U.S. patent application number 14/526334 was filed with the patent office on 2015-04-23 for osteocalcin as a treatment for male reproductive disorders.
The applicant listed for this patent is The Trustees Of Columbia University In The City Of New York. Invention is credited to Patricia F. Ducy, Gerard KARSENTY.
Application Number | 20150111825 14/526334 |
Document ID | / |
Family ID | 44307540 |
Filed Date | 2015-04-23 |
United States Patent
Application |
20150111825 |
Kind Code |
A1 |
KARSENTY; Gerard ; et
al. |
April 23, 2015 |
OSTEOCALCIN AS A TREATMENT FOR MALE REPRODUCTIVE DISORDERS
Abstract
Methods and compositions for treating, preventing, or diagnosing
disorders related to reproduction in male mammals, preferably
humans, are provided. The methods generally involve modulation of
the OST-PTP signaling pathway or the PTP-1B signaling pathway
involving gamma-carboxylase and osteocalcin. Disorders amenable to
treatment by the methods include, but are not limited to, male
infertility, low sperm count, impaired sperm motility, impaired
sperm viability, low testosterone levels, reduced libido, erectile
dysfunction, underdevelopment of testes, and excess apoptosis in
testes.
Inventors: |
KARSENTY; Gerard; (New York,
NY) ; Ducy; Patricia F.; (New York, NY) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
The Trustees Of Columbia University In The City Of New
York |
New York |
NY |
US |
|
|
Family ID: |
44307540 |
Appl. No.: |
14/526334 |
Filed: |
October 28, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13574196 |
Oct 15, 2012 |
8883739 |
|
|
PCT/US11/21634 |
Jan 19, 2011 |
|
|
|
14526334 |
|
|
|
|
61296339 |
Jan 19, 2010 |
|
|
|
61296415 |
Jan 19, 2010 |
|
|
|
Current U.S.
Class: |
514/10.2 ;
514/9.8 |
Current CPC
Class: |
A61P 15/00 20180101;
A61P 15/08 20180101; A61P 43/00 20180101; A61K 38/39 20130101; A61P
15/16 20180101; A61P 15/10 20180101 |
Class at
Publication: |
514/10.2 ;
514/9.8 |
International
Class: |
A61K 38/39 20060101
A61K038/39 |
Goverment Interests
[0002] This invention was made with Government support under Grant
No. PHS 398/2590 (Rev. September 2004, Reissued April 2006). The
Government has certain rights in the invention.
Claims
1. A method of treatment for increasing low sperm count, increasing
low testosterone, or decreasing excessive apoptosis in testes in
male mammals comprising administering to a male mammal in need of
such treatment a pharmaceutical composition comprising a
therapeutically effective amount of
undercarboxylated/uncarboxylated osteocalcin and a pharmaceutically
acceptable carrier or excipient.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application continuation of U.S. application Ser. No.
13/574,196, filed Oct. 15, 2012, which is a 371 of International
Patent Application No. PCT/US2011/021634, filed Jan. 19, 2011,
which claims priority to U.S. Provisional Patent Application Ser.
No. 61/296,339, filed Jan. 19, 2010 and U.S. Provisional Patent
Application Ser. No. 61/296,415, filed Jan. 19, 2010. The contents
of these applications are hereby incorporated by reference in their
entireties.
FIELD OF THE INVENTION
[0003] The present invention is directed to methods and
compositions for treating, preventing, and diagnosing disorders
related to reproduction in male mammals. Such disorders include,
but are not limited to, male infertility, low sperm count, impaired
sperm motility, impaired sperm viability, low testosterone levels,
reduced libido, erectile dysfunction, underdevelopment of testes,
and excess apoptosis in testes. The present invention also provides
methods of contraception for use in male mammals.
BACKGROUND OF THE INVENTION
[0004] Osteocalcin, one of the very few osteoblast-specific
proteins, has several features of a hormone. For instance, it is
synthesized as a pre-pro-molecule and is secreted in the general
circulation (Hauschka et al., 1989, Physiol. Review 69:990-1047;
Price, 1989, Connect. Tissue Res. 21:51-57 (discussion 57-60)).
Because of their exquisite cell-specific expression, the
osteocalcin genes have been intensively studied to identify
osteoblast-specific transcription factors and to define the
molecular bases of bone physiology (Ducy et al., 2000, Science
289:1501-1504; Harada & Rodan, 2003, Nature 423:349-355).
[0005] Osteocalcin is the most abundant non-collagenous protein
found associated with the mineralized bone matrix and it is
currently being used as a biological marker for clinical assessment
of bone turnover. Osteocalcin is a small (46-50 residue) bone
specific protein that contains 3 gamma-carboxylated glutamic acid
residues in its primary structure. The name osteocalcin (osteo,
Greek for bone; calc, Latin for lime salts; in, protein) derives
from the protein's ability to bind Ca.sup.2+ and its abundance in
bone. Osteocalcin undergoes a peculiar post-translational
modification whereby glutamic acid residues are carboxylated to
form gamma-carboxyglutamic acid (Gla) residues; hence osteocalcin's
other name, bone Gla protein (Hauschka et al., 1989, Physiol.
Review 69:990-1047).
[0006] Mature human osteocalcin contains 49 amino acids with a
predicted molecular mass of 5,800 kDa (Poser et al., 1980, J. Biol.
Chem. 255:8685-8691). Osteocalcin is synthesized primarily by
osteoblasts and ondontoblasts and comprises 15 to 20% of the
non-collagenous protein of bone. Poser et al., 1980, J. Biol. Chem.
255:8685-8691 showed that mature osteocalcin contains three
carboxyglutamic acid residues which are formed by
post-translational vitamin K-dependent modification of glutamic
acid residues. The carboxylated Gla residues are at positions 17,
21 and 24 of human mature osteocalcin. Some human osteocalcin has
been shown to contain only 2 Gla residues (Poser & Price, 1979,
J. Biol. Chem. 254:431-436).
[0007] Osteocalcin has several features of a hormone. Ducy et al.,
1996, Nature 382:448-452 demonstrated that mineralized bone from
aging osteocalcin-deficient mice was two times thicker than that of
wild-type. It was shown that the absence of osteocalcin led to an
increase in bone formation without impairing bone resorption and
did not affect mineralization. Multiple immunoreactive forms of
human osteocalcin have been discovered in circulation (Garnero et
al., 1994, J. Bone Miner. Res. 9:255-264) and also in urine (Taylor
et al., 1990, J. Clin. Endocrin. Metab. 70:467-472). Fragments of
human osteocalcin can be produced either during osteoclastic
degradation of bone matrix or as the result of the catabolic
breakdown of the circulating protein after synthesis by
osteoblasts.
[0008] OST-PTP is the protein encoded by the Esp gene. The Esp gene
was originally named for embryonic stem (ES) cell phosphatase and
it has also been called the Ptprv gene in mice. (Lee et al, 1996,
Mech. Dev. 59:153-164). Because of its bone and testicular
localization, the gene product of Esp is often referred to as
osteoblast testicular protein tyrosine phosphatase (OST-PTP).
OST-PTP is a large, 1711 amino-acid long protein that includes
three distinct domains. OST-PTP has a 1068 amino-acid long
extracellular domain containing multiple fibronectin type III
repeats.
[0009] Esp expression is restricted to ES cells, the gonads and the
skeleton. In the gonads, Esp is specifically expressed in Sertoli
cells of the testis and coelomic epithelial cells of the ovaries.
During development, Esp is initially expressed in the apical
ectodermal ridge of the limbs. Later during embryonic development
and after birth, its expression becomes restricted to
pre-osteoblasts and osteoblasts (i.e., Run.times.2-positive cells)
of the perichondrium and periosteum.
[0010] Protein tyrosine phosphatase-1B (PTP-1B) is an .about.50 kd
intracellular protein present in abundant amounts in various human
tissues (Charbonneau et al., 1989, Proc. Natl. Acad. Sci. USA
86:5252-5256; Goldstein, 1993, Receptor 3:1-15).
[0011] GPRC6A is an orphan receptor that belongs to the C family of
GPCRs (Wellendorph and Brauner-Osborne, 2004, Gene 335:37-46) and
has been proposed to be a receptor for amino acids or for calcium
in the presence of osteocalcin as a cofactor, and for androgens (Pi
et al., 2008, PLoS One. 3:e3858; Pi et al., 2005, J. Biol. Chem.
280:40201-40209; Pi et al., 2010, J. Biol. Chem.
285:39953-39964).
SUMMARY OF THE INVENTION
[0012] The present invention provides methods of treating disorders
related to reproduction in male mammals comprising administering to
a male mammal in need of treatment for a disorder related to
reproduction a pharmaceutical composition comprising a
therapeutically effective amount of
undercarboxylated/uncarboxylated osteocalcin and a pharmaceutically
acceptable carrier or excipient. In certain embodiments, the
osteocalcin is human osteocalcin. In certain embodiments, the
disorder is male infertility, low sperm count, impaired sperm
motility, impaired sperm viability, low testosterone levels,
reduced libido, erectile dysfunction, underdevelopment of testes,
or excess apoptosis in testes.
[0013] The present invention also provides methods of treating
disorders related to reproduction in male mammals comprising
administering to a male mammal in need of treatment for a disorder
related to reproduction a pharmaceutical composition comprising an
agent that modulates the OST-PTP signaling pathway or the PTP-1B
signaling pathway, wherein the agent reduces OST-PTP phosphorylase
expression or activity or reduces PTP-1B phosphorylase expression
or activity, reduces gamma-carboxylase expression or activity, or
increases the level of undercarboxylated/uncarboxylated
osteocalcin, wherein the pharmaceutical composition comprises the
agent in an amount that produces an effect in a male mammal
selected from the group consisting of increasing fertility, raising
sperm count, increasing sperm motility, increasing sperm viability,
increasing serum testosterone levels, increasing libido,
ameliorating erectile dysfunction, reducing underdevelopment of
testes, and reducing excess apoptosis in testes.
[0014] In certain embodiments, the male mammal is a human.
[0015] In certain embodiments, the agent is
undercarboxylated/uncarboxylated osteocalcin. In certain
embodiments, the agent is human undercarboxylated/uncarboxylated
osteocalcin.
[0016] In certain embodiments, the agent inhibits the expression or
activity of OST-PTP, inhibits the expression or activity of PTP-1B,
inhibits the expression or activity of gamma-carboxylase, inhibits
phosphorylation of gamma-carboxylase, inhibits carboxylation of
osteocalcin, or decarboxylates osteocalcin. In certain embodiments,
the agent is selected from the group consisting of a small
molecule, an antibody, or a nucleic acid.
[0017] In certain embodiments where the agent is
undercarboxylated/uncarboxylated osteocalcin, at least one of the
glutamic acids in the undercarboxylated/uncarboxylated osteocalcin
at the positions corresponding to positions 17, 21 and 24 of mature
human osteocalcin is not carboxylated. In certain embodiments, all
three of the glutamic acids in the undercarboxylated/uncarboxylated
osteocalcin at the positions corresponding to positions 17, 21 and
24 of mature human osteocalcin are not carboxylated.
[0018] In certain embodiments, the undercarboxylated/uncarboxylated
osteocalcin is a preparation of undercarboxylated/uncarboxylated
osteocalcin in which more than about 20% of the total Glu residues
at the positions corresponding to positions 17, 21 and 24 of mature
human osteocalcin in the preparation are not carboxylated. In
certain embodiments, the undercarboxylated/uncarboxylated
osteocalcin shares at least 80% amino acid sequence identity with
mature human osteocalcin when the undercarboxylated/uncarboxylated
osteocalcin and mature human osteocalcin are aligned for maximum
sequence homology. In certain embodiments, the
undercarboxylated/uncarboxylated osteocalcin shares about 75%,
about 76%, about 77%, about 78%, about 79%, about 80%, about 81%,
about 82%, about 83%, about 84%, about 85%, about 86%, about 87%,
about 88%, about 89%, about 90%, about 91%, about 92%, about 93%,
about 94%, about 95%, about 96%, about 97%, or about 98% amino acid
sequence identity with mature human osteocalcin when the
undercarboxylated/uncarboxylated osteocalcin and mature human
osteocalcin are aligned for maximum sequence homology. In certain
embodiments, the undercarboxylated/uncarboxylated osteocalcin
differs at 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid residues
from mature human osteocalcin.
[0019] In certain embodiments, at least one of the glutamic acids
in the undercarboxylated/uncarboxylated osteocalcin at the
positions corresponding to positions 17, 21 and 24 of mature human
osteocalcin is not carboxylated. In certain embodiments, all three
of the glutamic acids in the undercarboxylated/uncarboxylated
osteocalcin at the positions corresponding to positions 17, 21 and
24 of mature human osteocalcin are not carboxylated. In certain
embodiments, the present invention provides methods of
administering undercarboxylated/uncarboxylated osteocalcin to a
mammal to increase fertility, raise sperm count, increase sperm
motility, increase sperm viability, increase serum testosterone
levels, increase libido, or ameliorate erectile dysfunction.
[0020] In certain embodiments, the undercarboxylated/uncarboxylated
osteocalcin is a polypeptide selected from the group consisting of:
[0021] (a) a fragment comprising mature human osteocalcin missing
the last 10 amino acids from the C-terminal end; [0022] (b) a
fragment comprising mature human osteocalcin missing the first 10
amino acids from the N-terminal end; [0023] (c) a fragment
comprising amino acids 62-90 of SEQ ID NO:2; [0024] (d) a fragment
comprising amino acids 1-36 of mature human osteocalcin; and [0025]
(e) variants of the above.
[0026] In certain embodiments, the pharmaceutical composition
comprises a small molecule selected from the group consisting of
warfarin, vitamin K inhibitors, and biologically active fragments
or variants thereof. In a preferred embodiment, the small molecule
is warfarin. In another preferred embodiment, the agent is a small
molecule that increases the activity or expression of
osteocalcin.
[0027] In certain embodiments, the pharmaceutical composition
comprises an antibody or antibody fragment that binds to and
inhibits the activity of OST-PTP, PTP-1B, or gamma-carboxylase.
Preferably, the antibody or antibody fragment is a monoclonal
antibody. In certain embodiments, the antibody or antibody fragment
binds to the extracellular domain of OST-PTP or PTP-1B. In
preferred embodiments, the OST-PTP is human OST-PTP or the PTP-1B
is human PTP-1B. In certain embodiments, the OST-PTP is the mouse
OST-PTP of SEQ ID NO:11 or an OST-PTP having an amino acid sequence
that is substantially homologous or identical to SEQ ID NO:11. In
certain embodiments, the OST-PTP is an OST-PTP having an amino acid
sequence that is at least 70% homologous or identical to SEQ ID
NO:11. In certain embodiments, the PTP-1B is human PTP-1B of SEQ ID
NO:17 or a PTP-1B having an amino acid sequence that is
substantially homologous or identical to SEQ ID NO:17. In certain
embodiments, the PTP-1B is a PTP-1B having an amino acid sequence
that is at least 70%, at least 80%, at least 90%, at least 95%, or
at least 98% homologous or identical to SEQ ID NO:17.
[0028] In certain embodiments, the pharmaceutical composition
comprises a nucleic acid that inhibits the expression or activity
of OST-PTP, PTP-1B, or gamma-carboxylase. In certain embodiments,
the nucleic acid is an antisense oligonucleotide or a small
interfering RNA (siRNA). In certain embodiments, the nucleic acid
is an isolated nucleic acid that is selected from the group
consisting of an antisense DNA, antisense RNA, and siRNA, which
nucleic acid is sufficiently complementary to SEQ ID NO:10 or a
sequence that is substantially homologous or identical to SEQ ID
NO:10 to permit specific hybridization to SEQ ID NO:10 or a
sequence that is substantially homologous or identical to SEQ ID
NO:10, and wherein the hybridization prevents or reduces expression
of OST-PTP in osteoblasts. In certain embodiments, the nucleic acid
is an isolated nucleic acid that is selected from the group
consisting of an antisense DNA, antisense RNA, and siRNA, which
nucleic acid is sufficiently complementary to SEQ ID NO:16 or a
sequence that is substantially homologous or identical to SEQ ID
NO:16 to permit specific hybridization to SEQ ID NO:16 or a
sequence that is substantially homologous or identical to SEQ ID
NO:16, and wherein the hybridization prevents or reduces expression
of PTP-1B in osteoblasts.
