0 13 7 230 A 16 81
50 6 69 44 231 A 16 19 25 6 50 50 232 A 10 60 30 20 30 20 233 L 16
94 81 6 75 31 234 V 12 58 33 8 75 75 235 K 16 88 63 56 88 88 236 Q
16 94 88 13 75 50 237 K 17 94 71 65 88 82 238 N 17 71 71 47 94 88
239 P 17 71 82 65 100 82 240 S 14 71 93 14 93 79 241 W 19 42 63 63
95 81 242 S 15 33 33 47 100 73 243 N 18 39 50 39 94 89 244 V 16 56
75 63 94 81 245 Q 13 62 77 46 100 77 246 I 17 76 24 29 35 35 247 R
19 53 68 21 84 79 248 N 16 69 56 31 94 88 249 H 18 17 28 39 94 83
250 L 17 65 12 0 29 24 251 K 14 64 50 50 86 64
252 N 16 38 81 63 88 75 253 T 14 36 29 7 93 79 254 A 18 39 22 0 22
11 255 T 17 18 29 35 94 94 256 S 17 47 82 35 100 65 257 L 15 87 40
0 40 13 258 G 17 82 59 0 82 53 259 S 12 83 100 8 100 25 260 T 14 64
86 21 100 79 261 N 16 56 88 63 100 75 262 L 17 71 71 35 94 88 263 Y
15 93 33 0 13 7 264 G 14 79 7 0 7 0 265 S 18 83 83 6 72 44 267 L 17
76 41 0 41 6 268 V 15 53 13 0 53 47 269 N 13 85 85 8 100 69 270 A
17 88 71 0 65 35 271 E 14 29 100 0 100 64 272 A 16 69 63 25 100 69
273 A 15 100 73 7 73 27 274 T 15 87 80 13 87 60 275 R 14 86 50 79
71 50
[0296] "Restrictive" sites are those sites that have less than 20%
neutral mutations for activity and stability. In Table 6-3 below,
the results for variants that contain sites that meet the
definition of a restrictive site are shown as a percentage (%) of
variants evaluated that meet definition of a neutral mutation
(PI>0.5).
TABLE-US-00015 Table 6-3 Restrictive Sites for BPN' and GG36
Position BPN' WT # BPN' BPN' BMI BPN' BMI BPN' BMI BPN' BPN' GG36
WT # GG36 GG36 BMI GG36 GG36 GG36 (BPN' #) Residue Variants
pH7/16.degree. C. pH8/16.degree. C. pH8/32.degree. LAS AAPF Residue
Variants pH8/32.degree. C. Egg LAS/EDTA AAPF 23 G 18 11 17 11 11 6
G 13 15 15 15 15 32 D 16 0 0 0 0 0 D 17 12 18 0 0 64 H 13 0 0 0 0 0
H 14 0 0 7 0 65 G 17 6 12 12 6 6 G 10 0 0 0 0 70 G 16 0 0 0 0 0 G
12 0 0 0 0 83 G 19 5 5 5 5 5 G 10 10 10 0 10 125 S 19 16 5 5 5 0 S
15 13 7 13 0 168 P 19 16 11 0 0 0 P 18 6 6 0 0 202 G 19 0 0 11 0 0
G 18 6 0 0 0 221 S 16 0 0 0 0 0 S 16 0 0 0 0
[0297] In short, as determined during development of the present
invention, 10 positions in the mature region of two reference
subtilisins are restrictive positions for activity and stability.
Thus the remaining 265 positions in the mature region of two
reference subtilisins are nonrestrictive positions (.gtoreq.20%
neutral mutations) for activity and stability
Example 7
Evaluation of Stain Removal by GCI P036 Combinatorial Library
Variants
[0298] In this Example, results for variants of GCI-P036 were
tested for their stain removal performance in automatic dishwashing
and liquid laundry detergent applications are provided. Cloning of
the combinatorial library was performed by Sloning BioTechnology
using the Slonomax Technology. Preparation of variant protease
samples was performed as described above. Briefly, combinatorial
library variants were tested in blood, milk, ink (BMI) microswatch
and CS-38 microswatch assays in detergents representing various
market geographies (e.g., differing pH, temperature, and/or water
hardness), in both laundry and automatic dishwashing (ADW)
applications. As described throughout, functionality of protease
variants was quantified as a performance index (PI), which is the
ratio of performance of a variant to that of a reference protease.
The substitutions are listed relative to the GCI-P036 reference
protease using BPN' numbering and the PI is determined in
relationship to the GCI-P036 reference. Data is shown in Tables 7-1
to 7-5.
TABLE-US-00016 TABLE 7-1 Protease Variants with PI .gtoreq.0.8 on
Baked Egg Assay in CASCADE .RTM. Detergent (NA ADW) Variant S87
Q109 G118 S128 P129 S130 S188 T213 S248 PI 75 S87N Q109Q G118D
S128L P129Q S130A S188S T213E N248R 2.23 46 S87N Q109R G118V S128L
P129Q S130A S188D T213R N248D 1.72 1 S87N Q109Q G118V S128L P129Q
S130A S188S T213T N248N 1.68 47 S87N Q109R G118V S128L P129Q S130A
S188D T213E N248N 1.64 48 S87N Q109R G118V S128L P129Q S130A S188D
T213E N248R 1.63 42 S87N Q109R G118V S128L P129Q S130A S188D T213T
N248R 1.62 26 S87N Q109R G118V S128L P129Q S130A S188S T213T N248R
1.52 63 S87R Q109R G118V S128L P129Q S130A S188D T213E N248R 1.51
80 S87R Q109Q G118R S128L P129Q S130A S188D T213T N248R 1.51 79
S87R Q109R G118R S128L P129Q S130A S188D T213T N248R 1.42 45 S87N
Q109R G118V S128L P129Q S130A S188D T213R N248R 1.41 67 S87R Q109Q
G118R S128L P129Q S130A S188S T213E N248R 1.40 64 S87R Q109Q G118R
S128L P129Q S130A S188D T213E N248R 1.37 32 S87N Q109R G118V S128L
P129Q S130A S188S T213E N248R 1.32 34 S87N Q109R G118V S128L P129Q
S130A S188R T213T N248R 1.28 62 S87R Q109R G118R S128L P129Q S130A
S188D T213E N248R 1.26 66 S87R Q109Q G118R S128L P129Q S130A S188D
T213E N248N 1.25 73 S87N Q109R G118R S128L P129Q S130A S188D T213E
N248R 1.24 39 S87N Q109R G118V S128L P129Q S130A S188R T213E N248N
1.20 40 S87N Q109R G118V S128L P129Q S130A S188R T213E N248R 1.19
17 S87N Q109Q G118V S128L P129Q S130A S188D T213T N248N 1.17 38
S87N Q109R G118V S128L P129Q S130A S188R T213R N248D 1.16 2 S87N
Q109Q G118V S128L P129Q S130A S188S T213T N248R 1.16 37 S87N Q109R
G118V S128L P129Q S130A S188R T213R N248R 1.15 25 S87N Q109R G118V
S128L P129Q S130A S188S T213T N248N 1.15 43 S87N Q109R G118V S128L
P129Q S130A S188D T213T N248D 1.14 44 S87N Q109R G118V S128L P129Q
S130A S188D T213R N248N 1.14 31 S87N Q109R G118V S128L P129Q S130A
S188S T213E N248N 1.14 35 S87N Q109R G118V S128L P129Q S130A S188R
T213T N248D 1.13 21 S87N Q109Q G118V S128L P129Q S130A S188D T213R
N248R 1.09 36 S87N Q109R G118V S128L P129Q S130A S188R T213R N248N
1.04 15 S87N Q109Q G118V S128L P129Q S130A S188R T213E N248N 1.03
23 S87N Q109Q G118V S128L P129Q S130A S188D T213E N248N 1.03 13
S87N Q109Q G118V S128L P129Q S130A S188R T213R N248R 1.02 18 S87N
Q109Q G118V S128L P129Q S130A S188D T213T N248R 1.00 28 S87N Q109R
G118V S128L P129Q S130A S188S T213R N248N 0.98 33 S87N Q109R G118V
S128L P129Q S130A S188R T213T N248N 0.97 65 S87R Q109Q G118V S128L
P129Q S130A S188D T213E N248R 0.96 24 S87N Q109Q G118V S128L P129Q
S130A S188D T213E N248R 0.94 55 S87N Q109D G118V S128L P129Q S130A
S188R T213R N248N 0.94 27 S87N Q109R G118V S128L P129Q S130A S188S
T213T N248D 0.91 53 S87N Q109R G118V S128L P129Q S130A S188R T213E
N248D 0.91 22 S87N Q109Q G118V S128L P129Q S130A S188D T213R N248D
0.90 7 S87N Q109Q G118V S128L P129Q S130A S188S T213E N248N 0.88 54
S87N Q109R G118V S128L P129Q S130A S188D T213E N248D 0.87 71 S87R
Q109D G118R S128L P129Q S130A S188D T213E N248N 0.87 81 S87N Q109R
G118V S128L P129Q S130A S188R T213R N248R 0.86 12 S87N Q109Q G118V
S128L P129Q S130A S188R T213R N248N 0.86 10 S87N Q109Q G118V S128L
P129Q S130A S188R T213T N248R 0.85 8 S87N Q109Q G118V S128L P129Q
S130A S188S T213E N248R 0.85 30 S87N Q109R G118V S128L P129Q S130A
S188S T213R N248D 0.83 16 S87N Q109Q G118V S128L P129Q S130A S188R
T213E N248R 0.82
TABLE-US-00017 TABLE 7-2 Protease Variants with PI .gtoreq.0.8 on
Baked Egg Assay in CALGONIT .RTM. Detergent (WE ADW) Variant S87
Q109 G118 S128 P129 S130 S188 T213 S248 PI 75 S87N Q109Q G118D
S128L P129Q S130A S188S T213E N248R 3.23 32 S87N Q109R G118V S128L
P129Q S130A S188S T213E N248R 1.87 48 S87N Q109R G118V S128L P129Q
S130A S188D T213E N248R 1.68 47 S87N Q109R G118V S128L P129Q S130A
S188D T213E N248N 1.67 42 S87N Q109R G118V S128L P129Q S130A S188D
T213T N248R 1.63 80 S87R Q109Q G118R S128L P129Q S130A S188D T213T
N248R 1.59 46 S87N Q109R G118V S128L P129Q S130A S188D T213R N248D
1.56 63 S87R Q109R G118V S128L P129Q S130A S188D T213E N248R 1.41
66 S87R Q109Q G118R S128L P129Q S130A S188D T213E N248N 1.38 64
S87R Q109Q G118R S128L P129Q S130A S188D T213E N248R 1.36 39 S87N
Q109R G118V S128L P129Q S130A S188R T213E N248N 1.36 67 S87R Q109Q
G118R S128L P129Q S130A S188S T213E N248R 1.26 31 S87N Q109R G118V
S128L P129Q S130A S188S T213E N248N 1.26 15 S87N Q109Q G118V S128L
P129Q S130A S188R T213E N248N 1.22 40 S87N Q109R G118V S128L P129Q
S130A S188R T213E N248R 1.20 34 S87N Q109R G118V S128L P129Q S130A
S188R T213T N248R 1.20 26 S87N Q109R G118V S128L P129Q S130A S188S
T213T N248R 1.18 27 S87N Q109R G118V S128L P129Q S130A S188S T213T
N248D 1.14 16 S87N Q109Q G118V S128L P129Q S130A S188R T213E N248R
1.14 7 S87N Q109Q G118V S128L P129Q S130A S188S T213E N248N 1.11 8
S87N Q109Q G118V S128L P129Q S130A S188S T213E N248R 1.09 23 S87N
Q109Q G118V S128L P129Q S130A S188D T213E N248N 1.09 65 S87R Q109Q
G118V S128L P129Q S130A S188D T213E N248R 1.09 35 S87N Q109R G118V
S128L P129Q S130A S188R T213T N248D 1.07 2 S87N Q109Q G118V S128L
P129Q S130A S188S T213T N248R 1.06 10 S87N Q109Q G118V S128L P129Q
S130A S188R T213T N248R 1.06 21 S87N Q109Q G118V S128L P129Q S130A
S188D T213R N248R 1.06 45 S87N Q109R G118V S128L P129Q S130A S188D
T213R N248R 1.04 73 S87N Q109R G118R S128L P129Q S130A S188D T213E
N248R 1.02 24 S87N Q109Q G118V S128L P129Q S130A S188D T213E N248R
1.02 28 S87N Q109R G118V S128L P129Q S130A S188S T213R N248N 0.98
25 S87N Q109R G118V S128L P129Q S130A S188S T213T N248N 0.98 43
S87N Q109R G118V S128L P129Q S130A S188D T213T N248D 0.97 38 S87N
Q109R G118V S128L P129Q S130A S188R T213R N248D 0.94 44 S87N Q109R
G118V S128L P129Q S130A S188D T213R N248N 0.91 22 S87N Q109Q G118V
S128L P129Q S130A S188D T213R N248D 0.88 71 S87R Q109D G118R S128L
P129Q S130A S188D T213E N248N 0.87 33 S87N Q109R G118V S128L P129Q
S130A S188R T213T N248N 0.85 13 S87N Q109Q G118V S128L P129Q S130A
S188R T213R N248R 0.83 1 S87N Q109Q G118V S128L P129Q S130A S188S
T213T N248N 0.83 18 S87N Q109Q G118V S128L P129Q S130A S188D T213T
N248R 0.83 17 S87N Q109Q G118V S128L P129Q S130A S188D T213T N248N
0.82
TABLE-US-00018 TABLE 7-3 Protease Variants with PI .gtoreq.0.8 on
CS-38 Microswatch Assay in CASCADE .RTM. Detergent (NA ADW) Variant
S87 Q109 G118 S128 P129 S130 S188 T213 S248 PI 38 S87N Q109R G118V
S128L P129Q S130A S188R T213R N248D 4.02 1 S87N Q109Q G118V S128L
P129Q S130A S188S T213T N248N 4.00 74 S87N Q109Q G118R S128L P129Q
S130A S188D T213E N248R 3.87 33 S87N Q109R G118V S128L P129Q S130A
S188R T213T N248N 3.78 40 S87N Q109R G118V S128L P129Q S130A S188R
T213E N248R 3.47 75 S87N Q109Q G118D S128L P129Q S130A S188S T213E
N248R 3.01 42 S87N Q109R G118V S128L P129Q S130A S188D T213T N248R
2.74 32 S87N Q109R G118V S128L P129Q S130A S188S T213E N248R 2.52
12 S87N Q109Q G118V S128L P129Q S130A S188R T213R N248N 2.48 73
S87N Q109R G118R S128L P129Q S130A S188D T213E N248R 2.46 21 S87N
Q109Q G118V S128L P129Q S130A S188D T213R N248R 2.43 66 S87R Q109Q
G118R S128L P129Q S130A S188D T213E N248N 2.41 63 S87R Q109R G118V
S128L P129Q S130A S188D T213E N248R 2.41 10 S87N Q109Q G118V S128L
P129Q S130A S188R T213T N248R 2.38 39 S87N Q109R G118V S128L P129Q
S130A S188R T213E N248N 2.31 45 S87N Q109R G118V S128L P129Q S130A
S188D T213R N248R 2.30 35 S87N Q109R G118V S128L P129Q S130A S188R
T213T N248D 2.25 37 S87N Q109R G118V S128L P129Q S130A S188R T213R
N248R 2.19 17 S87N Q109Q G118V S128L P129Q S130A S188D T213T N248N
2.16 7 S87N Q109Q G118V S128L P129Q S130A S188S T213E N248N 2.14 31
S87N Q109R G118V S128L P129Q S130A S188S T213E N248N 2.02 15 S87N
Q109Q G118V S128L P129Q S130A S188R T213E N248N 2.02 79 S87R Q109R
G118R S128L P129Q S130A S188D T213T N248R 1.95 27 S87N Q109R G118V
S128L P129Q S130A S188S T213T N248D 1.93 30 S87N Q109R G118V S128L
P129Q S130A S188S T213R N248D 1.83 34 S87N Q109R G118V S128L P129Q
S130A S188R T213T N248R 1.81 62 S87R Q109R G118R S128L P129Q S130A
S188D T213E N248R 1.69 16 S87N Q109Q G118V S128L P129Q S130A S188R
T213E N248R 1.63 46 S87N Q109R G118V S128L P129Q S130A S188D T213R
N248D 1.61 67 S87R Q109Q G118R S128L P129Q S130A S188S T213E N248R
1.56 13 S87N Q109Q G118V S128L P129Q S130A S188R T213R N248R 1.55
47 S87N Q109R G118V S128L P129Q S130A S188D T213E N248N 1.52 64
S87R Q109Q G118R S128L P129Q S130A S188D T213E N248R 1.49 4 S87N
Q109Q G118V S128L P129Q S130A S188S T213R N248N 1.48 8 S87N Q109Q
G118V S128L P129Q S130A S188S T213E N248R 1.46 25 S87N Q109R G118V
S128L P129Q S130A S188S T213T N248N 1.39 3 S87N Q109Q G118V S128L
P129Q S130A S188S T213T N248D 1.13 49 S87N Q109Q G118V S128L P129Q
S130A S188S T213E N248D 1.13 69 S87R Q109D G118R S128L P129Q S130A
S188D T213E N248R 1.08 14 S87N Q109Q G118V S128L P129Q S130A S188R
T213R N248D 0.96 28 S87N Q109R G118V S128L P129Q S130A S188S T213R
N248N 0.88 61 S87R Q109D G118R S128L P129Q S130A S188S T213E N248R
0.82
TABLE-US-00019 TABLE 7-4 Protease Variants with PI .gtoreq.0.8 on
C-S38 Microswatch Assay in CALGONIT .RTM. Detergent (WE ADW)
Variant S87 Q109 G118 S128 P129 S130 S188 T213 S248 PI 38 S87N
Q109R G118V S128L P129Q S130A S188R T213R N248D 1.36 1 S87N Q109Q
G118V S128L P129Q S130A S188S T213T N248N 1.30 74 S87N Q109Q G118R
S128L P129Q S130A S188D T213E N248R 1.47 33 S87N Q109R G118V S128L
P129Q S130A S188R T213T N248N 1.75 40 S87N Q109R G118V S128L P129Q
S130A S188R T213E N248R 1.10 75 S87N Q109Q G118D S128L P129Q S130A
S188S T213E N248R 1.47 42 S87N Q109R G118V S128L P129Q S130A S188D
T213T N248R 1.06 12 S87N Q109Q G118V S128L P129Q S130A S188R T213R
N248N 1.18 73 S87N Q109R G118R S128L P129Q S130A S188D T213E N248R
1.13 21 S87N Q109Q G118V S128L P129Q S130A S188D T213R N248R 1.20
66 S87R Q109Q G118R S128L P129Q S130A S188D T213E N248N 1.78 63
S87R Q109R G118V S128L P129Q S130A S188D T213E N248R 1.34 10 S87N
Q109Q G118V S128L P129Q S130A S188R T213T N248R 1.21 80 S87R Q109Q
G118R S128L P129Q S130A S188D T213T N248R 1.37 39 S87N Q109R G118V
S128L P129Q S130A S188R T213E N248N 1.38 45 S87N Q109R G118V S128L
P129Q S130A S188D T213R N248R 0.97 35 S87N Q109R G118V S128L P129Q
S130A S188R T213T N248D 1.19 37 S87N Q109R G118V S128L P129Q S130A
S188R T213R N248R 0.91 81 S87N Q109R G118V S128L P129Q S130A S188R
T213R N248R 1.22 36 S87N Q109R G118V S128L P129Q S130A S188R T213R
N248N 1.03 17 S87N Q109Q G118V S128L P129Q S130A S188D T213T N248N
1.43 7 S87N Q109Q G118V S128L P129Q S130A S188S T213E N248N 1.20 44
S87N Q109R G118V S128L P129Q S130A S188D T213R N248N 1.13 31 S87N
Q109R G118V S128L P129Q S130A S188S T213E N248N 0.81 15 S87N Q109Q
G118V S128L P129Q S130A S188R T213E N248N 1.40 79 S87R Q109R G118R
S128L P129Q S130A S188D T213T N248R 1.17 26 S87N Q109R G118V S128L
P129Q S130A S188S T213T N248R 0.80 27 S87N Q109R G118V S128L P129Q
S130A S188S T213T N248D 1.12 48 S87N Q109R G118V S128L P129Q S130A
S188D T213E N248R 0.99 30 S87N Q109R G118V S128L P129Q S130A S188S
T213R N248D 1.20 34 S87N Q109R G118V S128L P129Q S130A S188R T213T
N248R 1.13 62 S87R Q109R G118R S128L P129Q S130A S188D T213E N248R
0.86 16 S87N Q109Q G118V S128L P129Q S130A S188R T213E N248R 1.22
24 S87N Q109Q G118V S128L P129Q S130A S188D T213E N248R 0.82 46
S87N Q109R G118V S128L P129Q S130A S188D T213R N248D 1.41 43 S87N
Q109R G118V S128L P129Q S130A S188D T213T N248D 0.81 67 S87R Q109Q
G118R S128L P129Q S130A S188S T213E N248R 1.26 13 S87N Q109Q G118V
S128L P129Q S130A S188R T213R N248R 1.12 47 S87N Q109R G118V S128L
P129Q S130A S188D T213E N248N 1.13 64 S87R Q109Q G118R S128L P129Q
S130A S188D T213E N248R 1.09 71 S87R Q109D G118R S128L P129Q S130A
S188D T213E N248N 0.86 2 S87N Q109Q G118V S128L P129Q S130A S188S
T213T N248R 0.99 4 S87N Q109Q G118V S128L P129Q S130A S188S T213R
N248N 0.83 8 S87N Q109Q G118V S128L P129Q S130A S188S T213E N248R
1.16 25 S87N Q109R G118V S128L P129Q S130A S188S T213T N248N 1.43
53 S87N Q109R G118V S128L P129Q S130A S188R T213E N248D 0.92 65
S87R Q109Q G118V S128L P129Q S130A S188D T213E N248R 0.83 49 S87N
Q109Q G118V S128L P129Q S130A S188S T213E N248D 1.05 69 S87R Q109D
G118R S128L P129Q S130A S188D T213E N248R 0.83 22 S87N Q109Q G118V
S128L P129Q S130A S188D T213R N248D 1.17 18 S87N Q109Q G118V S128L
P129Q S130A S188D T213T N248R 1.18 14 S87N Q109Q G118V S128L P129Q
S130A S188R T213R N248D 0.85 50 S87N Q109Q G118V S128L P129Q S130A
S188R T213E N248D 0.91
TABLE-US-00020 TABLE 7-5 Protease Variants with PI .gtoreq.0.8 on
BMI Assay in TIDE .RTM. 2X Coldwater (NA Liquid Laundry) PI GCI- PI
Variant S87 Q109 G118 S128 P129 S130 S188 T213 S248 P036 FNA 75
S87N Q109Q G118D S128L P129Q S130A S188S T213E N248R 1.74 1.16 17
S87N Q109Q G118V S128L P129Q S130A S188D T213T N248N 1.72 1.15 60
S87D Q109D G118R S128L P129Q S130A S188R T213E N248D 1.70 1.13 7
S87N Q109Q G118V S128L P129Q S130A S188S T213E N248N 1.69 1.13 50
S87N Q109Q G118V S128L P129Q S130A S188R T213E N248D 1.69 1.13 23
S87N Q109Q G118V S128L P129Q S130A S188D T213E N248N 1.59 1.06 43
S87N Q109R G118V S128L P129Q S130A S188D T213T N248D 1.58 1.06 3
S87N Q109Q G118V S128L P129Q S130A S188S T213T N248D 1.57 1.05 49
S87N Q109Q G118V S128L P129Q S130A S188S T213E N248D 1.54 1.03 22
S87N Q109Q G118V S128L P129Q S130A S188D T213R N248D 1.54 1.03 19
S87N Q109Q G118V S128L P129Q S130A S188D T213T N248D 1.53 1.02 71
S87R Q109D G118R S128L P129Q S130A S188D T213E N248N 1.52 1.02 1
S87N Q109Q G118V S128L P129Q S130A S188S T213T N248N 1.46 0.98 59
S87D Q109Q G118D S128L P129Q S130A S188S T213E N248D 1.45 0.97 52
S87N Q109R G118V S128L P129Q S130A S188S T213E N248D 1.41 0.94 51
S87N Q109Q G118V S128L P129Q S130A S188D T213E N248D 1.38 0.92 69
S87R Q109D G118R S128L P129Q S130A S188D T213E N248R 1.34 0.90 18
S87N Q109Q G118V S128L P129Q S130A S188D T213T N248R 1.34 0.89 15
S87N Q109Q G118V S128L P129Q S130A S188R T213E N248N 1.33 0.89 47
S87N Q109R G118V S128L P129Q S130A S188D T213E N248N 1.32 0.88 8
S87N Q109Q G118V S128L P129Q S130A S188S T213E N248R 1.31 0.88 27
S87N Q109R G118V S128L P129Q S130A S188S T213T N248D 1.30 0.87 24
S87N Q109Q G118V S128L P129Q S130A S188D T213E N248R 1.29 0.86 66
S87R Q109Q G118R S128L P129Q S130A S188D T213E N248N 1.26 0.84 54
S87N Q109R G118V S128L P129Q S130A S188D T213E N248D 1.25 0.84 31
S87N Q109R G118V S128L P129Q S130A S188S T213E N248N 1.22 0.82 46
S87N Q109R G118V S128L P129Q S130A S188D T213R N248D 1.21 0.81 25
S87N Q109R G118V S128L P129Q S130A S188S T213T N248N 1.19 0.80 65
S87R Q109Q G118V S128L P129Q S130A S188D T213E N248R 1.18 0.79 61
S87R Q109D G118R S128L P129Q S130A S188S T213E N248R 1.15 0.77 11
S87N Q109Q G118V S128L P129Q S130A S188R T213T N248D 1.13 0.75 2
S87N Q109Q G118V S128L P129Q S130A S188S T213T N248R 1.08 0.72 6
S87N Q109Q G118V S128L P129Q S130A S188S T213R N248D 1.08 0.72 21
S87N Q109Q G118V S128L P129Q S130A S188D T213R N248R 1.08 0.72 4
S87N Q109Q G118V S128L P129Q S130A S188S T213R N248N 1.05 0.70 48
S87N Q109R G118V S128L P129Q S130A S188D T213E N248R 1.05 0.70 42
S87N Q109R G118V S128L P129Q S130A S188D T213T N248R 1.04 0.70 35
S87N Q109R G118V S128L P129Q S130A S188R T213T N248D 1.02 0.68 32
S87N Q109R G118V S128L P129Q S130A S188S T213E N248R 1.02 0.68 78
S87R Q109D G118R S128L P129Q S130A S188D T213T N248R 1.01 0.68 44
S87N Q109R G118V S128L P129Q S130A S188D T213R N248N 1.00 0.67 53
S87N Q109R G118V S128L P129Q S130A S188R T213E N248D 0.97 0.65 12
S87N Q109Q G118V S128L P129Q S130A S188R T213R N248N 0.93 0.62 16
S87N Q109Q G118V S128L P129Q S130A S188R T213E N248R 0.85 0.57 67
S87R Q109Q G118R S128L P129Q S130A S188S T213E N248R 0.85 0.57 39
S87N Q109R G118V S128L P129Q S130A S188R T213E N248N 0.83 0.55 14
S87N Q109Q G118V S128L P129Q S130A S188R T213R N248D 0.82 0.55 10
S87N Q109Q G118V S128L P129Q S130A S188R T213T N248R 0.81 0.54 64
S87R Q109Q G118R S128L P129Q S130A S188D T213E N248R 0.81 0.54 26
S87N Q109R G118V S128L P129Q S130A S188S T213T N248R 0.80 0.53
Evaluation of Stain Removal by Multiple Mutation Library (MML)
Variants of GCI-P036
[0299] Variants of GCI-P036 were tested for their stain removal
performance in cleaning applications. Cloning of the combinatorial
library was performed by Sloning BioTechnology using the Slonomax
Technology. Preparation of variant protease samples was performed
as previously described. Briefly, MML variants were tested in
blood, milk, ink (BMI) microswatch CS-38 microswatch assays, using
the methods of Example 1. As described throughout, functionality of
protease variants was quantified as a performance index (PI), which
is the ratio of performance of a variant to that of a reference
protease. The substitutions are listed relative to the GCI-P036
reference protease using BPN' numbering and the PI is determined in
relationship to the GCI-P036 reference. Results are shown in Tables
7-6 and 7-7.
TABLE-US-00021 TABLE 7-6 Multiple Mutation Variants of GCI-P036
Having a PI .gtoreq. 0.5 in BMI Assay (pH 8; 32.degree. C.) PI
G097P/N185Q/A215I 0.76 N018R/N185R/S256W 0.62 N018Q/N185R/A215R
0.75 N018Q/N185Q/Y209W/S256W 0.91 N018K/G097P/N185K/S256W 0.51
N185K/Y209W/S256W 1.15 N018Q/N185K/Y209W/A215V/S256W 0.84
N018R/N185Q/A215V/S256W 0.80 N018R/G097P/Y209W/S256W 0.62
N018R/N185R/Y209W/S256W 0.55 N185Q/A215R/S256W 0.80 N018K/A215R
0.86 N018K/G097P/Y209W/A215V/S256W 0.59 N018K/N185R/A215V 0.68
N018K/N185K/Y209W/A215R 0.53 N185K/A215V 1.00 N018K/N185K 0.83
N018R/N185R/A215R 0.58 N018K/G097P/N185K/Y209W/A215I/S256W 0.53
G097P/Y209W/A215V/S256W 0.67 N018K/N185K/S256W 0.86
N018R/Y209W/S256W 0.74 N018Q/N185K/S256W 0.83
N018K/N185Q/A215V/S256W 1.10 N018K/S256W 0.75
N018R/Y209W/A215V/S256W 0.66 N018Q/G097P/N185K/Y209W 0.92
N018R/G097P/Y209W/A215V 0.66 N185R/S256W 0.85
N018K/G097P/N185Q/Y209W/A215V/S256W 0.62 N018K/N185R/A215I/S256W
0.60 N185R/Y209W/A215I 0.83 N018R/N185K/S256W 0.54
N018K/N185Q/A215R/S256W 0.63 N018K/N185K/A215V/S256W 0.64
N018Q/N185R/S256W 0.89 N018K/A215I 1.94 N018Q/N185Q/A215V 1.19
N018R/N185Q/Y209W/S256W 0.83 N185R/Y209W/S256W 0.85
N018K/N185Q/Y209W/S256W 0.63 N018Q/N185K/Y209W/A215V 0.79
N018K/A215V 1.07 N018Q/N185Q/S256W 1.01 N018K/N185Q/S256W 1.17
N018R/N185K/A215V/S256W 0.66 N018Q/N185K 0.71
N018K/G097P/N185R/Y209W 0.76 N018K/N185R/Y209W/A215V/S256W 0.51
N018Q/N185K/Y209W/A215I/S256W 0.76 N018R/G097P/N185Q/A215I 0.60
N018Q/G097P/N185K/A215V 0.82 N185Q/S256W 0.90
N018K/G097P/N185R/Y209W/S256W 0.52 N043V/S101T/N248K 1.08
N043S/N117Y/N248K 1.29 N043E/S101E 1.59 N043S/S101E/N117Y/N248K
1.31 S101R/N248K 0.83 N043E/S101V 2.16 N043S/S101Y/N117I 1.32
N043I/N117Y 1.29 N043S/S101F 1.07 S101E/N117Y/N248K 1.37
S101Y/N117Y 1.19 N043V/S101V/N248K 1.08 N043I/S101R/N248K 1.14
N043F/N117I 1.21 S101F/N248K 1.05 N043S/S101Y/N248K 1.10
N043S/N248I 1.78 N043I/S101E/N248I 1.79 N043V/S101R/N117I/N248K
0.76 N043V/S101F/N248K 0.99 S101T/N248I 1.53
N043E/S101Y/N117Y/N248K 1.23 N043V/S101Y/N117I 1.27
N043V/S101V/N117I 1.56 S101Y/N248K 1.06 N043S/S101R/N117I/N248K
0.85 N043V/N248I 2.00 N043V/S101F/N117Y 1.29 N043E/S101F 1.36
N043S/S101N/N117I 1.41 S101V/N248K 1.33 N043I/S101N/N117Y/N248K
1.19 S101F/N117I/N248I 2.01 S101F/N117Y/N248K 0.82
N043I/S101F/N117Y/N248K 1.25 N043S/S101F/N248K 1.16
N043E/S101N/N117Y 1.53 S101T/N117Y/N248K 0.97 N043S/S101E/N248K
1.46 S101R/N117I/N248K 0.65 N043E/S101Y/N117I/N248K 1.21
N043S/S101Y 1.97 N043E/S101E/N248K 1.39 N043V/S101Y 1.26
S101F/N117Y/N248I 1.21 N043S/S101E/N117I/N248I 2.68 N043F/S101R
1.14 N043V/S101E/N248I 1.54 N043V/N248K 1.23 S101E/N117I 1.84
N043V/S101Y/N117I/N248K 1.01 N043S/S101E 1.50 S101R/N117Y 1.62
N043I/S101Y/N117Y/N248K 0.89 N043V/S101F 1.09 N043S/S101Y/N117Y
1.27 S101Y/N117I/N248K 0.82 P052I/S144Y/N185R/Y209W 1.01
P052V/S144T 1.56 P052V/M119F/S144T/N185R/S256T 1.62
S144Y/Y209W/S256I 1.15 P052I/S144Y/Y209W/S256I 1.36 S144T/N185V
1.33 S144V/N185R/Y209W/S256T 0.93 M119F/Y209W 0.78
M119F/N185V/Y209W 1.19 M119F/N185R 0.79 S144V/Y209W 1.21
P052I/S144T/N185R/Y209W/S256T 1.20 P052I/N185V/Y209W 1.34
P052V/S144V/N185R/Y209W/S256T 1.13 S144W/S256I 1.30
S144V/N185R/Y209W 0.98 P052V/S144W/Y209W 1.50
P052V/M119F/S144T/Y209W 1.73 P052V/S144T/Y209W/S256I 1.58
P052V/S144Y/Y209W 1.36 P052I/S144T/Y209W/S256T 1.60
P052I/N185R/Y209W/S256I 1.07 P052V/S144W/N185R 1.47
P052V/M119F/S144T/N185R/Y209W 1.05 P052V/N185V/Y209W/S256I 1.54
P052I/S144Y/N185V/S256T 1.63 S144V/N185R/S256I 0.75 S144T/N185R
1.02 P052I/S144Y/N185V 1.75 P052V/M119F/S144T 2.01
M119F/N185R/Y209W/S256T 0.84 P052I/S144T/N185V/Y209W/S256T 1.47
M119F/Y209W/S256I 1.26 S144W/N185R/Y209W/S256T 0.81
P052V/S144V/N185V/Y209W 1.37 P052I/M119F 1.52
M119F/S144W/N185R/S256L 0.94 P052V/S144W/N185V/Y209W 1.47
N185V/Y209W 0.99 P052I/M119F/S144V/Y209W 1.91 P052I/S144V/Y209W
1.25 P052I/M119F/S144T/N185R/Y209W 1.52 S144W/N185V/Y209W/S256I
1.22 M119F/S144T/N185V/S256I 1.18 P052I/M119F/Y209W/S256I 2.11
P052I/N185V/Y209W/S256I 1.60 S144T/N185R/Y209W/S256I 0.82
P052V/M119F/N185V/Y209W/S256I 1.93 P052I/S144T 1.44
S144T/N185R/Y209W/S256T 0.83 S144V/S256I 1.27 P052I/S144T/S256I
1.46 P052V/S144T/N185V/Y209W/S256T 1.47 P052V/S144Y/S256T 1.68
P052I/S144T/Y209W/S256I 1.01 P052V/S256T 1.48
P052V/S144V/Y209W/S256I 1.63 P052V/S144T/N185V/Y209W/S256I 1.62
A001K/R045K/I072V/L126F/S164Q 0.81 A001K/L126F/S164Q 1.11
A001K/R045F/V104I/L126F/S164Q 0.86 A001K/I072V/V104I 0.92
A001K/R045K/I072V/S164F 0.95 A001K/L126F 0.93
A001K/R045F/I072V/V104G/S164T 1.06 R045L/I072S/S164I 1.15
L126A/S164N 0.96 A001K/L126F/S164F 0.82 R045K/L126F/S164F 0.73
A001K/R045K/I072V/V104I/L126F/S164F 0.66
A001K/I072C/V104I/L126F/S164Q 0.73 A001K/I072V/V104I/S164F 0.83
A001K/V104I/L126F/S164I 0.85 A001K/R045K/L126F 1.17
A001K/R045F/L126F/S164I 0.70 A001K/R045K/L126F/S164I 0.77
A001L/I072C 0.80 A001K/R045K/I072V/S164Q 0.92
A001K/I072C/L126F/S164Q 0.78 A001K/V104E 0.91 A001K/I072C/L126F
0.95 L126F/S164V 0.98 R045F/I072V/L126F/S164Q 1.22
A001K/R045S/V104C/L126Y/S164F 0.72 A001K/R045F/I072V/L126F/S164I
0.76 A001K/V104I/L126F/S164Q 0.76 A001K/R045K/V104I/S164Q 0.81
A001K/R045K/I072V/L126F 0.73 A001K/R045K/I072V/V104I/L126F/S164I
1.48 A001K/R045K/V104L/S164A 1.02 A001K/R045F/L126F/S164F 0.82
A001K/I072V/V104I/S164Q 0.87 A001K/I072V/L126F 1.08
A001K/I072V/L126F/S164F 0.87 V104E/L126I/S164L 1.13
A001K/R045K/L126F/S164Q 0.73 A001K/I072V 0.91
A001K/I072V/V104I/L126F/S164I 1.00 A001K/V104I/L126F 0.78
A001K/R045K/I072V/V104I/L126F/S164Q 0.86
A001K/R045K/I072V/L126F/S164F 0.84 A001K/R045F/I072V/L126F/S164Q
0.73 A001K/R045K/I072C/L126F/S164Q 0.79 A001K/R045K/S164F 1.55
A001K/R045F/I072C/V104I/S164F 1.42 A001K/R045F/I072C 1.22
A001K/S164Q 1.01 A001K/R045K/L126F/S164P 0.80
A001K/I072C/V104I/L126F 0.71 A001K/L126F/S164I 0.71
S024W/Q109V/G118S/S132Y 0.59 S024W/Q109K/G118R 0.80 S024H/Q109L
0.60 S024V/Q109R/G118F 0.90 S024R/Q109V 0.69 Q109T/G118N 1.08
S024W/Q109I 0.94 S024V/Q109C/G118L 1.10 S024R/Q109T/S132Y 0.58
S024H/Q109T/G118R 0.67 S024R/G118R/S132N 1.03 Q109I/S132N 0.71
Q109I/G118S 1.07 S024C/Q109K/G118I 0.65 S024W/Q109L 0.95
S024W/Q109T/G118L 0.69 Q109A/G118S 1.00 S024R/S132Y 0.69
Q109V/G118F 1.23 Q109P/G118Q 0.57 S024V/Q109R/G118F 1.00
S024R/Q109V 0.94 Q109T/G118N 0.85
S024W/Q109I 1.53 S024V/Q109C/G118L 0.96 S024H/Q109T/G118R 0.86
S024R/Q109V/S132N 1.23 Q109I/S132N 0.95 Q109I/G118S 0.99
S024C/Q109K/G118I 0.80 S024W/Q109L 1.04 Q109I/G118R 1.10
S024W/Q109T/G118L 1.02 Q109A/G118S 0.96 Q109V/G118F 0.83
Q109P/G118Q 0.82 S024W/Q109T/G118R/G127Q/S132N 0.89
S024W/Q109V/G127T/S132Y 0.86 S024H/G127R 0.66
S024R/Q109R/G118T/G127R 0.50 S024V/Q109L/G118V 1.17
S024W/Q109T/G118T/G127T 0.93 S024W/G127R 1.20 Q109S/G118R 1.10
Q109L/G118L/G127Q/S132N 0.96 S024N/Q109T/G127R/S132N 0.72
S024H/G118L/G127T/S132Y 0.71 S024R/Q109V/G127S 1.08 Q109H/G127R
1.09 S024N/Q109T/G127T/S132R 0.74 Q109I/G127T/S132Y 0.88
S024R/G118H/S132V 1.15 S024R/Q109T/G127R/S132N 0.64 S024N/G127R
0.68 Q109D/G118V/G127H 1.17 S024W/G118L/G127T/S132Y 0.75
S024R/Q109I/G127T 0.95 S024R/Q109T/G127T/S132Y 0.69
S024R/Q109K/G118T/G127Q/S132N 0.62 S024W/Q109L/G127R/S132N 0.70
S024W/Q109T/G127R/S132R 0.51 S024L/Q109K/G127R/S132Y 0.51
S024L/Q109T/G118V/G127Q/S132R 0.51 S024W/Q109V/G127T 0.98
S024N/Q109V/G127R/S132N 0.71 S024N/Q109V/G118L/G127Q 0.87
S024N/S132R 0.83 Q109K/G118F/G127Q/S132N 0.75
S024R/Q109T/G127R/S132Y 1.00 Q109V/G127R 1.02 S024H/Q109V/G127T
0.89 S024A/Q109Y/G118C 0.63 S024H/Q109V/G127R/S132N 0.80
S024T/Q109I/G127T 0.85 S024N/Q109T/G127T/S132Y 0.69
S024R/G118L/G127R/S132R 1.38 S024A/G118I 1.13 G118L/G127R/S132L
0.93 Q109V/G127R/S132N 0.84 S024N/Q109V/G118R/G127T/S132Y 0.72
S024W/Q109I/G127T 0.94 S024R/Q109V/G118R/G127T 0.76 Q109R/G118V
0.54 Q109I/G127C 0.64 Q109V/G127R/S132Y 0.87
S024W/Q109R/G127T/S132N 0.65 S024L/Q109V/G118R/G127Q 0.80
Q109V/G127Q 0.93 S024Q/Q109R/S132R 0.63 S024H/G118K/G127I 0.55
S024R/Q109V/G118C/S132A 1.23 A001K/S024R/R045N/A172C 0.71
A001R/S024H/R045N/I107T/A172Q 0.67 R045F/I107T 0.64
R045V/I107R/A172D 1.10 A001R/A172Q 1.10 S024T/R045K/I107V 0.68
S024T/I107T 0.56 A001T/S024H/I107L/A172Y 0.72
A001R/S024W/R045K/I107T/A172Q 0.55 S024N/R045K/A172L 0.93
A001R/R045N/I107T 0.64 A001K/R045F/I107T 0.72 S024N/I107T 0.56
A001R/R045K/A172Q 0.92 R045K/I107T 0.53 A001K/S024L/R045A 0.68
A001R/R045F 0.91 I107Q/A172D 0.70 A001R/S024R/A172Q 0.75
A001K/A172L 0.62 A001S/A172V 0.55 A001I/R045T/I107R/A172T 0.61
A001R/S024H/R045K/I107T 0.51 S024W/A172Q 0.94 S024W/R045N/A172Q
1.00 R045N/I107T/A172Q 0.61 A001R/S024R 0.59 A001K/A172W 0.78
A001R/S024N 0.74 A001R/S024R/A172H 0.74 R045S/I107L 0.66
A001R/S024T/R045N/I107T/A172Q 0.52 A001Q/R045K/I107T 0.60
S024N/R045K/I107V/A172N 0.63 A001R/S024T/I107T/A172Q 0.63
A001K/S024N/R045K/A172Y 0.80 S024R/R045F/I107T/A172Q 0.62
R045N/I107V/A172Q 0.50 A001R/I107V/A172Q 1.13
A001K/R045F/I107L/A172N 0.71 A001P/A172V 0.68
S024I/I107R/G127I/A172R 0.64 A001K/S024T/I107T/G127Q/A172Q 0.53
A001C/S024V/I107L 0.50 A001R/S024T/R045K/A172Q 0.84 A001R/A172G
0.62 A001R/R045N/A172K 0.54 A001K/R045F/I107T 0.51
A001K/S024T/R045N/G127Q/A172Q 0.60 A001K/R045K/I107A/A172T 0.62
A001K/R045K/I107R/G127A/A172N 0.79 R045N/I107A/A172R 0.62
A001R/S024W/I107V/A172S 0.56 A001R/R045N/A172Q 0.84
S024T/R045K/I107T/G127R/A172Q 0.52 A001K/R045N/I107T/G127Q 0.53
A001K/S024H/I107V 0.58 I107A/G127K/A172G 0.55 A001R/S024W/R045K
0.87 A001R/R045N/I107V/A172V 0.60
A001K/S024H/R045N/I107T/G127Q/A172Q 0.56 S024Y/G127R/A172E 0.67
S024W/S099Q 0.93 S024W/S099T/S103P/G118T/S132N 0.76
S099Q/S103N/S132H 1.04 S099K/G118R 0.57 S024W/S099T/S103P 1.14
S024W/S103K/S132R 0.97 S024W/S103P 0.83 S099T/G118T/S132N 1.61
S024W/S099T/S103P/G118R 0.82 S024H/S099Q/S103P 1.08
S024H/S099K/S103R/G118A/S132P 1.29 S024H/S099T/S103P/G118R/S132H
1.44 S024W/G118K 0.74 S024H/S099T/S103N/S132N 1.11
S099K/S103P/S132H 0.81 S099Q/S103N/G118R/S132N 0.87
S024W/S099T/S103N 1.03 S024P/S099Q/S103P/G118R 1.18
S099T/G118T/S132H 1.86 S024W/S099Q/S103N/G118T 1.01 S024W/S132H
1.34 S103L/S132E 1.14 S103R/S132P 0.92 S099Q/S103P/G118R 0.83
S099Q/S103N/G118T 1.21 S024H/S099Q/S132N 1.09
S024W/S099T/G118T/S132H 1.39 S099K/S103N/G118T 0.95
S024H/S099Q/S103P/S132H 1.23 S024H/S132R 0.88
S024W/S099T/S103N/S132N 1.12 S024T/G118D 0.89 S099N/S132R 0.88
S099H/S103I/G118N 1.03 S024W/S099Q/S103N/G118R/S132N 0.97
S024W/S099T/S103P/G118R/S132H 1.20 S024W/S099Q/G118T 0.94
S024W/S099T/G118R/S132R 0.78 S024H/S099Q/S132H 0.88 S099Q/S132R
0.81 S099Q/S103P/G118R/S132N 1.26 S024M/G118V 0.72 S024W/S132N 0.88
S099K/S103R/G118A/S132P 0.85 S024W/S099T/S103P/S132H 1.41
S024W/S099T/S103N/S132H 0.91
S087N/G118V/S128L/P129Q/S130A/S024R/Q109K 0.86
S087N/G118V/S128L/P129Q/S130A/S024W/Q109V 1.02
S087N/G118V/S128L/P129Q/S130A/S024W/Q109T 1.04
S087N/G118V/S128L/P129Q/S130A/S024W/Q109L 0.58
S087N/G118V/S128L/P129Q/S130A/S024H/Q109V 1.04
S087N/G118V/S128L/P129Q/S130A/S024W/Q109R/G127Q 0.81
S087N/G118V/S128L/P129Q/S130A/S024R 0.70
S087N/G118V/S128L/P129Q/S130A/S024H 0.99
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L 0.97
S087N/G118V/S128L/P129Q/S130A/Q109T 1.06
S087N/G118V/S128L/P129Q/S130A/S024R/Q109V 0.75
S087N/G118V/S128L/P129Q/S130A/S024W/Q109I 0.86
S087N/G118V/S128L/P129Q/S130A/Q109V 1.09
S087N/G118V/S128L/P129Q/S130A/S024R/G127R 0.56
S087N/G118V/S128L/P129Q/S130A/S024W 1.07
S087N/G118V/S128L/P129Q/S130A/Q109T/G127Q 0.80
S087N/G118V/S128L/P129Q/S130A/S024T/G127T 0.84
S087N/G118V/S128L/P129Q/S130A/G127T 0.84
S087N/G118V/S128L/P129Q/S130A/Q109I 1.10
S087N/G118V/S128L/P129Q/S130A/S024T 0.87
S087N/G118V/S128L/P129Q/S130A/S024T/Q109V/G127T 0.90
S087N/G118V/S128L/P129Q/S130A/S024H/Q109V/G127Q 0.67
S087N/G118V/S128L/P129Q/S130A/S024N/Q109K 0.83
S087N/G118V/S128L/P129Q/S130A/G127Q 0.85
S087N/G118V/S128L/P129Q/S130A/S024N/Q109T/G127T 0.93
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L/G127Q 0.73
S087N/G118V/S128L/P129Q/S130A/Q109L/G127Q 0.99
S087N/G118V/S128L/P129Q/S130A/R045S 0.67
S087N/G118V/S128L/P129Q/S130A/S024R/I107T/A172Q 0.70
S087N/G118V/S128L/P129Q/S130A/A001K/S024W/R045N/I107T 0.64
S087N/G118V/S128L/P129Q/S130A/S024N/I107V 0.78
S087N/G118V/S128L/P129Q/S130A/A001R/R045K/I107T 0.65
S087N/G118V/S128L/P129Q/S130A/S024H/I107V/A172S 0.81
S087N/G118V/S128L/P129Q/S130A/A001K/I107W/A172P 0.69
S087N/G118V/S128L/P129Q/S130A/A001R 0.82
S087N/G118V/S128L/P129Q/S130A/A001K/I107T/A172Q 0.63
S087N/G118V/S128L/P129Q/S130A/A001K/R045N/I107V 0.80
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/A172Q 0.93
S087N/G118V/S128L/P129Q/S130A/A001R/S024W/A172W 0.68
S087N/G118V/S128L/P129Q/S130A/A172N 0.69
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172Q 0.68
S087N/G118V/S128L/P129Q/S130A/S024T/I107T/A172Q 0.78
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/I107V 0.77
S087N/G118V/S128L/P129Q/S130A/S024W/I107T 0.85
S087N/G118V/S128L/P129Q/S130A/A001R/R045K 1.02
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172W 0.67
S087N/G118V/S128L/P129Q/S130A/A001K/R045K/I107S 0.75
S087N/G118V/S128L/P129Q/S130A/S024T/R045N/I107V/A172S 0.82
S087N/G118V/S128L/P129Q/S130A/S024N/I107N 0.67
S087N/G118V/S128L/P129Q/S130A/S024H/R045N/I107T 0.95
S087N/G118V/S128L/P129Q/S130A/A001K/S024T/I107V/A172W 0.69
S087N/G118V/S128L/P129Q/S130A/R045N/I107V/A172P 0.78
S087N/G118V/S128L/P129Q/S130A/R045F/I107T/A172Q 0.91
S087N/G118V/S128L/P129Q/S130A/A001K/R045F 0.73
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045P/I107T 0.65
S087N/G118V/S128L/P129Q/S130A/A001K/R045N/I107T/A172Q 0.88
S087N/G118V/S128L/P129Q/S130A/A001R/S024R/R045K/I107G/A172L 0.63
S087N/G118V/S128L/P129Q/S130A/S024R/I107V/A172S 0.78
S087N/G118V/S128L/P129Q/S130A/A001R/S024N/I107T 0.63
S087N/G118V/S128L/P129Q/S130A/A001R/S024T/R045N/I107T 0.74
S087N/G118V/S128L/P129Q/S130A/A001R/A172I 0.61
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/A172N 0.72
S087N/G118V/S128L/P129Q/S130A/S024R/R045F/I107T 0.82
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172P 0.72
S087N/G118V/S128L/P129Q/S130A/S024T 1.03
S087N/G118V/S128L/P129Q/S130A/A001R/R045N/I107T/A172Q 0.70
S087N/G118V/S128L/P129Q/S130A/R045N/A172Q 1.06
S087N/G118V/S128L/P129Q/S130A/S024W/R045F/I107V/A172Q 0.83
S087N/G118V/S128L/P129Q/S130A/A001R/A172Q 0.79
S087N/G118V/S128L/P129Q/S130A/S024N/I107T 0.57
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/I107T/A172Q 0.54
S087N/G118V/S128L/P129Q/S130A/S024W/S099K 1.07
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N/G127R/S132N 0.51
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S103P 1.32
S087N/G118V/S128L/P129Q/S130A/S099T/S103N/S132H 0.70
S087N/G118V/S128L/P129Q/S130A/S099Q/S103N 1.06
S087N/G118V/S128L/P129Q/S130A/S099Q 0.96
S087N/G118V/S128L/P129Q/S130A/S024W 1.20
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N/S132N 1.77
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S132N 1.28
S087N/G118V/S128L/P129Q/S130A/S024W/S099T 0.99
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N 0.96
S087N/G118V/S128L/P129Q/S130A/S103N/S132H 1.52
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/G127R/S132H 0.65
S087N/G118V/S128L/P129Q/S130A/S099K/S103N 0.95
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S132N 1.70
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103P 1.36
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q 0.98
S087N/G118V/S128L/P129Q/S130A/S103P 1.25
S087N/G118V/S128L/P129Q/S130A/S099K/S132H 1.17
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S103P 1.36
S087N/G118V/S128L/P129Q/S130A/S024H/S103P/S132N 0.98
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P/S132N 0.87
S087N/G118V/S128L/P129Q/S130A/S099T/S132H 1.09
S087N/G118V/S128L/P129Q/S130A/S024L/S099K/S103P/S132N 0.98
S087N/G118V/S128L/P129Q/S130A/S099T/S103N 1.49
S087N/G118V/S128L/P129Q/S130A/S099K/S103P 1.25
S087N/G118V/S128L/P129Q/S130A/S024W/G127T 0.93
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S132N 1.73
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P 1.41
S087N/G118V/S128L/P129Q/S130A/S099Q/S132H 1.43
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132H 1.29
S087N/G118V/S128L/P129Q/S130A/S099K 0.92
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q 0.97
S087N/G118V/S128L/P129Q/S130A/S099T/S103P 1.20
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N 0.99
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132N 1.41
S087N/G118V/S128L/P129Q/S130A/S099Q/S103P 0.85
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N/S132N 1.32
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103N/S132N 1.53
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S132H 0.99
S087N/G118V/S128L/P129Q/S130A/N018K/N185K 0.82
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/A215R 0.75
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W 0.83
S087N/G118V/S128L/P129Q/S130A/N018R/N185K 0.68
S087N/G118V/S128L/P129Q/S130A/N018K 1.03
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185Q/A215I/S256W 0.83
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/S256W 0.91
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/Y209W/S256W 0.85
S087N/G118V/S128L/P129Q/S130A/N018Q/N185R/A215R/S256P 1.03
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W/A215I/S256W 0.71
S087N/G118V/S128L/P129Q/S130A/Y209W/S256W 0.86
S087N/G118V/S128L/P129Q/S130A/N018R/S256W 0.89
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/A215I/S256W 0.73
S087N/G118V/S128L/P129Q/S130A/N018K/N185R 0.82
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/S256W 0.76
S087N/G118V/S128L/P129Q/S130A/N018Q/Y209W/S256W 0.87
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/A215V/S256R 0.81
S087N/G118V/S128L/P129Q/S130A/N185K/A215V/S256W 0.97
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W 0.82
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/S256W 0.80
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/S256W 0.73
S087N/G118V/S128L/P129Q/S130A/N018K/A215R/S256W 0.57
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/A215R 0.68
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/Y209W/S256W 0.68
S087N/G118V/S128L/P129Q/S130A/N018Q/A215R/S256W 0.76
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/Y209W 0.70
S087N/G118V/S128L/P129Q/S130A/A215V/S256W 1.00
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V/S256W 0.85
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/A215R 0.82
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V 0.89
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215V/S256W 0.63
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/A215V/S256W 0.74
S087N/G118V/S128L/P129Q/S130A/G097P/N185R/A215I/S256W 0.83
S087N/G118V/S128L/P129Q/S130A/N018R 0.92
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W/A215I 0.91
S087N/G118V/S128L/P129Q/S130A/N018Q/A215I/S256W 0.90
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q 0.77
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215I/S256W 0.71
S087N/G118V/S128L/P129Q/S130A/G097P/N185Q/Y209W/A215V/S256W 0.82
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215R 0.62
S087N/G118V/S128L/P129Q/S130A/Y209W/A215I/S256W 0.98
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215V/S256W 0.72
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215R 0.88
S087N/G118V/S128L/P129Q/S130A/N018Q/G097P/N185R 1.01
S087N/G118V/S128L/P129Q/S130A/N185R/A215V/S256W 0.83
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W 0.63
S087N/G118V/S128L/P129Q/S130A/A215V 1.20
S087N/G118V/S128L/P129Q/S130A/N018R/N185Q/A215I/S256W 0.88
S087N/G118V/S128L/P129Q/S130A/G097P/N185K/A215I 0.87
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215R 0.84
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W/A215V 0.84
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W 0.76
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/Y209W/A215I/S256W
0.67 S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215V 0.88
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/S256L 0.80
S087N/G118V/S128L/P129Q/S130A/N018K/S256W 0.72
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/S256W 0.84
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215V/S256W 0.77
S087N/G118V/S128L/P129Q/S130A/P052I/N248K 1.07
S087N/G118V/S128L/P129Q/S130A/N043W/S101F/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101Y 1.33
S087N/G118V/S128L/P129Q/S130A/N043V/S101T 1.08
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F/N248K 1.53
S087N/G118V/S128L/P129Q/S130A/P052V 1.20
S087N/G118V/S128L/P129Q/S130A/N043S 1.37
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y 1.04
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101R 1.18
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101F 1.30
S087N/G118V/S128L/P129Q/S130A/N043F/P052V/S101T/N248K 1.12
S087N/G118V/S128L/P129Q/S130A/N043I/S101E/N248K 1.13
S087N/G118V/S128L/P129Q/S130A/S101E/N248K 1.08
S087N/G118V/S128L/P129Q/S130A/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/N043W/S101E 1.09
S087N/G118V/S128L/P129Q/S130A/N043S/S101E/N248K 1.29
S087N/G118V/S128L/P129Q/S130A/P052I/S101V/N248K 0.99
S087N/G118V/S128L/P129Q/S130A/S101F/N248K 0.72
S087N/G118V/S128L/P129Q/S130A/N043V/S101T/N248K 1.00
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/N248K 1.52
S087N/G118V/S128L/P129Q/S130A/N043S/S101N/N248I 1.64
S087N/G118V/S128L/P129Q/S130A/S101Y 0.86
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101Y/N248K 1.28
S087N/G118V/S128L/P129Q/S130A/N043I/S101N 1.19
S087N/G118V/S128L/P129Q/S130A/N043E/P052V/S101E/N248K 1.72
S087N/G118V/S128L/P129Q/S130A/N043V/P052I 1.40
S087N/G118V/S128L/P129Q/S130A/P052I/S101F/N248K 1.20
S087N/G118V/S128L/P129Q/S130A/P052V/S101E/N248I 1.59
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101E/N248K 1.69
S087N/G118V/S128L/P129Q/S130A/N043E 0.99
S087N/G118V/S128L/P129Q/S130A/N043S/S101T 1.07
S087N/G118V/S128L/P129Q/S130A/N043V/S101F 1.09
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101T/N248K 1.67
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y/N248I 1.34
S087N/G118V/S128L/P129Q/S130A/N043E/S101R 0.92
S087N/G118V/S128L/P129Q/S130A/N043S/P052I/N248K 1.39
S087N/G118V/S128L/P129Q/S130A/N043E/S101Y 1.16
S087N/G118V/S128L/P129Q/S130A/N043E/S101E 1.30
S087N/G118V/S128L/P129Q/S130A/N043I/P052I/S101F/N248K 1.58
S087N/G118V/S128L/P129Q/S130A/N043T/N248K 0.98
S087N/G118V/S128L/P129Q/S130A/N043T/P052I/S101Y 1.38
S087N/G118V/S128L/P129Q/S130A/P052V/S101R 0.90
S087N/G118V/S128L/P129Q/S130A/N043I/P052V/S101F/N248K 1.38
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y/N248K 1.48
S087N/G118V/S128L/P129Q/S130A/P052I/S101E/N248K 1.42
S087N/G118V/S128L/P129Q/S130A/S101N/N248K 1.00
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248K 1.31
S087N/G118V/S128L/P129Q/S130A/N043V/S101R 0.94
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F 1.35
S087N/G118V/S128L/P129Q/S130A/S101E 0.70
S087N/G118V/S128L/P129Q/S130A/N043F/S101Y/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/N043S/P052V 1.19
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y 1.39
S087N/G118V/S128L/P129Q/S130A/N043S/P052I 1.55
S087N/G118V/S128L/P129Q/S130A/N043T/S101E/N248I 1.99
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248I 2.15
S087N/G118V/S128L/P129Q/S130A/N043V/S101R/N248I 1.32
S087N/G118V/S128L/P129Q/S130A/N248I 1.37
S087N/G118V/S128L/P129Q/S130A/N043E/P052I/S101Y/N248K 1.79
S087N/G118V/S128L/P129Q/S130A/S101R/N248K 0.69
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/N248K 1.41
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y 1.01
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y/N248K 1.00
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101V/N248K 1.22
S087N/G118V/S128L/P129Q/S130A/N043T 1.09
S087N/G118V/S128L/P129Q/S130A/N043T/P052V/S101Y/N248K 1.20
S087N/G118V/S128L/P129Q/S130A/P052V/S144T 1.24
S087N/G118V/S128L/P129Q/S130A/Y209W 1.02
S087N/G118V/S128L/P129Q/S130A/G097S/S144Y/S256I 1.02
S087N/G118V/S128L/P129Q/S130A/N043S/N185V/S256T 1.10
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W 1.07
S087N/G118V/S128L/P129Q/S130A/G097S/S144V/Y209W/S256I 1.17
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/S256I 1.23
S087N/G118V/S128L/P129Q/S130A/G097T/S144W/Y209W/S256I 0.96
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/S256I 1.12
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W/S256I 1.02
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185R/S256P 0.96
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/Y209W 0.95
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185R/Y209W/S256I 1.05