[0029] In certain embodiments, the pharmaceutical composition
comprises about 0.5 mg to about 5 g, about 1 mg to about 1 g, about
5 mg to about 750 mg, about 10 mg to about 500 mg, about 20 mg to
about 250 mg, or about 25 mg to about 200 mg, of the agent. In
certain embodiments, the pharmaceutical composition comprises an
agent that is formulated into a controlled release preparation. In
certain embodiments, the pharmaceutical composition comprises an
agent that is chemically modified to prolong its half life in the
human body.
[0030] In certain embodiments, the pharmaceutical composition for
treating a disorder related to reproduction in male mammals
comprises an undercarboxylated/uncarboxylated osteocalcin
polypeptide comprising an amino acid sequence
YLYQWLGAPVPYPDPLX.sub.1PRRX.sub.2VCX.sub.3LNPDCDELADHIGFQEAYRRFYGPV
(SEQ ID NO:13)
[0031] wherein
[0032] X.sub.1, X.sub.2 and X.sub.3 are each independently selected
from an amino acid or amino acid analog, with the proviso that if
X.sub.1, X.sub.2 and X.sub.3 are each glutamic acid, then X.sub.1
is not carboxylated, or less than 50 percent of X.sub.2 is
carboxylated, and/or less than 50 percent of X.sub.3 is
carboxylated,
[0033] or said osteocalcin polypeptide comprises an amino acid
sequence that is different from SEQ. ID. NO:13 at 1 to 7 positions
other than X.sub.1, X.sub.2 and X.sub.3; and/or
[0034] wherein said amino acid sequence can include one or more
amide backbone substitutions.
[0035] In certain embodiments, the osteocalcin polypeptide of SEQ.
ID. NO:13 is a fusion protein. In certain embodiments, the arginine
at position 43 of SEQ. ID. NO:13 is replaced with an amino acid or
amino acid analog that reduces susceptibility of the osteocalcin
polypeptide to proteolytic degradation. In certain embodiments, the
arginine at position 44 of SEQ. ID. NO:13 is replaced with
.beta.-dimethyl-arginine. In certain embodiments, the osteocalcin
polypeptide is a retroenantiomer of uncarboxylated human
osteocalcin (1-49).
[0036] The present invention also provides a method of treating a
disorder related to reproduction in male mammals by modulating the
OST-PTP signaling pathway or the PTP-1B signaling pathway, the
method comprising administering an agent that reduces OST-PTP
phosphorylase activity or reduces PTP-1B phosphorylase activity,
reduces gamma-carboxylase activity, or increases
undercarboxylated/uncarboxylated osteocalcin, wherein the agent is
administered in an amount that produces an effect in a male mammal
selected from the group consisting of increasing fertility, raising
sperm count, increasing sperm motility, increasing sperm viability,
increasing serum testosterone levels, increasing libido,
ameliorating erectile dysfunction, reducing underdevelopment of
testes, and reducing excess apoptosis in testes.
[0037] The present invention also provides a method of diagnosing a
patient as having or being at risk of developing a disorder related
to reproduction in male mammals comprising (i) determining the
ratio of undercarboxylated/uncarboxylated osteocalcin to total
osteocalcin in a biological sample from the patient; and (ii)
comparing the ratio to a standard ratio; wherein, if the patient
ratio is lower than the standard ratio, the patient is diagnosed as
having or being at risk of developing a disorder related to
reproduction in male mammals. In certain embodiments, the method
comprises the further step of administering a therapeutic agent as
described herein to the patient diagnosed as having or being at
risk of developing a disorder related to reproduction in male
mammals.
[0038] In certain embodiments, the patient has or is at risk for a
disorder related to reproduction in male mammals selected from the
group consisting of male infertility, low sperm count, impaired
sperm motility, impaired sperm viability, low testosterone levels,
reduced libido, erectile dysfunction, underdevelopment of testes,
and excess apoptosis in testes.
[0039] In certain embodiments, the biological sample is blood.
[0040] In certain embodiments of the diagnostic method described
above, the standard ratio is 5%-10%, 10%-15%, 15%-20%, 20%-25%,
25%-30%, 30%-35%, or 35%-40%.
[0041] The present invention provides a use of an agent that
reduces OST-PTP phosphorylase activity, reduces PTP-1B
phosphorylase activity, reduces gamma-carboxylase activity, and/or
increases undercarboxylated/uncarboxylated osteocalcin as a
medicament for treating or preventing a disorder related to
reproduction in male mammals.
[0042] In certain embodiments, the agent inhibits phosphorylation
of gamma-carboxylase. In certain embodiments, the agent increases
the level of undercarboxylated/uncarboxylated osteocalcin. In
certain embodiments, the agent increases the ratio of
undercarboxylated/uncarboxylated osteocalcin compared to
carboxylated osteocalcin. In certain embodiments, the agent
inhibits carboxylation of osteocalcin. In certain embodiments, the
agent decarboxylates osteocalcin.
[0043] In certain embodiments of the use described above, the agent
is undercarboxylated/uncarboxylated osteocalcin. In certain
embodiments of the use described above, the
undercarboxylated/uncarboxylated osteocalcin increases fertility,
raises sperm count, increases sperm motility, increases sperm
viability, increases serum testosterone levels, increases libido,
ameliorates erectile dysfunction, reduces underdevelopment of
testes, or reduces excess apoptosis in testes. In certain
embodiments, at least one of the glutamic acids in the
undercarboxylated/uncarboxylated osteocalcin at the positions
corresponding to positions 17, 21 and 24 of mature human
osteocalcin is not carboxylated. In certain embodiments, all three
of the glutamic acids in the undercarboxylated/uncarboxylated
osteocalcin at the positions corresponding to positions 17, 21 and
24 of mature human osteocalcin are not carboxylated. In certain
embodiments, the undercarboxylated/uncarboxylated osteocalcin is a
preparation of undercarboxylated/uncarboxylated osteocalcin in
which more than about 20% of the total Glu residues at the
positions corresponding to positions 17, 21 and 24 of mature human
osteocalcin in the preparation are not carboxylated. In certain
embodiments, the undercarboxylated/uncarboxylated osteocalcin
shares about 75%, about 76%, about 77%, about 78%, about 79%, about
80%, about 81%, about 82%, about 83%, about 84%, about 85%, about
86%, about 87%, about 88%, about 89%, about 90%, about 91%, about
92%, about 93%, about 94%, about 95%, about 96%, about 97%, or
about 98% amino acid sequence identity with mature human
osteocalcin when the undercarboxylated/uncarboxylated osteocalcin
and mature human osteocalcin are aligned for maximum sequence
homology. In certain embodiments, the
undercarboxylated/uncarboxylated osteocalcin differs at 1, 2, 3, 4,
5, 6, 7, 8, 9, or 10 amino acid residues from mature human
osteocalcin.
[0044] In certain embodiments of the use described above, the agent
is selected from the group consisting of a small molecule, an
antibody, or a nucleic acid.
[0045] In certain embodiments of the use described above, the agent
is a small molecule that inhibits the expression or activity of
OST-PTP, PTP-1B, or gamma-carboxylase. In certain embodiments, the
agent is a small molecule selected from the group consisting of
warfarin, vitamin K inhibitors, and biologically active fragments
or variants thereof. In a preferred embodiment, the small molecule
is warfarin. In another preferred embodiment, the agent is a small
molecule that increases the activity or expression of
osteocalcin.
[0046] The present invention provides the use of an
undercarboxylated osteocalcin polypeptide, or mimetic thereof, for
the manufacture of a medicament for treatment of a disorder related
to reproduction in male mammals. In certain embodiments, the
disorder is selected from the group consisting of male infertility,
low sperm count, impaired sperm motility, impaired sperm viability,
low testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, and excess apoptosis in testes.
[0047] The present invention also provides the use of an agent that
reduces OST-PTP phosphorylase activity, reduces PTP-1B
phosphorylase activity, reduces gamma-carboxylase activity, and/or
increases undercarboxylated/uncarboxylated osteocalcin for the
manufacture of a medicament for treatment of a disorder related to
reproduction in male mammals. In certain embodiments, the disorder
is selected from the group consisting of male infertility, low
sperm count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, and excess apoptosis in testes.
[0048] The present invention provides methods of contraception for
use in male mammals. comprising administering to a male mammal in
need of contraception a pharmaceutical composition comprising a
therapeutically effective amount of an antagonist of
undercarboxylated/uncarboxylated osteocalcin and a pharmaceutically
acceptable carrier or excipient. In certain embodiments, the
antagonist is an antagonist of human
undercarboxylated/uncarboxylated osteocalcin.
BRIEF DESCRIPTION OF THE FIGURES
[0049] FIG. 1. Comparison between the average litter frequency (A)
and size (B) generated by Osteocalcin -/- and wild type (WT) male
mice crossed with WT females (breedings were tested from 6 weeks to
4 months of age).
[0050] FIG. 2. Analysis of testicular weight (A), size (lower panel
in A) and sperm count (B) of Osteocalcin-/- and wild-type (+/+)
littermate mice at 6 weeks, 3 months, and 6 months of age.
[0051] FIG. 3. Analysis of testicular weight (A), size (lower panel
in A) and sperm count (B) of Esp-/- and wild-type (+/+) littermate
mice at 6 weeks, 3 months and 6 months of age.
[0052] FIG. 4. Analysis of cell proliferation in 2-week-old testes
from WT and Osteocalcin mutant mice 1 day after bromodeoxyuridine
(BrdU) injection (A). TUNEL analysis of Osteocalcin-/-, Esp-/-
testes at 6 weeks and 3 months of age (B-C). Western-blot analysis
of extracts from 2-week and 6 week-old Osteocalcin-/- testes using
an anti Cleaved Caspase-3 (Asp175) (5A1) Rabbit antibody (D).
.beta.-Actin was used as a loading control.
[0053] FIG. 5. Analysis of testosterone serum levels in
Osteocalcin-/- and WT littermate breeder mice at 3 months of age
(A). Analysis of testosterone serum level of Esp -/- and WT
littermate non-breeder mice (B) at 3 months of age.
[0054] FIG. 6. Quantitative PCR (qPCR) analysis of StAR, Cyp17, and
Cyp11a expression in TM3 Leydig cells cultured in the presence of
different concentrations of osteocalcin (from 0.3 to 300 ng/ml) for
2 hours.
[0055] FIG. 7. Analysis of testis weight and size (lower panel)
(A), sperm count (B), apoptosis (C) and testosterone serum levels
(D) in WT mice injected once daily with vehicle (veh) or a dose of
osteocalcin (0, 3 or 30 ng/g) from 2 to 4 months of age.
[0056] FIG. 8. qPCR analysis of Osteocalcin expression in bone,
testis, and ovary of 3 month-old WT mice (A). In situ hybridization
analysis of Osteocalcin expression in bone and testis of 3
month-old WT mice (B). Analysis of mCherry fluorescent protein in
bone and testis of Osteocalcin-mCherry Knockin mice (C).
[0057] FIG. 9. Targeting strategy to generate conditional
Osteocalcin-/- mice through homologous recombination in embryonic
stem (ES) cells (A). Identification of an ES cell clone targeted
for the Osteocalcin floxed allele (red arrows) by Southern blot
analysis. A 400-bp fragment and a 540-bp fragment respectively
located at the 5' end and 3' end of the genomic locus was used as a
probe external to the targeting vector. Hybridization of these
probes with Hind III or NcoI-digested genomic DNA yielded both a WT
and a lower targeted band in the targeted ES cells (B).
[0058] FIG. 10. Measurement of uncarboxylated (Glu OC) and
carboxylated (Gla OC) osteocalcin using uncarboxylated osteocalcin
ELISA.
[0059] FIG. 11. Osteoblasts enhance testosterone biosynthesis by
Leydig cells. (A) Schematic representation of the cell-based assay
used to determine the role of various mesenchymal cells in steroid
sex hormone production. Various primary mesenchymal cells from mice
were cultured in Leydig cell medium and supernatants were collected
after 24 hours. Then, testis or ovary explants or primary Leydig
cells were cultured for 1 hour with these supernatants and
radioimmunoassays (RIAs) were performed to measure levels of
testosterone, estradiol, or progesterone. (B-D) Testis explants
cultured in the presence of supernatants of different mesenchymal
cell cultures: RIA measurement of (B) testosterone, (C) estradiol,
and (D) progesterone levels. (E-G) Ovary explants cultured in the
presence of supernatants of different mesenchymal cell cultures:
RIA measurement of (E) testosterone, (F) estradiol, and (G)
progesterone levels. (H) Testosterone production by primary Leydig
cells cultured in the presence of osteocalcin (3 ng/ml of culture
medium) or vehicle. Error bars represent SEM. Student's t test (*)
P<0.05.
[0060] FIG. 12. Osteocalcin favors male fertility by increasing
testosterone production by Leydig cells. (A-B) Testosterone
production by testis explants (A) or primary Leydig cells (B)
cultured in the presence of supernatants of wild type (WT) or Ocn
-/- osteoblast cultures. (C-D) Testosterone production by testis
explants (C) or primary Leydig cells (D) following stimulation with
increasing doses of osteocalcin (0, 0.3, 1, 3, 10, 100 ng/ml of
culture medium). (E) Circulating testosterone levels in WT mice 1
hour, 4 hours, and 8 hours after vehicle or osteocalcin (3 ng/g of
body weight) injection. (F-G) Comparison between the average litter
size (F) and frequency (G) generated by WT, Ocn-/-, or Esp-/- male
littermate mice crossed with WT females (breeding was tested from 6
to 16 weeks of age). (H-L) Testis size (H), testis weight (I),
epididymides weight (J), seminal vesicles weight (K), and sperm
count (L) in Ocn-/- and Esp-/- compared to WT littermate mice. (M)
Circulating steroid sex hormone levels in Ocn-/- and Esp-/-
compared to WT littermate mice. The analyses were performed on
breeder and non-breeder mice. Error bars represent SEM. Student's t
test (*) P<0.05, (**) P<0.001.
[0061] FIG. 13. Osteocalcin promotes male fertility through its
expression in osteoblasts. (A) qPCR analysis of Osteocalcin
expression in bone, testes, and ovaries of 3 month-old WT mice. (B)
Western blot analysis of osteocalcin in femur, calvaria, and
testis. (C) In situ hybridization analysis of Osteocalcin
expression in bone and testis of 3 month-old WT mice. (D). Analysis
of mCherry fluorescent protein in bone and testis of
Osteocalcin-mCherry Knock-in mice. (E-I) Fertility in mice lacking
Ocn specifically in osteoblasts (Ocn.sub.osb-/-) or Leydig cells
(Ocn.sub.Leydig-/-) compared to WT littermates: (E) Testes weights,
(F) sperm count, (G) epididymides and seminal vesicle (H) weights,
and (I) ratio of circulating testosterone levels measured in WT and
Ocn.sub.osb-/- or in WT and Ocn.sub.Leydig-/- littermate mice. (J)
Linear regression representation of circulating testosterone levels
versus circulating osteocalcin levels in Ocn.sub.osb-/- mice
(n=11). Each dot represents one Ocn.sub.osb-/- mouse. (K-M)
Fertility in mice lacking Esp specifically in osteoblasts
(Esp.sub.osb-/-) or Leydig cells (Esp.sub.Leydig-/-) compared to WT
littermates: (K) Testes weight, (L) sperm count and (M) seminal
vesicle weight. (N) Ratio of circulating testosterone levels
measured in WT and Esp.sub.osb-/- or in WT and Esp.sub.Leydig-/-
littermate mice. Error bars represent SEM. Student's t test (*)
P<0.05, (**) P<0.001.