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256T 1.10
S087N/G118V/S128L/P129Q/S130A/P052V/G097T/N185R/Y209W/S256T 0.95
S087N/G118V/S128L/P129Q/S130A/G097S/N185R/S256I 0.85
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185V/S256T 1.14
S087N/G118V/S128L/P129Q/S130A/N043V/S144Y/N185R/Y209W 1.02
S087N/G118V/S128L/P129Q/S130A/S144W/Y209W 1.14
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/Y209W 1.04
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144Y/N185R/Y209W/S256T
0.74 S087N/G118V/S128L/P129Q/S130A/S144V/N185V 1.15
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/Y209W 0.96
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R 0.97
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/N185V 1.16
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W 0.96
S087N/G118V/S128L/P129Q/S130A/G097T/S144W/N185R/Y209W/S256I 0.59
S087N/G118V/S128L/P129Q/S130A/S144T/N185R 0.83
S087N/G118V/S128L/P129Q/S130A/S144T/Y209W/S256I 1.10
S087N/G118V/S128L/P129Q/S130A/N043V/S144Y/N185V/Y209W/S256I 0.75
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/S256I 0.91
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256I 1.15
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/Y209W/S256I 1.12
S087N/G118V/S128L/P129Q/S130A/N185V/Y209W 0.86
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/S256T 0.97
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/S256I 1.17
S087N/G118V/S128L/P129Q/S130A/N043S/N185R/Y209W/S256T 0.86
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/Y209W 1.01
S087N/G118V/S128L/P129Q/S130A/S144V 0.99
S087N/G118V/S128L/P129Q/S130A/N043T/S144V/Y209W/S256T 1.17
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185R/Y209W/S256T 1.30
S087N/G118V/S128L/P129Q/S130A/S144Y/N185V/Y209W 1.25
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W/S256I 1.08
S087N/G118V/S128L/P129Q/S130A/N185R/S256T 0.87
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185V/Y209W/S256I 1.29
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/Y209W/S256T 1.12
S087N/G118V/S128L/P129Q/S130A/S144T/S256I 1.11
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/S256I 0.80
S087N/G118V/S128L/P129Q/S130A/N043S/S256I 0.94
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R/Y209W/S256T 1.06
S087N/G118V/S128L/P129Q/S130A/N043V/N185V/Y209W/S256I 1.00
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V/Y209W/S256I 1.23
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/S256I 1.11
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/Y209W 1.27
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144V/N185R/Y209W/S256I
0.90 S087N/G118V/S128L/P129Q/S130A/G097T/S144T/N185R/Y209W/S256I
0.90 S087N/G118V/S128L/P129Q/S130A/N043S/S144W 1.23
S087N/G118V/S128L/P129Q/S130A/N043V/S144T/N185V/S256I 1.19
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V 1.37
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W/S256T 1.02
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/V104I/S164I 0.67
S087N/G118V/S128L/P129Q/S130A/S164I 1.03
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164I 0.87
S087N/G118V/S128L/P129Q/S130A/A001K/I072C 1.24
S087N/G118V/S128L/P129Q/S130A/R045K/I072C/L126F 1.05
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164F 0.93
S087N/G118V/S128L/P129Q/S130A/I072C/S164I 1.46
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/S164Q 1.16
S087N/G118V/S128L/P129Q/S130A/A001K/S164F 0.99
S087N/G118V/S128L/P129Q/S130A/S164Q 0.94
S087N/G118V/S128L/P129Q/S130A/I072C/L126F 1.08
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164Q 0.57
S087N/G118V/S128L/P129Q/S130A/A001K/S164I 0.99
S087N/G118V/S128L/P129Q/S130A/I072C/S164Q 1.48
S087N/G118V/S128L/P129Q/S130A/A001K/L126F/S164F 1.32
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/S164I 0.68
S087N/G118V/S128L/P129Q/S130A/L126F/S164I 0.85
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164I 1.07
S087N/G118V/S128L/P129Q/S130A/I072V/S164F 1.13
S087N/G118V/S128L/P129Q/S130A/I072C/L126F/S164F 1.01
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164F 0.89
S087N/G118V/S128L/P129Q/S130A/V104I/S164Q 0.88
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164Q 0.77
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164I 0.90
S087N/G118V/S128L/P129Q/S130A/I072C 1.51
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/V104I/L126F 0.91
S087N/G118V/S128L/P129Q/S130A/V104I/S164I 1.00
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/V104I/L126F/S164F 0.75
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164F 1.07
S087N/G118V/S128L/P129Q/S130A/I072P 1.27
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F/S164I 0.92
S087N/G118V/S128L/P129Q/S130A/L126F 0.93
S087N/G118V/S128L/P129Q/S130A/I072C/V104I/L126F/S164I 1.06
S087N/G118V/S128L/P129Q/S130A/V104I 0.99
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164F 0.71
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F 0.99
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/L126F/S164F 0.78
TABLE-US-00022 TABLE 7-7 Multiple Mutation Variants of GCI-P036
Having a PI .gtoreq. 0.5 in CS-38 Microswatch Assay (pH 10;
32.degree. C.) PI G097P/N185Q/A215I 0.97 N018R/N185R/S256W 0.96
N018Q/N185R/A215R 0.72 N018Q/N185Q/Y209W/S256W 0.90
N018K/G097P/N185K/S256W 0.93 N018Q/N185K/Y209W/A215V/S256W 0.97
N018R/N185Q/A215V/S256W 0.81 N018R/G097P/Y209W/S256W 0.92
N018R/N185R/Y209W/S256W 0.98 N185Q/A215R/S256W 0.83 N018K/A215R
1.12 N018K/G097P/Y209W/A215V/S256W 1.02 N018K/N185R/A215V 0.81
N018K/N185K/Y209W/A215R 0.68 N185K/A215V 1.19 N018K/N185K 1.22
N018R/N185R/A215R 1.48 N018K/G097P/N185K/Y209W/A215I/S256W 1.12
G097P/Y209W/A215V/S256W 1.01 N018R/Y209W/S256W 0.93
N018Q/N185K/S256W 0.88 N018K/N185Q/A215V/S256W 1.46 N018K/S256W
0.94 N018R/Y209W/A215V/S256W 0.80 N018Q/G097P/N185K/Y209W 1.33
N018R/G097P/Y209W/A215V 1.21 N185R/S256W 0.99
N018K/G097P/N185Q/Y209W/A215V/S256W 1.09
N018K/G097P/N185R/A215R/S256W 0.64 N018K/N185R/A215I/S256W 0.67
N185R/Y209W/A215I 1.10 N018R/N185K/S256W 0.76
N018K/G097P/N185R/S256W 0.97 N018K/N185Q/A215R/S256W 0.91
N018K/N185K/A215V/S256W 0.95 N018Q/N185R/S256W 0.79
N018Q/N185Q/A215V 1.03 N018R/N185Q/Y209W/S256W 0.60
N185R/Y209W/S256W 1.42 N018K/N185Q/Y209W/S256W 0.97
N018Q/N185K/Y209W/A215V 0.80 N018K/A215V 1.58 N018Q/N185Q/S256W
0.77 N018R/N185K/A215V/S256W 0.76 N018Q/N185K 0.77
N018K/G097P/N185R/Y209W 1.25 N018K/N185R/Y209W/A215V/S256W 0.82
N018Q/N185K/Y209W/A215I/S256W 0.78 N018K/G097P/N185R/A215V/S256W
0.72 N018K/G097P/A215I/S256W 0.61 N018R/G097P/N185Q/A215I 0.85
N018Q/G097P/N185K/A215V 1.31 N185Q/S256W 0.92
N018K/G097P/N185R/Y209W/S256W 1.34 N043V/S101T/N248K >4.0
N043S/N117Y/N248K >4.0 N043E/S101E >4.0
N043S/S101E/N117Y/N248K >4.0 S101R/N248K 3.40 N043S/S101Y/N117I
>4.0 N043I/N117Y 1.32 N043S/S101F 3.07 S101E/N117Y/N248K >4.0
S101Y/N117Y >4.0 N043V/S101V/N248K 3.55 N043F/N117I 0.76
S101F/N248K >4.0 N043S/S101Y/N248K >4.0 N043S/N248I 0.75
N043V/S101R/N117I/N248K 3.18 N043V/S101F/N248K >4.0 S101T/N248I
>4.0 N043V/S101Y/N117I 1.11 S101Y/N248K >4.0
N043S/S101R/N117I/N248K 3.54 N043E/S101F >4.0 N043S/S101N/N117I
>4.0 N043I/S101N/N117Y/N248K 3.56 S101F/N117Y/N248K 2.15
N043S/S101F/N248K 3.24 N043E/S101N/N117Y 2.29 S101T/N117Y/N248K
3.14 N043S/S101E/N248K >4.0 S101R/N117I/N248K 3.80
N043E/S101E/N248K 3.98 N043V/S101Y >4.0 S101F/N117Y/N248I
>4.0 N043F/S101R >4.0 N043V/S101E/N248I >4.0 N043V/N248K
1.93 N043V/S101Y/N117I/N248K >4.0 N043S/S101E >4.0
N043I/S101Y/N117Y/N248K 2.50 N043V/S101F 3.24 N043S/S101Y/N117Y
>4.0 S101Y/N117I/N248K 2.65 P052I/S144Y/N185R/Y209W 3.93
P052V/S144T 1.41 S144Y/Y209W/S256I 2.38 S144T/N185V 1.83
S144V/N185R/Y209W/S256T 2.22 M119F/Y209W 0.98 M119F/N185V/Y209W
1.46 M119F/N185R 0.73 S144V/Y209W 2.25 P052I/N185V/Y209W >4.0
S144V/N185R/Y209W 1.89 P052V/S144Y/Y209W 2.15
P052I/N185R/Y209W/S256I 3.36 S144V/N185R/S256I 0.98 S144T/N185R
1.23 M119F/N185R/Y209W/S256T 1.17 M119F/Y209W/S256I 1.52
S144W/N185R/Y209W/S256T >4.0 P052V/S144V/N185V/Y209W >4.0
N185V/Y209W 1.09 P052I/S144V/Y209W >4.0 S144W/N185V/Y209W/S256I
>4.0 M119F/S144T/N185V/S256I 1.10 S144T/N185R/Y209W/S256I 2.35
S144T/N185R/Y209W/S256T 1.12 S144V/S256I 1.73
P052I/S144T/Y209W/S256I 1.01 A001K/R045K/I072V/L126F/S164Q 1.14
A001K/L126F/S164Q 0.92 A001K/R045F/V104I/L126F/S164Q 0.83
A001K/I072V/V104I 1.16 A001K/R045K/I072V/S164F 1.09 A001K/L126F
1.46 A001K/R045F/I072V/V104G/S164T 0.93 R045L/I072S/S164I 1.35
A001K/L126F/S164F 0.92 R045K/L126F/S164F 0.72
A001K/R045K/I072V/V104I/L126F/S164F 0.76
A001K/I072C/V104I/L126F/S164Q 0.81 A001K/I072V/V104I/S164F 1.00
A001K/V104I/L126F/S164I 0.81 A001K/R045F/L126F/S164I 0.65
A001K/R045K/L126F/S164I 0.95 A001L/I072C 0.76
A001K/R045K/I072V/S164Q 1.00 A001K/I072C/L126F/S164Q 1.04
A001K/V104E 1.07 A001K/I072C/L126F 0.55 L126F/S164V 0.94
A001K/R045S/V104C/L126Y/S164F 0.86 A001K/R045F/I072V/L126F/S164I
0.66 A001K/V104I/L126F/S164Q 0.85 A001K/R045K/V104I/S164Q 0.75
A001K/R045K/I072V/L126F 0.93 A001K/R045K/V104L/S164A 0.85
A001K/R045F/L126F/S164F 0.80 A001K/I072V/V104I/S164Q 0.92
A001K/I072V/L126F >4.0 A001K/I072V/L126F/S164F 1.20
V104E/L126I/S164L 1.20 A001K/I072V 1.44 A001K/V104I/L126F 0.91
A001K/R045K/I072V/V104I/L126F/S164Q 1.03
A001K/R045K/I072V/L126F/S164F 1.21 A001K/R045F/I072V/L126F/S164Q
0.64 A001K/R045K/I072C/L126F/S164Q 0.86 A001K/R045K/S164F 0.66
A001K/R045F/I072C 2.48 A001K/S164Q 1.66 A001K/R045K/L126F/S164P
1.08 A001K/I072C/V104I/L126F 0.72 A001K/L126F/S164I 0.83
S024W/Q109V/G118S/S132Y >4.0 S024W/Q109K/G118R 0.84 S024H/Q109L
0.57 S024V/Q109R/G118F 0.75 S024R/Q109V 2.54 S024W/Q109I 1.32
S024V/Q109C/G118L 1.94 S024R/Q109T/S132Y 1.47 S024H/Q109T/G118R
0.96 S024R/G118R/S132N 0.83 Q109I/G118S 1.34 S024C/Q109K/G118I 1.11
S024W/Q109L 1.24 Q109A/G118S 0.80 S024R/S132Y 0.99 Q109P/G118Q 1.00
S024V/Q109R/G118F 1.29 S024R/Q109V 3.28 Q109T/G118N 0.99
S024V/Q109C/G118L 1.36 S024H/Q109T/G118R 1.61 Q109I/G118S 1.15
S024C/Q109K/G118I 0.72 S024W/Q109L 2.74 Q109I/G118R 3.89
Q109A/G118S 1.01 Q109V/G118F 1.14 Q109P/G118Q 1.04
S024W/Q109V/G127T/S132Y 2.32 S024H/G127R 0.87 S024R/Q109C/G127H
0.86 S024R/Q109R/G118T/G127R 2.18 S024W/G127R 2.22 Q109S/G118R 2.44
S024N/Q109T/G127R/S132N >4.0 S024H/G118L/G127T/S132Y 0.61
S024R/Q109V/G127S 0.79 Q109H/G127R >4.0 S024N/Q109T/G127T/S132R
0.54 Q109I/G127T/S132Y >4.0 S024R/G118H/S132V 0.84
S024R/Q109T/G127R/S132N >4.0 S024N/G127R 0.60 Q109D/G118V/G127H
1.14 S024W/G118L/G127T/S132Y 0.61 S024R/Q109T/G127T/S132Y 0.93
S024R/Q109K/G118T/G127Q/S132N 0.90 S024W/Q109L/G127R/S132N 2.33
S024L/Q109K/G127R/S132Y 2.50 S024W/Q109V/G127T >4.0
S024N/G118R/G127L/S132Y >4.0 Q109K/G118F/G127Q/S132N 0.68
Q109V/G127R 0.72 S024H/Q109V/G127T 1.40 S024A/Q109Y/G118C 1.59
S024T/Q109I/G127T 0.83 S024N/Q109T/G127T/S132Y 0.59 S024/G118I 0.75
S024N/Q109V/G118R/G127T/S132Y 2.11 S024W/Q109I/G127T 1.53
Q109R/G118V 1.30 Q109V/G127Q 1.94 S024Q/Q109R/S132R 0.80
S024H/G118K/G127I 2.59 A001K/S024R/R045N/A172C 1.19
A001S/S024L/I107Y/A172S 1.23 I107C/A172S 1.45 A001R/S024H/I107T
1.10 A001R/S024H/R045N/I107T/A172Q 1.27 R045F/I107T 0.88
R045V/I107R/A172D 1.23 A001R/A172Q 1.07 S024T/R045K/I107V 1.21
A001V/I107L/A172I 1.53 S024T/I107T 0.86 A001T/S024H/I107L/A172Y
1.43
A001R/S024W/R045K/I107T/A172Q 1.19 A001R/S024R/I107V/A172L 2.81
S024N/R045K/A172L 0.85 A001R/R045N/I107T 1.36 A001R/I107T 1.10
S024N/I107T 0.81 A001R/R045K/A172Q 0.97 R045K/I107T 0.64
A001K/S024L/R045A 1.04 A001R/R045F 1.04 A001R/S024W/R045N/I107T
1.07 I107Q/A172D 1.74 A001R/S024R/A172Q 1.07 A001K/A172L 1.47
A001S/A172V 1.50 A001I/R045T/I107R/A172T 1.65
A001R/S024H/R045K/I107T 1.09 S024W/A172Q 1.07 S024W/R045N/A172Q
1.07 S024V/R045I/A172V 1.33 R045N/I107T/A172Q 1.02 A001R/S024R 1.03
A001K/A172W 0.83 A001R/S024N 0.95 A001R/S024R/A172H 0.88
R045S/I107L 1.17 A001R/S024T/R045N/I107T/A172Q 0.96
A001Q/R045K/I107T 0.80 S024N/R045K/I107V/A172N 0.81
A001R/S024T/I107T/A172Q 1.29 A001K/S024N/R045K/A172Y 0.78
S024R/R045F/I107T/A172Q 0.73 A001R/I107T/A172Q 1.01
A001R/I107V/A172Q >4.0 A001K/R045F/I107L/A172N 1.01 A001P/A172V
0.93 S024H/I107K 1.02 A001L/S024D/R045Y/I107Y 1.60
A001M/R045S/I107E/A172D 1.34 S024I/I107R/G127I/A172R 1.17
A001K/S024T/I107T/G127Q/A172Q 1.72 A001R/S024R/R045F/I107T/G127R
2.38 A001C/S024V/I107L 1.76 A001K/S024H/R045N/I107T 1.09
A001K/I107V/G127Q 0.91 A001K/S024R/R045N/I107T/G127R 2.47
A001R/S024T/R045K/A172Q 0.85 A001R/A172G 0.73 A001R/R045N/A172K
0.93 A001L/R045Q/G127H/A172R 0.86 A001K/I107V/G127R/A172Q 3.07
A001K/R045F/I107T 1.07 A001K/S024T/R045N/G127Q/A172Q 1.08
A001K/R045K/I107A/A172T 1.41 A001R/I107T/G127Q/A172Q 1.12
A001K/R045K/I107R/G127A/A172N 0.86 A001R/S024W/R045F/I107V/G127Q
2.33 R045N/I107A/A172R 1.27 A001R/R045N/I107T/G127Q 1.09
I107P/A172S 1.47 A001R/S024W/I107V/A172S 1.54
A001K/S024H/I107T/G127Q 1.46 A001R/S024H/R045K/I107T/A172Q 1.01
A001R/R045N/A172Q 0.83 A001K/R045F/I107V/G127Q 0.82
A001K/S024N/I107V/G127T 0.80 S024T/R045K/I107T/G127R/A172Q 3.14
A001K/R045N/I107T/G127Q 1.14 A001K/S024W/I107V/G127T/A172Q 1.27
A001K/I107V/G127Q/A172Q 1.02 A001R/R045N/I107V/G127R 1.03
A001K/S024H/I107T/G127R 1.46 A001R/I107T 0.93 A001K/S024H/I107V
2.10 I107A/G127K/A172G 1.05 A001R/R045K/G127R 1.84
A001R/R045K/I107T/G127Q 1.30 A001R/S024W/R045K 0.89
A001R/R045N/I107T 0.83 A001K/S024R/R045N/I107T 1.77
A001K/R045K/I107T/G127R/A172Q 1.95 A001K/I107T/A172Q 0.85
A001R/R045N/I107V/A172V 0.97 A001R/S024R/R045K/I107T/G127Q 1.21
A001R/R045N/I107V/G127Q/A172Q 1.00 A001R/S024R/I107V/G127R 1.06
A001R/S024R/R045F/I107T/G127Q 1.23
A001K/S024H/R045N/I107T/G127Q/A172Q 1.31 S024Y/G127R/A172E 1.26
A001K/S024W/I107T/G127R >4.0 A001R/R045K/I107V/G127R 1.28
A001K/R045K/I107T/G127R 1.51 A001R/S024T/R045K/I107L/G127P/A172P
1.15 S024W/S099Q 1.08 S099Q/S103N/S132H 0.78 S099K/G118R 1.03
S024W/S099T/S103P 1.26 S024W/S103K/S132R 1.12 S024W/S103P 0.75
S024W/S099T/S103P/G118R 0.76 S024H/S099Q/S103P 1.09
S024H/S099K/S103R/G118A/S132P >4.0 S024W/G118K 1.24
S024H/S099T/S103N/S132N 2.11 S099Q/S103N/G118R/S132N 0.95
S024W/S099T/S103N 1.29 S024W/S099Q/S103N/G118T 0.84 S103L/S132E
1.17 S103R/S132P 0.83 S099Q/S103P/G118R >4.0 S099Q/S103N/G118T
3.67 S024H/S099Q/S132N 1.21 S099K/S103N/G118T 1.10 S024H/S132R 0.88
S024W/S099T/S103N/S132N 1.15 S024T/G118D 0.88 S099N/S132R 0.63
S099H/S103I/G118N 1.09 S024W/S099Q/S103N/G118R/S132N 1.54
S024W/S099Q/G118T >4.0 S024H/S099Q/S132H 0.63 S099Q/S132R 0.70
S024M/G118V 0.98 S024W/S132N 0.90 S099K/S103R/G118A/S132P >4.0
S024W/S099T/S103N/S132H 0.83 S099Q/G118T/G127Q 1.18
S024W/S099T/S103N/G118R 1.63 S024H/S099Q/G118R/G127Q/S132H >4.0
S103G/G118I/G127E/S132E 3.51 S024H/S099T/S103N 1.58
S024H/S099Q/S132H >4.0 S024W/S099Q/S103N/G118R/G127Q/S132N
>4.0 S024H/S099Q/G118R/S132H 1.80 G118T/G127Q 1.16
S099T/G118R/S132H 0.97 S024H/S099K/G118F/G127R >4.0
S024H/S103P/G127R/S132R 0.92 S024N/S099T/G127T/S132H 0.82
S024H/S099T/S103N/G127R/S132N >4.0 S024L/G127R 0.96
S024W/G127R/S132N >4.0 S024W/S099T 3.99 S024H/S099T/S103P/S132N
0.83 S099T/S103P 0.98 S024W/S099T/G118R/G127Q 1.11 S024W/S132H
>4.0 S024W/S099T/S103P 1.39 S024H/S099Q/S103N/G118R/G127T/S132N
1.37 S024H/S099K/S103P 0.88 S024W/S103P 0.79 S024H/S103N/S132H 0.59
S024W/S099Q/S103P 0.93 S024H/S132N >4.0 S099K/S103P/G127Q 0.61
S099Q/G118F/G127R 1.40 S099Q/S103P/S132H >4.0 S024H/S099T/G118R
0.74 S024H/S099T/S103P/G118R 0.80
S87N/G118V/S128L/P129Q/S130A/S024R/Q109K 1.28
S87N/G118V/S128L/P129Q/S130A/S024R 0.75
S87N/G118V/S128L/P129Q/S130A/S024H 1.02
S87N/G118V/S128L/P129Q/S130A/S024R/Q109L 1.60
S87N/G118V/S128L/P129Q/S130A/S024R/Q109V 1.56
S87N/G118V/S128L/P129Q/S130A/Q109V 0.66
S87N/G118V/S128L/P129Q/S130A/S024R/G127R >4.0
S87N/G118V/S128L/P129Q/S130A/S024W 1.22
S87N/G118V/S128L/P129Q/S130A/S024T/G127T 1.05
S87N/G118V/S128L/P129Q/S130A/G127T 1.23
S87N/G118V/S128L/P129Q/S130A/Q109I >4.0
S87N/G118V/S128L/P129Q/S130A/S024T 0.70
S87N/G118V/S128L/P129Q/S130A/S024N/Q109K 0.94
S87N/G118V/S128L/P129Q/S130A/G127Q 2.97
S87N/G118V/S128L/P129Q/S130A/S024R/Q109L/G127Q >4.0
S87N/G118V/S128L/P129Q/S130A/Q109L/G127Q >4.0
S87N/G118V/S128L/P129Q/S130A/R045S 1.05
S87N/G118V/S128L/P129Q/S130A/S024H/I107V/A172S 1.23
S87N/G118V/S128L/P129Q/S130A/A001K/I107W/A172P 1.73
S87N/G118V/S128L/P129Q/S130A/A001R 1.05
S87N/G118V/S128L/P129Q/S130A/A001K/R045N/I107V 1.30
S87N/G118V/S128L/P129Q/S130A/A001K/S024H/A172Q 1.34
S87N/G118V/S128L/P129Q/S130A/A001R/S024W/A172W 1.95
S87N/G118V/S128L/P129Q/S130A/A172N 1.68
S87N/G118V/S128L/P129Q/S130A/A001R/I107V/A172Q 1.59
S87N/G118V/S128L/P129Q/S130A/A001K/S024H/I107V 1.65
S87N/G118V/S128L/P129Q/S130A/A001R/R045K 1.66
S87N/G118V/S128L/P129Q/S130A/A001R/I107V/A172W 1.65
S87N/G118V/S128L/P129Q/S130A/A001K/R045K/I107S 1.61
S87N/G118V/S128L/P129Q/S130A/S024T/R045N/I107V/A172S 2.52
S87N/G118V/S128L/P129Q/S130A/S024N/I107N 1.04
S87N/G118V/S128L/P129Q/S130A/A001K/S024T/I107V/A172W 1.20
S87N/G118V/S128L/P129Q/S130A/R045N/I107V/A172P 1.29
S87N/G118V/S128L/P129Q/S130A/A001K/R045F 2.32
S87N/G118V/S128L/P129Q/S130A/A001R/S024R/R045K/I107G/A172L 1.99
S87N/G118V/S128L/P129Q/S130A/S024R/I107V/A172S 1.50
S87N/G118V/S128L/P129Q/S130A/A001R/A172I 1.64
S87N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/A172N 1.46
S87N/G118V/S128L/P129Q/S130A/A001R/I107V/A172P 1.57
S87N/G118V/S128L/P129Q/S130A/S024T 0.96
S87N/G118V/S128L/P129Q/S130A/R045N/A172Q 1.03
S87N/G118V/S128L/P129Q/S130A/S024W/R045F/I107V/A172Q 1.75
S87N/G118V/S128L/P129Q/S130A/A001R/A172Q 1.37
S87N/G118V/S128L/P129Q/S130A/S024W/S099K >4.0
S87N/G118V/S128L/P129Q/S130A/S099Q/S103N 2.62
S87N/G118V/S128L/P129Q/S130A/S099Q 1.12
S87N/G118V/S128L/P129Q/S130A/S024W 0.90
S87N/G118V/S128L/P129Q/S130A/S024W/S099T 1.33
S87N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N 1.61
S87N/G118V/S128L/P129Q/S130A/S099K/S103N 1.69
S87N/G118V/S128L/P129Q/S130A/S024H/S099Q 1.39
S87N/G118V/S128L/P129Q/S130A/S024W/G127T >4.0
S87N/G118V/S128L/P129Q/S130A/S099K 1.33
S87N/G118V/S128L/P129Q/S130A/S024W/S099Q 1.56
S87N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N 1.52
S87N/G118V/S128L/P129Q/S130A/N018K/N185K 0.94
S87N/G118V/S128L/P129Q/S130A/N185R/Y209W 0.97
S87N/G118V/S128L/P129Q/S130A/N018K 1.35
S87N/G118V/S128L/P129Q/S130A/N018Q/N185Q/S256W 1.02
S87N/G118V/S128L/P129Q/S130A/N018Q/N185Q/Y209W/S256W 1.24
S87N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W/A215I/S256W 1.65
S87N/G118V/S128L/P129Q/S130A/Y209W/S256W 0.79
S87N/G118V/S128L/P129Q/S130A/N018R/Y209W/A215I/S256W 1.61
S87N/G118V/S128L/P129Q/S130A/N018K/N185R 1.00
S87N/G118V/S128L/P129Q/S130A/N018K/N185K/S256W 1.22
S87N/G118V/S128L/P129Q/S130A/N018Q/Y209W/S256W 1.26
S87N/G118V/S128L/P129Q/S130A/N185R/Y209W/A215V/S256R 0.81
S87N/G118V/S128L/P129Q/S130A/N185K/A215V/S256W 1.15
S87N/G118V/S128L/P129Q/S130A/N018K/Y209W 0.99
S87N/G118V/S128L/P129Q/S130A/N018K/N185Q/S256W 1.07
S87N/G118V/S128L/P129Q/S130A/N018R/Y209W/S256W 1.28
S87N/G118V/S128L/P129Q/S130A/N018K/A215R/S256W 1.23
S87N/G118V/S128L/P129Q/S130A/N018Q/A215R/S256W 1.16
S87N/G118V/S128L/F129Q/S130A/N018K/G097P/N185R/Y209W 2.83
S87N/G118V/S128L/P129Q/S130A/A215V/S256W 1.54
S87N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V/S256W 0.85
S87N/G118V/S128L/P129Q/S130A/N018R/N185R/A215R 1.27
S87N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V 0.88
S87N/G118V/S128L/P129Q/S130A/N018K/N185R/A215V/S256W 1.03
S87N/G118V/S128L/P129Q/S130A/N018R 0.98
S87N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W/A215I >4.0
S87N/G118V/S128L/P129Q/S130A/N018Q/A215I/S256W 2.09
S87N/G118V/S128L/P129Q/S130A/N018K/N185Q 1.09
S87N/G118V/S128L/P129Q/S130A/N018K/N185R/A215I/S256W 1.12
S87N/G118V/S128L/P129Q/S130A/G097P/N185Q/Y209W/A215V/S256W 0.68
S87N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215R 0.98
S87N/G118V/S128L/P129Q/S130A/Y209W/A215I/S256W 1.96
S87N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215V/S256W 1.04
S87N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215R 0.82
S87N/G118V/S128L/P129Q/S130A/N185R/A215V/S256W 1.11
S87N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W 0.85
S87N/G118V/S128L/P129Q/S130A/A215V >4.0
S87N/G118V/S128L/P129Q/S130A/N018R/N185Q/A215I/S256W >4.0
S87N/G118V/S128L/P129Q/S130A/G097P/N185K/A215I >4.0
S87N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215R 1.14
S87N/G118V/S128L/P129Q/S130A/N018K/Y209W/A215V 1.21
S87N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W 0.89
S87N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215V 0.68
S87N/G118V/S128L/P129Q/S130A/N185R/Y209W/S256L 0.87
S87N/G118V/S128L/P129Q/S130A/N018K/S256W 1.10
S87N/G118V/S128L/P129Q/S130A/N018Q/N185K/S256W 0.71
S87N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215V/S256W 0.79
S87N/G118V/S128L/P129Q/S130A/P052I/N248K 1.24
S87N/G118V/S128L/P129Q/S130A/N043V/S101T 1.84
S87N/G118V/S128L/P129Q/S130A/P052V >4.0
S87N/G118V/S128L/P129Q/S130A/N043V/S101Y >4.0
S87N/G118V/S128L/P129Q/S130A/S101E/N248K 3.92
S87N/G118V/S128L/P129Q/S130A/N248K 1.40
S87N/G118V/S128L/P129Q/S130A/N043W/S101E 3.08
S87N/G118V/S128L/P129Q/S130A/P052I/S101V/N248K >4.0
S87N/G118V/S128L/P129Q/S130A/S101F/N248K >4.0
S87N/G118V/S128L/P129Q/S130A/N043V/S101T/N248K 3.71
S87N/G118V/S128L/P129Q/S130A/S101Y >4.0
S87N/G118V/S128L/P129Q/S130A/N043E 1.36
S87N/G118V/S128L/P129Q/S130A/N043S/S101T 2.49
S87N/G118V/S128L/P129Q/S130A/N043V/S101F >4.0
S87N/G118V/S128L/P129Q/S130A/N043E/S101R 1.17
S87N/G118V/S128L/P129Q/S130A/N043E/S101Y >4.0
S87N/G118V/S128L/P129Q/S130A/N043E/S101E 3.61
S87N/G118V/S128L/P129Q/S130A/N043T/N248K >4.0
S87N/G118V/S128L/P129Q/S130A/P052V/S101R >4.0
S87N/G118V/S128L/P129Q/S130A/S101N/N248K >4.0
S87N/G118V/S128L/P129Q/S130A/N043V/S101R 1.63
S87N/G118V/S128L/P129Q/S130A/N043F/S101Y/N248K >4.0
S87N/G118V/S128L/P129Q/S130A/S101R/N248K 0.94
S87N/G118V/S128L/P129Q/S130A/N043I/S101Y >4.0
S87N/G118V/S128L/P129Q/S130A/N043T >4.0
S87N/G118V/S128L/P129Q/S130A/Y209W 0.54
S87N/G118V/S128L/P129Q/S130A/P052V/Y209W 2.14
S87N/G118V/S128L/P129Q/S130A/S144V/N185R/Y209W >4.0
S87N/G118V/S128L/P129Q/S130A/G097S/N185R/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/S144V/N185V/Y209W >4.0
S87N/G118V/S128L/P129Q/S130A/S144V/N185V 0.63
S87N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/Y209W >4.0
S87N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W 1.63
S87N/G118V/S128L/P129Q/S130A/S144T/N185R 1.79
S87N/G118V/S128L/P129Q/S130A/S144T/Y209W/S256I 3.43
S87N/G118V/S128L/P129Q/S130A/N043S/N185R/Y209W/S256T 1.35
S87N/G118V/S128L/P129Q/S130A/S144T/N185V/Y209W 1.11
S87N/G118V/S128L/P129Q/S130A/G097T/Y209W/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/N185R/S256T 0.99
S87N/G118V/S128L/P129Q/S130A/S144T/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/S144T/N185R/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/N043S/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/N043V/N185V/Y209W/S256I >4.0
S87N/G118V/S128L/P129Q/S130A/P052V/Y209W/S256T >4.0
S87N/G118V/S128L/P129Q/S130A/S164I 0.97
S87N/G118V/S128L/P129Q/S130A/A001K/V104I/S164I 0.99
S87N/G118V/S128L/P129Q/S130A/A001K/V104I/S164F 1.12
S87N/G118V/S128L/P129Q/S130A/A001K/S164F 1.67
S87N/G118V/S128L/P129Q/S130A/S164Q 0.95
S87N/G118V/S128L/P129Q/S130A/A001K/S164I 1.74
S87N/G118V/S128L/P129Q/S130A/L126F/S164I 1.01
S87N/G118V/S128L/P229Q/S130A/I072V/S164F 3.75
S87N/G118V/S128L/P129Q/S130A/V104I/L126F/S164F 0.76
S87N/G118V/S128L/P129Q/S130A/V104I/S164Q 0.87
S87N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164Q 1.91
S87N/G118V/S128L/P129Q/S130A/V104I/L126F/S164I 0.65
S87N/G118V/S128L/P129Q/S130A/V104I/S164I 0.75
S87N/G118V/S128L/P129Q/S130A/A001K/I072V/V104I/L126F/S164F 1.25
S87N/G118V/S128L/P129Q/S130A/L126F 0.76
S87N/G118V/S128L/P129Q/S130A/V104I 0.87
S87N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164F 0.83
Evaluation of LAS/EDTA Stability by Multiple Mutation Library (MML)
Variants of GCI-P036
[0300] Variants of GCI-P036 were tested for their stability after
incubation in a composition containing LAS and EDTA stability.
Cloning of the combinatorial library was performed by Sloning
BioTechnology using the Slonomax Technology. Preparation of variant
protease samples was performed as described above. Briefly, MML
variants were in an LAS/EDTA stability assay using the methods of
Example 1. As described throughout, functionality of protease
variants was quantified as a performance index (PI), which is the
ratio of performance of a variant to that of a reference protease.
The substitutions are listed relative to the GCI-P036 reference
protease using BPN' numbering and the PI is determined in
relationship to the GCI-P036 reference. Results are shown in Table
7-8.
TABLE-US-00023 TABLE 7-8 Multiple Mutation Variants of GCI-P036
Having a PI .gtoreq. 0.5 for LAS/EDTA Stability PI
G097P/N185Q/A215I 1.51 N018Q/N185Q/Y209W/S256W 1.08
N018K/G097P/N185K/S256W 0.54 N185K/Y209W/S256W 0.93
N018Q/N185K/Y209W/A215V/S256W 1.23 N185Q/A215R/S256W 0.72
N018K/G097P/Y209W/A215V/S256W 0.87 N185K/A215V 1.15
N018K/G097P/N185K/Y209W/A215I/S256W 0.85 G097P/Y209W/A215V/S256W
1.55 N018Q/N185K/S256W 0.52 N018K/N185Q/A215V/S256W 1.34
N018Q/G097P/N185K/Y209W 1.06 N185R/S256W 0.78
N018K/G097P/N185Q/Y209W/A215V/S256W 0.95 N185R/Y209W/A215I 0.96
N018K/N185K/A215V/S256W 0.68 N018Q/N185R/S256W 0.64 N018K/A215I
1.39 N018Q/N185Q/A215V 1.37 N185R/Y209W/S256W 0.83
N018K/N185Q/Y209W/S256W 0.53 N018Q/N185K/Y209W/A215V 1.12
N018K/A215V 0.77 N018Q/N185Q/S256W 1.14 N018K/N185Q/S256W 0.56
N018Q/N185K 1.22 N018K/N185R/Y209W/A215V/S256W 0.63
N018Q/N185K/Y209W/A215I/S256W 1.09 N018K/G097P/N185R/A215V/S256W
0.79 N018K/G097P/A215I/S256W 0.85 N018Q/G097P/N185K/A215V 1.33
N185Q/S256W 1.02 N018K/G097P/N185R/Y209W/S256W 0.52
N043V/S101T/N248K 0.62 N043S/N117Y/N248K 0.92 N043E/S101E 1.35
N043S/S101E/N117Y/N248K 1.20 S101R/N248K 1.06
N043V/S101E/N117I/N248K 0.91 N043E/S101V 1.25 N043S/S101Y/N117I
1.29 N043I/N117Y 0.82 N043S/S101F 1.27 S101E/N117Y/N248K 1.03
S101Y/N117Y 1.01 N043V/S101V/N248K 0.67 N043I/S101R/N248K 0.86
N043F/N117I 1.07 S101F/N248K 0.92 N043S/S101Y/N248K 1.01
N043S/N248I 1.01 N043I/S101E/N248I 0.85 N043V/S101R/N117I/N248K
0.86 N043V/S101F/N248K 0.78 N043V/N117Y/N248I 1.24 S101T/N248I 0.90
N043E/S101Y/N117Y/N248K 1.15 N043V/S101Y/N117I 0.81
N043V/S101V/N117I 0.83 S101Y/N248K 0.89 N043S/S101R/N117I/N248K
1.12 N043V/N248I 0.64 N043V/S101F/N117Y 0.81
N043S/S101V/N117I/N248I 1.12 N043E/S101F 1.33 N043S/S101N/N117I
1.25 N043I/S101N/N117Y/N248K 0.79 S101F/N117I/N248I 0.90
S101F/N117Y/N248K 1.06 N043I/S101F/N117Y/N248K 0.76
N043S/S101F/N248K 1.10 N043E/S101N/N117Y 1.17 S101T/N117Y/N248K
0.84 N043S/S101E/N248K 1.18 N043I/S101Y/N117I/N248I 0.85
N043V/S101F/N117I 0.68 N043E/S101Y/N117I/N248K 1.09 N043S/S101Y
0.58 N043E/S101E/N248K 1.24 N043V/S101Y 0.86 S101F/N117Y/N248I 1.03
N043S/S101E/N117I/N248I 1.24 N043F/S101R 0.95 N043V/S101E/N248I
0.80 N043V/N248K 0.61 S101E/N117I 0.96 N043V/S101Y/N117I/N248K 0.66
N043S/S101E 1.30 S101R/N117Y 1.06 N043I/S101Y/N117Y/N248K 0.73
N043V/S101F 0.72 N043S/S101Y/N117Y 1.15 S101Y/N117I/N248K 0.81
P052V/S144T 0.98 P052V/M119F/S144T/N185R/S256T 0.61
S144Y/Y209W/S256I 0.89 P052I/S144Y/Y209W/S256I 0.83 S144T/N185V
0.94 S144V/N185R/Y209W/S256T 0.60 M119F/Y209W 0.94
M119F/N185V/Y209W 0.96 M119F/N185R 0.71 S144V/Y209W 0.90
P052I/N185V/Y209W 0.95 P052I/M119F/S144Y/N185R/Y209W/S256I 0.52
S144V/N185R/Y209W 0.51 P052V/S144W/Y209W 0.62
P052V/M119F/S144T/Y209W 0.99 P052V/S144T/Y209W/S256I 0.83
P052V/S144Y/Y209W 0.94 P052I/N185R/Y209W/S256I 0.51
P052V/M119F/S144T/N185R/Y209W 0.76 P052V/N185V/Y209W/S256I 0.91
P052I/S144Y/N185V/S256T 0.78 P052I/M119F/S144Y/N185R 0.53
S144T/N185R 0.58 P052I/S144Y/N185V 0.96 P052V/M119F/S144T 1.12
P052I/S144T/N185V/Y209W/S256T 0.89 M119F/Y209W/S256I 0.99
P052V/S144V/N185V/Y209W 0.84 P052I/M119F 0.99
P052V/S144W/N185V/Y209W 0.66 N185V/Y209W 0.92
P052I/M119F/S144V/Y209W 0.88 P052I/S144V/Y209W 0.84
P052I/M119F/S144T/N185R/Y209W 0.65 S144W/N185V/Y209W/S256I 0.61
M119F/S144T/N185V/S256I 0.85 P052I/M119F/Y209W/S256I 0.89
P052I/N185V/Y209W/S256I 0.81 P052V/M119F/S144T/S256T 0.94
P052V/M119F/N185V/Y209W/S256I 0.87 P052I/S144T 0.93
S144T/N185R/Y209W/S256T 0.56 S144V/S256I 0.66 P052I/S144T/S256I
0.80 P052V/S144T/N185V/Y209W/S256T 0.90
P052V/M119F/S144V/N185V/S2561 0.87 P052V/S144Y/S256T 0.78
P052I/S144T/Y209W/S256I 0.83 P052V/S256T 0.83
P052V/S144V/Y209W/S256I 0.74 P052V/S144T/N185V/Y209W/S256I 0.78
A001K/R045K/I072V/L126F/S164Q 0.74 A001K/L126F/S164Q 0.78
A001K/R045F/V104I/L126F/S164Q 0.96 A001K/I072V/V104I 0.66
A001K/R045K/I072V/S164F 0.99 A001K/L126F 0.72
A001K/R045F/I072V/V104G/S164T 0.76 R045K/I072C/V104I/L126F/S164F
0.79 R045L/I072S/S164I 0.93 L126A/S164N 1.08 A001K/L126F/S164F 1.18
R045K/L126F/S164F 1.20 A001K/R045K/I072V/V104I/L126F/S164F 1.09
A001K/I072C/V104I/L126F/S164Q 0.64 A001K/I072V/V104I/S164F 0.90
A001K/V104I/L126F/S164I 1.12 A001K/R045F/L126F/S164I 1.08
A001K/R045K/L126F/S164I 1.22 A001L/I072C 1.07
A001K/R045K/I072V/S164Q 0.76 A001K/I072C/L126F/S164Q 0.60
A001K/V104E 0.63 A001K/I072C/L126F 0.68 L126F/S164V 1.16
R045F/I072V/L126F/S164Q 1.09 A001K/R045S/V104C/L126Y/S164F 0.88
A001K/R045F/I072V/L126F/S164I 1.24 A001K/V104I/L126F/S164Q 0.71
A001K/R045K/V104I/S164Q 0.71 A001K/R045K/I072V/L126F 0.81
A001K/R045K/V104L/S164A 0.86 A001K/R045F/L126F/S164F 1.11
A001K/I072V/V104I/S164Q 0.72 A001K/I072V/L126F 0.78
A001K/I072V/L126F/S164F 0.97 V104E/L126I/S164L 1.11 A001K/I072V
0.65 A001K/V104I/L126F 0.67 A001K/R045K/I072V/V104I/L126F/S164Q
0.83 A001K/R045K/I072V/L126F/S164F 1.20
A001K/R045F/I072V/L126F/S164Q 0.85 A001K/R045K/I072C/L126F/S164Q
0.61 A001K/R045F/I072C/V104I/S164F 0.91 A001K/R045F/I072C 0.73
A001K/S164Q 0.54 A001K/R045K/L126F/S164P 0.52
A001K/I072C/V104I/L126F 0.51 A001K/L126F/S164I 1.11
S024W/Q109K/G118R 0.83 S024V/Q109R/G118F 0.96 S024W/Q109I 1.04
S024V/Q109C/G118L 1.00 S024R/G118R/S132N 1.02 Q109I/G118S 1.10
S024W/Q109L 0.97 Q109A/G118S 1.00 S024V/Q109R/G118F 1.04
S024R/Q109V 1.08 Q109T/G118N 1.16 S024V/Q109C/G118L 1.12
S024H/Q109T/G118R 1.09 Q109I/S132N 1.31 Q109I/G118S 1.11
S024C/Q109K/G118I 1.01 S024W/Q109L 1.29 Q109I/G118R 1.12
S024W/Q109T/G118L 1.09 Q109A/G118S 1.11 Q109V/G118F 1.02
Q109P/G118Q 1.09 S024V/Q109L/G118V 1.07 S024W/G127R 1.07
Q109S/G118R 1.12 S024R/Q109V/G127S 0.96 Q109H/G127R 0.98
S024R/G118H/S132V 1.05 Q109D/G118V/G127H 0.96 S024N/S132R 0.80
S024R/Q109T/G127R/S132Y 0.94 Q109V/G127R 0.94
S024R/G118L/G127R/S132R 1.02 S024A/G118I 0.87 G118L/G127R/S132L
0.88 S024R/Q109V/G118C/S132A 0.74 R045F/I107T 1.03
R045V/I107R/A172D 1.01 S024T/R045K/I107V 0.99 S024T/I107T 0.85
A001T/S024H/I107L/A172Y 0.81 S024N/R045K/A172L 0.91 S024N/I107T
1.00 R045K/I107T 0.98 I107Q/A172D 1.04 S024W/A172Q 0.94
S024W/R045N/A172Q 1.12 A001Q/R045K/I107T 0.85
S024N/R045K/I107V/A172N 1.03 S024R/R045F/I107T/A172Q 0.84
A001K/R045F/I107L/A172N 0.55
S024I/I107R/G127I/A172R 0.52 A001K/S024H/R045N/I107T 0.69
A001K/R045F/I107T 0.62 A001K/R045K/I107A/A172T 0.50
R045N/I107A/A172R 0.56 A001R/R045N/I107T/G127Q 0.53
A001K/S024R/R045N/I107T 0.51 S024W/S099Q 1.17
S024W/S099T/S103P/G118T/S132N 1.14 S099Q/S103N/S132H 1.06
S024W/S099T/S103P 1.16 S024W/S103K/S132R 1.26 S024W/S103P 1.09
S099T/G118T/S132N 1.10 S024W/S099T/S103P/G118R 1.11
S024H/S099Q/S103P 1.26 S024H/S099K/S103R/G118A/S132P 1.41
S024H/S099T/S103P/G118R/S132H 1.15 S024W/G118K 0.68
S024H/S099T/S103N/S132N 1.18 S099K/S103P/S132H 0.59
S099Q/S103N/G118R/S132N 1.09 S024W/S099T/S103N 1.16
S099T/S103P/G118L/S132H 1.13 S024P/S099Q/S103P/G118R 1.07
S099T/G118T/S132H 1.06 S024W/S099Q/S103N/G118T 1.27 S024W/S132H
1.12 S103L/S132E 0.95 S103R/S132P 0.94 S099Q/S103P/G118R 1.02
S099Q/S103N/G118T 1.04 S024H/S099Q/S132N 1.01
S099Q/S103N/G118T/S132H 1.08 S024W/S099T/G118T/S132H 1.08
S099K/S103N/G118T 1.14 S024H/S099Q/S103P/S132H 1.11 S024H/S132R
1.07 S024W/S099T/S103N/S132N 0.85 S024T/G118D 1.00 S099N/S132R 0.82
S099K/S103P/G118L/S132N 0.97 S099H/S103I/G118N 1.28
S024W/S099Q/S103N/G118R/S132N 1.00 S024W/S099T/S103P/G118R/S132H
1.00 S024W/S099Q/G118T 0.91 S024H/S099Q/S132H 1.11 S099Q/S132R 1.14
S099Q/S103P/G118R/S132N 0.96 S024M/G118V 0.55 S024W/S132N 0.66
S099K/S103R/G118A/S132P 0.79 S024W/S099T/S103P/S132H 0.84
S024W/S099T/S103N/S132H 0.87 S024W/S099T/S103N/G118R 1.13
S099T/G118F 0.90 S024W/S103P/G118F/S132H 1.13
S103G/G118I/G127E/S132E 1.03 S024H/S099T/S103N 1.16
S024H/S099Q/S132H 1.02 S024W/S099K/S103P/S132H 1.03
S024H/S099Q/G118R/S132H 1.03 S024H/S099K/S103P/G118F 1.08
S099T/G118R/S132H 1.10 S024W/S099Q/S103P/G118R/S132H 1.07
S024L/G127R 1.06 S024W/S099T/S103P/G118T/S132N 0.71 S024W/S099T
0.91 S024H/S099T/S103P/S132N 0.95 S099T/S103P 1.03 S024W/S132H 1.14
S024W/S099T/S103P 1.16 S024H/S099Q/S103P/G118R/S132H 0.87
S024H/S099K/S103P 1.11 S024W/S103P 1.04 S024H/S103N/S132H 0.98
S024W/S099Q/S103P/S132N 1.02 S024W/S099Q/S103P 1.12 S024H/S132N
0.96 S024W/S099T/G118R 0.96 S024H/S099Q/S103N/G118T/S132H 1.21
S099Q/S103P/S132H 1.01 S024W/S099T/S103P/G118T 0.87
S024H/S099T/G118R 0.86 S024W/S099Q/S103P/G118T/S132N 0.88
S024H/S099T/S103P/G118R 0.97
S087N/G118V/S128L/P129Q/S130A/S024R/Q109K 0.80
S087N/G118V/S128L/P129Q/S130A/S024W/Q109V 1.06
S087N/G118V/S128L/P129Q/S130A/S024W/Q109T 0.95
S087N/G118V/S128L/P129Q/S130A/S024W/Q109L 0.61
S087N/G118V/S128L/P129Q/S130A/S024H/Q109V 0.97
S087N/G118V/S128L/P129Q/S130A/S024R 0.84
S087N/G118V/S128L/P129Q/S130A/S024H 1.04
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L 0.86
S087N/G118V/S128L/P129Q/S130A/Q109T 1.05
S087N/G118V/S128L/P129Q/S130A/S024R/Q109V 0.91
S087N/G118V/S128L/P129Q/S130A/S024W/Q109I 1.04
S087N/G118V/S128L/P129Q/S130A/Q109V 1.03
S087N/G118V/S128L/P129Q/S130A/S024W 1.01
S087N/G118V/S128L/P129Q/S130A/G127T 0.90
S087N/G118V/S128L/P129Q/S130A/Q109I 1.10
S087N/G118V/S128L/P129Q/S130A/S024T 0.98
S087N/G118V/S128L/P129Q/S130A/S024N/Q109K 1.11
S087N/G118V/S128L/P129Q/S130A/R045S 0.50
S087N/G118V/S128L/P129Q/S130A/A001N/R045N/I107T 0.72
S087N/G118V/S128L/P129Q/S130A/A001S/S024L/R045L/I107W/A172F 0.60
S087N/G118V/S128L/P129Q/S130A/S024R/I107T/A172Q 0.67
S087N/G118V/S128L/P129Q/S130A/A001K/S024W/R045N/I107T 0.60
S087N/G118V/S128L/P129Q/S130A/S024N/I107V 0.92
S087N/G118V/S128L/P129Q/S130A/S024H/I107V/A172S 0.99
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/A172Q 0.58
S087N/G118V/S128L/P129Q/S130A/S024T/I107T/A172Q 0.82
S087N/G118V/S128L/P129Q/S130A/A001K/I107T 0.57
S087N/G118V/S128L/P129Q/S130A/S024W/I107T 0.92
S087N/G118V/S128L/P129Q/S130A/S024T/R045N/I107V/A172S 0.98
S087N/G118V/S128L/P129Q/S130A/A001C/S024E/I107G 0.95
S087N/G118V/S128L/P129Q/S130A/S024N/I107N 0.89
S087N/G118V/S128L/P129Q/S130A/S024H/R045N/I107T 0.94
S087N/G118V/S128L/P129Q/S130A/R045N/I107V/A172P 1.08
S087N/G118V/S128L/P129Q/S130A/R045F/I107T/A172Q 0.89
S087N/G118V/S128L/P129Q/S130A/A001K/R045F 0.56
S087N/G118V/S128L/P129Q/S130A/S024R/I107V/A172S 0.85
S087N/G118V/S128L/P129Q/S130A/S024R/R045F/I107T 0.77
S087N/G118V/S128L/P129Q/S130A/S024T 0.99
S087N/G118V/S128L/P129Q/S130A/R045N/A172Q 1.02
S087N/G118V/S128L/P129Q/S130A/S024W/R045F/I107V/A172Q 0.95
S087N/G118V/S128L/P129Q/S130A/S024W/S099K 0.74
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S103P 0.68
S087N/G118V/S128L/P129Q/S130A/S099T/S103N/S132H 0.62
S087N/G118V/S128L/P129Q/S130A/S099Q/S103N 0.93
S087N/G118V/S128L/P129Q/S130A/S099Q 0.98
S087N/G118V/S128L/P129Q/S130A/S024W 1.01
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N/S132N 0.89
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S132N 1.01
S087N/G118V/S128L/P129Q/S130A/S024W/S099T 0.97
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P/S132H 1.14
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N 0.91
S087N/G118V/S128L/P129Q/S130A/S103N/S132H 1.02
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/G127R/S132H 1.14
S087N/G118V/S128L/P129Q/S130A/S099K/S103N 0.72
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S132N 1.00
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103P 0.87
S087N/G118VIS128L/P129Q/S130A/S024H/S099Q 1.04
S087N/G118V/S128L/P129Q/S130A/S103P 1.01
S087N/G118V/S128L/P129Q/S130A/S099K/S132H 0.97
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q/S103P 0.52
S087N/G118V/S128L/P129Q/S130A/S024H/S103P/S132N 1.07
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P/S132N 1.15
S087N/G118V/S128L/P129Q/S130A/S099T/S132H 1.14
S087N/G118V/S128L/P129Q/S130A/S024L/S099K/S103P/S132N 0.84
S087N/G118V/S128L/P129Q/S130A/S099T/S103N 0.91
S087N/G118V/S128L/P129Q/S130A/S099K/S103P 0.82
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S132N 1.00
S087N/G118V/S128L/P129Q/S130A/S024H/S099T/S103P 0.94
S087N/G118V/S128L/P129Q/S130A/S099Q/S132H 0.86
S087N/G118V/S128L/P129Q/S130A/S099T/G127Q 0.66
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132H 1.10
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103P/S132H 1.34
S087N/G118V/S128L/P129Q/S130A/S099K 0.82
S087N/G118V/S128L/P129Q/S130A/S099Q/S103P/S132H 1.11
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q 0.93
S087N/G118V/S128L/P129Q/S130A/S099T/S103P 0.61
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N 0.73
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S132N 0.95
S087N/G118V/S128L/P129Q/S130A/S099Q/S103P 0.83
S087N/G118V/S128L/P129Q/S130A/S099T/S103P/S132H 1.09
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q/S103N/G127R/S132N 0.92
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N/S132N 0.74
S087N/G118V/S128L/P129Q/S130A/S024W/S099K/S132H 0.93
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W 1.23
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185Q/A215I/S256W 0.86
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/S256W 1.09
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/Y209W/S256W 1.11
S087N/G118V/S128L/P129Q/S130A/Y209W/S256W 1.08
S087N/G118V/S128L/P129Q/S130A/N018Q/Y209W/S256W 0.98
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/A215V/S256R 0.97
S087N/G118V/S128L/P129Q/S130A/N185K/A215V/S256W 1.31
S087N/G118V/S128L/P129Q/S130A/N018Q/A215R/S256W 0.55
S087N/G118V/S128L/P129Q/S130A/A215V/S256W 1.37
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V/S256W 1.26
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V 1.26
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215V/S256W 0.59
S087N/G118V/S128L/P129Q/S130A/G097P/N185R/A215I/S256W 1.13
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W/A215I 0.57
S087N/G118V/S128L/P129Q/S130A/N018Q/A215I/S256W 1.20
S087N/G118V/S128L/P129Q/S130A/G097P/N185Q/Y209W/A215V/S256W 1.16
S087N/G118V/S128L/P129Q/S130A/Y209W/A215I/S256W 1.50
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215V/S256W 0.82
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215R 0.66
S087N/G118V/S128L/P129Q/S130A/N018Q/G097P/N185R 0.71
S087N/G118V/S128L/P129Q/S130A/N185R/A215V/S256W 1.06
S087N/G118V/S128L/P129Q/S130A/A215V 1.19
S087N/G118V/S128L/P129Q/S130A/G097P/N185K/A215I 1.28
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W/A215V 0.75
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215V 1.17
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/S256L 0.93
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/S256W 0.82
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215V/S256W 1.31
S087N/G118V/S128L/P129Q/S130A/P052I/N248K 0.83
S087N/G118V/S128L/P129Q/S130A/N043W/S101F/N248K 0.93
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101Y 0.76
S087N/G118V/S128L/P129Q/S130A/N043V/S101T 0.72
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F/N248K 0.63
S087N/G118V/S128L/P129Q/S130A/P052V 0.96
S087N/G118V/S128L/P129Q/S130A/N043S 1.19
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y 0.79
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101R 1.08
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101F 1.10
S087N/G118V/S128L/P129Q/S130A/N043F/P052V/S101T/N248K 0.85
S087N/G118V/S128L/P129Q/S130A/N043I/S101E/N248K 0.81
S087N/G118V/S128L/P129Q/S130A/S101E/N248K 1.02
S087N/G118V/S128L/P129Q/S130A/N248K 0.69
S087N/G118V/S128L/P129Q/S130A/N043W/S101E 1.10
S087N/G118V/S128L/P129Q/S130A/N043S/S101E/N248K 1.00
S087N/G118V/S128L/P129Q/S130A/P052I/S101V/N248K 0.84
S087N/G118V/S128L/P129Q/S130A/S101F/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/N043V/S101T/N248K 0.73
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/N248K 0.70
S087N/G118V/S128L/P129Q/S130A/N043S/S101N/N248I 1.03
S087N/G118V/S128L/P129Q/S130A/S101Y 1.02
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101Y/N248K 1.00
S087N/G118V/S128L/P129Q/S130A/N043I/S101N 0.74
S087N/G118V/S128L/P129Q/S130A/N043E/P052V/S101E/N248K 1.23
S087N/G118V/S128L/P129Q/S130A/N043V/P052I 0.73
S087N/G118V/S128L/P129Q/S130A/P052I/S101F/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/P052V/S101E/N248I 0.83
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101E/N248K 1.05
S087N/G118V/S128L/P129Q/S130A/N043E 1.14
S087N/G118V/S128L/P129Q/S130A/N043S/S101T 1.20
S087N/G118V/S128L/P129Q/S130A/N043V/S101F 0.75
S087N/G118V/S128L/P129Q/S130A/N043V/P052I/S101T/N248K 0.66
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y/N248I 0.78
S087N/G118V/S128L/P129Q/S130A/N043E/S101R 1.26
S087N/G118V/S128L/P129Q/S130A/N043S/P052I/N248K 1.11
S087N/G118V/S128L/P129Q/S130A/N043E/S101Y 1.41
S087N/G118V/S128L/P129Q/S130A/N043E/S101E 1.25
S087N/G118V/S128L/P129Q/S130A/N043I/P052I/S101F/N248K 0.63
S087N/G118V/S128L/P129Q/S130A/N043T/N248K 0.98
S087N/G118V/S128L/P129Q/S130A/N043T/P052I/S101Y 1.11
S087N/G118V/S128L/P129Q/S130A/P052V/S101R 0.82
S087N/G118V/S128L/P129Q/S130A/N043I/P052V/S101F/N248K 0.71
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y/N248K 0.91
S087N/G118V/S128L/P129Q/S130A/P052I/S101E/N248K 1.08
S087N/G118V/S128L/P129Q/S130A/S101N/N248K 0.89
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248K 0.61
S087N/G118V/S128L/P129Q/S130A/N043V/S101R 0.70
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S101F 0.69
S087N/G118V/S128L/P129Q/S130A/S101E 1.03
S087N/G118V/S128L/P129Q/S130A/N043F/S101Y/N248K 0.96
S087N/G118V/S128L/P129Q/S130A/N043S/P052V 1.07
S087N/G118V/S128L/P129Q/S130A/N043W/P052V/S101Y 1.05
S087N/G118V/S128L/P129Q/S130A/N043S/P052I 1.13
S087N/G118V/S128L/P129Q/S130A/N043T/S101E/N248I 1.14
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248I 0.74
S087N/G118V/S128L/P129Q/S130A/N043V/S101R/N248I 0.57
S087N/G118V/S128L/P129Q/S130A/N248I 1.00
S087N/G118V/S128L/P129Q/S130A/N043E/P052I/S101Y/N248K 0.97
S087N/G118V/S128L/P129Q/S130A/S101R/N248K 0.86
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/N248K 0.96
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y 0.79
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y/N248K 0.72
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101V/N248K 0.93
S087N/G118V/S128L/P129Q/S130A/N043T 0.89
S087N/G118V/S128L/P129Q/S130A/N043T/P052V/S101Y/N248K 0.88
S087N/G118V/S128L/P129Q/S130A/P052V/S144T 0.93
S087N/G118V/S128L/P129Q/S130A/Y209W 1.01
S087N/G118V/S128L/P129Q/S130A/G097S/S144Y/S256I 0.96
S087N/G118V/S128L/P129Q/S130A/N043S/N185V/S256T 1.10
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W 0.99
S087N/G118V/S128L/P129Q/S130A/G097S/S144V/Y209W/S256I 0.85
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/S256I 0.91
S087N/G118V/S128L/P129Q/S130A/G097T/S144W/Y209W/S256I 0.77
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W/S256I 0.55
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W 0.66
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185R/S256P 0.78
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/Y209W 0.71
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185R/Y209W/S256I 0.62
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256T 0.96
S087N/G118V/S128L/P129Q/S130A/P052V/G097T/N185R/Y209W/S256T 0.70
S087N/G118V/S128L/P129Q/S130A/N043S/S144W/N185V/S256T 0.93
S087N/G118V/S128L/P129Q/S130A/S144W/Y209W 0.94
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/Y209W 1.03
S087N/G118V/S128L/P129Q/S130A/S144V/N185V 1.01
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/Y209W 0.76
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R 0.68
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/N185V 0.70
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W 0.73
S087N/G118V/S128L/P129Q/S130A/S144T/N185R 0.68
S087N/G118V/S128L/P129Q/S130A/S144T/Y209W/S256I 0.99
S087N/G118V/S128L/P129Q/S130A/N043V/S144Y/N185V/Y209W/S256I 0.68
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/S256I 0.52
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/Y209W/S256T 0.66
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256I 0.86
S087N/G118V/S128L/P129Q/S130A/N043V/S144W/Y209W/S256I 0.59
S087N/G118V/S128L/P129Q/S130A/N185V/Y209W 0.90
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/S256T 0.56
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/S256I 1.06
S087N/G118V/S128L/P129Q/S130A/N043S/N185R/Y209W/S256T 0.93
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/Y209W 1.01
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185R/Y209W 0.66
S087N/G118V/S128L/P129Q/S130A/S144V 1.04
S087N/G118V/S128L/P129Q/S130A/N043T/S144V/Y209W/S256T 0.98
S087N/G118V/S128L/P129Q/S130A/S144Y/N185V/Y209W 1.02
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W/S256I 1.06
S087N/G118V/S128L/P129Q/S130A/N185R/S256T 0.66
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/N185V/Y209W/S256I 0.86
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/Y209W/S256T 0.93
S087N/G118V/S128L/P129Q/S130A/S144T/S256I 0.99
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/S256I 0.52
S087N/G118V/S128L/P129Q/S130A/N043S/S256I 1.11
S087N/G118V/S128L/P129Q/S130A/S144Y/N185R/Y209W/S256T 0.65
S087N/G118V/S128L/P129Q/S130A/N043V/P052V/S144W/S256T 0.70
S087N/G118V/S128L/P129Q/S130A/N043V/N185V/Y209W/S256I 0.77
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V/Y209W/S256I 0.91
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/S256I 0.91
S087N/G118V/S128L/P129Q/S130A/P052V/S144V/Y209W 0.85
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/N185R/Y209W/S256I 0.65
S087N/G118V/S128L/P129Q/S130A/N043S/S144W 1.09
S087N/G118V/S128L/P129Q/S130A/N043V/S144T/N185V/S2561 0.63
S087N/G118V/S128L/P129Q/S130A/P052V/S144Y/N185V 0.94
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W/S256T 0.88
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/V104I/S164I 0.60
S087N/G118V/S128L/P129Q/S130A/S164I 1.04
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164I 0.64
S087N/G118V/S128L/P129Q/S130A/R045K/I072C/L126F 0.84
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164F 0.75
S087N/G118V/S128L/P129Q/S130A/I072C/S164I 0.83
S087N/G118V/S128L/P129Q/S130A/A001K/S164F 0.72
S087N/G118V/S128L/P129Q/S130A/S164Q 0.92
S087N/G118V/S128L/P129Q/S130A/I072C/L126F 0.83
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164Q 0.65
S087N/G118V/S128L/P129Q/S130A/A001K/S164I 0.74
S087N/G118V/S128L/P129Q/S130A/I072C/S164Q 0.89
S087N/G118V/S128L/P129Q/S130A/A001K/L126F/S164F 0.92
S087N/G118V/S128L/P129Q/S130A/A001K/I072C/S164I 0.52
S087N/G118V/S128L/P129Q/S130A/L126F/S164I 0.91
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164I 0.76
S087N/G118V/S128L/P129Q/S130A/I072V/S164F 1.08
S087N/G118V/S128L/P129Q/S130A/I072C/L126F/S164F 0.84
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164F 1.03
S087N/G118V/S128L/P129Q/S130A/V104I/S164Q 1.06
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164Q 0.74
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164I 0.98
S087N/G118V/S128L/P129Q/S130A/I072C 0.85
S087N/G118V/S128L/P129Q/S130A/V104I/S164I 0.97
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/V104I/L126F/S164F 0.71
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164F 0.74
S087N/G118V/S128L/P129Q/S130A/I072P 0.96
S087N/G118V/S128L/P129Q/S130A/L126F 1.00
S087N/G118V/S128L/P129Q/S130A/I072C/V104I/L126F/S164I 0.80
S087N/G118V/S128L/P129Q/S130A/V104I 0.92
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164F 0.66
Evaluation of Protein Content of Multiple Mutation Library (MML)
Variant Cultures Expressing GCI-P036
[0301] Recombinant expression of variants of GCI-P036 was measured
by assessing protein content of cultures in the TCA assay of
Example 1. Cloning of the combinatorial library was performed by
Sloning BioTechnology using Slonomax Technology. Preparation of
variant protease samples was performed as described above. Briefly,
MML variants were tested in a TCA assay using the methods of
Example 1. As described throughout, functionality of protease
variants was quantified as a performance index (PI), which is the
ratio of performance of a variant to that of a reference protease.
The substitutions are listed relative to the GCI-P036 reference
protease using BPN' numbering and the PI is determined in
relationship to the GCI-P036 reference. Results are shown in Table
7-9.