[0062] FIG. 14. Cellular and molecular events triggered by
osteocalcin in Leydig cells. (A-C) Histological analyses of Leydig
cells in Ocn -/- and Esp-/- mice: (A) Absolute number of Leydig
cells per testis was quantified by the number of 3.beta.-HSD
positive cells. (B) Ratio between Leydig cells (immunopositive for
3.beta.-HSD) versus testis interstitial areas in WT, Ocn-/-, and
Esp-/- mice. (C) 3.beta.-HSD immunohistochemistry staining of WT,
Ocn-/-, and Esp-/- testes. (D) Quantification of tubule, lumen, and
epithelium areas in WT and Ocn-/- mice. (E) Germ cell apoptosis
analysis by TUNEL assay in WT, Ocn-/-, and Esp-/- testes. (F-H)
qPCR analysis of the expression of steroidogenic acute regulatory
protein (StAR), cholesterol side-chain cleavage enzyme (Cyp11a),
cytochrome P-450 17 alpha (Cyp17), 3-.beta.-hydroxysteroid
dehydrogenase (3.beta.-HSD), aromatase enzyme (Cyp19), and
17.beta.-hydroxysteroid dehydrogenase (HSD-17) in testis after
treatment with vehicle or 3 ng/ml of osteocalcin (F) in Ocn-/-
compared to WT littermate testes (G) and in Esp-/- compared to WT
littermate testes (H). (I) qPCR analysis of Grth/Ddx25 expression
in WT, Ocn-/-, Esp-/-, and WT mice treated with vehicle or
osteocalcin (3 ng/g of body weight). (J) Western blot analysis of
cleaved caspase 3 and tACE in WT and Ocn-/- testes. Error bars
represent SEM. Student's t test (*) P<0.05, (**) P<0.001.
[0063] FIG. 15. G-protein coupled receptor OstR is a receptor for
osteocalcin. (A) Anti-phospho-tyrosine antibody Western blot
analysis of TM3 Leydig cells treated with increasing concentration
of osteocalcin, or 10% FBS, or insulin as positive controls, for 1
minute (upper panel). Proteins phosphorylated on tyrosine residues
appear in positive controls (asterisks) but not in osteocalcin
treated cells. Equal loading was assessed using an anti-actin
antibody (lower panel). (B) Western blot analysis of TM3 Leydig
cells showing the absence of ERK1/2 phosphorylation upon
stimulation with vehicle or osteocalcin. (C) Calcium fluxes in
primary Leydig cells upon stimulation with increasing doses of
osteocalcin, 10% FBS, and ionophore (A23187) were used as positive
controls. (D) cAMP production upon osteocalcin stimulation is
increased in TM3 Leydig cells. (E) Schematic representation of the
results obtained by the differential expression search for OstR.
Among the 103 orphan GPCRs expressed in testis and ovary, 22 were
predominantly expressed in testis and only four were enriched in
primary Leydig cells compared to the expression in whole testis.
(F) Relative expression of Gprc6a, Gpr45, Gpr112, and Gpr139 in
Leydig cells compared to whole testis. (G) Immunofluorescence
analysis of OstR expression in WT testes coronal section. Anti-IgG
was used as negative control. (H) qPCR analysis of OstR expression
in 1, 4, 6, and 12 week-old WT testes. (I) Cross sections of testes
from WT and OstR-deficient mice stained with biotinylated
osteocalcin (b-osteocalcin). Upper left panel: WT testis stained
with avidin-biotin complex only; upper middle panel: WT testis
stained with 10 nM of b-osteocalcin; upper right panel: testis from
OstR-deficient mice stained with 10 nM of b-osteocalcin; lower left
panel: WT testis stained with 10 nM of b-osteocalcin in the
presence of 1000 nM hCG; lower middle panel: WT testis stained with
10 nM of b-osteocalcin in the presence of 1000 nM lysine; lower
right panel: WT testis stained with 10 nM of b-osteocalcin in the
presence of 1000 nM of unlabeled osteocalcin. Error bars represent
SEM. Student's t test (*) P<0.05, (**) P<0.001.
[0064] FIG. 16. Specific deletion of OstR in Leydig cells decreases
male fertility. (A-E) Fertility in mice lacking OstR in Leydig
cells only (OstR.sub.Leydig-/-) or lacking one allele of Ocn or one
allele of OstR in Leydig cells only (Ocn+/- or OstR.sub.Leydig+/-),
or in compound heterozygous mice (Ocn+/- and OstR.sub.Leydig+/-)
compared to control littermates. (A) Testis size, (B) testis
weight, (C) sperm count, (D-E) epididymides and seminal vesicles
weights. (F) qPCR analysis of Grth expression in mice of indicated
genotypes. (G) Ratio between Leydig cells (stained by
immunohistochemistry of 3.beta.-HSD) versus testis interstitial
areas. (H) Ratio of circulating testosterone levels measured in WT
and OstR.sub.Leydig-/-. (I) qPCR analysis of StAR, Cyp11a, and
3.beta.-HSD in OstR.sub.Leydig-/- and Ocn+/-; OstR.sub.Leydig+/-
compared to WT littermate testes. (J) Germ cell apoptosis analysis
by TUNEL assay. Error bars represent SEM. Student's t test (*)
P<0.05.
[0065] FIG. 17. CREB is a transcription factor mediating
osteocalcin-evoked gene expression in Leydig cells. (A) Western
blot analysis of CREB activation upon stimulation with osteocalcin.
(B-F) Fertility in mice lacking Creb in Leydig cells
(Creb.sub.Leydig-/-) or lacking one allele of Creb or one allele of
OstR in Leydig cells only (Creb.sub.Leydig+/- or
OstR.sub.Leydig+/-), or of compound heterozygous mice
(Creb.sub.Leydig+/-; OstR.sub.Leydig+/-) compared to control
littermates. (B) Testis size, (C) testis weight, (D) sperm count,
(E-F) epididymides and seminal vesicle weights. (G) Quantification
of circulating testosterone levels represented as fold change
compared to WT. (H) qPCR analysis of Grth expression in mice of
indicated genotypes. (I) qPCR analysis of StAR, Cyp11a, Cyp17,
3.beta.-HSD, Cyp19, and HSD-17 in Creb.sub.Leydig-/- compared to
control littermate testes. (J) Chromatin immunoprecipitation (ChIP)
using anti-CREB antibody and unspecific isotype IgG antibody. (K)
Model representing the current knowledge about the regulation of
male fertility by the skeleton. Error bars represent SEM. Student's
t test (*) P<0.05.
[0066] FIG. 18. (A-C) Sperm motility and morphology analyses. (A)
Percentage (%) of motile sperm, (B) abnormal sperm, and (C) dead
sperm in WT and Ocn-/- male littermate mice analyzed immediately
and 2 hours after dissection. (D-E) Fertility analysis of Ocn-/-
females. (D) Comparison between the average litter frequency and
(E) size generated by wild type (WT) and Ocn-/- female littermates
crossed with WT males (breeding was tested from 6 to 16 weeks of
age). (F) Average number of cycles within 2 weeks in WT and Ocn-/-
female littermate mice. (G) Percentage of WT and Ocn-/- female
littermate mice to cycle. (H) Uteri and ovaries of WT and Ocn-/-
female littermate mice. (I) Ovary weight of WT and Ocn-/- female
littermate mice. (J) Histological analyses of ovary sections and
number of follicles from WT and Ocn-/- female littermate mice.
Follicles are indicated by asterisks (*). (K) Number of apoptotic
cells per WT and Ocn-/- ovaries. (L) Circulating steroid sex
hormone levels in WT and Ocn-/- female littermate mice. Error bars
represent SEM.
[0067] FIG. 19. (A-B) Generation of Ocn-mCherry knock-in allele.
(A) Schematic representation of the targeting strategy. The open
reading frames of Exons Bglap1 and Bglap2 are represented by dark
rectangles with white lettering; thin lines represent untranslated
regions of the Ocn locus. The neomycin resistance gene (for
positive selection) flanked by two LoxP sites (triangles)
(FRT-neoPGK-FRT) and the HSV-tk cassette (for negative selection)
are indicated. (B) Southern blot performed with 5' and 3' probes;
the position of each probe is shown in (A). (C-D) Generation of Ocn
conditional allele. (C) Schematic representation of the targeting
strategy. The open reading frames of Exons Bglap1 and Bglap2 are
represented by dark rectangles with white lettering. Thin lines
represent untranslated regions of the Ocn locus. The neomycin
resistance gene (for positive selection) flanked by two FRT sites
(FRT-neoPGK-FRT), the HSV-tk cassette (for negative selection), and
LoxP are indicated. (D) Southern blot performed with 5' and 3'
probes; the position of each probe is shown in (C).
[0068] FIG. 20. (A) Germ cell proliferation analyzed by BrdU
staining in 2-week-old WT, Ocn-/-, and Esp-/- male littermates.
(B-E) qPCR analysis of StAR, Cyp11a, Cyp17, 3.beta.-HSD, Cyp19, and
HSD-17 in (B) Ocn-/- and WT ovaries, (C) Ocn-/- and WT adrenals,
(D) Esp-/- and WT ovaries, and (E) Esp-/- and WT adrenals. Error
bars represent SEM.
[0069] FIG. 21. (A) Schematic representation of the results
obtained by the differential expression search for the osteocalcin
receptor (OstR). Among the 103 orphan GPCRs expressed in testis and
ovary, 22 were predominantly expressed in testis and only four
(Gprc6a, Gpr139, Gpr112, and Gpr45) were enriched in primary Leydig
cells compared to their expression in whole testis. (B)
Immunofluorescence of OstR and IgG control in coronal sections of
WT ovaries.
[0070] FIG. 22. (A-B) Generation of OstR conditional allele. (A)
Schematic representation of the targeting strategy. The open
reading frames of ExonI, ExonII, and ExonIII are represented by
grey rectangles with white lettering and thin lines represent
untranslated regions of the OstR locus. The neomycin resistance
gene (for positive selection) flanked by two FRT sites (grey
triangles) (FRT-neoPGK-FRT), the HSV-tk cassettes (for negative
selection) and LoxP sites (light triangles) are indicated. (B)
Southern blot performed with 5' and 3' probes; the position of each
probe is shown in (A). (C) Specificity of OstR deletion was tested
by PCR in the indicated tissues. Primer positions are shown in
(A).
[0071] FIG. 23. Nucleotide sequence encoding human GPRC6A from
GenBank accession no. AF502962.
[0072] FIG. 24. Amino acid sequence of human GPRC6A from GenBank
accession no. AF502962.
DETAILED DESCRIPTION OF THE INVENTION
[0073] The present invention is based in part on the discovery of a
previously unknown biochemical pathway linking osteocalcin and
reproductive biology in male mammals by which increased activity of
osteocalcin leads to increased activity of enzymes involved in the
synthesis of testosterone. This in turn leads to beneficial effects
on male reproduction.
[0074] The present invention is also based in part on the
observation that Osteocalcin-deficient male mice have significantly
smaller testes than their wild type (WT) littermates. These mutant
mice are also subfertile and display low sperm counts. Histological
and molecular studies revealed that in the absence of osteocalcin
the entire spermatogenic process seems to be affected because of an
increase in apoptosis. Circulating levels of testosterone are also
quite low in Osteocalcin-deficient mice. These observations
indicate that osteocalcin is a critical regulator of male fertility
in these mice.
[0075] In view of the observations described above, certain aspects
of the invention are directed to the therapeutic use of
undercarboxylated/uncarboxylated osteocalcin, as well as fragments
and variants thereof, to treat or prevent disorders related to
reproduction in male mammals.
[0076] Preventing a disorder related to reproduction in male
mammals means actively intervening as described herein prior to
overt onset of the disorder to prevent or minimize the extent of
the disorder or slow its course of development.
[0077] Treating a disorder related to reproduction in male mammals
means actively intervening after onset of the disorder to slow
down, ameliorate symptoms of, minimize the extent of, or reverse
the disorder in a patient who is known or suspected of having the
disorder.
[0078] The present invention also provides methods of increasing
testosterone levels, particularly serum testosterone levels, in
male mammals by administering the therapeutic agents described
herein to male mammals known to be in need of treatment to increase
testosterone levels. In some embodiments of the methods of the
present invention, the therapeutic agent increases serum
testosterone levels by about 10%-25%, 20%-35%, 30%-50%, 50%-500%,
70%-400%, 100%-300%, or 100%-500% compared to pre-treatment serum
testosterone levels.
[0079] A "patient" is a mammal, preferably a human, but can also be
a companion animal such as dogs or cats, or farm animals such as
horses, cattle, pigs, or sheep.
[0080] A patient in need of treatment or prevention for a disorder
related to reproduction in male mammals includes a patient known or
suspected of having or being at risk of developing a disorder
related to reproduction in male mammals. Such a patient in need of
treatment could be, e.g., a male mammal known to have low
testosterone levels. Patients in need of treatment or prevention by
the methods of the present invention include patients who are known
to be in need of therapy to increase serum testosterone levels in
order to treat or prevent a disorder related to reproduction in
male mammals. In some embodiments, such patients might include male
mammals who have been identified as having a serum testosterone
level that is about 25%, about 50%, or about 75% lower than the
serum testosterone level in normal subjects.
[0081] A patient in need of treatment or prevention for a disorder
related to reproduction in male mammals by the methods of the
present invention does not include a patient being administered the
therapeutic agents described herein where the patient is being
administered the therapeutic agents described herein only for a
purpose other than to treat or prevent a disorder related to
reproduction in male mammals. Thus, e.g., a patient in need of
treatment or prevention for a disorder related to reproduction in
male mammals by the methods of the present invention does not
include a patient being treated with osteocalcin only for the
purpose of treating a bone mass disease or a metabolic disorder
such as diabetes. A patient in need of treatment or prevention for
a disorder related to reproduction in male mammals by the methods
of the present invention also does not include a patient being
treated with osteocalcin that is not
undercarboxylated/uncarboxylated osteocalcin.
[0082] In certain embodiments, the methods of the present invention
comprise the step of identifying a patient in need of therapy for a
disorder related to reproduction in male mammals. Thus, the present
invention provides a method comprising:
[0083] (a) identifying a patient in need of therapy for a disorder
related to reproduction in male mammals;
[0084] (b) administering to the patient a therapeutically effective
amount of undercarboxylated/uncarboxylated osteocalcin or an agent
that modulates the OST-PTP signaling pathway or the PTP-1B
signaling pathway, wherein the agent reduces OST-PTP phosphorylase
expression or activity, reduces PTP-1B phosphorylase expression or
activity, or reduces gamma-carboxylase expression or activity.
[0085] The present invention is also based on the observation that
gamma-carboxylase carboxylates osteocalcin, thereby producing
carboxylated osteocalcin. This provides the opportunity to modulate
the degree of carboxylation of the osteocalcin used in the methods
of the present invention by modulating the activity of
gamma-carboxylase. In particular, this provides the opportunity to
lower the degree of carboxylation of the osteocalcin used in the
methods of the present invention, thus providing
undercarboxylated/uncarboxylated osteocalcin for use in the methods
of the present invention. Therefore, certain aspects of the
invention are directed to the therapeutic use of agents that
inhibit the activity of gamma-carboxylase to treat or prevent a
disorder related to reproduction in male mammals.
[0086] The present invention is further based on the observation
that OST-PTP activates gamma-carboxylase through dephosphorylation.
As indicated above, activation of gamma-carboxylase leads to
carboxylation of osteocalcin. This provides the opportunity to
indirectly modulate the degree of carboxylation of the osteocalcin
used in the methods of the present invention by modulating the
activity of OST-PTP (which will then modulate the activity of
gamma-carboxylase). Therefore certain aspects of the invention are
directed to the therapeutic use of agents that inhibit the activity
of OST-PTP to treat or prevent a disorder related to reproduction
in male mammals.