TABLE-US-00024 TABLE 7-9 Multiple Mutation Variants of GCI-P036
Having a PI .gtoreq. 0.5 in a TCA Assay PI G097P/N185Q/A215I 1.59
N018R/N185R/S256W 1.08 N018Q/N185R/A215R 1.16
N018Q/N185Q/Y209W/S256W 1.17 N018K/G097P/N185K/S256W 1.72
N185K/Y209W/S256W 0.66 N018Q/N185K/Y209W/A215V/S256W 1.10
N018R/N185Q/A215V/S256W 1.15 N018R/G097P/Y209W/S256W 1.48
N018R/N185R/Y209W/S256W 1.14 N018K/N185R/A215R/S256W 1.01
N185Q/A215R/S256W 1.06 N018K/A215R 0.98
N018K/G097P/Y209W/A215V/S256W 1.52 N018K/N185R/A215V 1.18
N018K/N185K/Y209W/A215R 1.29 N185K/A215V 0.98 N018K/N185K 1.01
N018R/N185R/A215R 1.09 N018K/G097P/N185K/Y209W/A215I/S256W 1.44
G097P/Y209W/A215V/S256W 1.63 N018K/N185K/S256W 0.91
N018R/Y209W/S256W 1.19 N018Q/N185K/S256W 1.12
N018K/N185Q/A215V/S256W 1.00 N018K/S256W 1.19
N018R/Y209W/A215V/S256W 1.04 N018Q/G097P/N185K/Y209W 1.08
N018R/G097P/Y209W/A215V 1.52 N185R/S256W 1.03
N018K/G097P/N185Q/Y209W/A215V/S256W 1.44
N018K/G097P/N185R/A215R/S256W 2.30 N018K/N185R/A215I/S256W 1.13
N185R/Y209W/A215I 1.18 N018R/N185K/S256W 1.06
N018K/G097P/N185R/S256W 1.70 N018K/N185Q/A215R/S256W 1.15
N018K/N185K/A215V/S256W 1.16 N018Q/N185R/S256W 1.06 N018K/A215I
0.57 N018Q/N185Q/A215V 1.07 N018R/N185Q/Y209W/S256W 1.13
N185R/Y209W/S256W 0.95 N018K/N185Q/Y209W/S256W 1.19
N018Q/N185K/Y209W/A215V 1.10 N018K/A215V 0.91 N018Q/N185Q/S256W
1.16 N018K/N185Q/S256W 0.68 N018R/N185K/A215V/S256W 1.14
N018Q/N185K 1.31 N018K/G097P/N185R/Y209W 1.38
N018K/N185R/Y209W/A215V/S256W 1.20 N018Q/N185K/Y209W/A215I/S256W
1.13 N018K/G097P/N185R/A215V/S256W 2.14 N018K/G097P/A215I/S256W
2.49 N018R/G097P/N185Q/A215I 1.83 N018Q/G097P/N185K/A215V 1.30
N185Q/S256W 1.06 N018K/G097P/N185R/Y209W/S256W 1.31
N043V/S101T/N248K 0.89 N043S/N117Y/N248K 0.79 N043E/S101E 0.87
N043S/S101E/N117Y/N248K 0.94 S101R/N248K 1.13 N043E/S101V 0.57
N043S/S101Y/N117I 0.74 N043I/N117Y 0.94 N043S/S101F 0.89
S101E/N117Y/N248K 0.78 S101Y/N117Y 0.86 N043V/S101V/N248K 0.90
N043I/S101R/N248K 0.64 N043F/N117I 1.07 S101F/N248K 0.80
N043S/S101Y/N248K 0.75 N043S/N248I 0.62 N043I/S101E/N248I 0.67
N043V/S101R/N117I/N248K 1.03 N043V/S101F/N248K 0.96 S101T/N248I
0.75 N043E/S101Y/N117Y/N248K 0.67 N043V/S101Y/N117I 0.75
N043V/S101V/N117I 0.68 S101Y/N248K 0.81 N043S/S101R/N117I/N248K
0.99 N043V/N248I 0.51 N043F/S101E/N117I/N248K 0.53
N043V/S101F/N117Y 0.70 N043E/S101F 0.80 N043S/S101N/N117I 0.77
N043I/S101N/N117Y/N248K 0.90 S101F/N117I/N248I 0.58
S101F/N117Y/N248K 1.07 N043I/S101F/N117Y/N248K 0.54
N043S/S101F/N248K 0.72 N043E/S101N/N117Y 0.99 S101T/N117Y/N248K
0.96 N043S/S101E/N248K 0.87 S101R/N117I/N248K 0.83
N043E/S101Y/N117I/N248K 0.66 N043E/S101E/N248K 0.90 N043V/S101Y
0.83 S101F/N117Y/N248I 0.77 N043F/S101R 0.79 N043V/S101E/N248I 0.92
N043V/N248K 0.89 S101E/N117I 0.64 N043V/S101Y/N117I/N248K 0.77
N043S/S101E 0.89 S101R/N117Y 0.50 N043I/S101Y/N117Y/N248K 0.99
N043V/S101F 0.85 N043S/S101Y/N117Y 0.76 S101Y/N117I/N248K 0.96
P052I/S144Y/N185R/Y209W 0.91 P052V/S144T 0.70 S144Y/Y209W/S256I
0.82 P052I/S144Y/Y209W/S256I 0.71 S144T/N185V 0.96
S144V/N185R/Y209W/S256T 0.90 M119F/Y209W 1.39 M119F/N185V/Y209W
0.95 M119F/N185R 1.33 S144V/Y209W 0.87
P052I/S144T/N185R/Y209W/S256T 0.65 P052I/N185V/Y209W 0.78
P052V/S144V/N185R/Y209W/S256T 0.74 S144W/S256I 0.73
S144V/N185R/Y209W 0.97 P052V/S144W/Y209W 0.64
P052V/M119F/S144T/Y209W 0.64 P052V/S144T/Y209W/S256I 0.71
P052V/S144Y/Y209W 0.75 P052I/S144T/Y209W/S256T 0.57
P052I/N185R/Y209W/S256I 0.79 P052V/M119F/S144T/N185R/Y209W 0.64
P052V/N185V/Y209W/S256I 0.67 P052I/S144Y/N185V/S256T 0.60
S144V/N185R/S256I 0.93 S144T/N185R 0.98 P052I/S144Y/N185V 0.62
P052I/S144Y/S256T 0.51 P052V/M119F/S144T 0.54
M119F/N185R/Y209W/S256T 1.09 P052I/S144T/N185V/Y209W/S256T 0.70
M119F/Y209W/S256I 0.90 S144W/N185R/Y209W/S256T 0.83
P052V/S144V/N185V/Y209W 0.81 P052I/M119F 0.74
M119F/S144W/N185R/S256L 0.75 P052V/S144W/N185V/Y209W 0.75
N185V/Y209W 1.03 P052I/S144V/Y209W 0.81 S144W/N185V/Y209W/S256I
0.80 M119F/S144T/N185V/S256I 0.93 P052I/N185V/Y209W/S256I 0.69
S144T/N185R/Y209W/S256I 0.89 P052V/M119F/N185V/Y209W/S256I 0.56
P052I/S144T 0.70 S144T/N185R/Y209W/S256T 1.06 S144V/S256I 0.74
P052I/S144T/S256I 0.69 P052V/S144T/N185V/Y209W/S256T 0.73
P052V/S144Y/S256T 0.62 P052I/S144T/Y209W/S256I 1.19 P052V/S256T
0.68 P052V/S144V/Y209W/S256I 0.66 P052V/S144T/N185V/Y209W/S256I
0.62 A001K/R045K/I072V/L126F/S164Q 1.38 A001K/L126F/S164Q 1.03
A001K/R045F/V104I/L126F/S164Q 1.58 A001K/I072V/V104I 1.13
A001K/R045K/I072V/S164F 1.18 A001K/L126F 0.76
A001K/R045F/I072V/V104G/S164T 1.25 R045L/I072S/S164I 1.03
L126A/S164N 0.99 A001K/L126F/S164F 1.42 R045K/L126F/S164F 1.66
A001K/R045K/I072V/V104I/L126F/S164F 1.71
A001K/I072C/V104I/L126F/S164Q 1.53 A001K/I072V/V104I/S164F 1.25
A001K/V104I/L126F/S164I 1.56 A001K/R045K/L126F 0.73
A001K/R045F/L126F/S164I 1.84 A001K/R045K/L126F/S164I 1.10
A001L/I072C 1.55 A001K/R045K/I072V/S164Q 1.39
A001K/I072C/L126F/S164Q 1.53 A001K/R045F/S164F 0.60 A001K/V104E
1.25 A001K/I072C/L126F 1.05 L126F/S164V 1.32
R045F/I072V/L126F/S164Q 0.59 A001K/R045S/V104C/L126Y/S164F 1.25
A001K/R045F/I072V/L126F/S164I 1.87 A001K/V104I/L126F/S164Q 1.52
A001K/R045K/V104I/S164Q 1.60 A001K/R045K/I072V/L126F 1.21
A001K/R045K/V104L/S164A 1.20 A001K/R045F/L126F/S164F 1.61
A001K/I072V/V104I/S164Q 1.27 A001K/I072V/L126F 0.88
A001K/I072V/L126F/S164F 1.19 V104E/L126I/S164L 1.14
A001K/R045K/L126F/S164Q 0.70 A001K/R045F/I072V/S164F 0.54
A001K/I072V 1.26 A001K/R045F/I072C/L126F 0.52 A001K/V104I/L126F
1.43 A001K/R045K/I072V/V104I/L126F/S164Q 1.37
A001K/R045K/I072V/L126F/S164F 1.26 A001K/R045F/I072V/L126F/S164Q
1.98 A001K/R045K/I072C/L126F/S164Q 1.69 A001K/R045K/S164F 0.86
A001K/R045F/I072C/V104I/S164F 0.68 A001K/R045F/I072C 0.76
A001K/S164Q 0.91 A001K/R045K/L126F/S164P 1.33
A001K/I072C/V104I/L126F 1.79 A001K/L126F/S164I 1.56
S024W/Q109V/G118S/S132Y 0.85 S024W/Q109K/G118R 1.58 S024H/Q109L
2.53 S024V/Q109R/G118F 1.64 S024R/Q109V 1.18 S024W/Q109I 1.17
S024V/Q109C/G118L 0.90 S024R/Q109T/S132Y 1.41 S024H/Q109T/G118R
1.72 S024R/G118R/S132N 1.30 Q109I/S132N 0.62 Q109I/G118S 1.07
S024C/Q109K/G118I 1.58 S024W/Q109L 1.20 S024W/Q109T/G118L 0.81
Q109A/G118S 1.49 S024R/S132Y 1.71 Q109P/G118Q 1.75
S024V/Q109R/G118F 1.14 S024R/Q109V 0.89 Q109T/G118N 1.49
S024V/Q109C/G118L 0.81 S024H/Q109T/G118R 0.93
S024R/Q109V/S132N 0.56 Q109I/G118S 1.13 S024C/Q109K/G118I 1.80
S024W/Q109L 0.93 Q109I/G118R 0.73 Q109A/G118S 1.25 Q109V/G118F 1.34
Q109P/G118Q 1.42 S024W/Q109T/G118R/G127Q/S132N 0.73
S024W/Q109V/G127T/S132Y 1.13 S024R/Q109L/G127Q 0.52 S024H/G127R
1.58 S024R/Q109C/G127H 1.57 S024R/Q109R/G118T/G127R 1.12
S024V/Q109L/G118V 0.83 S024W/G127R 1.01 Q109S/G118R 0.96
S024N/Q109T/G127R/S132N 0.93 S024H/G118L/G127T/S132Y 1.94
S024R/Q109V/G127S 1.22 Q109H/G127R 0.85 S024N/Q109T/G127T/S132R
2.06 Q109I/G127T/S132Y 1.31 S024R/G118H/S132V 1.16
S024R/Q109T/G127R/S132N 0.95 S024N/G127R 1.93 Q109D/G118V/G127H
1.03 S024W/G118L/G127T/S132Y 1.96 S024R/Q109I/G127T 0.57
S024R/Q109T/G127T/S132Y 1.61 S024R/Q109K/G118T/G127Q/S132N 1.57
S024W/Q109L/G127R/S132N 1.11 S024W/Q109T/G127R/S132R 0.73
S024L/Q109K/G127R/S132Y 1.07 Q109H/G118S/S132P 0.68
S024W/Q109V/G127T 0.88 S024N/Q109V/G127R/S132N 0.69
S024N/G118R/G127L/S132Y 0.87 S024N/S132R 2.10
Q109K/G118F/G127Q/S132N 1.85 S024R/Q109T/G127R/S132Y 0.68
Q109V/G127R 0.76 S024H/Q109V/G127T 1.28 S024A/Q109Y/G118C 1.23
S024H/Q109V/G127R/S132N 0.63 S024T/Q109I/G127T 1.61
S024N/Q109T/G127T/S132Y 1.93 S024A/G118I 1.15 G118L/G127R/S132L
0.91 Q109V/G127R/S132N 0.79 S024N/Q109V/G118R/G127T/S132Y 1.15
S024W/Q109I/G127T 1.24 S024R/Q109V/G118R/G127T 0.80 Q109R/G118V
1.31 Q109I/G127C 2.19 S024W/Q109R/G127T/S132N 2.42
S024L/Q109V/G118R/G127Q 0.52 Q109V/G127Q 1.18 S024Q/Q109R/S132R
1.64 S024H/G118K/G127I 1.10 A001K/S024R/R045N/A172C 1.20
A001S/S024L/I107Y/A172S 1.18 I107C/A172S 1.24 A001R/S024H/I107T
1.43 A001R/S024H/R045N/I107T/A172Q 1.37 R045F/I107T 1.70
R045V/I107R/A172D 0.80 A001R/A172Q 1.11 S024T/R045K/I107V 1.08
A001V/I107L/A172I 1.02 S024T/I107T 1.75 A001T/S024H/I107L/A172Y
1.01 A001R/S024W/R045K/I107T/A172Q 1.40 A001R/S024R/I107V/A172L
0.87 S024N/R045K/A172L 1.43 A001R/R045N/I107T 1.33
A001K/S024R/I107T 0.51 A001R/I107T 1.47 S024N/I107T 1.81
A001R/R045K/A172Q 1.32 R045K/I107T 2.13 A001K/S024L/R045A 1.07
A001R/R045F 1.16 A001R/S024W/R045N/I107T 1.45 I107Q/A172D 0.94
A001R/S024R/A172Q 1.19 A001K/A172L 1.10 A001S/A172V 0.96
A001I/R045T/I107R/A172T 0.98 A001R/S024H/R045K/I107T 1.50
S024W/A172Q 1.28 S024W/R045N/A172Q 1.08 S024V/R045I/A172V 1.11
R045N/I107T/A172Q 1.44 A001R/S024R 1.30 A001K/A172W 1.49
A001R/S024N 1.11 A001R/S024R/A172H 1.36 R045S/I107L 1.22
A001R/S024T/R045N/I107T/A172Q 1.60 A001Q/R045K/I107T 1.73
S024N/R045K/I107V/A172N 1.42 A001R/S024T/I107T/A172Q 1.40
A001K/S024N/R045K/A172Y 1.44 S024R/R045F/I107T/A172Q 1.84
A001R/I107T/A172Q 1.53 R045N/I107V/A172Q 0.89 A001R/I107V/A172Q
0.76 A001K/R045F/I107L/A172N 1.21 A001P/A172V 1.18 S024H/I107K 1.54
A001L/S024D/R045Y/I107Y 1.01 A001M/R045S/I107E/A172D 1.33
S024I/I107R/G127I/A172R 1.06 A001K/S024T/I107T/G127Q/A172Q 1.34
A001R/S024R/R045F/I107T/G127R 1.15 A001C/S024V/I107L 0.96
A001K/S024H/R045N/I107T 1.47 A001K/I107V/G127Q 1.80
A001K/S024R/R045N/I107T/G127R 1.12 A001R/S024T/R045K/A172Q 1.46
A001R/A172G 1.72 A001R/R045N/A172K 1.32 A001L/R045Q/G127H/A172R
1.23 A001K/I107V/G127R/A172Q 1.01 A001K/R045F/I107T 1.51
A001K/S024T/R045N/G127Q/A172Q 1.69 A001K/R045K/I107A/A172T 1.03
A001R/I107T/G127Q/A172Q 1.75 A001K/R045K/I107R/G127A/A172N 1.56
A001R/S024W/R045F/I107V/G127Q 1.11 R045N/I107A/A172R 1.07
A001R/R045N/I107T/G127Q 1.69 I107P/A172S 1.08
A001R/S024W/I107V/A172S 1.03 A001K/S024H/I107T/G127Q 1.45
A001R/S024H/R045K/I107T/A172Q 1.60 A001R/R045N/A172Q 1.42
A001K/R045F/I107V/G127Q 1.94 A001K/S024N/I107V/G127T 2.01
A001R/S024W/R045F/I107V/G127R 0.73 S024T/R045K/I107T/G127R/A172Q
0.75 A001K/R045N/I107T/G127Q 1.65 A001K/S024W/I107V/G127T/A172Q
1.45 A001K/I107V/G127Q/A172Q 1.68 A001R/R045N/I107V/G127R 1.53
A001K/S024H/I107T/G127R 1.35 A001R/I107T 1.65 A001K/S024H/I107V
0.88 I107A/G127K/A172G 1.35 A001R/R045K/G127R 1.26
A001R/R045K/I107T/G127Q 1.61 A001R/S024W/R045K 1.16
A001R/R045N/I107T 1.71 A001K/S024R/R045N/I107T 1.19
A001K/R045K/I107T/G127R/A172Q 1.21 A001K/I107T/A172Q 1.80
A001R/R045N/I107V/A172V 1.31 A001R/S024R/R045K/I107T/G127Q 1.68
A001R/R045N/I107V/G127Q/A172Q 1.70 A001R/S024R/I107V/G127R 1.52
A001R/S024R/R045F/I107T/G127Q 1.62
A001K/S024H/R045N/I107T/G127Q/A172Q 1.51 S024Y/G127R/A172E 1.06
A001K/S024W/I107T/G127R 0.94 A001R/R045K/I107V/G127R 1.36
A001K/R045K/I107T/G127R 1.35 A001R/S024T/R045K/I107L/G127P/A172P
1.17 S024W/S099Q 1.36 S024W/S099K/S103P/G118R/S132H 0.50
S099Q/S103N/S132H 1.03 S099K/G118R 1.97 S024W/S099T/S103P 0.72
S024W/S103K/S132R 1.08 S024W/S103P 1.61 S024W/S099T/S103P/G118R
1.12 S024H/S099Q/S103P 1.03 S024H/S099K/S103R/G118A/S132P 0.68
S024W/G118K 0.84 S024H/S099T/S103N/S132N 0.91
S099Q/S103N/G118R/S132N 1.13 S024W/S099T/S103N 1.09
S024W/S099Q/S103N/G118T 1.32 S024W/S132H 0.52 S103L/S132E 1.08
S103R/S132P 0.82 S099Q/S103P/G118R 1.13 S099Q/S103N/G118T 0.75
S024H/S099Q/S132N 1.03 S099K/S103N/G118T 1.13
S024H/S099Q/S103P/S132H 0.63 S024H/S132R 1.42
S024W/S099T/S103N/S132N 1.09 S024T/G118D 1.36 S099N/S132R 0.84
S099H/S103I/G118N 1.19 S024W/S099Q/S103N/G118R/S132N 1.05
S024W/S099Q/G118T 0.70 S024W/S099T/G118R/S132R 0.63
S024H/S099Q/S132H 1.56 S099Q/S132R 1.87 S024M/G118V 0.98
S024W/S132N 1.49 S099K/S103R/G118A/S132P 0.79
S024W/S099T/S103P/S132H 0.55 S024W/S099T/S103N/S132H 1.44
S099Q/G118T/G127Q 1.76 S024W/S099T/S103N/G118R 0.92 S099T/G118F
0.72 S024H/S099Q/G118R/G127Q/S132H 1.01 S103G/G118I/G127E/S132E
0.90 S024H/S099T/S103N 1.00 S024H/S099Q/S132H 0.83
S024W/S099Q/S103N/G118R/G127Q/S132N 0.95 S024W/S099K/S103P/S132H
0.72 S024H/S099Q/G118R/S132H 0.90 S024G/G118F/G127R/S132N 0.53
S024H/S099K/S103P/G118F 0.74 G118T/G127Q 1.62 S099T/G118R/S132H
1.12 S024H/S099K/G118F/G127R 0.92 S024H/S103P/G127R/S132R 1.07
S024N/S099T/G127T/S132H 2.06 S024H/S099T/S103N/G127R/S132N 0.98
S024H/S099K/G118R/G127R/S132H 0.60 S024L/G127R 1.00
S024W/G127R/S132N 0.77 S024W/S099T 0.85 S024H/S099T/S103P/S132N
1.15 S024W/S099T/S103N/G127R/S132H 0.69 S099T/S103P 1.31
S024W/S099T/G118R/G127Q 1.81 S024W/S132H 0.84 S024W/S099T/S103P
0.97 S024H/S099Q/S103N/G118R/G127T/S132N 1.54 S024H/S099K/S103P
1.67 S024W/S103P 1.77 S024H/S103N/S132H 1.41
S024W/S099Q/S103P/S132N 0.71 S024W/S099Q/S103P 1.20 S024H/S132N
0.81 S024W/S099T/G118R 0.52 S099K/S103P/G127Q 2.82
S099Q/G118F/G127R 1.58 S099Q/S103P/S132H 0.82
S024W/S099T/S103P/G118T 0.62 S024H/S099T/G118R 1.78
S024H/S099T/S103P/G118R 1.42
S087N/G118V/S128L/P129Q/S130A/S024R/Q109K 0.87
S087N/G118V/S128L/P129Q/S130A/S024R 0.72
S087N/G118V/S128L/P129Q/S130A/S024H 1.30
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L 0.82
S087N/G118V/S128L/P129Q/S130A/S024R/Q109V 1.09
S087N/G118V/S128L/P129Q/S130A/Q109V 0.57
S087N/G118V/S128L/P129Q/S130A/S024R/G127R 0.57
S087N/G118V/S128L/P129Q/S130A/S024W 0.71
S087N/G118V/S128L/P129Q/S130A/S024T/G127T 1.42
S087N/G118V/S128L/P129Q/S130A/G127T 1.22
S087N/G118V/S128L/P129Q/S130A/Q109I 0.58
S087N/G118V/S128L/P129Q/S130A/S024T 1.85
S087N/G118V/S128L/P129Q/S130A/S024N/Q109K 1.58
S087N/G118V/S128L/P129Q/S130A/G127Q 0.86
S087N/G118V/S128L/P129Q/S130A/S024R/Q109L/G127Q 0.59
S087N/G118V/S128L/P129Q/S130A/Q109L/G127Q 0.59
S087N/G118V/S128L/P129Q/S130A/R045S 1.31
S087N/G118V/S128L/P129Q/S130A/S024H/I107V/A172S 1.10
S087N/G118V/S128L/P129Q/S130A/A001K/I107W/A172P 1.06
S087N/G118V/S128L/P129Q/S130A/A001R 1.22
S087N/G118V/S128L/P129Q/S130A/A001K/R045N/I107V 1.05
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/A172Q 1.13
S087N/G118V/S128L/P129Q/S130A/A001R/S024W/A172W 0.90
S087N/G118V/S128L/P129Q/S130A/A172N 1.01
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172Q 1.03
S087N/G118V/S128L/P129Q/S130A/A001K/S024H/I107V 0.66
S087N/G118V/S128L/P129Q/S130A/A001R/R045K 0.89
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172W 1.06
S087N/G118V/S128L/P129Q/S130A/A001K/R045K/I107S 1.06
S087N/G118V/S128L/P129Q/S130A/S024T/R045N/I107V/A172S 0.75
S087N/G118V/S128L/P129Q/S130A/S024N/I107N 1.39
S087N/G118V/S128L/P129Q/S130A/A001K/S024T/I107V/A172W 1.04
S087N/G118V/S128L/P129Q/S130A/R045N/I107V/A172P 1.20
S087N/G118V/S128L/P129Q/S130A/A001K/R045F 0.74
S087N/G118V/S128L/P129Q/S130A/A001R/S024R/R045K/I107G/A172L 0.89
S087N/G118V/S128L/P129Q/S130A/S024R/I107V/A172S 1.08
S087N/G118V/S128L/P129Q/S130A/A001R/A172I 1.09
S087N/G118V/S128L/P129Q/S130A/A001R/S024H/R045K/A172N 1.04
S087N/G118V/S128L/P129Q/S130A/A001R/I107V/A172P 1.14
S087N/G118V/S128L/P129Q/S130A/S024T 1.32
S087N/G118V/S128L/P129Q/S130A/R045N/A172Q 1.20
S087N/G118V/S128L/P129Q/S130A/S024W/R045F/I107V/A172Q 0.91
S087N/G118V/S128L/P129Q/S130A/A001R/A172Q 1.12
S087N/G118V/S128L/P129Q/S130A/S024W/S099K 0.74
S087N/G118V/S128L/P129Q/S130A/S099Q/S103N 0.90
S087N/G118V/S128L/P129Q/S130A/S099Q 1.19
S087N/G118V/S128L/P129Q/S130A/S024W 0.59
S087N/G118V/S128L/P129Q/S130A/S024W/S099T 0.69
S087N/G118V/S128L/P129Q/S130A/S024W/S099T/S103N 1.00
S087N/G118V/S128L/P129Q/S130A/S099K/S103N 1.06
S087N/G118V/S128L/P129Q/S130A/S024H/S099Q 1.09
S087N/G118V/S128L/P129Q/S130A/S024W/G127T 0.83
S087N/G118V/S128L/P129Q/S130A/S099K 1.20
S087N/G118V/S128L/P129Q/S130A/S024W/S099Q 1.02
S087N/G118V/S128L/P129Q/S130A/S024H/S099K/S103N 1.09
S087N/G118V/S128L/P129Q/S130A/N018K/N185K 1.26
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/A215R 0.58
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W 1.22
S087N/G118V/S128L/P129Q/S130A/N018R/N185K 0.65
S087N/G118V/S128L/P129Q/S130A/N018K 1.07
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185Q/A215I/S256W 0.71
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/S256W 1.16
S087N/G118V/S128L/P129Q/S130A/N018Q/N185Q/Y209W/S256W 1.12
S087N/G118V/S128L/P129Q/S130A/N018Q/N185R/A215R/S256P 0.73
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W/A215I/S256W 1.00
S087N/G118V/S128L/P129Q/S130A/Y209W/S256W 1.27
S087N/G118V/S128L/P129Q/S130A/N018R/S256W 0.69
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/A215I/S256W 0.98
S087N/G118V/S128L/P129Q/S130A/N018K/N185R 1.24
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/S256W 1.15
S087N/G118V/S128L/P129Q/S130A/N018Q/Y209W/S256W 1.07
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/A215V/S256R 1.23
S087N/G118V/S128L/P129Q/S130A/N185K/A215V/S256W 1.10
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W 1.24
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/S256W 1.16
S087N/G118V/S128L/P129Q/S130A/N018R/Y209W/S256W 1.09
S087N/G118V/S128L/P129Q/S130A/N018K/A215R/S256W 1.13
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/A215R 0.74
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/Y209W/S256W 0.64
S087N/G118V/S128L/P129Q/S130A/N018Q/A215R/S256W 1.11
S087N/G118V/S128L/P129Q/S130A/N018K/G097P/N185R/Y209W 0.91
S087N/G118V/S128L/P129Q/S130A/A215V/S256W 0.98
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V/S256W 1.27
S087N/G118V/S128L/P129Q/S130A/N018R/N185R/A215R 1.07
S087N/G118V/S128L/P129Q/S130A/N185K/Y209W/A215V 1.32
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215V/S256W 1.10
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/A215V/S256W 0.60
S087N/G118V/S128L/P129Q/S130A/G097P/N185R/A215I/S256W 0.70
S087N/G118V/S128L/P129Q/S130A/N018R 1.22
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W/A215I 0.74
S087N/G118V/S128L/P129Q/S130A/N018Q/A215I/S256W 0.92
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q 1.21
S087N/G118V/S128L/P129Q/S130A/N018K/N185R/A215I/S256W 1.06
S087N/G118V/S128L/P129Q/S130A/G097P/N185Q/Y209W/A215V/S256W 1.41
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215R 1.12
S087N/G118V/S128L/P129Q/S130A/Y209W/A215I/S256W 0.90
S087N/G118V/S128L/P129Q/S130A/N018K/N185Q/A215V/S256W 1.11
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215R 1.32
S087N/G118V/S128L/P129Q/S130A/N018Q/G097P/N185R 0.72
S087N/G118V/S128L/P129Q/S130A/N185R/A215V/S256W 1.16
S087N/G118V/S128L/P129Q/S130A/N018R/N185K/Y209W 1.27
S087N/G118V/S128L/P129Q/S130A/A215V 0.79
S087N/G118V/S128L/P129Q/S130A/N018R/N185Q/A215I/S256W 0.74
S087N/G118V/S128L/P129Q/S130A/G097P/N185K/A215I 0.81
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215R 1.07
S087N/G118V/S128L/P129Q/S130A/N018K/Y209W/A215V 1.09
S087N/G118V/S128L/P129Q/S130A/N018K/N185K/Y209W 1.36
S087N/G118V/S128L/P129Q/S130A/N018R/G097P/N185K/Y209W/A215I/S256W
0.73 S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/A215V 1.44
S087N/G118V/S128L/P129Q/S130A/N185R/Y209W/S256L 1.31
S087N/G118V/S128L/P129Q/S130A/N018K/S256W 1.13
S087N/G118V/S128L/P129Q/S130A/N018Q/N185K/S256W 1.37
S087N/G118V/S128L/P129Q/S130A/N185Q/Y209W/A215V/S256W 1.28
S087N/G118V/S128L/P129Q/S130A/P052I/N248K 0.63
S087N/G118V/S128L/P129Q/S130A/N043W/S101F/N248K 0.51
S087N/G118V/S128L/P129Q/S130A/N043V/S101T 1.05
S087N/G118V/S128L/P129Q/S130A/P052V 0.84
S087N/G118V/S128L/P129Q/S130A/N043S 0.52
S087N/G118V/S128L/P129Q/S130A/N043V/S101Y 0.87
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101R 0.70
S087N/G118V/S128L/P129Q/S130A/N043F/P052V/S101T/N248K 0.51
S087N/G118V/S128L/P129Q/S130A/N043I/S101E/N248K 0.68
S087N/G118V/S128L/P129Q/S130A/S101E/N248K 0.90
S087N/G118V/S128L/P129Q/S130A/N248K 0.93
S087N/G118V/S128L/P129Q/S130A/N043W/S101E 0.88
S087N/G118V/S128L/P129Q/S130A/N043S/S101E/N248K 0.66
S087N/G118V/S128L/P129Q/S130A/P052I/S101V/N248K 0.75
S087N/G118V/S128L/P129Q/S130A/S101F/N248K 0.80
S087N/G118V/S128L/P129Q/S130A/N043V/S101T/N248K 0.89
S087N/G118V/S128L/P129Q/S130A/S101Y 0.89
S087N/G118V/S128L/P129Q/S130A/N043V/P052I 0.65
S087N/G118V/S128L/P129Q/S130A/N043E 0.98
S087N/G118V/S128L/P129Q/S130A/N043S/S101T 0.97
S087N/G118V/S128L/P129Q/S130A/N043V/S101F 0.79
S087N/G118V/S128L/P129Q/S130A/N043E/S101R 1.31
S087N/G118V/S128L/P129Q/S130A/N043E/S101Y 0.73
S087N/G118V/S128L/P129Q/S130A/N043E/S101E 0.87
S087N/G118V/S128L/P129Q/S130A/N043T/N248K 0.79
S087N/G118V/S128L/P129Q/S130A/P052V/S101R 0.89
S087N/G118V/S128L/P129Q/S130A/P052I/S101E/N248K 0.52
S087N/G118V/S128L/P129Q/S130A/S101N/N248K 0.86
S087N/G118V/S128L/P129Q/S130A/N043V/S101E/N248K 0.59
S087N/G118V/S128L/P129Q/S130A/N043V/S101R 1.17
S087N/G118V/S128L/P129Q/S130A/N043F/S101Y/N248K 0.70
S087N/G118V/S128L/P129Q/S130A/N043S/P052V 0.57
S087N/G118V/S128L/P129Q/S130A/S101R/N248K 1.45
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y 0.80
S087N/G118V/S128L/P129Q/S130A/N043I/S101Y/N248K 0.54
S087N/G118V/S128L/P129Q/S130A/N043S/P052V/S101V/N248K 0.53
S087N/G118V/S128L/P129Q/S130A/N043T 0.83
S087N/G118V/S128L/P129Q/S130A/Y209W 1.11
S087N/G118V/S128L/P129Q/S130A/N043S/N185V/S256T 0.52
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W 0.92
S087N/G118V/S128L/P129Q/S130A/S144V/N185R/Y209W 0.74
S087N/G118V/S128L/P129Q/S130A/S144V/Y209W/S256T 0.59
S087N/G118V/S128L/P129Q/S130A/P052V/G097T/N185R/Y209W/S256T 0.51
S087N/G118V/S128L/P129Q/S130A/G097S/N185R/S256I 0.75
S087N/G118V/S128L/P129Q/S130A/S144V/N185V/Y209W 0.71
S087N/G118V/S128L/P129Q/S130A/S144V/N185V 0.72
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/Y209W 0.70
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/Y209W 0.93
S087N/G118V/S128L/P129Q/S130A/S144T/N185R 0.91
S087N/G118V/S128L/P129Q/S130A/S144T/Y209W/S256I 0.77
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/N185R/S256T 0.54
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/S256I 0.64
S087N/G118V/S128L/P129Q/S130A/N043S/N185R/Y209W/S256T 1.05
S087N/G118V/S128L/P129Q/S130A/S144T/N185V/Y209W 1.04
S087N/G118V/S128L/P129Q/S130A/S144V 0.66
S087N/G118V/S128L/P129Q/S130A/N043T/S144V/Y209W/S256T 0.51
S087N/G118V/S128L/P129Q/S130A/S144Y/N185V/Y209W 0.50
S087N/G118V/S128L/P129Q/S130A/G097T/Y209W/S256I 0.68
S087N/G118V/S128L/P129Q/S130A/N185R/S256T 1.26
S087N/G118V/S128L/P129Q/S130A/P052V/S144T/Y209W/S256T 0.55
S087N/G118V/S128L/P129Q/S130A/S144T/S256I 0.65
S087N/G118V/S128L/P129Q/S130A/S144T/N185R/S256I 0.74
S087N/G118V/S128L/P129Q/S130A/N043S/S256I 0.75
S087N/G118V/S128L/P129Q/S130A/N043V/N185V/Y209W/S256I 0.76
S087N/G118V/S128L/P129Q/S130A/G097T/S144T/N185R/Y209W/S256I 0.53
S087N/G118V/S128L/P129Q/S130A/N043V/S144T/N185V/S256I 0.55
S087N/G118V/S128L/P129Q/S130A/P052V/Y209W/S256T 0.79
S087N/G118V/S128L/P129Q/S130A/S164I 1.19
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164I 1.19
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/S164F 1.15
S087N/G118V/S128L/P129Q/S130A/A001K/S164F 0.98
S087N/G118V/S128L/P129Q/S130A/S164Q 1.24
S087N/G118V/S128L/P129Q/S130A/A001K/S164I 0.95
S087N/G118V/S128L/P129Q/S130A/L126F/S164I 1.10
S087N/G118V/S128L/P129Q/S130A/I072V/S164F 0.82
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164F 1.02
S087N/G118V/S128L/P129Q/S130A/V104I/S164Q 0.84
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164Q 1.00
S087N/G118V/S128L/P129Q/S130A/V104I/L126F/S164I 1.00
S087N/G118V/S128L/P129Q/S130A/V104I/S164I 1.36
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/V104I/L126F/S164F 1.02
S087N/G118V/S128L/P129Q/S130A/A001K/I072V/S164F 0.59
S087N/G118V/S128L/P129Q/S130A/L126F 1.31
S087N/G118V/S128L/P129Q/S130A/V104I 1.38
S087N/G118V/S128L/P129Q/S130A/A001K/V104I/L126F/S164F 1.37
Example 8
Evaluation of Stain Removal by Multiple Mutation Library (MML)
Variants of GCI-P036
[0302] Results of experiments conducted to determine stain removal
activity (microswatch assay to determine cleaning performance in
automatic dishwashing detergents using CS-38 swatches), LAS/EDTA
stability, thermostability, and protein determination by a TCA
assay (tests of properties of interest) of variants of GCI-P036 are
shown in Table 8-1. The results were obtained using the methods
described in Example 1, with the following modifications for the
stain removal performance assay. The test detergents were heat
inactivated (CALGONIT.RTM. 5 in 1 and CASCADE.RTM. Complete) and
the MTP was sealed with adhesive foil and placed in an IEMS
incubator for 30 minutes with agitation at temperatures
indicated.