[0087] The present invention is further based on the observation
that, in humans, PTP-1B activates gamma-carboxylase through
dephosphorylation. As indicated above, activation of
gamma-carboxylase leads to carboxylation of osteocalcin. This
provides the opportunity to indirectly modulate the degree of
carboxylation of the osteocalcin used in the methods of the present
invention by modulating the activity of PTP-1B in male humans
(which will then modulate the activity of gamma-carboxylase).
Therefore certain aspects of the invention are directed to the
therapeutic use in male humans of agents that inhibit the activity
of PTP-1B to treat or prevent a disorder related to reproduction in
male humans.
[0088] Other aspects of the invention are directed to diagnostic
methods based on detection of the level of
undercarboxylated/uncarboxylated osteocalcin in a patient, which
level is associated with disorders related to reproduction in male
mammals.
[0089] In one aspect, the method of diagnosing a disorder related
to reproduction in male mammals in a patient comprises (i)
determining a patient level of undercarboxylated/uncarboxylated
osteocalcin in a biological sample taken from the patient (ii)
comparing the patient level of undercarboxylated/uncarboxylated
osteocalcin and a control level of undercarboxylated/uncarboxylated
osteocalcin, and (iii) if the patient level is significantly lower
than the control level, then diagnosing the patient as having, or
being at risk for, the disorder related to reproduction in male
mammals.
[0090] Other aspects of the invention are directed to diagnostic
methods based on detection of decreased ratios of
undercarboxylated/uncarboxylated vs carboxylated osteocalcin. Such
ratios may be associated with disorders related to reproduction in
male mammals. In one aspect, the method of diagnosing a disorder
related to reproduction in male mammals in a patient comprises (i)
determining a patient ratio of undercarboxylated/uncarboxylated vs.
carboxylated osteocalcin in a biological sample taken from the
patient (ii) comparing the patient ratio of
undercarboxylated/uncarboxylated vs carboxylated osteocalcin and a
control ratio of undercarboxylated/uncarboxylated vs carboxylated
osteocalcin, and (iii) if the patient ratio is significantly lower
than the control ratio, then the patient is diagnosed has having,
or being at risk for, the disorder related to reproduction in male
mammals.
Pharmaceutical Compositions for Use in the Methods of the
Invention
[0091] The present invention provides pharmaceutical compositions
for use in the treatment of a disorder related to reproduction in
male mammals comprising an agent for modulating the OST-PTP
signaling pathway or for modulating the PTP-1B signaling pathway,
which pathways involve gamma-carboxylase and osteocalcin. In
particular embodiments, the agent inhibits OST-PTP phosphorylase
activity, inhibits PTP-1B phosphorylase activity reduces
gamma-carboxylase activity, and/or increases
undercarboxylated/uncarboxylated osteocalcin. In particular
embodiments, the agent decarboxylates osteocalcin. The agent may be
selected from the group consisting of small molecules,
polypeptides, antibodies, and nucleic acids. The pharmaceutical
compositions of the invention provide an amount of the agent
effective to treat or prevent a disorder related to reproduction in
male mammals. In certain embodiments, the pharmaceutical
composition provides an amount of the agent effective to treat or
prevent male infertility, low sperm count, impaired sperm motility,
impaired sperm viability, low testosterone levels, reduced libido,
erectile dysfunction, underdevelopment of testes, or excess
apoptosis in testes.
[0092] In certain embodiments, the pharmaceutical compositions for
use in the methods of the invention may function to increase serum
undercarboxylated/uncarboxylated osteocalcin serum levels.
[0093] In particular embodiments of the invention, therapeutic
agents that may be administered in the methods of the present
invention include undercarboxylated osteocalcin; uncarboxylated
osteocalcin; or inhibitors that reduce the expression or activity
of gamma-carboxylase, PTP-1B, or OST-PTP (e.g., antibodies, small
molecules, antisense nucleic acids or siRNA). The pharmaceutical
agents may also include agents that decarboxylate osteocalcin.
[0094] The therapeutic agents are generally administered in an
amount sufficient to treat or prevent male infertility, low sperm
count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, or excess apoptosis in testes.
[0095] Biologically active fragments or variants of the therapeutic
agents are also within the scope of the present invention. By
"biologically active" is meant capable of modulating the OST-PTP
signaling pathway or the PTP-1B signaling pathway involving
gamma-carboxylase and osteocalcin. "Biologically active" may also
mean reducing the expression of OST-PTP or its ability to
dephosphorylate gamma-carboxylase and reducing the expression of
gamma-carboxylase or its ability to carboxylate osteocalcin, or
decarboxylating carboxylated osteocalcin thereby leading to
increased levels of undercarboxylated/uncarboxylated
osteocalcin.
[0096] "Biologically active" also means reducing the expression of
PTP-1B or its ability to dephosphorylate gamma-carboxylase and
reducing the expression of gamma-carboxylase or its ability to
carboxylate osteocalcin, or decarboxylating carboxylated
osteocalcin thereby leading to increased levels of
undercarboxylated/uncarboxylated osteocalcin.
[0097] "Biologically active" also refers to fragments or variants
of osteocalcin that retain the ability of
undercarboxylated/uncarboxylated osteocalcin to treat or prevent a
disorder related to reproduction in male mammals.
[0098] "Biologically active" also means capable of producing at
least one effect in a male mammal selected from the group
consisting of increasing fertility, raising sperm count, increasing
sperm motility, increasing sperm viability, increasing serum
testosterone levels, increasing libido, ameliorating erectile
dysfunction, reducing underdevelopment of testes, and reducing
excess apoptosis in testes.
Pharmaceutical Compositions Comprising
Undercarboxylated/Uncarboxylated Osteocalcin
[0099] In a specific embodiment of the invention, pharmaceutical
compositions comprising undercarboxylated/uncarboxylated
osteocalcin are provided for use in treating or preventing a
disorder related to reproduction in a male mammal.
[0100] "Undercarboxylated osteocalcin" means osteocalcin in which
one or more of the Glu residues at positions Glu17, Glu21 and Glu24
of the amino acid sequence of the mature human osteocalcin having
49 amino acids, or at the positions corresponding to Glu17, Glu21
and Glu24 in other forms of osteocalcin, are not carboxylated.
Undercarboxylated osteocalcin includes "uncarboxylated
osteocalcin," i.e., osteocalcin in which all three of the glutamic
acid residues at positions 17, 21, and 24 are not carboxylated.
Preparations of osteocalcin are considered to be "undercarboxylated
osteocalcin" if more than about 10% of the total Glu residues at
positions Glu17, Glu21 and Glu24 (taken together) in mature
osteocalcin (or the corresponding Glu residues in other forms) of
the preparation are not carboxylated. In particular preparations of
undercarboxylated osteocalcin, more than about 20%, more than about
30%, more than about 40%, more than about 50%, more than about 60%,
more than about 70%, more than about 80%, more than about 90%, more
than about 95%, or more than about 99% of the total Glu residues at
positions Glu17, Glu21 and Glu24 in mature osteocalcin (or the
corresponding Glu residues in other forms) of the preparation are
not carboxylated. In particularly preferred embodiments,
essentially all of the Glu residues at positions Glu17, Glu21 and
Glu24 in mature osteocalcin (or the corresponding Glu residues in
other forms) of the preparation are not carboxylated.
[0101] "Undercarboxylated/uncarboxylated osteocalcin" is used
herein to refer collectively to undercarboxylated and
uncarboxylated osteocalcin.
[0102] Human osteocalcin cDNA (SEQ ID NO:1) encodes a mature
osteocalcin protein represented by the last 49 amino acids of SEQ
ID NO:2 (i.e., positions 52-100) with a predicted molecular mass of
5,800 kDa (Poser et al., 1980, J. Biol. Chem. 255:8685-8691). SEQ
ID NO:2 is the pre-pro-sequence of human osteocalcin encoded by SEQ
ID NO:1 and mature human osteocalcin (SEQ ID NO:12) is the
processed product of SEQ ID NO:2. In this application, the amino
acid positions of mature human osteocalcin are referred to. It will
be understood that the amino acid positions of mature human
osteocalcin correspond to those of SEQ ID NO:2 as follows: position
1 of mature human osteocalcin corresponds to position 52 of SEQ ID
NO:2; position 2 of mature human osteocalcin corresponds to
position 53 of SEQ ID NO:2, etc. In particular, positions 17, 21,
and 24 of mature human osteocalcin correspond to positions 68, 72,
and 75, respectively, of SEQ ID NO:2.
[0103] When positions in two amino acid sequences correspond, it is
meant that the two positions align with each other when the two
amino acid sequences are aligned with one another to provide
maximum homology between them. This same concept of correspondence
also applies to nucleic acids.
[0104] For example, in the two amino acid sequences AGLYSTVLMGRPS
and GLVSTVLMGN, positions 2-11 of the first sequence correspond to
positions 1-10 of the second sequence, respectively. Thus, position
2 of the first sequence corresponds to position 1 of the second
sequence; position 4 of the first sequence corresponds to position
3 of the second sequence; etc. It should be noted that a position
in one sequence may correspond to a position in another sequence,
even if the positions in the two sequence are not occupied by the
same amino acid.
[0105] "Osteocalcin" includes the mature protein and further
includes biologically active fragments derived from full-length
osteocalcin (SEQ ID NO:2) or the mature protein, including various
domains, as well as variants as described herein.
[0106] In one embodiment of the present invention, the
pharmaceutical compositions for use in the methods of the invention
comprise a mammalian uncarboxylated osteocalcin. In a preferred
embodiment of the invention, the compositions for use in the
methods of the invention comprise human uncarboxylated osteocalcin
having the amino acid sequence of SEQ ID NO:2, or portions thereof,
and encoded for by the nucleic acid of SEQ ID NO:1, or portions
thereof. In some embodiments, the compositions for use in the
methods of the invention may comprise one or more of the human
osteocalcin fragments described herein.
[0107] In a preferred embodiment of the invention, the compositions
for use in the methods of the invention comprise human
uncarboxylated osteocalcin having the amino acid sequence of SEQ ID
NO:12.
[0108] In a specific embodiment, the present invention provides
pharmaceutical compositions comprising human undercarboxylated
osteocalcin which does not contain a carboxylated glutamic acid at
one or more of positions corresponding to positions 17, 21 and 24
of mature human osteocalcin. A preferred form of osteocalcin for
use in the methods of the present invention is mature human
osteocalcin wherein at least one of the glutamic acid residues at
positions 17, 21, and 24 is not carboxylated. In certain
embodiments, the glutamic acid residue at position 17 is not
carboxylated. Preferably, all three of the glutamic acid residues
at positions 17, 21, and 24 are not carboxylated. The amino acid
sequence of mature human osteocalcin is shown in SEQ. ID.
NO:12.
[0109] The primary sequence of osteocalcin is highly conserved
among species and it is one of the ten most abundant proteins in
the human body, suggesting that its function is preserved
throughout evolution. Conserved features include 3 Gla residues at
positions 17, 21, and 24 and a disulfide bridge between Cys23 and
Cys29. In addition, most species contain a hydroxyproline at
position 9. The N-terminus of osteocalcin shows highest sequence
variation in comparison to other parts of the molecule. The high
degree of conservation of human and mouse osteocalcin underscores
the relevance of the mouse as an animal model for the human, in
both healthy and diseased states, and validates the therapeutic and
diagnostic use of osteocalcin to treat or prevent disorders related
to reproduction in male humans based on the experimental data
derived from the mouse model disclosed herein.
[0110] The present invention also includes the use of polypeptide
fragments of osteocalcin. Fragments can be derived from the
full-length, naturally occurring amino acid sequence of osteocalcin
(e.g., SEQ. ID. NO:2). Fragments may also be derived from mature
osteocalcin (e.g., SEQ. ID. NO:12). The invention also encompasses
fragments of the variants of osteocalcin described herein. A
fragment can comprise an amino acid sequence of any length that is
biologically active.
[0111] Preferred fragments of osteocalcin include fragments
containing Glu17, Glu21 and Glu24 of the mature protein. Also
preferred are fragments of the mature protein missing the last 10
amino acids from the C-terminal end of the mature protein. Also
preferred are fragments missing the first 10 amino acids from the
N-terminal end of the mature protein. Also preferred is a fragment
of the mature protein missing both the last 10 amino acids from the
C-terminal end and the first 10 amino acids from the N-terminal
end. Such a fragment comprises amino acids 62-90 of SEQ ID
NO:2.
[0112] Other preferred fragments of osteocalcin for the
pharmaceutical compositions of the invention described herein
include polypeptides comprising, consisting of, or consisting
essentially of, the following sequences of amino acids: [0113]
positions 1-19 of mature human osteocalcin [0114] positions 20-43
of mature human osteocalcin [0115] positions 20-49 of mature human
osteocalcin [0116] positions 1-43 of mature human osteocalcin
[0117] positions 1-42 of mature human osteocalcin [0118] positions
1-41 of mature human osteocalcin [0119] positions 1-40 of mature
human osteocalcin [0120] positions 1-39 of mature human osteocalcin
[0121] positions 1-38 of mature human osteocalcin [0122] positions
1-37 of mature human osteocalcin [0123] positions 1-36 of mature
human osteocalcin [0124] positions 1-35 of mature human osteocalcin
[0125] positions 1-34 of mature human osteocalcin [0126] positions
1-33 of mature human osteocalcin [0127] positions 1-32 of mature
human osteocalcin [0128] positions 1-31 of mature human osteocalcin
[0129] positions 1-30 of mature human osteocalcin [0130] positions
1-29 of mature human osteocalcin [0131] positions 2-49 of mature
human osteocalcin [0132] positions 2-45 of mature human osteocalcin
[0133] positions 2-40 of mature human osteocalcin [0134] positions
2-35 of mature human osteocalcin [0135] positions 2-30 of mature
human osteocalcin [0136] positions 2-25 of mature human osteocalcin
[0137] positions 2-20 of mature human osteocalcin [0138] positions
4-49 of mature human osteocalcin [0139] positions 4-45 of mature
human osteocalcin [0140] positions 4-40 of mature human osteocalcin
[0141] positions 4-35 of mature human osteocalcin [0142] positions
4-30 of mature human osteocalcin [0143] positions 4-25 of mature
human osteocalcin [0144] positions 4-20 of mature human osteocalcin
[0145] positions 8-49 of mature human osteocalcin [0146] positions
8-45 of mature human osteocalcin [0147] positions 8-40 of mature
human osteocalcin [0148] positions 8-35 of mature human osteocalcin
[0149] positions 8-30 of mature human osteocalcin [0150] positions
8-25 of mature human osteocalcin [0151] positions 8-20 of mature
human osteocalcin [0152] positions 10-49 of mature human
osteocalcin [0153] positions 10-45 of mature human osteocalcin
[0154] positions 10-40 of mature human osteocalcin [0155] positions
10-35 of mature human osteocalcin [0156] positions 10-30 of mature
human osteocalcin [0157] positions 10-25 of mature human
osteocalcin [0158] positions 10-20 of mature human osteocalcin
[0159] positions 6-34 of mature human osteocalcin [0160] positions
6-35 of mature human osteocalcin [0161] positions 6-36 of mature
human osteocalcin [0162] positions 6-37 of mature human osteocalcin
[0163] positions 6-38 of mature human osteocalcin [0164] positions
7-34 of mature human osteocalcin [0165] positions 7-35 of mature
human osteocalcin [0166] positions 7-36 of mature human osteocalcin
[0167] positions 7-37 of mature human osteocalcin [0168] positions
7-38 of mature human osteocalcin [0169] positions 7-30 of mature
human osteocalcin [0170] positions 7-25 of mature human osteocalcin
[0171] positions 7-23 of mature human osteocalcin [0172] positions
7-21 of mature human osteocalcin [0173] positions 7-19 of mature
human osteocalcin [0174] positions 7-17 of mature human osteocalcin
[0175] positions 8-30 of mature human osteocalcin [0176] positions
8-25 of mature human osteocalcin [0177] positions 8-23 of mature
human osteocalcin [0178] positions 8-21 of mature human osteocalcin
[0179] positions 8-19 of mature human osteocalcin [0180] positions
8-17 of mature human osteocalcin [0181] positions 9-30 of mature
human osteocalcin [0182] positions 9-25 of mature human osteocalcin
[0183] positions 9-23 of mature human osteocalcin [0184] positions
9-21 of mature human osteocalcin [0185] positions 9-19 of mature
human osteocalcin [0186] positions 9-17 of mature human
osteocalcin
[0187] Especially preferred is a fragment comprising positions 1-36
of mature human osteocalcin. Another preferred fragment is a
fragment comprising positions 20-49 of mature human osteocalcin.