[0303] For testing stain removal performance and stability of
variant clones 1-44, diluted filtered culture supernatants were
used. For clones 100-105, purified samples at different
concentrations were used. The average of PI values for clones
100-105 calculated at 4 ppm and 6 ppm dosages is shown in Table
8-1. For clones 47-50 and clone 106, formulated ultra filtered
concentrate (UFC) of samples were used. Culture broths of Bacillus
subtilis cells expressing clones 47-50 were centrifuged at
9000.times.g for 30 minutes and the supernatant filtered through a
Seitz-EKS Depth filter (Pall) in a Buchner funnel, followed by
sterile Seitz-EKS Depth filter filtration under pressure and stored
at 4.degree. C. The resulting cell-free supernatant was
concentrated with a PALL UF-filtration unit, using a filter with a
cut-off of 10 kDa. The resulting ultrafiltered concentrate was
formulated by adding 51% (W/W) propylene glycol and 1.2% (W/W)
sodium formate. Formic acid was used to lower the pH to 6.0.
[0304] As described throughout, functionality of GCI-P036 variants
were quantified as a performance index (Pi), which is the ratio of
performance of a variant to a parent GCI-P036 protein. ND indicates
"not determined."
TABLE-US-00025 TABLE 8-1 P.sub.i Values of GCI-PO36 Variants Tested
for Stain Removal Performance on CS-38 Swatches, LAS/EDTA
Stability, Thermostability and Protein Determination Calgonit
Calgonit Cascade LAS- 5 in 1 5 in 1 Complete EDTA TCA Thermo- Clone
Variants based on GCI-P036 40.degree. C. 50.degree. C. 50.degree.
C. Stability Assay stability 1
S87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109K 1.93 2.23 1.5 0.93
1.12 0.9 2
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109R/N185R/A215R 2.27
3.29 1.87 0.02 0.57 1.14 3
S87N/G118V/S128L/P129Q/S130A/I72V/Q109R/S164I 0.98 0.88 1.16 0.99
0.85 1.08 4 S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/N248R
1.65 1.72 1.87 0.99 1.11 0.55 5
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109L/N185R/A215R ND
ND 1.37 0.02 0.3 1.17 6
S87R/G118R/S128L/P129Q/S130A/S101K/S188D/N248R 2.36 2.31 1.91 0.65
1.33 0.1 7 S87N/G118V/S128L/P129Q/S130A/S24W/S101L/Q109L 2.31 3.43
1.37 0.95 0.54 0.89 8
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/Q109R/N185R/A215R 8.01
5.85 1.91 0.03 0.45 1.1 9
S87N/G118V/S128L/P129Q/S130A/I72V/S101L/Q109R/S164I 2.94 3.58 1.9
0.99 0.65 1.14 10
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109R/S188D/T213E/N248R 1.25
1.92 1.71 1.09 1.06 0.11 11
S87R/G118R/S128L/P129Q/S130A/I72V/S164I/S188D/N248R 0.76 0.9 1.09
0.72 1.14 0.37 12 S87N/G118V/S128L/P129Q/S130A/N76D 0.48 0.71 0.97
1.4 0.97 1.04 13 S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109K 1.68
1.69 1.39 1.01 1.06 1.03 14
S87N/G118V/S128L/P129Q/S130A/N43S/P52V/S101R/Q109R 3.76 4.86 2.13
1.09 0.72 0.85 15
S87N/G118V/S128L/P129Q/S130A/I72V/S101Y/Q109R/S164I 5.94 4.01 1.95
1.03 0.63 1.2 16
S87N/G118V/S128L/P129Q/S130A/S101L/Q109L/S188D/N248R ND ND 1.66
1.08 0.37 0.62 17
S87N/G118V/S128L/P129Q/S130A/I72V/Q109R/S164I/S188D/N248R 0.67 0.98
0.56 1.1 0.59 0.88 18 S87N/G118V/S128L/P129Q/S130A/N76D/S101L 1.72
2.52 1.97 1.41 0.87 1.07 19
S87N/G118V/S128L/P129Q/S130A/S24W/S101Y/Q109L 3.89 4.14 1.65 1 0.5
1.04 20 S87N/G118V/S128L/P129Q/S130A/N76D/S164I 0.56 1.03 0.82 1.46
0.94 1.17 21 S87R/G118R/S128L/P129Q/S130A/N76D/S188D/N248R 0.93
1.20 1.24 1.54 1.39 0.7 22
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/N248R 3.8 4.24 1.83
1.11 0.46 0.72 23 S87R/G118R/S128L/P129Q/S130A/V118R/S188D/N248R
0.89 0.99 1.2 0.87 1.13 0.17 24
S87N/G118V/S128L/P129Q/S130A/N76D/S101M 1.05 1.63 1.35 1.48 0.94
1.09 25 S87N/G118V/S128L/P129Q/S130A/N18K/N76D/G97P/N185R/A215R
1.64 2.35 0.9 0.46 0.52 1.22 26
S87N/G118V/S128L/P129Q/S130A/I72V/S101L/S164I 2.01 2.72 1.85 1.01
0.59 1.23 27 S87R/G118R/S128L/P129Q/S130A/S101L/S188D/N248R 1.9
2.15 1.88 0.76 1.21 0.18 28
S87N/G118V/S128L/P129Q/S130A/S101Y/Q109L/S188D/T213E/N248R 2.7 2.98
1.72 1.07 0.52 0.2 29
S87R/G118R/S128L/P129Q/S130A/Q109L/S188D/N248R 0.94 1.24 1.27 0.78
1.02 0.22 30
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/N185R/A215R 3.94 4.66
1.32 0.02 0.48 1.3 31 S87N/G118V/S128L/P129Q/S130A/I72V/S101Y/S164I
1.95 2.74 1.68 1.05 0.58 1.26 32
S87N/G118V/S128L/P129Q/S130A/S101Y/T213E/N248R 4.32 4 1.87 0.96
0.71 0.36 33 S87N/G118V/S128L/P129Q/S130A/I72V/S101L/Q109L/S164I ND
ND 1.16 1.03 0.3 1.22 34
S87R/G118R/S128L/P129Q/S130A/S101V/S188D/N248R 2.62 2.65 1.74 0.77
1.35 0.19 35
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101Y/N185R/A215R 7.52 7.71
1.75 0.02 0.43 1.22 36
S87N/G118V/S128L/P129Q/S130A/I72V/S101V/S164I 1.92 2.51 1.72 1.01
0.84 1.2 37 S87N/G118V/S128L/P129Q/S130A/S101L/T213E/N248R 2.94
3.06 1.83 1 0.79 0.41 38
S87N/G118V/S128L/P129Q/S130A/I72V/S101Y/Q109L/S164I ND ND 0.98 1.04
0.29 1.21 39 S87R/G118R/S128L/P129Q/S130A/S101H/S188D/N248R 2.13
2.56 1.58 0.8 1.33 0.19 40
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/Q109R/N185R/A215R 2.31 3.33
1.2 0.02 0.52 1.03 41 S87N/G118V/S128L/P129Q/S130A/I72V/S101H/S164I
1.23 4 1.59 0.99 0.65 1.22 42
S87N/G118V/S128L/P129Q/S130A/S101L/Q109R/S188D/N248R 2.78 2.71 1.8
0.98 0.88 0.56 43
S87N/G118V/S128L/P129Q/S130A/N18K/G97P/S101L/Q109L/N185R/A215R ND
ND 1.11 0.02 0.25 1.18 44
S87R/G118R/S128L/P129Q/S130A/S101M/S188D/N248R 1.53 1.69 1.75 0.73
1.26 0.17 47 N76D/S87R/G118R/S128L/P129Q/S130A/S188D 1.02 1.11 1.23
ND ND ND 49 N76D/S87R/G118R/S128L/P129Q/S130A/S188D/N248K 0.86 1.12
1.08 ND ND ND 100 S87N/G118V/G127S/S128L/P129Q/S130A ND 1.38 1.10
ND ND ND 101 S87N/S101H/G118V/S128L/P129Q/S130A ND 1.52 1.31 1.28
ND 1.06 102 S87N/S101K/G118V/S128L/P129Q/S130A ND 1.74 1.60 1.18 ND
0.99 103 S87N/S101V/G118V/S128L/P129Q/S130A ND 1.72 1.56 1.19 ND
1.05 104 S87N/S101Y/G118V/S128L/P129Q/S130A ND 1.31 1.23 1.18 ND
1.09 105 S87N/S101L/G118V/S128L/P129Q/S130A ND 1.65 1.48 1.06 ND
1.03 106 I72V/S87N/G118V/S128L/P129Q/S130A//S164I ND 1.04 1.01 ND
ND ND
Example 9
Evaluation of Stain Removal by Multiple Mutation Library (MML)
Variants in Laundry Application Studies
[0305] Results of experiments conducted to determine stain removal
activity (microswatch assay to determine cleaning performance in
laundry applications) of variants of GCI-P036 (clones 8, 47, 49 as
described in Example 8) are shown in Table 9-1. The results were
obtained using the methods described in Example 1. The test
detergents used were heat inactivated P&G TIDE.RTM. 2.times.
(NA HDL) and P&G TIDE.RTM. (NA HDG). Cleaning performance of
BMI stained microswatches was tested using 0.2 ppm of the variants
at 25.degree. C. for 30 minutes with 1400 rpm shaking in a volume
of 200 uL. As described throughout, functionality of GCI-P036
variants were quantified as a performance index (Pi), which is the
ratio of performance of a variant to a parent GCI-P036 protein.
Subtilisin FNA (BPN'-Y217L) and
GCI-P036-S87N-G118V-S128L-P129Q-S130A proteins were also
tested.
TABLE-US-00026 TABLE 9-1 P.sub.i Values of GCI-PO36 Variants Tested
for Stain Removal Performance on BMI Microswatches in NA HDL and NA
HDG Detergents Variants based Clone # on GCI-P036 NA HDL pH 8 NA
HDG pH 10 GCI-P036 -- 1.00 1.00 8 N18K/S87N/ 0.46 0.38 G97P/Q109R/
G118V/S128L/ P129Q/S130A/ N185R/A215R 47 S87R/N76D/ 1.12 1.19
G118R/S128L/ P129Q/S130A/ S188D 49 N76D/S87R/ 0.92 1.06
G118R/S128L/ P129Q/S130A/ S188D/N248K GCI-P036-variant S87N-G118V-
1.22 1.14 S128L-P129Q- S130A FNA BPN' Y217L 1.29 0.66
Example 10
Protease Variants with Increased Production Titers
[0306] Mutations within the mature region of GCI-P036 were selected
based on beneficial gains in protein titer or microswatch wash
performance observed during the superscreen carried out in
microtiter plates. The protease samples tested in the prior
examples were obtained using a replicating plasmid expression
system. For the expression of the 45 variants described in this
example, a gene labeled GCI-P036ci, encoding the wildtype GCI-P036
protein, was used. This "ci" synthetic gene consists of a codon
improved version based on FNA codon usage (a protein expressed to
very high levels). Nucleic acids encoding these variants were
introduced into the GCI-P036ci gene template as described below, to
generate a series of plasmids in the p2JH backbone
(p2JH-GCI-P036ci, FIG. 3), an integrating vector system amenable to
protein production at large scale. This integrating Bacillus
expression system was used to evaluate the variants listed in Table
9-1 using culture broth from shake flask cultures. Protein
expression and microswatch performance was again evaluated. Since
certain variants displayed diminished protease activity versus the
suc-AAPF-pNA substrate when compared to wild type, an eglin c
titration assay was used for determining protease concentration.
Results obtained for eglin c and BMI assays are shown in FIG. 4 and
FIG. 5, respectively.
TABLE-US-00027 TABLE 10-1 Protease Variants GCI-P036 WT BPN'
Position Position Variants Evaluated S9 S9 L, G V28 V28 A V30 V30 A
N60 N62 S V91 V93 T L94 L96 A G95 G97 P S97 D99 P I105 I107 F A106
I108 I, C, M G113 I115 M V119 V121 A L124 M126 F, N G125 G127 S
S126 G128 I, L, W, K, V, Y, N, F, T, G, E, A, C, D, H, P, R, Q, M
S130 S132 N V145 V147 I N167 S173 H F183 F189 G I192 V198 L T218
S224 N A222 A228 G
Integrating Plasmid
[0307] Integrating plasmid p2JH-GCI-P036ci was assembled using a
GCI-P036 codon-improved synthetic gene (GCI-P036ci), fused at the
eighth codon of the AprE signal sequence, under the control of the
AprE promoter and FNBase terminator (Wells et al., Nucleic Acids
Res, 11:7911-25, 1983). In the GCI-P036ci sequence of
p2JH-GCI-P036ci provided below, bold and italicized font indicates
AprE promoter, standard font indicates the signal sequence region,
underlined font indicates the GCI-P036 pro sequence region,
boldfaced font indicates DNA that encodes GCI-P036 mature protease
region, and underlined italicized font indicates FNBase
terminator.
TABLE-US-00028 (SEQ ID NO: 8) GTGAGAAGCAAAAAATTGTGGATCGTCGCGTCG
ACCGCATTGCTGATTTCTGTTGCTTTTAGCTCATCCATCGCATCCGCTGCTGAAGAAGCAAA
AGAAAAATATTTAATTGGCTTTAATGAGCAGGAAGCTGTCAGTGAGTTTGTAGAACAAGTT
GAGGCAAATGACGAGGTAGCCATTCTCTCTGAGGAAGAGGAAGTCGAAATTGAATTGCTTC
ATGAATTTGAAACGATTCCTGTTCTGTCCGTTGAGTTAAGCCCAGAAGATGTGGACGCGTTA
GAGCTCGATCCAGCTATTTCTTATATTGAAGAGGATGCAGAAGTAACTACAATGGCGCA
ATCGGTACCATGGGGAATTAGCAGAGTACAAGCCCCAGCTGCACATAACCGTGGATTGA
CAGGTTCTGGTGTAAAAGTTGCTGTCCTTGATACCGGTATTTCCACTCATCCAGACTTA
AATATTCGTGGTGGAGCTAGCTTTGTACCAGGGGAACCATCCACTCAAGATGGCAATGG
ACATGGCACTCATGTTGCCGGCACAATCGCGGCTCTTAACAATTCAATTGGTGTTCTTG
GCGTAGCGCCAAGCGCAGAACTATACGCTGTTAAAGTATTAGGAGCAAGCGGTTCAGGC
TCTGTCAGCTCTATTGCCCAAGGATTGGAATGGGCAGGGAACAATGGCATGCACGTTGC
TAATCTTAGTTTAGGATCTCCTTCGCCAAGTGCCACACTTGAGCAAGCTGTTAATAGCG
CGACTTCTAGAGGCGTTCTTGTTGTAGCGGCCTCTGGAAATTCAGGTGCAGGCTCAATC
AGCTATCCGGCCCGTTATGCGAACGCTATGGCAGTCGGAGCTACTGACCAAAACAACAA
CCGCGCCAGCTTTTCACAGTATGGCGCAGGGCTTGACATTGTCGCACCAGGTGTAAACG
TGCAGAGCACTTACCCAGGTTCAACATATGCCAGCTTAAACGGTACATCAATGGCTACT
CCTCATGTTGCAGGTGCGGCTGCACTTGTTAAACAAAAGAACCCATCTTGGTCCAATGT
ACAAATCCGCAATCATCTTAAGAATACGGCAACTAGCTTAGGAAGCACAAACTTGTATG
GAAGCGGACTTGTCAATGCAGAAGCTGCAACTCGTTAAAAGCTTAACTCGAGATAAAAA
ACCGGCCTTGGCCCCGCCGGTTTTTT.
[0308] Features of p2JH-GCI-P036ci include: CAT=chloramphenicol
resistance gene from pC194, pMB1 origin=origin of replication from
pBR322, bla=beta-lactamase from pBR322, aprE
promoter=transcriptional promoter, Signal Peptide=signal peptide,
Pro Peptide=GCI-P036 pro region, GCI-P036ci Mature Peptide=mature
GCI-P036, FNBase Term=FNBase Terminator. The amino acid sequence of
the GCI-P036 precursor and GCI-P036 mature protease is provided
above as SEQ ID NOS: 6 and SEQ ID NO: 2, respectively.
Generation of Further GCI-P036 Variants
[0309] Site-directed mutagenesis using Multi-site QuickChange Kit
(Stratagene) was carried out using the p2JH-GCI-P036ci plasmid as a
template and site-specific primer sets, forward (F) and reverse (R)
with the sequences shown in Table 9-2. Five microliters of the
mutated product was used to transform chemically competent Top10 E.
coli cells (Invitrogen) and plated on LA+50 ppm carbenicillin for
growth under selection. Plates were incubated overnight at
37.degree. C.
TABLE-US-00029 TABLE 10-2 Site specific Primer Sets Used for
Creating Mature Region Mutants in p2JH-GCI-P036ci. Primer SEQ ID
Name NO: Primer Sequence (5'-3') S126A-F 9
ctaatcttagtttaggagctccttcgccaagtgcc S126A-R 10
ggcacttggcgaaggagctcctaaactaagattag S126C-F 11
cacgttgctaatcttagtttaggatgcccttcgccaagtgc S126C-R 12
gcacttggcgaagggcatcctaaactaagattagcaacgtg S126D-F 13
gcacgttgctaatcttagtttaggagatccttcgccaagtg S126D-R 14
cacttggcgaaggatctcctaaactaagattagcaacgtgc 5126E-F 15
catgcacgttgctaatcttagtttaggagaaccttcgccaagtgcc 5126E-R 16
ggcacttggcgaaggttctcctaaactaagattagcaacgtgcatg S126F-F 17
cacgttgctaatcttagtttaggattcccttcgccaagtgc S126F-R 18
gcacttggcgaagggaatcctaaactaagattagcaacgtg S126G-F 19
catgcacgttgctaatcttagtttaggaggcccttcgccaagtgcc S126G-R 20
ggcacttggcgaagggcctcctaaactaagattagcaacgtgcatg S126H-F 21
catgcacgttgctaatcttagtttaggacacccttcgccaagtgcc S126H-R 22
ggcacttggcgaagggtgtcctaaactaagattagcaacgtgcatg S126I-F 23
catgcacgttgctaatcttagtttaggaatcccttcgccaagtgcc S126I-R 24
ggcacttggcgaagggattcctaaactaagattagcaacgtgcatg S126K-F 25
Catgcacgttgctaatcttagtttaggaaaaccttcgccaagtgcc S126K-R 26
Ggcacttggcgaaggttttcctaaactaagattagcaacgtgcatg S126L-F 27
Gcacgttgctaatcttagtttaggacttccttcgccaagtg S126L-R 28
Cacttggcgaaggaagtcctaaactaagattagcaacgtgc S126M-F 29
Catgcacgttgctaatcttagtttaggaatgccttcgccaagtgcc S126M-R 30
Ggcacttggcgaaggcattcctaaactaagattagcaacgtgcatg S126N-F 31
Catgcacgttgctaatcttagtttaggaaacccttcgccaagtgcc S126N-R 32
Ggcacttggcgaagggtttcctaaactaagattagcaacgtgcatg S126P-F 33
Ctaatcttagtttaggacctccttcgccaagtgcc S126P-R 34
Ggcacttggcgaaggaggtcctaaactaagattag S126Q-F 35
Catgcacgttgctaatcttagtttaggacaaccttcgccaagtgcc S126Q-R 36
Ggcacttggcgaaggttgtcctaaactaagattagcaacgtgcatg S126R-F 37
Catgcacgttgctaatcttagtttaggaagaccttcgccaagtgcc S126R-R 38
Ggcacttggcgaaggtcttcctaaactaagattagcaacgtgcatg S126T-F 39
Cacgttgctaatcttagtttaggaacaccttcgccaagtg S126T-R 40
Cacttggcgaaggtgttcctaaactaagattagcaacgtg S126V-F 41
Gcacgttgctaatcttagtttaggagttccttcgccaagtg S126V-R 42
Cacttggcgaaggaactcctaaactaagattagcaacgtgc S126W-F 43
Cacgttgctaatcttagtttaggatggccttcgccaagtgc S126W-R 44
Gcacttggcgaaggccatcctaaactaagattagcaacgtg S126Y-F 45
Cacgttgctaatcttagtttaggatacccttcgccaagtgc S126Y-R 46
Gcacttggcgaagggtatcctaaactaagattagcaacgtg S9L-F 47
Gcaatcggtaccatggggaattcttagagtacaagccccagc S9L-R 48
Gctggggcttgtactctaagaattccccatggtaccgattgc S9G-F 49
Aatcggtaccatggggaattggcagagtacaagc S9G-R 50
Gcttgtactctgccaattccccatggtaccgatt A106C-F 51
Caggctctgtcagctctatttgccaaggattggaatggg A106C-R 52
Cccattccaatccttggcaaatagagctgacagagcctg A106I-F 53
Ggaacaatggcatgcacgctgctaatcttagtttagg A106I-R 54
Cctaaactaagattagcagcgtgcatgccattgttcc A106M-F 55
Tcaggctctgtcagctctattatgcaaggattggaatgggcag A106M-R 56
Ctgcccattccaatccttgcataatagagctgacagagcctga V119A-F 57
Caggctctgtcagctctattatccaaggattggaatggg V119A-R 58
Cccattccaatccttggataatagagctgacagagcctg L124F-F 59
gcatgcacgttgctaatcttagtttcggatctccttcgc L124F-R 60
Gcgaaggagatccgaaactaagattagcaacgtgcatgc L124N-F 61
Acaatggcatgcacgttgctaatcttagtaacggatctccttcgcca L124N-R 62
Tggcgaaggagatccgttactaagattagcaacgtgcatgccattgt G125S-F 63
Atggcatgcacgttgctaatcttagtttatcttctccttcgccaagt G125S-R 64
Acttggcgaaggagaagataaactaagattagcaacgtgcatgccat N167H-F 65
Cggcccgttatgcgcacgctatggcagtc N167H-R 66
Gactgccatagcgtgcgcataacgggccg V28A-F 67
Gttctggtgtaaaagctgctgtccttgataccggtatttccact V28A-R 68
Caagaccacattttcgacgacaggaactatggccataaaggtga V30A-F 69
Gttctggtgtaaaagttgctgctcttgataccggtatttccact V30A-R 70
Agtggaaataccggtatcaagagcagcaacttttacaccagaac N60S-F 71
Ccatccactcaagatggctctggacatggcactcatgt N60S-R 72
Acatgagtgccatgtccagagccatcttgagtggatgg V91T-F 73
Ccaagcgcagaactatacgctacaaaagtattaggagcaagcggt V91T-R 74
Accgcttgctcctaatacttttgtagcgtatagttctgcgcttgg L94A-F 75
Aagcgcagaactatacgctgttaaagtagctggagcaagcggttca L94A-R 76
Tgaaccgcttgctccagctactttaacagcgtatagttctgcgctt G95P-F 77
Gcgcagaactatacgctgttaaagtattacctgcaagcggttcaggc G95P-R 78
Gcctgaaccgcttgcaggtaatactttaacagcgtatagttctgcgc I105F-F 79
Gttcaggctctgtcagctctttcgcccaaggattggaa I105F-R 80
Ttccaatccttgggcgaaagagctgacagagcctgaac G113M-F 81
Tcaggctctgtcagctctattatgcaaggattggaatgggcag G113M-R 82
Ctgcccattccaatccttgcataatagagctgacagagcctga S123A-F 83
Catgcacgttgctaatcttgctttaggatctccttcgcca S123A-R 84
Tggcgaaggagatcctaaagcaag S130N-F 85
Tttaggatctccttcgccaaacgccacacttgagcaagc S130N-R 86
Gcttgctcaagtgtggcgtttggcgaaggagatcctaaa V145I-F 87
Cgcgacttctagaggcatccttgttgtagcggcct V145I-R 88
Aggccgctacaacaaggatgcctctagaagtcgcg F183G-F 89
Acaacaaccgcgccagcggctcacagtatggcgcagg F183G-R 90
Cctgcgccatactgtgagccgctggcgcggttgttgt I192L-F 91
Cgcagggcttgaccttgtcgcaccagg I192L-R 92 Cctggtgcgacaaggtcaagccctgcg
T218N-F 93 Aaacggtacatcaatggctaaccctcatgttgcaggtgcg T218N-R 94
Cgcacctgcaacatgagggttagccattgatgtaccgttt A222G-F 95
Gctactcctcatgttggcggtgcggctgcactt A222G-R 96
Aagtgcagccgcaccgccaacatgaggagtagc
[0310] Five transformants per mutation were selected and screened
for the presence of insert using PCR beads (GE/Amersham) as per
manufacturer's instructions. Sequences of insertion PCR primers
were as follows: forward primer=ISH-PCR-GCI-P036-5832F
5'-acaaataggg gttccgcgca-3' (SEQ ID NO: 97); and reverse
primer=ISH-PCR-GCI-P036-1902R 5'-cgcaagaattg attggctcc-3' (SEQ ID
NO: 98). Cycling conditions were as follows: hot start at
95.degree. C. for 2 min, 40 cycles of denaturation at 95.degree. C.
for 1 min, primer annealing at 53.degree. C. for 1 min, elongation
at 72.degree. C. for 1 min, then hold at 4.degree. C. Five
microliters of PCR product was analyzed by agarose gel
electrophoresis. PCR products of the expected fragment size of
.about.2 Kb were purified and sequenced. Clones with verified
mutations were expanded for plasmid preps using QiaPrep Spin
Miniprep Kit (Qiagen).
[0311] Purified plasmids were sequenced and 5 .mu.l of plasmid was
transformed into competent B. subtilis cells (phenotype:
.DELTA.aprE, .DELTA.nprE, oppA, .DELTA.spoIIE, degUHy32,
.DELTA.amyE::[xylR,pxylA-comK]), incubated for one hour in
37.degree. C. shaker (250 rpm), then plated on LA+1.6 Skim Milk+5
ppm chloramphenicol and incubated overnight at 37.degree. C. Two
transformants (per mutation) that showed halos were picked and
subcultured on LA+1.6 Skim Milk+25 ppm chloramphenicol to select
for additional gene amplification.
[0312] Single colonies, from fresh plates (post-amplification),
were picked and transferred into 5 ml of LB broth+25 ppm
chloramphenicol and incubated in 37.degree. C. shaker (250 rpm) for
6-7 hours to generate a pre-culture. Frozen stocks were made by
mixing 800 .mu.l of pre-culture aliquots with 400 .mu.l of 50%
(v/v) sterile glycerol. Shake flasks containing 25 mL of
semi-defined medium (phosphate-buffered soymeal and urea based
medium, containing salts) were inoculated with 1 mL of pre-culture,
and incubated in 37.degree. C. shaker (250 rpm) for 48 hours.
Samples were taken at 18, 24, 42 and 48 hours for analysis by
SDS-PAGE, AAPF, EglinC inhibition assay, and BMI wash performance
assay as described in Example 1 above.
Protein Analysis
[0313] Analysis of protein expression in shake flasks was performed
by SDS-PAGE, with titers based on a standard curve of purified
GCI-P036 of known protein concentration. For SDS-PAGE, 10 .mu.L of
2M HCl was added to 45 .mu.l of culture supernatant and incubated
on ice for 10 min. Then, 50 .mu.L of 2.times. glycine sample buffer
was added to each sample and 10 .mu.L of each sample mixture was
loaded on a 10 Bis-Tris gel and run in MES buffer at 200V for 30
min. The gel was washed three times in deionized water, then
stained with SimplyBlue Safe stain (Invitrogen) for one hour and
destained with deionized water overnight.
[0314] Protein expression was also monitored by an eglin c
inhibition assay. In the case of certain mutations, it was inferred
that the mutation led to a reduction of protease activity against
the synthetic substrate suc-AAPF-pNA, when an estimation of the
quantity of the variant by SDS PAGE was not comparable to activity
of the variant on the suc-AAPF-pNA substrate. For this reason,
eglin c binding was also measured to eliminate potential bias of
the AAPF assay.
[0315] Relative specific activities of variants were calculated by
dividing the specific activity of the variants by the specific
activity of the wildtype control. Corrected (normalized) protease
titers were obtained by dividing titers from AAPF activity assay by
relative specific activity of the variant obtained by the eglin C
inhibition assay. Normalized protein titers for multiple variant
proteases are shown in FIG. 4.