Other fragments can be designed to contain Pro13 to Tyr76 or Pro 13
to Asn26 of mature human osteocalcin. Additionally, fragments
containing the cysteine residues at positions 23 and 29 of mature
human osteocalcin, and capable of forming a disulfide bond between
those two cysteines, are useful.
[0188] Fragments can be discrete (not fused to other amino acids or
polypeptides) or can be within a larger polypeptide. Further,
several fragments can be comprised within a single larger
polypeptide. In one embodiment, a fragment designed for expression
in a host can have heterologous pre- and pro-polypeptide regions
fused to the amino terminus of the osteocalcin fragment and/or an
additional region fused to the carboxyl terminus of the
fragment.
[0189] Also provided for use in the compositions and methods of the
present invention are variants of osteocalcin and the osteocalcin
fragments described above. "Variants" refers to osteocalcin
peptides that contain modifications in their amino acid sequences
such as one or more amino acid substitutions, additions, deletions
and/or insertions but that are still biologically active. In some
instances, the antigenic and/or immunogenic properties of the
variants are not substantially altered, relative to the
corresponding peptide from which the variant was derived. Such
modifications may be readily introduced using standard mutagenesis
techniques, such as oligonucleotide directed site-specific
mutagenesis as taught, for example, by Adelman et al., 1983, DNA
2:183, or by chemical synthesis. Variants and fragments are not
mutually exclusive terms. Fragments also include peptides that may
contain one or more amino acid substitutions, additions, deletions
and/or insertions such that the fragments are still biologically
active.
[0190] One particular type of variant that is within the scope of
the present invention is a variant in which one of more of the
positions corresponding to positions 17, 21 and 24 of mature human
osteocalcin is occupied by an amino acid that is not glutamic acid.
In some embodiments, the amino acid that is not glutamic acid is
also not aspartic acid. Such variants are versions of
undercarboxylated osteocalcin because at least one of the three
positions corresponding to positions 17, 21 and 24 of mature human
osteocalcin is not carboxylated glutamic acid, since at least one
of those positions is not occupied by glutamic acid.
[0191] In particular embodiments, the present invention provides
osteocalcin variants comprising the amino acid sequence
TABLE-US-00001 (SEQ. ID. NO: 13) YLYQWLGAPV PYPDPLX.sub.1PRR
X.sub.2VCX.sub.3LNPDCD ELADHIGFQE AYRRFYGPV
wherein
[0192] X.sub.1, X.sub.2 and X.sub.3 are each independently selected
from an amino acid or amino acid analog, with the proviso that if
X.sub.1, X.sub.2 and X.sub.3 are each glutamic acid, then X.sub.1
is not carboxylated, or less than 50 percent of X.sub.2 is
carboxylated, and/or less than 50 percent of X.sub.3 is
carboxylated.
[0193] In certain embodiments, the osteocalcin variants comprise an
amino acid sequence that is different from SEQ. ID. NO:13 at 1 to 7
positions other than X.sub.1, X.sub.2 and X.sub.3.
[0194] In other embodiments, the osteocalcin variants comprise an
amino acid sequence that includes one or more amide backbone
substitutions.
[0195] Fully functional variants typically contain only
conservative variation or variation in non-critical residues or in
non-critical regions. Functional variants can also contain
substitutions of similar amino acids, which results in no change,
or an insignificant change, in function. Alternatively, such
substitutions may positively or negatively affect function to some
degree. The activity of such functional osteocalcin variants can be
determined using assays such as those described herein.
[0196] Variants can be naturally-occurring or can be made by
recombinant means, or chemical synthesis, to provide useful and
novel characteristics for undercarboxylated/uncarboxylated
osteocalcin. For example, the variant osteocalcin polypeptides may
have reduced immunogenicity, increased serum half-life, increased
bioavailability and/or increased potency. In particular
embodiments, serum half-life is increased by substituting one or
more of the native Arg residues at positions 19, 20, 43, and 44 of
mature osteocalcin with another amino acid or an amino acid analog,
e.g., .beta.-dimethyl-arginine. Such substitutions can be combined
with the other changes in the native amino acid sequence of
osteocalcin described herein.
[0197] Provided for use in the pharmaceutical compositions and
methods of the present invention are variants that are also
derivatives of the osteocalcin and osteocalcin fragments described
above. Derivatization is a technique used in chemistry which
transforms a chemical compound into a product of similar chemical
structure, called derivative. Generally, a specific functional
group of the compound participates in the derivatization reaction
and transforms the compound to a derivate of different reactivity,
solubility, boiling point, melting point, aggregate state,
functional activity, or chemical composition. Resulting new
chemical properties can be used for quantification or separation of
the derivatized compound or can be used to optimize the derivatized
compound as a therapeutic agent. The well-known techniques for
derivatization can be applied to the above-described osteocalcin
and osteocalcin fragments. Thus, derivatives of the osteocalcin and
osteocalcin fragments described above will contain amino acids that
have been chemically modified in some way so that they differ from
the natural amino acids.
[0198] Provided also are osteocalcin mimetics. "Mimetic" refers to
a synthetic chemical compound that has substantially the same
structural and functional characteristics of a naturally or
non-naturally occurring osteocalcin polypeptide, and includes, for
instance, polypeptide- and polynucleotide-like polymers having
modified backbones, side chains, and/or bases. Peptide mimetics are
commonly used in the pharmaceutical industry as non-peptide drugs
with properties analogous to those of the template peptide.
Generally, mimetics are structurally similar (i.e., have the same
shape) to a paradigm polypeptide that has a biological or
pharmacological activity, but one or more polypeptide linkages are
replaced. The mimetic can be either entirely composed of synthetic,
non-natural analogues of amino acids, or, is a chimeric molecule of
partly natural peptide amino acids and partly non-natural analogs
of amino acids. The mimetic can also incorporate any amount of
natural amino acid conservative substitutions as long as such
substitutions also do not substantially alter the mimetic's
structure and/or activity.
[0199] By way of examples that can be adapted to osteocalcin by
those skilled in the art: Cho et al., 1993, Science 261:1303-1305
discloses an "unnatural biopolymer" consisting of chiral
aminocarbonate monomers substituted with a variety of side chains,
synthesis of a library of such polymers, and screening for binding
affinity to a monoclonal antibody. Simon et al., 1992, Proc. Natl.
Acad. Sci. 89:9367-9371 discloses a polymer consisting of
N-substituted glycines ("peptoids") with diverse side chains.
Schumacher et al, 1996, Science 271:1854-1857 discloses D-peptide
ligands identified by screening phage libraries of L-peptides
against proteins synthesized with D-amino acids and then
synthesizing a selected L-peptide using D-amino acids. Brody et
al., 1999, Mol. Diagn. 4:381-8 describes generation and screening
of hundreds to thousands of aptamers.
[0200] A particular type of osteocalcin variant within the scope of
the invention is an osteocalcin mimetic in which one or more
backbone amides is replaced by a different chemical structure or in
which one or more amino acids are replaced by an amino acid analog.
In a particular embodiment, the osteocalcin mimetic is a
retroenantiomer of uncarboxylated human osteocalcin.
[0201] Osteocalcin, as well as its fragments and variants, is
optionally produced by chemical synthesis or recombinant methods
and may be produced as a modified osteocalcin molecule (i.e.,
osteocalcin fragments or variants) as described herein. Osteocalcin
polypeptides can be produced by any conventional means (Houghten,
1985, Proc. Natl. Acad. Sci. USA 82:5131-5135). Simultaneous
multiple peptide synthesis is described in U.S. Pat. No. 4,631,211
and can also be used. When produced recombinantly, osteocalcin may
be produced as a fusion protein, e.g., a GST-osteocalcin fusion
protein.
[0202] Undercarboxylated/uncarboxylated osteocalcin molecules that
can be used in the methods of the invention include proteins
substantially homologous to human osteocalcin, including proteins
derived from another organism, i.e., an ortholog of human
osteocalcin. One particular ortholog is mouse osteocalcin. Mouse
osteocalcin gene 1 cDNA is SEQ ID NO:3; mouse osteocalcin gene 2
cDNA is SEQ ID NO:4; the amino acid sequence of mouse osteocalcin
gene 1 and gene 2 is SEQ ID NO:5.
[0203] As used herein, two proteins are substantially homologous
when their amino acid sequences are at least about 70-75%
homologous. Typically the degree of homology is at least about
80-85%, and most typically at least about 90-95%, 97%, 98% or 99%
or more. "Homology" between two amino acid sequences or nucleic
acid sequences can be determined by using the algorithms disclosed
herein. These algorithms can also be used to determine percent
identity between two amino acid sequences or nucleic acid
sequences.
[0204] In a specific embodiment of the invention, the
undercarboxylated/uncarboxylated osteocalcin is an osteocalcin
molecule sharing at least 80% homology with the human osteocalcin
of SEQ ID:2 or a portion of SEQ ID:2 that is at least 8 amino acids
long. In another embodiment, the undercarboxylated/uncarboxylated
osteocalcin is an osteocalcin molecule sharing at least 80%, at
least 90%, at least 95%, or at least 97% amino acid sequence
identity with the human osteocalcin of SEQ ID:2 or a portion of SEQ
ID:2 that is at least 8 amino acids long. Homologous sequences
include those sequences that are substantially identical. In
preferred embodiments, the homology or identity is over the entire
length of mature human osteocalcin.
[0205] To determine the percent homology or percent identity of two
amino acid sequences, or of two nucleic acid sequences, the
sequences are aligned for optimal comparison purposes (e.g., gaps
can be introduced in one or both of a first and a second amino acid
or nucleic acid sequence for optimal alignment and non-homologous
sequences can be disregarded for comparison purposes). Preferably,
the length of a reference sequence aligned for comparison purposes
is at least 30%, preferably at least 40%, more preferably at least
50%, even more preferably at least 60%, and even more preferably at
least 70%, 80%, or 90% or more of the length of the sequence that
the reference sequence is compared to. The amino acid residues or
nucleotides at corresponding amino acid positions or nucleotide
positions are then compared. When a position in the first sequence
is occupied by the same amino acid residue or nucleotide as the
corresponding position in the second sequence, then the molecules
are identical at that position. The percent identity between the
two sequences is a function of the number of identical positions
shared by the sequences, taking into account the number of gaps,
and the length of each gap, which need to be introduced for optimal
alignment of the two sequences.
[0206] The invention also encompasses polypeptides having a lower
degree of identity but which have sufficient similarity so as to
perform one or more of the same functions performed by
undercarboxylated/uncarboxylated osteocalcin. Similarity is
determined by considering conserved amino acid substitutions. Such
substitutions are those that substitute a given amino acid in a
polypeptide by another amino acid of like characteristics.
Conservative substitutions are likely to be phenotypically silent.
Guidance concerning which amino acid changes are likely to be
phenotypically silent may be found in Bowie et al., 1990, Science
247:1306-1310.
[0207] Examples of conservative substitutions are the replacements,
one for another, among the hydrophobic amino acids Ala, Val, Leu,
and Ile; interchange of the hydroxyl residues Ser and Thr; exchange
of the acidic residues Asp and Glu; substitution between the amide
residues Asn and Gln; exchange of the basic residues Lys, His and
Arg; replacements among the aromatic residues Phe, Trp and Tyr;
exchange of the polar residues Gln and Asn; and exchange of the
small residues Ala, Ser, Thr, Met, and Gly.
[0208] The comparison of sequences and determination of percent
identity and homology between two osteocalcin polypeptides can be
accomplished using a mathematical algorithm. See, for example,
Computational Molecular Biology, Lesk, A. M., ed., Oxford
University Press, New York, 1988; Biocomputing: Informatics and
Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;
Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and
Griffin, H G., eds., Humana Press, New Jersey, 1994; Sequence
Analysis in Molecular Biology, van Heinje, G., Academic Press,
1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J.,
eds., M Stockton Press, New York, 1991. A non-limiting example of
such a mathematical algorithm is described in Karlin et al., 1993,
Proc. Natl. Acad. Sci. USA 90:5873-5877.
[0209] The percent identity or homology between two osteocalcin
amino acid sequences may be determined using the Needleman et al.,
1970, J. Mol. Biol. 48:444-453 algorithm.
[0210] A substantially homologous osteocalcin, according to the
present invention, may also be a polypeptide encoded by a nucleic
acid sequence capable of hybridizing to the human osteocalcin
nucleic acid sequence under highly stringent conditions, e.g.,
hybridization to filter-bound DNA in 0.5 M NaHPO.sub.4, 7% sodium
dodecyl sulfate (SDS), 1 mM EDTA at 65.degree. C., and washing in
0.1.times.SSC/0.1% SDS at 68.degree. C. (Ausubel et al., eds.,
1989, Current Protocols in Molecular Biology, Vol. I, Green
Publishing Associates, Inc., and John Wiley & sons, Inc., New
York, at p. 2.10.3) and encoding a functionally equivalent gene
product; or under less stringent conditions, such as moderately
stringent conditions, e.g., washing in 0.2.times.SSC/0.1% SDS at
42.degree. C. (Ausubel et al., 1989 supra), yet which still encodes
a biologically active undercarboxylated/uncarboxylated
osteocalcin.
[0211] A substantially homologous osteocalcin according to the
present invention may also be a polypeptide encoded by a nucleic
acid sequence capable of hybridizing to a sequence having at least
70-75%, typically at least about 80-85%, and most typically at
least about 90-95%, 97%, 98% or 99% identity to the human
osteocalcin nucleic acid sequence, under stringent conditions,
e.g., hybridization to filter-bound DNA in 0.5 M NaHPO.sub.4, 7%
sodium dodecyl sulfate (SDS), 1 mM EDTA at 65.degree. C., and
washing in 0.1.times.SSC/0.1% SDS at 68.degree. C. (Ausubel F. M.
et al., eds., 1989, Current Protocols in Molecular Biology, Vol. I,
Green Publishing Associates, Inc., and John Wiley & sons, Inc.,
New York, at p. 2.10.3) and encoding a functionally equivalent gene
product; or under less stringent conditions, such as moderately
stringent conditions, e.g., washing in 0.2.times.SSC/0.1% SDS at
42.degree. C. (Ausubel et al., 1989 supra), yet which still encodes
a biologically active undercarboxylated/uncarboxylated
osteocalcin.
[0212] It will be understood that a biologically active fragment or
variant of human osteocalcin may contain a different number of
amino acids than native human osteocalcin. Accordingly, the
position number of the amino acid residues corresponding to
positions 17, 21 and 24 of mature human osteocalcin may differ in
the fragment or variant. One skilled in the art would easily
recognize such corresponding positions from a comparison of the
amino acid sequence of the fragment or variant with the amino acid
sequence of mature human osteocalcin.
[0213] Peptides corresponding to fusion proteins in which full
length osteocalcin, mature osteocalcin, or an osteocalcin fragment
or variant is fused to an unrelated protein or polypeptide are also
within the scope of the invention and can be designed on the basis
of the osteocalcin nucleotide and amino acid sequences disclosed
herein. Such fusion proteins include fusions to an enzyme,
fluorescent protein, or luminescent protein which provides a marker
function. In a preferred embodiment of the invention, the fusion
protein comprises fusion to a polypeptide capable of targeting the
osteocalcin to a particular target cell or location in the body.