[0316] Analysis of variant performance by BMI wash assay was
conducted as described in Example 1, except one microswatch was
used per well and the variant proteases were dosed at 0.5 ppm and
incubated at room temperature. The EMPA 116 BMI microswatches were
used as a stain source, and ECE non-phosphate reference detergent
powder was used for testing cleaning performance under alkaline
conditions. The buffer solution was made in 2 mM sodium carbonate
(Na.sub.2CO.sub.3, MW=105.99 g/mol, anhydrous) at pH 10.5. The
final concentrations of buffer components were as follows: 6 gpg
water hardness, 6.16 g/L ECE-2 non-phosphate powder detergent, 1.6
g/L sodium perborate tetrahydrate (PB4), and 0.24 g/L tetraacetyl
ethylene diamine (TAED). Enzyme dilutions based on corrected titers
from EglinC inhibition analysis were performed in 10 mM NaCl+0.005
TWEEN.RTM.80 buffer. The results for the BMI assay are shown in
FIG. 5. Several variant proteases (G95P, S126M, Q, and R, S9L and
A106C with GCI-P036 numbering=G97P, S128M, Q, and R, S9L and A108C
with BPN' numbering) showed increased production in liquid cultures
while maintaining wash performance comparable to the GCI-P036
reference protease.
Example 11
Generation of Charge Ladder Variants of GCI-P036
[0317] This Example describes the production of GCI-P036 charge
ladder and combinatorial charge libraries. Testing the variant
proteases of the present invention was done in comparison with a
reference protease(s) to determine a performance index (PI) for the
variant proteases.
Charge Ladders
[0318] Multiple protein variants spanning a range of physical
properties of interest are selected from existing libraries or are
generated by site-directed mutagenesis techniques as known in the
art (See e.g., U.S. application Ser Nos. 10/576,331, 11/581,102,
and 11/583,334). This defined set of probe proteins is then assayed
in a test of interest. Exemplary protease charge ladder variants
are shown in the following Tables and assayed as described herein.
In these tables, the charge change is relative to the reference
protease, which in this example is the wild-type protease.
TABLE-US-00030 TABLE 11-1 GCI-P036 Charge Ladder Variants GCI-P036
Variant GCI-P036 Variant (GG36 numbering) (BPN' numbering) .DELTA.
Charge S85D-Q107D-S182D-N242D S87D-Q109D-S188D-N248D -4
S85D-Q107D-S182D S87D-Q109D-S188D -3 S85D-Q107D S87D-Q109D -2 Q107D
Q109D -1 (GG36) (GG36) 0 Q107R Q109R +1 S85R-Q107R S87R-Q109R +2
S85R-Q107R-S182R S87R-Q109R-S188R +3 S85R-Q107R-S182R-N242R
S87R-Q109R-S188R-N248R +4
Generation of GCI-P036 Combinatorial Charge Libraries (CCL)
[0319] The pAC-GG36ci plasmid containing the codon-improved gene
was used to generate CCL by DNA 2.0. Bacillus subtilis strain
(genotype: .DELTA.aprE, .DELTA.nprE, .DELTA.spoIIE,
amyE::xylRPxylAcomK-phleo) was used for transformations. In
addition, positional libraries at each of the four sites in
GCI-P036 protease that are shown in Table 10-2 were produced.
Variants were supplied as glycerol stocks in 96-well plates.
[0320] The GCI-P036 CCL was designed by identifying four
well-distributed, surface-exposed, uncharged polar amino-acid
residues outside the active site. These residues are Ser-85,
Gln-107, Ser-182, and Asn-242 (residues 87, 109, 188, and 248 in
BPN' numbering). An 81-member combinatorial library (G-1 to G-81)
was created by making all combinations of three possibilities at
each site: wild-type, arginine, or aspartic acid.
TABLE-US-00031 TABLE 11-2 GCI-P036 CCL Variants Variant # S 85 Q
107 S 182 N 242 .DELTA. Charge G-01 -- -- -- -- 0 G-02 -- -- -- D
-1 G-03 -- -- -- R +1 G-04 -- -- D -- -1 G-05 -- -- D D -2 G-06 --
-- D R 0 G-07 -- -- R -- +1 G-08 -- -- R D 0 G-09 -- -- R R +2 G-10
-- D -- -- -1 G-11 -- D -- D -2 G-12 -- D -- R 0 G-13 -- D D -- -2
G-14 -- D D D -3 G-15 -- D D R -1 G-16 -- D R -- 0 G-17 -- D R D -1
G-18 -- D R R +1 G-19 -- R -- -- +1 G-20 -- R -- D 0 G-21 -- R -- R
+2 G-22 -- R D -- 0 G-23 -- R D D -1 G-24 -- R D R +1 G-25 -- R R
-- +2 G-26 -- R R D +1 G-27 -- R R R +3 G-28 D -- -- -- -1 G-29 D
-- -- D -2 G-30 D -- -- R 0 G-31 D -- D -- -2 G-32 D -- D D -3 G-33
D -- D R -1 G-34 D -- R -- 0 G-35 D -- R D -1 G-36 D -- R R +1 G-37
D D -- -- -2 G-38 D D -- D -3 G-39 D D -- R -1 G-40 D D D -- -3
G-41 D D D D -4 G-42 D D D R -2 G-43 D D R -- -1 G-44 D D R D -2
G-45 D D R R 0 G-46 D R -- -- 0 G-47 D R -- D -1 G-48 D R -- R +1
G-49 D R D -- -1 G-50 D R D D -2 G-51 D R D R 0 G-52 D R R -- +1
G-53 D R R D 0 G-54 D R R R +2 G-55 R -- -- -- +1 G-56 R -- -- D 0
G-57 R -- -- R +2 G-58 R -- D -- 0 G-59 R -- D D -1 G-60 R -- D R
+1 G-61 R -- R -- +2 G-62 R -- R D +1 G-63 R -- R R +3 G-64 R D --
-- 0 G-65 R D -- D -1 G-66 R D -- R +1 G-67 R D D -- -1 G-68 R D D
D -2 G-69 R D D R 0 G-70 R D R -- +1 G-71 R D R D 0 G-72 R D R R +2
G-73 R R -- -- +2 G-74 R R -- D +1 G-75 R R -- R +3 G-76 R R D --
+1 G-77 R R D D 0 G-78 R R D R +2 G-79 R R R -- +3 G-80 R R R D +2
G-81 R R R R +4
Example 12
Stain Removal Performance of GCI-P036 Charge Variants
[0321] In this Example, results for variants of GCI-P036 tested in
blood, milk, ink (BMI) microswatch and baked egg yolk microswatch
assays in detergents representing various market geographies (e.g.,
differing pH, temperature, and/or water hardness), in both laundry
and automatic dishwashing (ADW) applications are provided. Market
geographies represented in the Tables of this example include NA
(North America), WE (Western Europe), and WE (ADW), as described in
Table 1-1. In Table 12-1, results for dish (i.e., "PI Dish") are
for assays conducted using the baked egg microtiter assay in
CALGONIT.RTM. (Reckitt-Benckiser), at 40.degree. C. 12 gpg, pH 10,
as described in Example 1.
TABLE-US-00032 TABLE 12-1 Evaluation of Stain Removal Performance
of GCI-P036 Charge Variants PI NA PI WE PI GCI-P036 Variants Net
Charge Laundry Laundry Dish GCI-P036 0 1.000 1.000 1.000 G-2 -1
0.950 0.939 1.450 G-3 1 0.578 0.759 1.231 G-4 -1 1.219 1.539 1.467
G-5 -2 1.261 1.194 1.508 G-6 0 0.936 0.999 1.563 G-7 1 0.568 0.834
0.712 G-8 0 0.043 0.151 -0.033 G-9 2 0.350 0.601 0.708 G-10 -1
1.266 1.089 1.022 G-11 -2 1.280 1.209 0.788 G-12 0 0.810 1.074
0.977 G-13 -2 1.317 1.411 1.300 G-14 -3 0.080 0.144 -0.007 G-15 -1
0.917 1.254 1.393 G-16 0 0.750 1.081 0.742 G-17 -1 0.815 0.894
0.909 G-18 1 0.675 0.931 0.867 G-19 1 0.713 0.856 1.310 G-20 0
0.071 0.129 -0.015 G-21 2 0.434 0.834 1.098 G-22 0 0.782 1.014
1.447 G-23 -1 0.964 0.939 1.396 G-24 1 0.466 0.729 1.368 G-25 2
0.322 0.744 0.638 G-26 1 0.517 0.984 0.694 G-27 3 0.303 1.074 0.971
G-28 -1 1.126 1.141 1.023 G-29 -2 1.126 0.991 1.037 G-30 0 0.945
1.149 1.006 G-31 -2 1.331 1.149 1.412 G-32 -3 1.345 0.999 1.303
G-33 -1 0.950 1.036 1.420 G-34 0 0.671 0.999 0.673 G-35 -1 0.694
1.021 1.026 G-36 1 0.415 0.774 0.704 G-37 -2 1.410 1.554 -0.011
G-38 -3 0.457 0.759 1.081 G-39 -1 0.936 1.186 0.940 G-40 -3 0.043
0.106 -0.006 G-41 -4 1.163 0.496 0.988 G-42 -2 1.359 1.276 1.165
G-43 -1 0.782 1.119 0.740 G-44 -2 0.926 1.051 0.748 G-45 0 0.503
0.961 0.619 G-46 0 0.759 0.916 1.035 G-47 -1 0.871 1.051 1.057 G-48
1 0.452 0.864 1.060 G-49 -1 0.885 0.909 1.239 G-50 -2 0.912 0.909
1.613 G-51 0 0.638 1.006 1.723 G-52 1 0.396 0.909 0.820 G-53 0
0.568 0.909 0.806 G-54 2 0.345 0.766 0.641 G-55 1 0.689 1.036 1.230
G-56 0 0.675 1.134 0.818 G-57 2 0.452 0.766 0.922 G-58 0 1.024
1.216 1.444 G-59 -1 1.131 1.306 1.473 G-60 1 0.699 0.946 1.520 G-61
2 0.457 0.886 0.680 G-62 1 0.759 1.059 1.169 G-63 3 0.327 0.669
0.687 G-64 0 0.847 1.119 1.001 G-65 -1 0.601 0.879 1.014 G-66 1
1.001 1.261 1.042 G-67 -1 1.196 1.411 1.489 G-68 -2 1.131 1.179
1.163 G-69 0 0.768 0.999 1.488 G-70 1 0.647 1.809 0.229 G-71 0
0.620 1.081 0.631 G-72 2 0.364 0.819 0.634 G-73 2 0.387 0.729 0.997
G-74 1 0.638 0.939 1.105 G-75 3 0.657 0.856 1.081 G-76 1 0.071
0.136 -0.018 G-77 0 0.866 0.969 1.400 G-78 2 0.434 0.789 1.175 G-79
3 0.327 0.789 0.874 G-80 2 0.355 0.781 0.833 G-81 4 0.229 0.466
0.653
Example 13
Liquid Laundry Detergent Compositions
[0322] In this Example, various formulations for liquid laundry
detergent compositions are provided. The following liquid laundry
detergent compositions of the present invention are prepared as
shown below. In each of these formulations, at least one protease
variant provided herein is included at a concentration of from
about 0.0001 to about 10 weight percent. In some alternative
embodiments, other concentrations will find use, as determined by
the formulator, based on their needs.
TABLE-US-00033 TABLE 13-1 Liquid Laundry Detergent Compositions
Formulations Compound I II III IV V LAS 24.0 32.0 6.0 3.0 6.0
NaC.sub.16-C.sub.17 HSAS -- -- -- 5.0 -- C.sub.12-C.sub.15
AE.sub.1.8S -- -- 8.0 7.0 5.0 C.sub.8-C.sub.10 propyl dimethyl
amine 2.0 2.0 2.0 2.0 1.0 C.sub.12-C.sub.14 alkyl dimethyl amine
oxide -- -- -- -- 2.0 C.sub.12-C.sub.15 AS -- -- 17.0 -- 8.0 CFAA
-- 5.0 4.0 4.0 3.0 C.sub.12-C.sub.14 Fatty alcohol ethoxylate 12.0
6.0 1.0 1.0 1.0 C.sub.12-C.sub.18 Fatty acid 3.0 -- 4.0 2.0 3.0
Citric acid (anhydrous) 4.5 5.0 3.0 2.0 1.0 DETPMP -- -- 1.0 1.0
0.5 Monoethanolamine 5.0 5.0 5.0 5.0 2.0 Sodium hydroxide -- -- 2.5
1.0 1.5 1N HCl aqueous solution #1 #1 -- -- -- Propanediol 12.7
14.5 13.1 10. 8.0 Ethanol 1.8 2.4 4.7 5.4 1.0 DTPA 0.5 0.4 0.3 0.4
0.5 Pectin Lyase -- -- -- 0.005 -- Amylase 0.001 0.002 -- --
Cellulase -- -- 0.0002 0.0001 Lipase 0.1 -- 0.1 -- 0.1 NprE
(optional) 0.05 0.3 -- 0.5 0.2 PMN -- -- 0.08 -- -- Protease A
(optional) -- -- -- -- 0.1 Aldose Oxidase -- -- 0.3 -- 0.003 ZnCl2
0.1 0.05 0.05 0.05 0.02 Ca formate 0.05 0.07 0.05 0.06 0.07 DETBCHD
-- -- 0.02 0.01 -- SRP1 0.5 0.5 -- 0.3 0.3 Boric acid -- -- -- --
2.4 Sodium xylene sulfonate -- -- 3.0 -- -- Sodium cumene sulfonate
-- -- -- 0.3 0.5 DC 3225C 1.0 1.0 1.0 1.0 1.0 2-butyl-octanol 0.03
0.04 0.04 0.03 0.03 Brightener 1 0.12 0.10 0.18 0.08 0.10 Balance
to 100% perfume/dye and/or water #1: Add 1N HCl aq. soln to adjust
the neat pH of the formula in the range from about 3 to about
5.
[0323] The pH of Examples above 13(I)-(II) is about 5 to about 7,
and of 13(III)-(V) is about 7.5 to about 8.5.
Example 14
Hand Dish Liquid Detergent Compositions
[0324] In this Example, various hand dish liquid detergent
formulations are provided. The following hand dish liquid detergent
compositions of the present invention are provided below. In each
of these formulations, at least one protease variant provided
herein is included at a concentration of from about 0.0001 to about
10 weight percent. In some alternative embodiments, other
concentrations will find use, as determined by the formulator,
based on their needs.
TABLE-US-00034 TABLE 14-1 Hand Dish Liquid Detergent Compositions
Formulations Compound I II III IV V VI C.sub.12-C.sub.15AE.sub.1.8S
30.0 28.0 25.0 -- 15.0 10.0 LAS -- -- -- 5.0 15.0 12.0 Paraffin
Sulfonate -- -- -- 20.0 -- -- C.sub.10-C.sub.18 Alkyl Dimethyl 5.0
3.0 7.0 -- -- -- Amine Oxide Betaine 3.0 -- 1.0 3.0 1.0 -- C.sub.12
poly-OH fatty acid -- -- -- 3.0 -- 1.0 amide C.sub.14 poly-OH fatty
acid -- 1.5 -- -- -- -- amide C.sub.11E.sub.9 2.0 -- 4.0 -- -- 20.0
DTPA -- -- -- -- 0.2 -- Tri-sodium Citrate 0.25 -- -- 0.7 -- --
dihydrate Diamine 1.0 5.0 7.0 1.0 5.0 7.0 MgCl.sub.2 0.25 -- -- 1.0
-- -- nprE (optional) 0.02 0.01 -- 0.01 -- 0.05 PMN -- -- 0.03 --
0.02 -- Protease A (optional) -- 0.01 -- -- -- -- Amylase 0.001 --
-- 0.002 -- 0.001 Aldose Oxidase 0.03 -- 0.02 -- 0.05 -- Sodium
Cumene -- -- 2.0 1.5 3.0 -- Sulphonate PAAC 0.01 0.01 0.02 -- -- --
DETBCHD -- -- -- 0.01 0.02 0.01 Balance to 100% perfume/dye and/or
water
[0325] The pH of Examples 14(I)-(VI) is about 8 to about 11
Example 15
Liquid Automatic Dishwashing Detergent Compositions
[0326] In this Example, various liquid automatic dishwashing
detergent formulations are provided. The following hand dish liquid
detergent compositions of the present invention are provided below.
In each of these formulations, at least one protease variant
provided herein is included at a concentration of from about 0.0001
to about 10 weight percent. In some alternative embodiments, other
concentrations will find use, as determined by the formulator,
based on their needs.
TABLE-US-00035 TABLE 15-1 Liquid Automatic Dishwashing Detergent
Compositions Formulations Compound I II III IV V STPP 16 16 18 16
16 Potassium Sulfate -- 10 8 -- 10 1,2 propanediol 6.0 0.5 2.0 6.0
0.5 Boric Acid -- -- -- 4.0 3.0 CaCl.sub.2 dihydrate 0.04 0.04 0.04
0.04 0.04 Nonionic 0.5 0.5 0.5 0.5 0.5 nprE (optional) 0.1 0.03 --
0.03 -- PMN -- -- 0.05 -- 0.06 Protease B (optional) -- -- -- 0.01
-- Amylase 0.02 -- 0.02 0.02 -- Aldose Oxidase -- 0.15 0.02 -- 0.01
Galactose Oxidase -- -- 0.01 -- 0.01 PAAC 0.01 -- -- 0.01 --
DETBCHD -- 0.01 -- -- 0.01 Balance to 100% perfume/dye and/or
water
Example 16
Granular and/or Tablet Laundry Compositions
[0327] This Example provides various formulations for granular
and/or tablet laundry detergents. The following laundry
compositions of present invention, which may be in the form of
granules or tablet, are provided below. In each of these
formulations, at least one protease variant provided herein is
included at a concentration of from about 0.0001 to about 10 weight
percent. In some alternative embodiments, other concentrations will
find use, as determined by the formulator, based on their
needs.
TABLE-US-00036 TABLE 16-1 Granular and/or Tablet Laundry
Compositions Compound Formulations Base Product I II III IV V
C.sub.14-C.sub.15AS or TAS 8.0 5.0 3.0 3.0 3.0 LAS 8.0 -- 8.0 --
7.0 C.sub.12-C.sub.15AE.sub.3S 0.5 2.0 1.0 -- --
C.sub.12-C.sub.15E.sub.5 or E.sub.3 2.0 -- 5.0 2.0 2.0 QAS -- -- --
1.0 1.0 Zeolite A 20.0 18.0 11.0 -- 10.0 SKS-6 (dry add) -- -- 9.0
-- -- MA/AA 2.0 2.0 2.0 -- -- AA -- -- -- -- 4.0 3Na Citrate
2H.sub.2O -- 2.0 -- -- -- Citric Acid 2.0 -- 1.5 2.0 -- (Anhydrous)
DTPA 0.2 0.2 -- -- -- EDDS -- -- 0.5 0.1 -- HEDP -- -- 0.2 0.1 --
PB1 3.0 4.8 -- -- 4.0 Percarbonate -- -- 3.8 5.2 -- NOBS 1.9 -- --
-- -- NACA OBS -- -- 2.0 -- -- TAED 0.5 2.0 2.0 5.0 1.00 BB1 0.06
-- 0.34 -- 0.14 BB2 -- 0.14 -- 0.20 -- Anhydrous Na 15.0 18.0 --
15.0 15.0 Carbonate Sulfate 5.0 12.0 5.0 17.0 3.0 Silicate -- 1.0
-- -- 8.0 nprE (optional) 0.03 -- 0.1 0.06 -- PMN -- 0.05 -- -- 0.1
Protease B (optional) -- 0.01 -- -- -- Protease C (optional) -- --
-- 0.01 -- Lipase -- 0.008 -- -- -- Amylase 0.001 -- -- -- 0.001
Cellulase -- 0.0014 -- -- -- Pectin Lyase 0.001 0.001 0.001 0.001
0.001 Aldose Oxidase 0.03 -- 0.05 -- -- PAAC -- 0.01 -- -- 0.05
Balance to 100% Moisture and/or Minors* *Perfume, dye,
brightener/SRP1/Na
carboxymethylcellulose/photobleach/MgSO.sub.4/PVPVI/suds
suppressor/high molecular PEG/clay.
Example 17
Liquid Laundry Detergents
[0328] This Example provides various formulations for liquid
laundry detergents. The following liquid laundry detergent
formulations of the present invention are provided below. In each
of these formulations, at least one protease variant provided
herein is included at a concentration of from about 0.0001 to about
10 weight percent. In some alternative embodiments, other
concentrations will find use, as determined by the formulator,
based on their needs.
TABLE-US-00037 TABLE 17-1 Liquid Laundry Detergents Formulations
Compound I I II III IV V LAS 11.5 11.5 9.0 -- 4.0 --
C.sub.12-C.sub.15AE.sub.2.85S -- -- 3.0 18.0 -- 16.0
C.sub.14-C.sub.15E.sub.2.5S 11.5 11.5 3.0 -- 16.0 --
C.sub.12-C.sub.13E.sub.9 -- -- 3.0 2.0 2.0 1.0 C.sub.12-C.sub.13E
.sub.7 3.2 3.2 -- -- -- -- CFAA -- -- -- 5.0 -- 3.0 TPKFA 2.0 2.0
-- 2.0 0.5 2.0 Citric Acid 3.2 3.2 0.5 1.2 2.0 1.2 (Anhydrous) Ca
formate 0.1 0.1 0.06 0.1 -- -- Na formate 0.5 0.5 0.06 0.1 0.05
0.05 ZnC12 0.1 0.05 0.06 0.03 0.05 0.05 Na Culmene 4.0 4.0 1.0 3.0
1.2 -- Sulfonate Borate 0.6 0.6 1.5 -- -- -- Na Hydroxide 6.0 6.0
2.0 3.5 4.0 3.0 Ethanol 2.0 2.0 1.0 4.0 4.0 3.0 1,2 Propanediol 3.0
3.0 2.0 8.0 8.0 5.0 Monoethanol- 3.0 3.0 1.5 1.0 2.5 1.0 amine
TEPAE 2.0 2.0 -- 1.0 1.0 1.0 nprE (optional) 0.03 0.05 -- 0.03 --
0.02 PMN -- -- 0.01 -- 0.08 -- Protease A -- -- 0.01 -- -- --
(optional) Lipase -- -- -- 0.002 -- -- Amylase -- -- -- -- 0.002 --
Cellulase -- -- -- -- -- 0.0001 Pectin Lyase 0.005 0.005 -- -- --
Aldose Oxidase 0.05 -- -- 0.05 -- 0.02 Galactose oxidase -- 0.04
PAAC 0.03 0.03 0.02 -- -- -- DETBCHD -- -- -- 0.02 0.01 -- SRP 1
0.2 0.2 -- 0.1 -- -- DTPA -- -- -- 0.3 -- -- PVNO -- -- -- 0.3 --
0.2 Brightener 1 0.2 0.2 0.07 0.1 -- -- Silicone antifoam 0.04 0.04
0.02 0.1 0.1 0.1 Balance to 100% perfume/dye and/or water
Example 18
High Density Dishwashing Detergents
[0329] This Example provides various formulations for high density
dishwashing detergents. The following compact high density
dishwashing detergents of the present invention are provided below.
In each of these formulations, at least one protease variant
provided herein is included at a concentration of from about 0.0001
to about 10 weight percent. In some alternative embodiments, other
concentrations will find use, as determined by the formulator,
based on their needs.
TABLE-US-00038 TABLE 18-1 High Density Dishwashing Detergents
Formulations Compound I II III IV V VI STPP -- 45.0 45.0 -- -- 40.0
3Na Citrate 2H.sub.2O 17.0 -- -- 50.0 40.2 -- Na Carbonate 17.5
14.0 20.0 -- 8.0 33.6 Bicarbonate -- -- -- 26.0 -- -- Silicate 15.0
15.0 8.0 -- 25.0 3.6 Metasilicate 2.5 4.5 4.5 -- -- -- PB1 -- --
4.5 -- -- -- PB4 -- -- -- 5.0 -- -- Percarbonate -- -- -- -- -- 4.8
BB1 -- 0.1 0.1 -- 0.5 -- BB2 0.2 0.05 -- 0.1 -- 0.6 Nonionic 2.0
1.5 1.5 3.0 1.9 5.9 HEDP 1.0 -- -- -- -- -- DETPMP 0.6 -- -- -- --
-- PAAC 0.03 0.05 0.02 -- -- -- Paraffin 0.5 0.4 0.4 0.6 -- -- nprE
(optional) 0.072 0.053 -- 0.026 -- 0.01 PMN -- -- 0.053 -- 0.059 --
Protease B -- -- -- -- -- 0.01 (optional) Amylase 0.012 -- 0.012 --
0.021 0.006 Lipase -- 0.001 -- 0.005 -- -- Pectin Lyase 0.001 0.001
0.001 -- -- -- Aldose Oxidase 0.05 0.05 0.03 0.01 0.02 0.01 BTA 0.3
0.2 0.2 0.3 0.3 0.3 Polycarboxylate 6.0 -- -- -- 4.0 0.9 Perfume
0.2 0.1 0.1 0.2 0.2 0.2 Balance to 100% Moisture and/or Minors*
*Brightener/dye/SRP1/Na
carboxymethylcellulose/photobleach/MgSO.sub.4/PVPVI/suds
suppressor/high molecular PEG/clay.
[0330] The pH of Examples 18(I) through (VI) is from about 9.6 to
about 11.3.
Example 19
Tablet Detergent Compositions
[0331] This Example provides various tablet detergent formulations.
The following tablet detergent compositions of the present
invention are prepared by compression of a granular dishwashing
detergent composition at a pressure of 13KN/cm.sup.2 using a
standard 12 head rotary press. In each of these formulations, at
least one protease variant provided herein is included at a
concentration of from about 0.0001 to about 10 weight percent. In
some alternative embodiments, other concentrations will find use,
as determined by the formulator, based on their needs.
TABLE-US-00039 TABLE 19-1 Tablet Detergent Compositions
Formulations Compound I II III IV V VI VII VIII STPP -- 48.8 44.7
38.2 -- 42.4 46.1 46.0 3Na Citrate 2H.sub.2O 20.0 -- -- -- 35.9 --
-- -- Na Carbonate 20.0 5.0 14.0 15.4 8.0 23.0 20.0 -- Silicate
15.0 14.8 15.0 12.6 23.4 2.9 4.3 4.2 Lipase 0.001 -- 0.01 -- 0.02
-- -- -- Protease B 0.01 -- -- -- -- -- -- -- (optional) Protease C
-- -- -- -- -- 0.01 -- -- (optional) nprE (optional) 0.01 0.08 --
0.04 -- 0.023 -- 0.05 PMN -- -- 0.05 -- 0.052 -- 0.023 -- Amylase
0.012 0.012 0.012 -- 0.015 -- 0.017 0.002 Pectin Lyase 0.005 -- --
0.002 -- -- -- -- Aldose Oxidase -- 0.03 -- 0.02 0.02 -- 0.03 --
PB1 -- -- 3.8 -- 7.8 -- -- 4.5 Percarbonate 6.0 -- -- 6.0 -- 5.0 --
-- BB1 0.2 -- 0.5 -- 0.3 0.2 -- -- BB2 -- 0.2 -- 0.5 -- -- 0.1 0.2
Nonionic 1.5 2.0 2.0 2.2 1.0 4.2 4.0 6.5 PAAC 0.01 0.01 0.02 -- --
-- -- -- DETBCHD -- -- -- 0.02 0.02 -- -- -- TAED -- -- -- -- --
2.1 -- 1.6 HEDP 1.0 -- -- 0.9 -- 0.4 0.2 -- DETPMP 0.7 -- -- -- --
-- -- -- Paraffin 0.4 0.5 0.5 0.5 -- -- 0.5 -- BTA 0.2 0.3 0.3 0.3
0.3 0.3 0.3 -- Polycarboxylate 4.0 -- -- -- 4.9 0.6 0.8 -- PEG
400-30,000 -- -- -- -- -- 2.0 -- 2.0 Glycerol -- -- -- -- -- 0.4 --
0.5 Perfume -- -- -- 0.05 0.2 0.2 0.2 0.2 Balance to 100% Moisture
and/or Minors* *Brightener/SRP1/Na
carboxymethylcellulose/photobleach/MgSO.sub.4/PVPVI/suds
suppressor/high molecular PEG/clay.
[0332] The pH of Examples 19(I) through 19(VII) is from about 10 to
about 11.5; pH of 19(VIII) is from 8-10. The tablet weight of
Examples 19(I) through 19(VIII) is from about 20 grams to about 30
grams.
Example 20
Liquid Hard Surface Cleaning Detergents
[0333] This Example provides various formulations for liquid hard
surface cleaning detergents. The following liquid hard surface
cleaning detergent compositions of the present invention are
provided below. In each of these formulations, at least one
protease variant provided herein is included at a concentration of
from about 0.0001 to about 10 weight percent. In some alternative
embodiments, other concentrations will find use, as determined by
the formulator, based on their needs.
TABLE-US-00040 TABLE 20-1 Liquid Hard Surface Cleaning Detergents
Formulations Compound I II III IV V VI VII C.sub.9-C.sub.11E.sub.5
2.4 1.9 2.5 2.5 2.5 2.4 2.5 C.sub.12-C.sub.14E.sub.5 3.6 2.9 2.5
2.5 2.5 3.6 2.5 C.sub.7-C.sub.9E.sub.6 -- -- -- -- 8.0 -- --
C.sub.12-C.sub.14E.sub.21 1.0 0.8 4.0 2.0 2.0 1.0 2.0 LAS -- -- --
0.8 0.8 -- 0.8 Sodium culmene sulfonate 1.5 2.6 -- 1.5 1.5 1.5 1.5
Isachem .RTM. AS 0.6 0.6 -- -- -- 0.6 -- Na.sub.2CO.sub.3 0.6 0.13
0.6 0.1 0.2 0.6 0.2 3Na Citrate 2H.sub.2O 0.5 0.56 0.5 0.6 0.75 0.5
0.75 NaOH 0.3 0.33 0.3 0.3 0.5 0.3 0.5 Fatty Acid 0.6 0.13 0.6 0.1
0.4 0.6 0.4 2-butyl octanol 0.3 0.3 -- 0.3 0.3 0.3 0.3 PEG DME-2000
.RTM. 0.4 -- 0.3 0.35 0.5 -- -- PVP 0.3 0.4 0.6 0.3 0.5 -- -- MME
PEG (2000) .RTM. -- -- -- -- -- 0.5 0.5 Jeffamine .RTM. ED-2001 --
0.4 -- -- 0.5 -- -- PAAC -- -- -- 0.03 0.03 0.03 -- DETBCHD 0.03
0.05 0.05 -- -- -- -- nprE (optional) 0.07 -- 0.08 0.03 -- 0.01
0.04 PMN -- 0.05 -- -- 0.06 -- -- Protease B (optional) -- -- -- --
-- 0.01 -- Amylase 0.12 0.01 0.01 -- 0.02 -- 0.01 Lipase -- 0.001
-- 0.005 -- 0.005 -- Pectin Lyase 0.001 -- 0.001 -- -- -- 0.002
ZnC12 0.02 0.01 0.03 0.05 0.1 0.05 0.02 Calcium Formate 0.03 0.03
0.01 -- -- -- -- PB1 -- 4.6 -- 3.8 -- -- -- Aldose Oxidase 0.05 --
0.03 -- 0.02 0.02 0.05 Balance to 100% perfume/dye and/or water
[0334] The pH of Examples 20(I) through (VII) is from about 7.4 to
about 9.5.