For example, osteocalcin polypeptide sequences may be fused to a
ligand molecule capable of targeting the fusion protein to a cell
expressing the receptor for said ligand. In a particular
embodiment, osteocalcin polypeptide sequences may be fused to a
ligand capable of targeting the fusion protein to cells of the
testes, e.g., Leydig cells.
[0214] Osteocalcin can also be made as part of a chimeric protein
for drug screening or use in making recombinant protein. These
chimeric proteins comprise an osteocalcin peptide sequence linked
to a heterologous peptide having an amino acid sequence not
substantially homologous to the osteocalcin. The heterologous
peptide can be fused to the N-terminus or C-terminus of osteocalcin
or can be internally located. In one embodiment, the fusion protein
does not affect osteocalcin function. For example, the fusion
protein can be a GST-fusion protein in which the osteocalcin
sequences are fused to the N- or C-terminus of the GST sequences.
Other types of fusion proteins include, but are not limited to,
enzymatic fusion proteins, for example beta-galactosidase fusions,
yeast two-hybrid GAL-4 fusions, poly-His fusions and Ig fusions.
Such fusion proteins, particularly poly-His fusions, can facilitate
the purification of recombinant osteocalcin. In certain host cells
(e.g., mammalian host cells), expression and/or secretion of a
protein can be increased by using a heterologous signal sequence.
Therefore, the fusion protein may contain a heterologous signal
sequence at its N-terminus.
[0215] Those skilled in art would understand how to adapt
well-known techniques for use with osteocalcin. For example, EP 0
464 533 discloses fusion proteins comprising various portions of
immunoglobulin constant regions (Fc regions). The Fc region is
useful in therapy and diagnosis and thus results, for example, in
improved pharmacokinetic properties (see, e.g., EP 0 232 262). In
drug discovery, for example, human proteins have been fused with Fc
regions for the purpose of high-throughput screening assays to
identify antagonists (Bennett et al., 1995, J. Mol. Recog. 8:52-58
and Johanson et al., 1995, J. Biol. Chem. 270:9459-9471). Thus,
various embodiments of this invention also utilize soluble fusion
proteins containing an osteocalcin polypeptide and various portions
of the constant regions of heavy or light chains of immunoglobulins
of various subclasses (e.g., IgG, IgM, IgA, IgE, IgB). Preferred as
immunoglobulin is the constant part of the heavy chain of human
IgG, particularly IgG1, where fusion takes place at the hinge
region. For some uses, it is desirable to remove the Fc region
after the fusion protein has been used for its intended purpose. In
a particular embodiment, the Fc part can be removed in a simple way
by a cleavage sequence, which is also incorporated and can be
cleaved, e.g., with factor Xa.
[0216] A chimeric or fusion protein can be produced by standard
recombinant DNA techniques. For example, DNA fragments coding for
the different protein sequences can be ligated together in-frame in
accordance with conventional techniques. In another embodiment, the
fusion gene can be synthesized by conventional techniques including
automated DNA synthesizers. Alternatively, PCR amplification of
gene fragments can be carried out using anchor primers which give
rise to complementary overhangs between two consecutive gene
fragments which can subsequently be annealed and re-amplified to
generate a chimeric gene sequence (see Ausubel et al., 1992,
Current Protocols in Molecular Biology). Moreover, many expression
vectors are commercially available that already encode a fusion
moiety (e.g., a GST protein). An osteocalcin-encoding nucleic acid
can be cloned into such an expression vector such that the fusion
moiety is linked in-frame to osteocalcin.
[0217] Chimeric osteocalcin proteins can be produced in which one
or more functional sites are derived from a different isoform, or
from another osteocalcin molecule from another species. Sites also
could be derived from osteocalcin-related proteins that occur in
the mammalian genome but which have not yet been discovered or
characterized.
[0218] Polypeptides often contain amino acids other than the 20
amino acids commonly referred to as the 20 naturally-occurring
amino acids. Further, many amino acids, including the terminal
amino acids, may be modified by natural processes, such as
processing and other post-translational modifications, or by
chemical modification techniques well known in the art.
[0219] Accordingly, the osteocalcin polypeptides useful in the
methods of the present invention also encompass derivatives which
contain a substituted non-naturally occurring amino acid residue
that is not one encoded by the genetic code, in which a substituent
group is included, in which the mature polypeptide is fused with
another compound, such as a compound to increase the half-life of
the polypeptide (for example, polyethylene glycol), or in which the
additional amino acids are fused to the osteocalcin polypeptide,
such as a leader or secretory sequence or a sequence for
purification of the osteocalcin polypeptide or a pro-protein
sequence.
[0220] Undercarboxylated/uncarboxylated osteocalcin can be modified
according to known methods in medicinal chemistry to increase its
stability, half-life, uptake or efficacy. Known modifications
include, but are not limited to, acetylation, acylation,
ADP-ribosylation, amidation, covalent attachment of flavin,
covalent attachment of a heme moiety, covalent attachment of a
nucleotide or nucleotide derivative, covalent attachment of a lipid
or lipid derivative, covalent attachment of phosphatidylinositol,
cross-linking, cyclization, disulfide bond formation,
demethylation, formation of covalent crosslinks, formation of
cysteine, formation of pyroglutamate, formylation, glycosylation,
GPI anchor formation, hydroxylation, iodination, methylation,
myristoylation, oxidation, proteolytic processing, phosphorylation,
prenylation, racemization, selenoylation, sulfation, transfer-RNA
mediated addition of amino acids to proteins such as arginylation,
and ubiquitination.
[0221] In a specific embodiment of the invention, modifications may
be made to the osteocalcin to reduce susceptibility to proteolysis
at residue Arg43 as a means for increasing serum half life. Such
modifications include, for example, the use of retroenantio
isomers, D-amino acids, or other amino acid analogs.
[0222] Acylation of the N-terminal amino group can be accomplished
using a hydrophilic compound, such as hydroorotic acid or the like,
or by reaction with a suitable isocyanate, such as methylisocyanate
or isopropylisocyanate, to create a urea moiety at the N-terminus.
Other agents can also be N-terminally linked that will increase the
duration of action of the osteocalcin derivative.
[0223] Reductive amination is the process by which ammonia is
condensed with aldehydes or ketones to form imines which are
subsequently reduced to amines. Reductive amination is a useful
method for conjugating undercarboxylated/uncarboxylated osteocalcin
and its fragments or variants to polyethylene glycol (PEG).
Covalent linkage of PEG to undercarboxylated/uncarboxylated
osteocalcin and its fragments and variants may result in conjugates
with increased water solubility, altered bioavailability,
pharmacokinetics, immunogenic properties, and biological
activities. See, e.g., Bentley et al., 1998, J. Pharm. Sci.
87:1446-1449.
[0224] Several particularly common modifications that may be
applied to undercarboxylated/uncarboxylated osteocalcin and its
fragments and variants such as glycosylation, lipid attachment,
sulfation, hydroxylation and ADP-ribosylation are described in most
basic texts, such as Proteins-Structure and Molecular Properties,
2nd ed., T. E. Creighton, W. H. Freeman and Company, New York
(1993). Many detailed reviews are available on this subject, such
as by Wold, F., Posttranslational Covalent Modification of
Proteins, B. C. Johnson, Ed., Academic Press, New York 1-12 (1983);
Seifter et al., 1990, Meth. Enzymol. 182:626-646 and Rattan et al.,
1992, Ann. New York Acad. Sci. 663:48-62.
[0225] As is also well known, polypeptides are not always entirely
linear. For instance, polypeptides may be branched as a result of
ubiquitination, and they may be circular, with or without
branching, generally as a result of post-translation events,
including natural processing events and events brought about by
human manipulation which do not occur naturally. Circular, branched
and branched circular polypeptides may be synthesized by
non-translational natural processes and by synthetic methods.
Well-known techniques for preparing such non-linear polypeptides
may be adapted by those skilled in the art to produce non-linear
osteocalcin polypeptides.
[0226] Modifications can occur anywhere in the
undercarboxylated/uncarboxylated osteocalcin and its fragments and
variants, including the peptide backbone, the amino acid
side-chains and the amino or carboxyl termini. Blockage of the
amino or carboxyl group in a polypeptide, or both, by a covalent
modification, is common in naturally-occurring and synthetic
polypeptides and may be applied to the
undercarboxylated/uncarboxylated osteocalcin or its fragments and
variants used in the present invention. For instance, the amino
terminal residue of polypeptides made in E. coli, prior to
proteolytic processing, almost invariably will be
N-formylmethionine. Thus, the use of
undercarboxylated/uncarboxylated osteocalcin and its fragments and
variants with N-formylmethionine as the amino terminal residue are
within the scope of the present invention.
[0227] A brief description of various protein modifications that
come within the scope of this invention are set forth in the table
below:
TABLE-US-00002 TABLE 1 Protein Modification Description Acetylation
Acetylation of N-terminus or .epsilon.-lysines. Introducing an
acetyl group into a protein, specifically, the substitution of an
acetyl group for an active hydrogen atom. A reaction involving the
replacement of the hydrogen atom of a hydroxyl group with an acetyl
group (CH.sub.3CO) yields a specific ester, the acetate. Acetic
anhydride is commonly used as an acetylating agent, which reacts
with free hydroxyl groups. Acylation may facilitate addition of
other functional groups. A common reaction is acylation of e.g.,
conserved lysine residues with a biotin appendage. ADP-ribosylation
Covalently linking proteins or other compounds via an
arginine-specific reaction. Alkylation Alkylation is the transfer
of an alkyl group from one molecule to another. The alkyl group may
be transferred as an alkyl carbocation, a free radical or a
carbanion (or their equivalents). Alkylation is accomplished by
using certain functional groups such as alkyl electrophiles, alkyl
nucleophiles or sometimes alkyl radicals or carbene acceptors. A
common example is methylation (usually at a lysine or arginine
residue). Amidation Reductive animation of the N-terminus. Methods
for amidation of insulin are described in U.S. Pat. No. 4,489,159.
Carbamylation Nigen et al. describes a method of carbamylating
hemoglobin. Citrullination Citrullination involves the addition of
citrulline amino acids to the arginine residues of a protein, which
is catalyzed by peptidylarginine deaminase enzymes (PADs). This
generally converts a positively charged arginine into a neutral
citrulline residue, which may affect the hydrophobicity of the
protein (and can lead to unfolding). Condensation of amines with
Such reactions, may be used, e.g., to attach a peptide to other
aspartate or glutamate proteins labels. Covalent attachment of
flavin Flavin mononucleotide (FAD) may be covalently attached to
serine and/or threonine residues. May be used, e.g., as a
light-activated tag. Covalent attachment of heme A heme moiety is
generally a prosthetic group that consists moiety of an iron atom
contained in the center of a large heterocyclic organic ring, which
is referred to as a porphyrin. The heme moiety may be used, e.g.,
as a tag for the peptide. Attachment of a nucleotide or May be used
as a tag or as a basis for further derivatising a nucleotide
derivative peptide. Cross-linking Cross-linking is a method of
covalently joining two proteins. Cross-linkers contain reactive
ends to specific functional groups (primary amines, sulfhydryls,
etc.) on proteins or other molecules. Several chemical groups may
be targets for reactions in proteins and peptides. For example,
Ethylene glycol bis[succinimidylsuccinate, Bis[2-
(succinimidooxycarbonyloxy)ethyl]sulfone, and
Bis[sulfosuccinimidyl] suberate link amines to amines. Cyclization
For example, cyclization of amino acids to create optimized
delivery forms that are resistant to, e.g., aminopeptidases (e.g.,
formation of pyroglutamate, a cyclized form of glutamic acid).
Disulfide bond formation Disulfide bonds in proteins are formed by
thiol-disulfide exchange reactions, particularly between cysteine
residues (e.g., formation of cystine). Demethylation See, e.g.,
U.S. Pat. No. 4,250,088 (Process for demethylating lignin).
Formylation The addition of a formyl group to, e.g., the N-terminus
of a protein. See, e.g., U.S. Pat. Nos. 4,059,589, 4,801,742, and
6,350,902. Glycylation The covalent linkage of one to more than 40
glycine residues to the tubulin C-terminal tail. Glycosylation
Glycosylation may be used to add saccharides (or polysaccharides)
to the hydroxy oxygen atoms of serine and threonine side chains
(which is also known as O-linked Glycosylation). Glycosylation may
also be used to add saccharides (or polysaccharides) to the amide
nitrogen of asparagine side chains (which is also known as N-linked
Glycosylation), e.g., via oligosaccharyl transferase. GPI anchor
formation The addition of glycosylphosphatidylinositol to the C-
terminus of a protein. GPI anchor formation involves the addition
of a hydrophobic phosphatidylinositol group- linked through a
carbohydrate containing linker (e.g., glucosamine and mannose
linked to phosphoryl ethanolamine residue)-to the C-terminal amino
acid of a protein. Hydroxylation Chemical process that introduces
one or more hydroxyl groups (--OH) into a protein (or radical).
Hydroxylation reactions are typically catalyzed by hydroxylases.
Proline is the principal residue to be hydroxylated in proteins,
which occurs at the C.sup..gamma. atom, forming hydroxyproline
(Hyp). In some cases, proline may be hydroxylated at its
C.sup..beta. atom. Lysine may also be hydroxylated on its
C.sup..delta. atom, forming hydroxylysine (Hyl). These three
reactions are catalyzed by large, multi-subunit enzymes known as
prolyl 4-hydroxylase, prolyl 3-hydroxylase and lysyl 5-hydroxylase,
respectively. These reactions require iron (as well as molecular
oxygen and .alpha.-ketoglutarate) to carry out the oxidation, and
use ascorbic acid to return the iron to its reduced state.
Iodination See, e.g., U.S. Pat. No. 6,303,326 for a disclosure of
an enzyme that is capable of iodinating proteins. U.S. Pat. No.
4,448,764 discloses, e.g., a reagent that may be used to iodinate
proteins. ISGylation Covalently linking a peptide to the ISG15
(Interferon- Stimulated Gene 15) protein, for, e.g., modulating
immune response. Methylation Reductive methylation of protein amino
acids with formaldehyde and sodium cyanoborohydride has been shown
to provide up to 25% yield of N-cyanomethyl (--CH.sub.2CN) product.
The addition of metal ions, such as Ni.sup.2+, which complex with
free cyanide ions, improves reductive methylation yields by
suppressing by-product formation. The N-cyanomethyl group itself,
produced in good yield when cyanide ion replaces cyanoborohydride,
may have some value as a reversible modifier of amino groups in
proteins. (Gidley et al.) Methylation may occur at the arginine and
lysine residues of a protein, as well as the N- and C-terminus
thereof. Myristoylation Myristoylation involves the covalent
attachment of a myristoyl group (a derivative of myristic acid),
via an amide bond, to the alpha-amino group of an N-terminal
glycine residue. This addition is catalyzed by the N-
myristoyltransferase enzyme. Oxidation Oxidation of cysteines.
Oxidation of N-terminal Serine or Threonine residues (followed by
hydrazine or aminooxy condensations). Oxidation of glycosylations
(followed by hydrazine or aminooxy condensations). Palmitoylation
Palmitoylation is the attachment of fatty acids, such as palmitic
acid, to cysteine residues of proteins. Palmitoylation increases
the hydrophobicity of a protein. (Poly)glutamylation
Polyglutamylation occurs at the glutamate residues of a protein.
Specifically, the gamma-carboxy group of a glutamate will form a
peptide-like bond with the amino group of a free glutamate whose
alpha-carboxy group may be extended into a polyglutamate chain. The
glutamylation reaction is catalyzed by a glutamylase enzyme (or
removed by a deglutamylase enzyme). Polyglutamylation has been
carried out at the C-terminus of proteins to add up to about six
glutamate residues. Using such a reaction, Tubulin and other
proteins can be covalently linked to glutamic acid residues.
Phosphopantetheinylation The addition of a 4'-phosphopantetheinyl
group. Phosphorylation A process for phosphorylation of a protein
or peptide by contacting a protein or peptide with phosphoric acid
in the presence of a non-aqueous apolar organic solvent and
contacting the resultant solution with a dehydrating agent is
disclosed e.g., in U.S. Pat. No. 4,534,894. Insulin products are
described to be amenable to this process. See, e.g., U.S. Pat. No.
4,534,894. Typically, phosphorylation occurs at the serine,
threonine, and tyrosine residues of a protein. Prenylation
Prenylation (or isoprenylation or lipidation) is the addition of
hydrophobic molecules to a protein. Protein prenylation involves
the transfer of either a farnesyl (linear grouping of three
isoprene units) or a geranyl-geranyl moiety to C- terminal
cysteine(s) of the target protein. Proteolytic Processing
Processing, e.g., cleavage of a protein at a peptide bond.
Selenoylation The exchange of, e.g., a sulfur atom in the peptide
for selenium, using a selenium donor, such as selenophosphate.
Sulfation Processes for sulfating hydroxyl moieties, particularly
tertiary amines, are described in, e.g., U.S. Pat. No. 6,452,035. A
process for sulphation of a protein or peptide by contacting the
protein or peptide with sulphuric acid in the presence of a
non-aqueous apolar organic solvent and contacting the resultant
solution with a dehydrating agent is disclosed. Insulin products
are described to be amenable to this process. See, e.g., U.S. Pat.
No. 4,534,894. SUMOylation Covalently linking a peptide a SUMO
(small ubiquitin- related Modifier) protein, for, e.g., stabilizing
the peptide. Transglutamination Covalently linking other protein(s)
or chemical groups (e.g., PEG) via a bridge at glutamine residues
tRNA-mediated addition of For example, the site-specific
modification (insertion) of an amino acids (e.g., amino acid analog
into a peptide. arginylation) Ubiquitination The small peptide
ubiquitin is covalently linked to, e.g., lysine residues of a
protein. The ubiquitin-proteasome system can be used to carryout
such reaction. See, e.g., U.S. 2007-0059731.
[0228] The present invention also encompasses the use of prodrugs
of undercarboxylated/uncarboxylated osteocalcin or derivative or
variant thereof that can be produced by esterifying the carboxylic
acid functions of the undercarboxylated/uncarboxylated osteocalcin
or derivative or variant thereof with a lower alcohol, e.g.,
methanol, ethanol, propanol, isopropanol, butanol, etc. The use of
prodrugs of the undercarboxylated/uncarboxylated osteocalcin or
derivative or variant thereof that are not esters is also
contemplated. For example, pharmaceutically acceptable carbonates,
thiocarbonates, N-acyl derivatives, N-acyloxyalkyl derivatives,
quaternary derivatives of tertiary amines, N-Mannich bases, Schiff
bases, amino acid conjugates, phosphate esters, metal salts and
sulfonate esters of the undercarboxylated/uncarboxylated
osteocalcin or derivative or variant thereof are also contemplated.
In some embodiments, the prodrugs will contain a biohydrolyzable
moiety (e.g., a biohydrolyzable amide, biohydrolyzable carbamate,
biohydrolyzable carbonate, biohydrolyzable ester, biohydrolyzable
phosphate, or biohydrolyzable ureide analog). Guidance for the
preparation of prodrugs of the undercarboxylated/uncarboxylated
osteocalcin or derivative or variant thereof disclosed herein can
be found in publications such as Design of Prodrugs, Bundgaard, A.
Ed., Elsevier, 1985; Design and Application of Prodrugs, A Textbook
of Drug Design and Development, Krosgaard-Larsen and H. Bundgaard,
Ed., 1991, Chapter 5, pages 113-191; and Bundgaard, H., Advanced
Drug Delivery Review, 1992, 8, pages 1-38.
[0229] To practice the methods of the present invention, it may be
desirable to recombinantly express osteocalcin, e.g., by
recombinantly expressing a cDNA sequence encoding osteocalcin. The
cDNA sequence and deduced amino acid sequence of human osteocalcin
is represented in SEQ ID NO:1 and SEQ ID NO:2. Osteocalcin
nucleotide sequences may be isolated using a variety of different
methods known to those skilled in the art. For example, a cDNA
library constructed using RNA from a tissue known to express
osteocalcin can be screened using a labeled osteocalcin probe.
Alternatively, a genomic library may be screened to derive nucleic
acid molecules encoding osteocalcin. Further, osteocalcin nucleic
acid sequences may be derived by performing a polymerase chain
reaction (PCR) using two oligonucleotide primers designed on the
basis of known osteocalcin nucleotide sequences. The template for
the reaction may be cDNA obtained by reverse transcription of mRNA
prepared from cell lines or tissue known to express
osteocalcin.
[0230] While the osteocalcin polypeptides and peptides can be
chemically synthesized (e.g., see Creighton, 1983, Proteins:
Structures and Molecular Principles, W.H. Freeman & Co., N.Y.),
large polypeptides derived from osteocalcin and the full length
osteocalcin itself may be advantageously produced by recombinant
DNA technology using techniques well known in the art for
expressing a nucleic acid. Such methods can be used to construct
expression vectors containing the osteocalcin nucleotide sequences
and appropriate transcriptional and translational control signals.
These methods include, for example, in vitro recombinant DNA
techniques, synthetic techniques, and in vivo genetic
recombination. See, for example, the techniques described in
Ausubel et al., 1989, supra.
[0231] A variety of host-expression vector systems may be utilized
to express the osteocalcin nucleotide sequences. In a preferred
embodiment, the osteocalcin peptide or polypeptide is secreted and
may be recovered from the culture media.
[0232] Appropriate expression systems can be chosen to ensure that
the correct modification, processing and subcellular localization
of the osteocalcin protein occurs. To this end, bacterial host
cells are useful for expression of osteocalcin, as such cells are
unable to carboxylate osteocalcin.
[0233] The isolated osteocalcin can be purified from cells that
naturally express it, e.g., osteoblasts, or purified from cells
that naturally express osteocalcin but have been recombinantly
modified to overproduce osteocalcin, or purified from cells that
that do not naturally express osteocalcin but have been
recombinantly modified to express osteocalcin. In a particular
embodiment, a recombinant cell has been manipulated to activate
expression of the endogenous osteocalcin gene. For example,
International Patent Publications WO 99/15650 and WO 00/49162
describe a method of expressing endogenous genes termed random
activation of gene expression (RAGE), which can be used to activate
or increase expression of endogenous osteocalcin. The RAGE
methodology involves non-homologous recombination of a regulatory
sequence to activate expression of a downstream endogenous gene.
Alternatively, International Patent Publications WO 94/12650, WO
95/31560, and WO 96/29411, as well as U.S. Pat. No. 5,733,761 and
U.S. Pat. No. 6,270,985, describe a method of increasing expression
of an endogenous gene that involves homologous recombination of a
DNA construct that includes a targeting sequence, a regulatory
sequence, an exon, and a splice-donor site. Upon homologous
recombination, a downstream endogenous gene is expressed. The
methods of expressing endogenous genes described in the foregoing
patents are hereby expressly incorporated by reference.
[0234] In certain embodiments of methods of the present invention
where the therapeutic agent is undercarboxylated/uncarboxylated
osteocalcin or a derivative or variant thereof, the
undercarboxylated/uncarboxylated osteocalcin or a derivative or
variant thereof is administered to a patient in a dosage range of
from about 0.5 .mu.g/kg/day to about 100 mg/kg/day, from about 1
.mu.g/kg/day to about 90 mg/kg/day, from about 5 .mu.g/kg/day to
about 85 mg/kg/day, from about 10 .mu.g/kg/day to about 80
mg/kg/day, from about 20 .mu.g/kg/day to about 75 mg/kg/day, from
about 50 .mu.g/kg/day to about 70 mg/kg/day, from about 150
.mu.g/kg/day to about 65 mg/kg/day, from about 250 .mu.g/kg/day to
about 50 mg/kg/day, from about 500 .mu.g/kg/day to about 50
mg/kg/day, from about 1 mg/kg/day to about 50 mg/kg/day, from about
5 mg/kg/day to about 40 mg/kg/day, from about 10 mg/kg/day to about
35 mg/kg/day, from about 15 mg/kg/day to about 30 mg/kg/day, from
about 5 mg/kg/day to about 16 mg/kg/day, or from about 5 mg/kg/day
to about 15 mg/kg/day.
[0235] In certain embodiments of methods of the present invention
where the therapeutic agent is undercarboxylated/uncarboxylated
osteocalcin or a derivative or variant thereof, the
undercarboxylated/uncarboxylated osteocalcin or a derivative or
variant thereof is administered to a patient in a dosage range of
from about 0.5 .mu.g/kg/day to about 100 .mu.g/kg/day, from about 1
.mu.g/kg/day to about 80 .mu.g/kg/day, from about 3 .mu.g/kg/day to
about 50 .mu.g/kg/day, or from about 3 .mu.g/kg/day to about 30
.mu.g/kg/day.
[0236] In certain embodiments of methods of the present invention
where the therapeutic agent is undercarboxylated/uncarboxylated
osteocalcin or a derivative or variant thereof, the
undercarboxylated/uncarboxylated osteocalcin or a derivative or
variant thereof is administered to a patient in a dosage range of
from about 0.5 ng/kg/day to about 100 ng/kg/day, from about 1
ng/kg/day to about 80 ng/kg/day, from about 3 ng/kg/day to about 50
ng/kg/day, or from about 3 ng/kg/day to about 30 ng/kg/day.
Compositions Comprising Inhibitors of Gamma-Carboxylase, PTP-1B,
and/or OST-PTP
[0237] In certain embodiments of the invention, the pharmaceutical
compositions useful in the method of the invention comprise an
inhibitor that reduces the expression or activity of
gamma-carboxylase, PTP-1B, or OST-PTP. Preferably, the biological
activity of gamma-carboxylase, PTP-1B, or OST-PTP is inhibited. The
inhibitors may be antibodies (monoclonal or polyclonal) or
fragments of antibodies, small molecules, polypeptides or proteins,
or nucleic acids (e.g., antisense DNA or RNA, siRNA).
[0238] In certain embodiments, the inhibitors reduce the activity
of OST-PTP having the amino acid sequence of SEQ ID NO:11. In other
embodiments, the inhibitors reduce the activity of an OST-PTP
having an amino acid sequence that is substantially homologous or
substantially identical, as previously described, to the amino acid
sequence of SEQ ID NO:11.
[0239] In certain embodiments, the inhibitors reduce the activity
of human PTP-1B having the amino acid sequence of SEQ ID NO:17. In
other embodiments, the inhibitors reduce the activity of a PTP-1B
having an amino acid sequence that is substantially homologous or
substantially identical, as previously described, to the amino acid
sequence of SEQ ID NO:17.
[0240] In certain embodiments, the inhibitors reduce the activity
of human gamma-carboxylase having the amino acid sequence of SEQ ID
NO:7. In other embodiments, the inhibitors reduce the activity of a
gamma-carboxylase having an amino acid sequence that is
substantially homologous or identical to SEQ ID NO:7.
Small Molecule Inhibitors of OST-PTP, PTP-1B, and
Gamma-Carboxylase
[0241] In certain embodiments, the agent is a small molecule. By
"small molecule" is meant organic compounds of molecular weight of
more than 100 and less than about 2,500 daltons, and preferably
less than 500 daltons. Such small molecules inhibit the biological
activity of OST-PTP, PTP-1B, or gamma-carboxylase.
[0242] The small molecule inhibitors may comprise agents that act
as inhibitors of vitamin K. Warfarin and other vitamin K
inhibitors, including Coumadin and other derivatives, may be
administered to patients who would benefit from inhibition of
gamma-carboxylase in order to treat or prevent a disorder related
to reproduction in male mammals. In a specific embodiment of the
invention, the small molecule warfarin may be used to inhibit the
activity of gamma-carboxylase. Warfarin derivatives are exemplified
by acenocoumarol, phenprocoumon and phenindione. Warfarin and other
Coumadin derivatives block vitamin K-dependent gamma-carboxylation
of osteocalcin, thus increasing the level of
undercarboxylated/uncarboxylated osteocalcin.
[0243] Other inhibitors include thiol specific inhibitors of
gamma-carboxylase. Cys and His residues of gamma-carboxylase are
implicated in the carboxylase mechanism of gamma-carboxylase and it
is observed that the enzyme is inhibited by thiol-specific
inhibitors, such as N-ethylmaleimide (NEM) and mercurials such as
p-hydroxymurcuribenzoate (pHMB). Additional non-limiting examples
of these inhibitors include 5,5-dithiobis-(2-nitrobenzoic acid)
(DTNB), 2-nitro-5-thiocyanobenzoic acid (NTCB), iodoacetamide (IA),
N-phenylmaleimide (PheM), N-(1-pyrenyl) maleimide (PyrM),
naphthalene-1,5-dimaleimide (NDM), N,N'-(1,2-phenylene)dimaleimide
(oPDM), N,N'-1,4-phenylene dimaleimide (pPDM), N,N'-1,3-phenylene
dimaleimide (mPDM), 1,1-(methylenedi-4,1-phenylene)bismaleimide
(BM), 4-(N-maleimido)phenyltrimethylammonium (MPTM),
N,N'-bis(3-maleimidopropionyl)-2-hydroxy-1,3-propanediamine (BMP),
N-succinimidyl 3-(2-pyridyldithio)propionate, diethyl
pyrocarbonate, p-chloromercuribenzene sulphonic acid and
thiosulfinates. These inhibitors may also be provided as conjugate
or derivative, such as with, e.g., BSA or aminodextran.
Antibody Inhibitors of OST-PTP, PTP-1B, and Gamma-Carboxylase
[0244] The present invention also provides compositions comprising
an antibody or antibodies, as well as biologically active fragments
or variants thereof, that are capable of binding to an epitope of
OST-PTP, PTP-1B, or gamma-carboxylase polypeptides and inhibiting
the activity of OST-PTP, PTP-1B, or gamma-carboxylase.
[0245] An antibody against OST-PTP that decreases its activity can
be used therapeutically. In certain embodiments, the antibody
against OST-PTP binds to the extracellular domain of OST-PTP.
[0246] In certain embodiments, the antibody against OST-PTP binds
to an epitope in the mouse OST-PTP of SEQ ID NO:11 or an OST-PTP
having an amino acid sequence that is substantially homologous or
identical to SEQ ID NO:11. In other embodiments, the antibody
against OST-PTP binds to an epitope in an OST-PTP having an amino
acid sequence that is at least 70% homologous or identical to SEQ
ID NO:11.
[0247] Human OST-PTP can be obtained by isolating the human
ortholog of mouse OST-PTP (SEQ ID NO:10) or rat OST-PTP (SEQ ID
NO:14) by methods known in the art. For example, one could prepare
a cDNA library from human osteoblasts and identify human OST-PTP
cDNA by hybridizing the cDNA clones from the library to a mouse
probe. The mouse probe could be based on a portion of mouse OST-PTP
(SEQ ID NO:10). Alternatively, PCR, using primers based on the
mouse sequence, can be used to obtain the human OST-PTP gene.
[0248] An antibody against human PTP-1B that decreases its activity
can be used therapeutically in the methods of the present
invention. In certain embodiments, the antibody against human
PTP-1B binds to the extracellular domain of human PTP-1B.
[0249] In certain embodiments, the antibody against human PTP-1B
binds to an epitope in the human PTP-1B of SEQ ID NO:17 or an
OST-PTP having an amino acid sequence that is substantially
homologous or identical to SEQ ID NO:17. In other embodiments, the
antibody against human PTP-1B binds to an epitope in a human PTP-1B
having an amino acid sequence that is at least 70% homologous or
identical to SEQ ID NO:17.
[0250] Gamma-carboxylase is an intracellular protein, so antibodies
or fragments of antibodies against it are preferably used
therapeutically when combined with technologies for delivering the
antibodies, fragments or variants into the interior of target cells
expressing gamma-carboxylase, e.g., osteoblasts. Antibodies or
antibody fragments or variants against osteocalcin similarly can be
used with technologies for delivering the antibodies or fragments
into the interior of target cells and can also be used in
diagnostics and drug screening assays.