Sequence CWU 1
1
1061275PRTB. amyloliquefaciens 1Ala Gln Ser Val Pro Tyr Gly Val Ser
Gln Ile Lys Ala Pro Ala Leu 1 5 10 15 His Ser Gln Gly Tyr Thr Gly
Ser Asn Val Lys Val Ala Val Ile Asp 20 25 30 Ser Gly Ile Asp Ser
Ser His Pro Asp Leu Lys Val Ala Gly Gly Ala 35 40 45 Ser Met Val
Pro Ser Glu Thr Asn Pro Phe Gln Asp Asn Asn Ser His 50 55 60 Gly
Thr His Val Ala Gly Thr Val Ala Ala Leu Asn Asn Ser Ile Gly 65 70
75 80 Val Leu Gly Val Ala Pro Ser Ala Ser Leu Tyr Ala Val Lys Val
Leu 85 90 95 Gly Ala Asp Gly Ser Gly Gln Tyr Ser Trp Ile Ile Asn
Gly Ile Glu 100 105 110 Trp Ala Ile Ala Asn Asn Met Asp Val Ile Asn
Met Ser Leu Gly Gly 115 120 125 Pro Ser Gly Ser Ala Ala Leu Lys Ala
Ala Val Asp Lys Ala Val Ala 130 135 140 Ser Gly Val Val Val Val Ala
Ala Ala Gly Asn Glu Gly Thr Ser Gly 145 150 155 160 Ser Ser Ser Thr
Val Gly Tyr Pro Gly Lys Tyr Pro Ser Val Ile Ala 165 170 175 Val Gly
Ala Val Asp Ser Ser Asn Gln Arg Ala Ser Phe Ser Gln Tyr 180 185 190
Gly Pro Glu Leu Asp Val Met Ala Pro Gly Val Ser Ile Gln Ser Thr 195
200 205 Leu Pro Gly Asn Lys Tyr Gly Ala Tyr Asn Gly Thr Ser Met Ala
Ser 210 215 220 Pro His Val Ala Gly Ala Ala Ala Leu Ile Leu Ser Lys
His Pro Asn 225 230 235 240 Trp Thr Asn Thr Gln Val Arg Ser Ser Leu
Glu Asn Thr Thr Thr Lys 245 250 255 Leu Gly Asp Ser Phe Tyr Tyr Gly
Lys Gly Leu Ile Asn Val Gln Ala 260 265 270 Ala Ala Gln 275
2269PRTArtificial SequenceChemically synthesized mature GCI-P036
protease 2Ala Gln Ser Val Pro Trp Gly Ile Ser Arg Val Gln Ala Pro
Ala Ala 1 5 10 15 His Asn Arg Gly Leu Thr Gly Ser Gly Val Lys Val
Ala Val Leu Asp 20 25 30 Thr Gly Ile Ser Thr His Pro Asp Leu Asn
Ile Arg Gly Gly Ala Ser 35 40 45 Phe Val Pro Gly Glu Pro Ser Thr
Gln Asp Gly Asn Gly His Gly Thr 50 55 60 His Val Ala Gly Thr Ile
Ala Ala Leu Asn Asn Ser Ile Gly Val Leu 65 70 75 80 Gly Val Ala Pro
Ser Ala Glu Leu Tyr Ala Val Lys Val Leu Gly Ala 85 90 95 Ser Gly
Ser Gly Ser Val Ser Ser Ile Ala Gln Gly Leu Glu Trp Ala 100 105 110
Gly Asn Asn Gly Met His Val Ala Asn Leu Ser Leu Gly Ser Pro Ser 115
120 125 Pro Ser Ala Thr Leu Glu Gln Ala Val Asn Ser Ala Thr Ser Arg
Gly 130 135 140 Val Leu Val Val Ala Ala Ser Gly Asn Ser Gly Ala Gly
Ser Ile Ser 145 150 155 160 Tyr Pro Ala Arg Tyr Ala Asn Ala Met Ala
Val Gly Ala Thr Asp Gln 165 170 175 Asn Asn Asn Arg Ala Ser Phe Ser
Gln Tyr Gly Ala Gly Leu Asp Ile 180 185 190 Val Ala Pro Gly Val Asn
Val Gln Ser Thr Tyr Pro Gly Ser Thr Tyr 195 200 205 Ala Ser Leu Asn
Gly Thr Ser Met Ala Thr Pro His Val Ala Gly Ala 210 215 220 Ala Ala
Leu Val Lys Gln Lys Asn Pro Ser Trp Ser Asn Val Gln Ile 225 230 235
240 Arg Asn His Leu Lys Asn Thr Ala Thr Ser Leu Gly Ser Thr Asn Leu
245 250 255 Tyr Gly Ser Gly Leu Val Asn Ala Glu Ala Ala Thr Arg 260
265 3269PRTArtificial SequenceChemically synthesized GCI-P037
protease 3Ala Gln Ser Val Pro Trp Gly Ile Ser Arg Val Gln Ala Pro
Ala Ala 1 5 10 15 His Asn Arg Gly Leu Thr Gly Ser Gly Val Lys Val
Ala Val Leu Asp 20 25 30 Thr Gly Ile Ser Thr His Pro Asp Leu Asn
Ile Arg Gly Gly Ala Ser 35 40 45 Phe Val Pro Gly Glu Pro Ser Thr
Gln Asp Gly Asn Gly His Gly Thr 50 55 60 His Val Ala Gly Thr Ile
Ala Ala Leu Asn Asn Ser Ile Gly Val Leu 65 70 75 80 Gly Val Ala Pro
Asn Ala Glu Leu Tyr Ala Val Lys Val Leu Gly Ala 85 90 95 Ser Gly
Ser Gly Ser Val Ser Ser Ile Ala Gln Gly Leu Glu Trp Ala 100 105 110
Gly Asn Asn Gly Met His Val Ala Asn Leu Ser Leu Gly Ser Pro Ser 115
120 125 Pro Ser Ala Thr Leu Glu Gln Ala Val Asn Ser Ala Thr Ser Arg
Gly 130 135 140 Val Leu Val Val Ala Ala Ser Gly Asn Ser Gly Ala Gly
Ser Ile Ser 145 150 155 160 Tyr Pro Ala Arg Tyr Ala Asn Ala Met Ala
Val Gly Ala Thr Asp Gln 165 170 175 Asn Asn Asn Arg Ala Ser Phe Ser
Gln Tyr Gly Ala Gly Leu Asp Ile 180 185 190 Val Ala Pro Gly Val Asn
Val Gln Ser Thr Tyr Pro Gly Ser Thr Tyr 195 200 205 Ala Ser Leu Asn
Gly Thr Ser Met Ala Thr Pro His Val Ala Gly Ala 210 215 220 Ala Ala
Leu Val Lys Gln Lys Asn Pro Ser Trp Ser Asn Val Gln Ile 225 230 235
240 Arg Asn His Leu Lys Asn Thr Ala Thr Ser Leu Gly Ser Thr Asn Leu
245 250 255 Tyr Gly Ser Gly Leu Val Asn Ala Glu Ala Ala Thr Arg 260
265 4269PRTArtificial SequenceChemically synthesized GCI-P038
protease 4Ala Gln Ser Val Pro Trp Gly Ile Ser Arg Val Gln Ala Pro
Ala Ala 1 5 10 15 His Asn Arg Gly Leu Thr Gly Ser Gly Val Lys Val
Ala Val Leu Asp 20 25 30 Thr Gly Ile Ser Thr His Pro Asp Leu Asn
Ile Arg Gly Gly Ala Ser 35 40 45 Phe Val Pro Gly Glu Pro Ser Thr
Gln Asp Gly Asn Gly His Gly Thr 50 55 60 His Val Ala Gly Thr Ile
Ala Ala Leu Asn Asn Ser Ile Gly Val Leu 65 70 75 80 Gly Val Ala Pro
Asn Ala Glu Leu Tyr Ala Val Lys Val Leu Gly Ala 85 90 95 Ser Gly
Ser Gly Ser Val Ser Ser Ile Ala Gln Gly Leu Glu Trp Ala 100 105 110
Gly Asn Asn Val Met His Val Ala Asn Leu Ser Leu Gly Leu Gln Ala 115
120 125 Pro Ser Ala Thr Leu Glu Gln Ala Val Asn Ser Ala Thr Ser Arg
Gly 130 135 140 Val Leu Val Val Ala Ala Ser Gly Asn Ser Gly Ala Gly
Ser Ile Ser 145 150 155 160 Tyr Pro Ala Arg Tyr Ala Asn Ala Met Ala
Val Gly Ala Thr Asp Gln 165 170 175 Asn Asn Asn Arg Ala Ser Phe Ser
Gln Tyr Gly Ala Gly Leu Asp Ile 180 185 190 Val Ala Pro Gly Val Asn
Val Gln Ser Thr Tyr Pro Gly Ser Thr Tyr 195 200 205 Ala Ser Leu Asn
Gly Thr Ser Met Ala Thr Pro His Val Ala Gly Ala 210 215 220 Ala Ala
Leu Val Lys Gln Lys Asn Pro Ser Trp Ser Asn Val Gln Ile 225 230 235
240 Arg Asn His Leu Lys Asn Thr Ala Thr Ser Leu Gly Ser Thr Asn Leu
245 250 255 Tyr Gly Ser Gly Leu Val Asn Ala Glu Ala Ala Thr Arg 260
265 51303DNAArtificial SequenceChemically synthesized
oligonucleotide used in GCI-P036 Protease Production 5atctcaaaaa
aatgggtcta ctaaaatatt actccatcta ttataataaa ttcacagaat 60agtcttttaa
gtaagtctac tctgaatttt tttaaaagga gagggtaaag agtgagaagc
120aaaaaattgt ggatcgtcgc gtcgaccgca ttgctgattt ctgttgcttt
tagctcatcc 180atcgcatccg ctgctgaaga agcaaaagaa aaatatttaa
ttggctttaa tgagcaggaa 240gctgtcagtg agtttgtaga acaagttgag
gcaaatgacg aggtagccat tctctctgag 300gaagaggaag tcgaaattga
attgcttcat gaatttgaaa cgattcctgt tctgtccgtt 360gagttaagcc
cagaagatgt ggacgcgtta gagctcgatc cagctatttc ttatattgaa
420gaggatgcag aagtaactac aatggcgcaa tcggtaccat ggggaattag
cagagtacaa 480gccccagctg cacataaccg tggattgaca ggttctggtg
taaaagttgc tgtccttgat 540accggtattt ccactcatcc agacttaaat
attcgtggtg gagctagctt tgtaccaggg 600gaaccatcca ctcaagatgg
caatggacat ggcactcatg ttgccggcac aatcgcggct 660cttaacaatt
caattggtgt tcttggcgta gcgccaagcg cagaactata cgctgttaaa
720gtattaggag caagcggttc aggctctgtc agctctattg cccaaggatt
ggaatgggca 780gggaacaatg gcatgcacgt tgctaatctt agtttaggat
ctccttcgcc aagtgccaca 840cttgagcaag ctgttaatag cgcgacttct
agaggcgttc ttgttgtagc ggcctctgga 900aattcaggtg caggctcaat
cagctatccg gcccgttatg cgaacgctat ggcagtcgga 960gctactgacc
aaaacaacaa ccgcgccagc ttttcacagt atggcgcagg gcttgacatt
1020gtcgcaccag gtgtaaacgt gcagagcact tacccaggtt caacatatgc
cagcttaaac 1080ggtacatcaa tggctactcc tcatgttgca ggtgcggctg
cacttgttaa acaaaagaac 1140ccatcttggt ccaatgtaca aatccgcaat
catcttaaga atacggcaac tagcttagga 1200agcacaaact tgtatggaag
cggacttgtc aatgcagaag ctgcaactcg ttaaaagctt 1260aactcgagat
aaaaaaccgg ccttggcccc gccggttttt tat 13036380PRTARTIFICIAL
SEQUENCEGCI-P036 precursor protein 6Met Arg Ser Lys Lys Leu Trp Ile
Val Ala Ser Thr Ala Leu Leu Ile 1 5 10 15 Ser Val Ala Phe Ser Ser
Ser Ile Ala Ser Ala Ala Glu Glu Ala Lys 20 25 30 Glu Lys Tyr Leu
Ile Gly Phe Asn Glu Gln Glu Ala Val Ser Glu Phe 35 40 45 Val Glu
Gln Val Glu Ala Asn Asp Glu Val Ala Ile Leu Ser Glu Glu 50 55 60
Glu Glu Val Glu Ile Glu Leu Leu His Glu Phe Glu Thr Ile Pro Val 65
70 75 80 Leu Ser Val Glu Leu Ser Pro Glu Asp Val Asp Ala Leu Glu
Leu Asp 85 90 95 Pro Ala Ile Ser Tyr Ile Glu Glu Asp Ala Glu Val
Thr Thr Met Ala 100 105 110 Gln Ser Val Pro Trp Gly Ile Ser Arg Val
Gln Ala Pro Ala Ala His 115 120 125 Asn Arg Gly Leu Thr Gly Ser Gly
Val Lys Val Ala Val Leu Asp Thr 130 135 140 Gly Ile Ser Thr His Pro
Asp Leu Asn Ile Arg Gly Gly Ala Ser Phe 145 150 155 160 Val Pro Gly
Glu Pro Ser Thr Gln Asp Gly Asn Gly His Gly Thr His 165 170 175 Val
Ala Gly Thr Ile Ala Ala Leu Asn Asn Ser Ile Gly Val Leu Gly 180 185
190 Val Ala Pro Ser Ala Glu Leu Tyr Ala Val Lys Val Leu Gly Ala Ser
195 200 205 Gly Ser Gly Ser Val Ser Ser Ile Ala Gln Gly Leu Glu Trp
Ala Gly 210 215 220 Asn Asn Gly Met His Val Ala Asn Leu Ser Leu Gly
Ser Pro Ser Pro 225 230 235 240 Ser Ala Thr Leu Glu Gln Ala Val Asn
Ser Ala Thr Ser Arg Gly Val 245 250 255 Leu Val Val Ala Ala Ser Gly
Asn Ser Gly Ala Gly Ser Ile Ser Tyr 260 265 270 Pro Ala Arg Tyr Ala
Asn Ala Met Ala Val Gly Ala Thr Asp Gln Asn 275 280 285 Asn Asn Arg
Ala Ser Phe Ser Gln Tyr Gly Ala Gly Leu Asp Ile Val 290 295 300 Ala
Pro Gly Val Asn Val Gln Ser Thr Tyr Pro Gly Ser Thr Tyr Ala 305 310
315 320 Ser Leu Asn Gly Thr Ser Met Ala Thr Pro His Val Ala Gly Ala
Ala 325 330 335 Ala Leu Val Lys Gln Lys Asn Pro Ser Trp Ser Asn Val
Gln Ile Arg 340 345 350 Asn His Leu Lys Asn Thr Ala Thr Ser Leu Gly
Ser Thr Asn Leu Tyr 355 360 365 Gly Ser Gly Leu Val Asn Ala Glu Ala
Ala Thr Arg 370 375 380 71148DNAARTIFICIAL SEQUENCEChemically
synthesized oligonucleotide used in GCI-P036 Protease Production
7gtgagaagca aaaaattgtg gatcgtcgcg tcgaccgcac tactcatttc tgttgctttc
60agttcatcga tcgcatcggc tgctgaagaa gcaaaagaaa aatatttaat tggctttaat
120gagcaggaag ctgtcagtga gtttgtagaa caagtagagg caaatgacga
ggtcgccatt 180ctctctgagg aagaggaagt cgaaattgaa ttgcttcatg
aatttgaaac gattcctgtt 240ttatccgttg agttaagccc agaagatgtg
gacgcgcttg agctcgatcc agcgatttct 300tatattgaag aggatgcaga
agtaacgaca atggcgcaat cagtgccatg gggaattagc 360cgtgtgcaag
ccccagctgc ccataaccgt ggattgacag gttctggtgt aaaagttgct
420gtcctcgata caggtatttc cactcatcca gacttaaata ttcgtggtgg
cgctagcttt 480gtaccagggg aaccatccac tcaagatggg aatgggcatg
gcacgcatgt ggccgggacg 540attgctgctt taaacaattc gattggcgtt
cttggcgtag cgccgagcgc ggaactatac 600gctgttaaag tattaggggc
gagcggttca ggttcggtca gctcgattgc ccaaggattg 660gaatgggcag
ggaacaatgg catgcacgtt gctaatttga gtttaggaag cccttcgcca
720agtgccacac ttgagcaagc tgttaatagc gcgacttcta gaggcgttct
tgttgtagcg 780gcatctggaa attcaggtgc aggctcaatc agctatccgg
cccgttatgc gaacgcaatg 840gcagtcggag ctactgacca aaacaacaac
cgcgccagct tttcacagta tggcgcaggg 900cttgacattg tcgcaccagg
tgtaaacgtg cagagcacat acccaggttc aacgtatgcc 960agcttaaacg
gtacatcgat ggctactcct catgttgcag gtgcagcagc ccttgttaaa
1020caaaagaacc catcttggtc caatgtacaa atccgcaatc atctaaagaa
tacggcaacg 1080agcttaggaa gcacgaactt gtatggaagc ggacttgtca
atgcagaagc tgcaactcgt 1140taaagctt 114881797DNAArtificial
SequenceChemically synthesized GCI-P036ci sequence of
p2JH-GCI-P036ci 8aattctccat tttcttctgc tatcaaaata acagactcgt
gattttccaa acgagctttc 60aaaaaagcct ctgccccttg caaatcggat gcctgtctat
aaaattcccg atattggtta 120aacagcggcg caatggcggc cgcatctgat
gtctttgctt ggcgaatgtt catcttattt 180cttcctccct ctcaataatt
ttttcattct atcccttttc tgtaaagttt atttttcaga 240atacttttat
catcatgctt tgaaaaaata tcacgataat atccattgtt ctcacggaag
300cacacgcagg tcatttgaac gaattttttc gacaggaatt tgccgggact
caggagcatt 360taacctaaaa aagcatgaca tttcagcata atgaacattt
actcatgtct attttcgttc 420ttttctgtat gaaaatagtt atttcgagtc
tctacggaaa tagcgagaga tgatatacct 480aaatagagat aaaatcatct
caaaaaaatg ggtctactaa aatattattc catctattac 540aataaattca
cagaatagtc ttttaagtaa gtctactctg aattttttta aaaggagagg
600gtaaagagtg agaagcaaaa aattgtggat cgtcgcgtcg accgcattgc
tgatttctgt 660tgcttttagc tcatccatcg catccgctgc tgaagaagca
aaagaaaaat atttaattgg 720ctttaatgag caggaagctg tcagtgagtt
tgtagaacaa gttgaggcaa atgacgaggt 780agccattctc tctgaggaag
aggaagtcga aattgaattg cttcatgaat ttgaaacgat 840tcctgttctg
tccgttgagt taagcccaga agatgtggac gcgttagagc tcgatccagc
900tatttcttat attgaagagg atgcagaagt aactacaatg gcgcaatcgg
taccatgggg 960aattagcaga gtacaagccc cagctgcaca taaccgtgga
ttgacaggtt ctggtgtaaa 1020agttgctgtc cttgataccg gtatttccac
tcatccagac ttaaatattc gtggtggagc 1080tagctttgta ccaggggaac
catccactca agatggcaat ggacatggca ctcatgttgc 1140cggcacaatc
gcggctctta acaattcaat tggtgttctt ggcgtagcgc caagcgcaga
1200actatacgct gttaaagtat taggagcaag cggttcaggc tctgtcagct
ctattgccca 1260aggattggaa tgggcaggga acaatggcat gcacgttgct
aatcttagtt taggatctcc 1320ttcgccaagt gccacacttg agcaagctgt
taatagcgcg acttctagag gcgttcttgt 1380tgtagcggcc tctggaaatt
caggtgcagg ctcaatcagc tatccggccc gttatgcgaa 1440cgctatggca
gtcggagcta ctgaccaaaa caacaaccgc gccagctttt cacagtatgg
1500cgcagggctt gacattgtcg caccaggtgt aaacgtgcag agcacttacc
caggttcaac 1560atatgccagc ttaaacggta catcaatggc tactcctcat
gttgcaggtg cggctgcact 1620tgttaaacaa aagaacccat cttggtccaa
tgtacaaatc cgcaatcatc ttaagaatac 1680ggcaactagc ttaggaagca
caaacttgta tggaagcgga cttgtcaatg cagaagctgc 1740aactcgttaa
aagcttaact cgagataaaa aaccggcctt ggccccgccg gtttttt
1797935DNAArtificial SequenceSynthetic primer S126A-F 9ctaatcttag
tttaggagct ccttcgccaa gtgcc 351035DNAArtificial SequenceSynthetic
primer S126A-R 10ggcacttggc gaaggagctc ctaaactaag attag
351141DNAArtificial SequenceSynthetic primer S126C-F 11cacgttgcta
atcttagttt aggatgccct tcgccaagtg c 411241DNAArtificial
SequenceSynthetic primer S126C-R 12gcacttggcg aagggcatcc taaactaaga
ttagcaacgt g 411341DNAArtificial SequenceSynthetic primer S126D-F
13gcacgttgct aatcttagtt taggagatcc ttcgccaagt g 411441DNAArtificial
SequenceSynthetic primer S126D-R 14cacttggcga
aggatctcct aaactaagat tagcaacgtg c 411546DNAArtificial
SequenceSynthetic primer S126E-F 15catgcacgtt gctaatctta gtttaggaga
accttcgcca agtgcc 461646DNAArtificial SequenceSynthetic primer
S126E-R 16ggcacttggc gaaggttctc ctaaactaag attagcaacg tgcatg
461741DNAArtificial SequenceSynthetic primer S126F-F 17cacgttgcta
atcttagttt aggattccct tcgccaagtg c 411841DNAArtificial
SequenceSynthetic primer S126F-R 18gcacttggcg aagggaatcc taaactaaga
ttagcaacgt g 411946DNAArtificial SequenceSynthetic primer S126G-F
19catgcacgtt gctaatctta gtttaggagg cccttcgcca agtgcc
462046DNAArtificial SequenceSynthetic primer S126G-R 20ggcacttggc
gaagggcctc ctaaactaag attagcaacg tgcatg 462146DNAArtificial
SequenceSynthetic primer S126H-F 21catgcacgtt gctaatctta gtttaggaca
cccttcgcca agtgcc 462246DNAArtificial SequenceSynthetic primer
S126H-R 22ggcacttggc gaagggtgtc ctaaactaag attagcaacg tgcatg
462346DNAArtificial SequenceSynthetic primer S126I-F 23catgcacgtt
gctaatctta gtttaggaat cccttcgcca agtgcc 462446DNAArtificial
SequenceSynthetic primer S126I-R 24ggcacttggc gaagggattc ctaaactaag
attagcaacg tgcatg 462546DNAArtificial SequenceSynthetic primer
S126K-F 25catgcacgtt gctaatctta gtttaggaaa accttcgcca agtgcc
462646DNAArtificial SequenceSynthetic primer S126K-R 26ggcacttggc
gaaggttttc ctaaactaag attagcaacg tgcatg 462741DNAArtificial
SequenceSynthetic primer S126L-F 27gcacgttgct aatcttagtt taggacttcc
ttcgccaagt g 412841DNAArtificial SequenceSynthetic primer S126L-R
28cacttggcga aggaagtcct aaactaagat tagcaacgtg c 412946DNAArtificial
SequenceSynthetic primer S126M-F 29catgcacgtt gctaatctta gtttaggaat
gccttcgcca agtgcc 463046DNAArtificial SequenceSynthetic primer
S126M-R 30ggcacttggc gaaggcattc ctaaactaag attagcaacg tgcatg
463146DNAArtificial SequenceSynthetic primer S126N-F 31catgcacgtt
gctaatctta gtttaggaaa cccttcgcca agtgcc 463246DNAArtificial
SequenceSynthetic primer S126N-R 32ggcacttggc gaagggtttc ctaaactaag
attagcaacg tgcatg 463335DNAArtificial SequenceSynthetic primer
S126P-F 33ctaatcttag tttaggacct ccttcgccaa gtgcc
353435DNAArtificial SequenceSynthetic primer S126P-R 34ggcacttggc
gaaggaggtc ctaaactaag attag 353546DNAArtificial SequenceSynthetic
primer S126Q-F 35catgcacgtt gctaatctta gtttaggaca accttcgcca agtgcc
463646DNAArtificial SequenceSynthetic primer S126Q-R 36ggcacttggc
gaaggttgtc ctaaactaag attagcaacg tgcatg 463746DNAArtificial
SequenceSynthetic primer S126R-F 37catgcacgtt gctaatctta gtttaggaag
accttcgcca agtgcc 463846DNAArtificial SequenceSynthetic primer
S126R-R 38ggcacttggc gaaggtcttc ctaaactaag attagcaacg tgcatg
463940DNAArtificial SequenceSynthetic primer S126T-F 39cacgttgcta
atcttagttt aggaacacct tcgccaagtg 404040DNAArtificial
SequenceSynthetic primer S126T-R 40cacttggcga aggtgttcct aaactaagat
tagcaacgtg 404141DNAArtificial SequenceSynthetic primer S126V-F
41gcacgttgct aatcttagtt taggagttcc ttcgccaagt g 414241DNAArtificial
SequenceSynthetic primer S126V-R 42cacttggcga aggaactcct aaactaagat
tagcaacgtg c 414341DNAArtificial SequenceSynthetic primer S126W-F
43cacgttgcta atcttagttt aggatggcct tcgccaagtg c 414441DNAArtificial
SequenceSynthetic primer S126W-R 44gcacttggcg aaggccatcc taaactaaga
ttagcaacgt g 414541DNAArtificial SequenceSynthetic primer S126Y-F
45cacgttgcta atcttagttt aggataccct tcgccaagtg c 414641DNAArtificial
SequenceSynthetic primer S126Y-R 46gcacttggcg aagggtatcc taaactaaga
ttagcaacgt g 414742DNAArtificial SequenceSynthetic primer S9L-F
47gcaatcggta ccatggggaa ttcttagagt acaagcccca gc
424842DNAArtificial SequenceSynthetic primer S9L-R 48gctggggctt
gtactctaag aattccccat ggtaccgatt gc 424934DNAArtificial
SequenceSynthetic primer S9G-F 49aatcggtacc atggggaatt ggcagagtac
aagc 345034DNAArtificial SequenceSynthetic primer S9G-R
50gcttgtactc tgccaattcc ccatggtacc gatt 345139DNAArtificial
SequenceSynthetic primer A106C-F 51caggctctgt cagctctatt tgccaaggat
tggaatggg 395239DNAArtificial SequenceSynthetic primer A106C-R
52cccattccaa tccttggcaa atagagctga cagagcctg 395337DNAArtificial
SequenceSynthetic primer A106I-F 53ggaacaatgg catgcacgct gctaatctta
gtttagg 375437DNAArtificial SequenceSynthetic primer A106I-R
54cctaaactaa gattagcagc gtgcatgcca ttgttcc 375543DNAArtificial
SequenceSynthetic primer A106M-F 55tcaggctctg tcagctctat tatgcaagga
ttggaatggg cag 435643DNAArtificial SequenceSynthetic primer A106M-R
56ctgcccattc caatccttgc ataatagagc tgacagagcc tga
435739DNAArtificial SequenceSynthetic primer V119A-F 57caggctctgt
cagctctatt atccaaggat tggaatggg 395839DNAArtificial
SequenceSynthetic primer V119A-R 58cccattccaa tccttggata atagagctga
cagagcctg 395939DNAArtificial SequenceSynthetic primer L124F-F
59gcatgcacgt tgctaatctt agtttcggat ctccttcgc 396039DNAArtificial
SequenceSynthetic primer L124F-R 60gcgaaggaga tccgaaacta agattagcaa
cgtgcatgc 396147DNAArtificial SequenceSynthetic primer L124N-F
61acaatggcat gcacgttgct aatcttagta acggatctcc ttcgcca
476247DNAArtificial SequenceSynthetic primer L124N-R 62tggcgaagga
gatccgttac taagattagc aacgtgcatg ccattgt 476347DNAArtificial
SequenceSynthetic primer G125S-F 63atggcatgca cgttgctaat cttagtttat
cttctccttc gccaagt 476447DNAArtificial SequenceSynthetic primer
G125S-R 64acttggcgaa ggagaagata aactaagatt agcaacgtgc atgccat
476529DNAArtificial SequenceSynthetic primer N167H-F 65cggcccgtta
tgcgcacgct atggcagtc 296629DNAArtificial SequenceSynthetic primer
N167H-R 66gactgccata gcgtgcgcat aacgggccg 296744DNAArtificial
SequenceSynthetic primer V28A-F 67gttctggtgt aaaagctgct gtccttgata
ccggtatttc cact 446844DNAArtificial SequenceSynthetic primer V28A-R
68caagaccaca ttttcgacga caggaactat ggccataaag gtga
446944DNAArtificial SequenceSynthetic primer V30A-F 69gttctggtgt
aaaagttgct gctcttgata ccggtatttc cact 447044DNAArtificial
SequenceSynthetic primer V30A-R 70agtggaaata ccggtatcaa gagcagcaac
ttttacacca gaac 447138DNAArtificial SequenceSynthetic primer N60S-F
71ccatccactc aagatggctc tggacatggc actcatgt 387238DNAArtificial
SequenceSynthetic primer N60S-R 72acatgagtgc catgtccaga gccatcttga
gtggatgg 387345DNAArtificial SequenceSynthetic primer V91T-F
73ccaagcgcag aactatacgc tacaaaagta ttaggagcaa gcggt
457445DNAArtificial SequenceSynthetic primer V91T-R 74accgcttgct
cctaatactt ttgtagcgta tagttctgcg cttgg 457546DNAArtificial
SequenceSynthetic primer L94A-F 75aagcgcagaa ctatacgctg ttaaagtagc
tggagcaagc ggttca 467646DNAArtificial SequenceSynthetic primer
L94A-R 76tgaaccgctt gctccagcta ctttaacagc gtatagttct gcgctt
467747DNAArtificial SequenceSynthetic primer G95P-F 77gcgcagaact
atacgctgtt aaagtattac ctgcaagcgg ttcaggc 477847DNAArtificial
SequenceSynthetic primer G95P-R 78gcctgaaccg cttgcaggta atactttaac
agcgtatagt tctgcgc 477938DNAArtificial SequenceSynthetic primer
I105F-F 79gttcaggctc tgtcagctct ttcgcccaag gattggaa
388038DNAArtificial SequenceSynthetic primer I105F-R 80ttccaatcct
tgggcgaaag agctgacaga gcctgaac 388143DNAArtificial
SequenceSynthetic primer G113M-F 81tcaggctctg tcagctctat tatgcaagga
ttggaatggg cag 438243DNAArtificial SequenceSynthetic primer G113M-R
82ctgcccattc caatccttgc ataatagagc tgacagagcc tga
438340DNAArtificial SequenceSynthetic primer S123A-F 83catgcacgtt
gctaatcttg ctttaggatc tccttcgcca 408424DNAArtificial
SequenceSynthetic primer S123A-R 84tggcgaagga gatcctaaag caag
248539DNAArtificial SequenceSynthetic primer S130N-F 85tttaggatct
ccttcgccaa acgccacact tgagcaagc 398639DNAArtificial
SequenceSynthetic primer S130N-R 86gcttgctcaa gtgtggcgtt tggcgaagga
gatcctaaa 398735DNAArtificial SequenceSynthetic primer V145I-F
87cgcgacttct agaggcatcc ttgttgtagc ggcct 358835DNAArtificial
SequenceSynthetic primer V145I-R 88aggccgctac aacaaggatg cctctagaag
tcgcg 358937DNAArtificial SequenceSynthetic primer F183G-F
89acaacaaccg cgccagcggc tcacagtatg gcgcagg 379037DNAArtificial
SequenceSynthetic primer F183G-R 90cctgcgccat actgtgagcc gctggcgcgg
ttgttgt 379127DNAArtificial SequenceSynthetic primer I192L-F
91cgcagggctt gaccttgtcg caccagg 279227DNAArtificial
SequenceSynthetic primer I192L-R 92cctggtgcga caaggtcaag ccctgcg
279340DNAArtificial SequenceSynthetic primer T218N-F 93aaacggtaca
tcaatggcta accctcatgt tgcaggtgcg 409440DNAArtificial
SequenceSynthetic primer T218N-R 94cgcacctgca acatgagggt tagccattga
tgtaccgttt 409533DNAArtificial SequenceSynthetic primer A222G-F
95gctactcctc atgttggcgg tgcggctgca ctt 339633DNAArtificial
SequenceSynthetic primer A222G-R 96aagtgcagcc gcaccgccaa catgaggagt
agc 339720DNAArtificial SequenceSynthetic primer
ISH-PCR-GCI-P036-5832F 97acaaataggg gttccgcgca 209820DNAArtificial
SequenceSynthetic primer ISH-PCR-GCI-P036-1902R 98cgcaagaatt
gattggctcc 209927DNAArtificial SequenceSynthetic primer SacI-Fw
99cgcgcttgag ctcgatccag cgatttc 2710025DNAArtificial
SequenceSynthetic primer HindIII-Rv 100gtctccaagc tttaacgagt tgcag
2510130DNAArtificial SequenceSynthetic primer pHPLT-BglII-Fw
101gcaattcaga tcttccttca ggttatgacc 3010230DNAArtificial
SequenceSynthetic primer pHPLT-BglII-Rv 102gcatcgaaga tctgattgct
taactgcttc 301034PRTArtificial SequenceSynthetic peptide motif
103His Gly Thr His 1 1047PRTArtificial SequenceSynthetic peptide
motif 104Gly Thr Ser Met Ala Xaa Pro 1 5 1054PRTArtificial
SequenceSynthetic peptide motif 105His Gly Thr Arg 1
1066PRTArtificial SequenceSynthetic peptide motif 106Gly Thr Ser
Xaa Xaa Pro 1 5
* * * * *