[0251] In a particular embodiment, the present invention provides
antibodies, fragments or variants of antibodies that recognize an
epitope in OST-PTP that includes the amino acid at position 1316 of
mouse OST-PTP or the corresponding position of human OST-PTP. In
certain embodiments, these antibodies, fragments or variants of
antibodies block or inhibit the ability of OST-PTP to activate
gamma-carboxylase. In certain embodiments, use of these antibodies
or fragments results in OST-PTP losing 50%, 60%, 70%, 80%, 90%,
95%, or essentially all of its ability to activate
gamma-carboxylase.
[0252] The term "epitope" refers to an antigenic determinant on an
antigen to which an antibody binds. Epitopes usually consist of
chemically active surface groupings of molecules such as amino
acids or sugar side chains, and typically have specific
three-dimensional structural characteristics, as well as specific
charge characteristics. Epitopes generally have at least five
contiguous amino acids but some epitopes are formed by
discontiguous amino acids that are brought together by the folding
of the protein that contains them.
[0253] The terms "antibody" and "antibodies" include polyclonal
antibodies, monoclonal antibodies, humanized or chimeric
antibodies, single chain Fv antibody fragments, Fab fragments, and
F(ab').sub.2 fragments. Polyclonal antibodies are heterogeneous
populations of antibody molecules that are specific for a
particular antigen, while monoclonal antibodies are homogeneous
populations of antibodies to a particular epitope contained within
an antigen. Monoclonal antibodies are particularly useful in the
present invention.
[0254] Antibody fragments that have specific binding affinity for
the polypeptide of interest (e.g., OST-PTP, PTP-1B, or
gamma-carboxylase) can be generated by known techniques. Such
antibody fragments include, but are not limited to, F(ab').sub.2
fragments that can be produced by pepsin digestion of an antibody
molecule, and Fab fragments that can be generated by reducing the
disulfide bridges of F(ab').sub.2 fragments. Alternatively, Fab
expression libraries can be constructed. See, for example, Huse et
al., 1989, Science 246:1275-1281. Single chain Fv antibody
fragments are formed by linking the heavy and light chain fragments
of the Fv region via an amino acid bridge (e.g., 15 to 18 amino
acids), resulting in a single chain polypeptide. Single chain Fv
antibody fragments can be produced through standard techniques,
such as those disclosed in U.S. Pat. No. 4,946,778.
[0255] Once produced, antibodies or fragments thereof can be tested
for recognition of the target polypeptide by standard immunoassay
methods including, for example, enzyme-linked immunosorbent assay
(ELISA) or radioimmunoassay assay (RIA). See, Short Protocols in
Molecular Biology eds. Ausubel et al., Green Publishing Associates
and John Wiley & Sons (1992).
[0256] The immunoassays, immunohistochemistry, RIA, IRMAs used
herein are based on the generation of various antibodies, including
those that specifically bind to osteocalcin, OST-PTP, PTP-1B,
gamma-carboxylase, vitamin K, or their fragments or variants.
Antibodies and methods of using antibodies to quantitate the amount
of osteocalcin, in particular, in a sample are also described in
U.S. Pat. No. 5,681,707. U.S. Pat. No. 5,681,707 discloses
antibodies that bind to the N-terminal 20 amino acids, or the
C-terminal 14 amino acids of osteocalcin. Anti-OST-PTP antibodies
are commercially available.
[0257] In one embodiment, antibodies against OST-PTP, PTP-1B, or
gamma-carboxylase that reduce its activity are useful in the
treatment of a patient having a disorder related to reproduction in
male mammals.
Nucleic Acid Inhibitors of OST-PTP, PTP-1B, and
Gamma-Carboxylase
[0258] Other embodiments of the present invention are directed to
the use of antisense nucleic acids or small interfering RNA (siRNA)
to reduce or inhibit expression and hence the biological activity
of osteocalcin, OST-PTP, PTP-1B, and/or gamma-carboxylase. cDNA
sequences encoding osteocalcin, OST-PTP, PTP-1B, and/or
gamma-carboxylase are set forth herein. Based on these sequences,
antisense DNA or RNA that hybridize sufficiently to the respective
gene or mRNA encoding osteocalcin, OST-PTP, PTP-1B, and/or
gamma-carboxylase to turn off or reduce expression can be readily
designed and engineered, using methods known in the art.
[0259] In a specific embodiment of the invention, antisense or
siRNA molecules for use in the methods of the present invention
include those that bind under stringent conditions to the human
gamma-carboxylase nucleic acid sequence of SEQ ID NO:6. In yet
another embodiment of the invention, the antisense or siRNA
molecules are those that that bind under stringent conditions to
the OST-PTP nucleic acid sequence of SEQ ID NO:10, or sequences
that are substantially homologous to SEQ ID NO:10.
[0260] In a specific embodiment of the invention, antisense or
siRNA molecules for use in the methods of the present invention
include those that bind under stringent conditions to the human
PTP-1B nucleic acid sequence of SEQ ID NO:16, or sequences that are
substantially homologous to SEQ ID NO:16.
[0261] Antisense-RNA and anti-sense DNA have been used
therapeutically in mammals to treat various diseases. See for
example Agrawal & Zhao, 1998, Curr. Opin. Chemical Biol. 2:
519-528; Agrawal & Zhao, 1997, CIBA Found. Symp. 209:60-78; and
Zhao et al., 1998, Antisense Nucleic Acid Drug Dev. 8:451-458; the
entire contents of which are hereby incorporated by reference as if
fully set forth herein. Antisense oligodeoxyribonucleotides
(antisense-DNA), oligoribonucleotides (antisense-RNA), and other
polymeric antisense compounds (e.g., oligonucleotides composed of
naturally-occurring nucleobases, sugars and covalent
internucleoside linkages and non-naturally-occurring portions which
function similarly) can base pair with a gene or its transcript.
Anderson et al., 1996, Antimicrobiol. Agents Chemother.
40:2004-2011 and U.S. Pat. No. 6,828,151 describe methods for
making and using antisense nucleic acids and their formulation, the
entire contents of which are hereby incorporated by reference as if
fully set forth herein. The disclosures of the foregoing
publications can adapted by those skilled in the art for use in the
methods of the present invention.
[0262] Methods of making antisense nucleic acids are well known in
the art. Further provided by the present invention are methods of
modulating the expression of OST-PTP, PTP1B, and gamma-carboxylase
genes and mRNA in cells or tissues by contacting the cells or
tissues with one or more antisense compounds or compositions in
order to treat or prevent a disorder related to reproduction in
male mammals. As used herein, the term "target nucleic acid"
encompasses DNA encoding osteocalcin, OST-PTP, PTP-1B, or
gamma-carboxylase and RNA (including pre-mRNA and mRNA) transcribed
from such DNA. The specific hybridization of a nucleic acid
oligomeric compound with its target nucleic acid interferes with
the normal function of the target nucleic acid. This modulation of
function of a target nucleic acid by compounds which specifically
hybridize to it is generally referred to as "antisense." The
functions of DNA to be interfered with include replication and
transcription. The functions of RNA to be interfered with include
all vital functions such as, for example, translocation of the RNA
to the site of protein translation, translation of protein from the
RNA, and catalytic activity which may be engaged in or facilitated
by the RNA. The overall effect of such interference with target
nucleic acid function is modulation of the expression of the
protein encoded by the DNA or RNA. In the context of the present
invention, "modulation" means reducing or inhibiting in the
expression of the gene or mRNA for osteocalcin, OST-PTP and/or
gamma-carboxylase. DNA is the preferred antisense nucleic acid.
[0263] The targeting process includes determination of a site or
sites within the target DNA or RNA encoding the osteocalcin,
OST-PTP, PTP-1B, and/or gamma-carboxylase for the antisense
interaction to occur such that the desired inhibitory effect is
achieved. Within the context of the present invention, a preferred
intragenic site is the region encompassing the translation
initiation or termination codon of the open reading frame (ORF) of
the mRNA for osteocalcin, OST-PTP, PTP-1B, or gamma-carboxylase,
preferably human osteocalcin, OST-PTP, PTP-1B, or
gamma-carboxylase. Since, as is known in the art, the translation
initiation codon is typically 5'-AUG (in transcribed mRNA
molecules; 5'-ATG in the corresponding DNA molecule), the
translation initiation codon is also referred to as the "AUG
codon," the "start codon" or the "AUG start codon." A minority of
genes have a translation initiation codon having the RNA sequence
5'-GUG, 5'-UUG or 5'-CUG, and 5'-AUA, 5'-ACG and 5'-CUG have been
shown to function in vivo. Thus, the terms "translation initiation
codon" and "start codon" can encompass many codon sequences, even
though the initiator amino acid in each instance is typically
methionine in eukaryotes. It is also known in the art that
eukaryotic genes may have two or more alternative start codons, any
one of which may be preferentially utilized for translation
initiation in a particular cell type or tissue, or under a
particular set of conditions. In the context of the invention,
"start codon" and "translation initiation codon" refer to the codon
or codons that are used in vivo to initiate translation of an mRNA
molecule transcribed from a gene. Routine experimentation will
determine the optimal sequence of the antisense or siRNA.
[0264] It is also known in the art that a translation termination
codon (or "stop codon") of a gene may have one of three sequences,
i.e., 5'-UAA, 5'-UAG and 5'-UGA (the corresponding DNA sequences
are 5'-TAA, 5'-TAG and 5'-TGA, respectively).
[0265] The terms "start codon region" and "translation initiation
codon region" refer to a portion of such an mRNA or gene that
encompasses from about 25 to about 50 contiguous nucleotides in
either direction (i.e., 5' or 3') from a translation initiation
codon. Similarly, the terms "stop codon region" and "translation
termination codon region" refer to a portion of such an mRNA or
gene that encompasses from about 25 to about 50 contiguous
nucleotides in either direction (i.e., 5' or 3') from a translation
termination codon.
[0266] The open reading frame (ORF) or "coding region," which is
known in the art to refer to the region between the translation
initiation codon and the translation termination codon, is also a
region which may be targeted effectively. Other target regions
include the 5' untranslated region (5'UTR), known in the art to
refer to the portion of an mRNA in the 5' direction from the
translation initiation codon, and thus including nucleotides
between the 5' cap site and the translation initiation codon of an
mRNA or corresponding nucleotides on the gene, and the 3'
untranslated region (3'UTR), known in the art to refer to the
portion of an mRNA in the 3' direction from the translation
termination codon, and thus including nucleotides between the
translation termination codon and 3' end of an mRNA or
corresponding nucleotides on the gene.
[0267] It is also known in the art that variants can be produced
through the use of alternative signals to start or stop
transcription and that pre-mRNAs and mRNAs can possess more that
one start codon or stop codon. Variants that originate from a
pre-mRNA or mRNA that use alternative start codons are known as
"alternative start variants" of that pre-mRNA or mRNA. Those
transcripts that use an alternative stop codon are known as
"alternative stop variants" of that pre-mRNA or mRNA. One specific
type of alternative stop variant is the "polyA variant" in which
the multiple transcripts produced result from the alternative
selection of one of the "polyA stop signals" by the transcription
machinery, thereby producing transcripts that terminate at unique
polyA sites.
[0268] Once one or more target sites have been identified, nucleic
acids are chosen which are sufficiently complementary to the
target, i.e., hybridize sufficiently well and with sufficient
specificity, to give the desired effect of inhibiting gene
expression and transcription or mRNA translation.
[0269] In the context of this invention, "hybridization" means
hydrogen bonding, which may be Watson-Crick, Hoogsteen or reversed
Hoogsteen hydrogen bonding, between complementary nucleoside or
nucleotide bases. For example, adenine and thymine are
complementary nucleobases which pair through the formation of
hydrogen bonds. "Complementary," as used herein, refers to the
capacity for precise pairing between two nucleotides. For example,
if a nucleotide at a certain position of a nucleic acid is capable
of hydrogen bonding with a nucleotide at the same position of a DNA
or RNA molecule, then the nucleic acid and the DNA or RNA are
considered to be complementary to each other at that position. The
nucleic acid and the DNA or RNA are complementary to each other
when a sufficient number of corresponding positions in each
molecule are occupied by nucleotides which can hydrogen bond with
each other. Thus, "specifically hybridizable" and "complementary"
are terms which are used to indicate a sufficient degree of
complementarity or precise pairing such that stable and specific
binding occurs between the nucleic acid and the DNA or RNA target.
It is understood in the art that the sequence of an antisense
compound need not be 100% complementary to that of its target
nucleic acid to be specifically hybridizable. An antisense compound
is specifically hybridizable when binding of the compound to the
target DNA or RNA molecule interferes with the normal function of
the target DNA or RNA to cause a loss of function, and there is a
sufficient degree of complementarity to avoid non-specific binding
of the antisense compound to non-target sequences under conditions
in which specific binding is desired, i.e., under physiological
conditions in the case of in vivo assays or therapeutic treatment,
and in the case of in vitro assays, under conditions in which the
assays are performed.
[0270] Antisense nucleic acids have been employed as therapeutic
moieties in the treatment of disease states in animals and man.
Antisense nucleic acid drugs, including ribozymes, have been safely
and effectively administered to humans in numerous clinical trials.
It is thus established that nucleic acids can be useful therapeutic
modalities that can be configured to be useful in treatment regimes
for treatment of cells, tissues and animals, especially humans, for
example to regulate expression of osteocalcin, OST-PTP, PTP-1B,
and/or gamma-carboxylase.
[0271] Nucleic acids in the context of this invention includes
"oligonucleotides," which refers to an oligomer or polymer of
ribonucleic acid (RNA) or deoxyribonucleic acid (DNA) or mimetics
thereof. This term includes oligonucleotides composed of
naturally-occurring nucleobases, sugars and covalent
internucleoside (backbone) linkages as well as oligonucleotides
having non-naturally-occurring portions which function similarly.
Such modified or substituted oligonucleotides are often preferred
over native forms because of desirable properties such as, for
example, enhanced cellular uptake, enhanced affinity for nucleic
acid target and increased stability in the presence of
nucleases.
[0272] While antisense nucleic acids are a preferred form of
antisense compound, the present invention comprehends other
oligomeric antisense compounds, including but not limited to
oligonucleotide mimetics. The antisense compounds in accordance
with this invention preferably comprise from about 8 to about 50
nucleobases (i.e., from about 8 to about 50 linked nucleosides).
Particularly preferred antisense compounds are antisense nucleic
acids comprising from about 12 to about 30 nucleobases. Antisense
compounds include ribozymes, external guide sequence (EGS) nucleic
acids (oligozymes), and other short catalytic RNAs or catalytic
nucleic acids which hybridize to the target nucleic acid and
modulate its expression.
[0273] The antisense compounds used in accordance with this
invention may be conveniently and routinely made through the
well-known technique of solid phase synthesis. Equipment for such
synthesis is sold by several vendors including, for example,
Applied Biosystems (Foster City, Calif.). Any other means for such
synthesis known in the art may additionally or alternatively be
employed. It is well known to use similar techniques to prepare
nucleic acids such as the phosphorothioates and alkylated
derivatives.
[0274] The antisense compounds of the present invention can be
utilized for diagnostics, therapeutics, and prophylaxis and as
research reagents and kits. For therapeutics, an animal, preferably
a human, suspected of having a disease or disorder such male
infertility, low sperm count, impaired sperm motility, impaired
sperm viability, low testosterone levels, reduced libido, erectile
dysfunction, underdevelopment of testes, or excess apoptosis in
testes, which can be treated by modulating the expression of
osteocalcin, gamma-carboxylase, PTP-1B, or OST-PTP, is treated by
administering antisense compounds in accordance with this
invention. The compounds useful in the methods of the invention can
be formulated into pharmaceutical compositions by adding an
effective amount of an antisense compound to a suitable
pharmaceutically acceptable diluent or carrier. The antisense
compounds and methods of the present invention are useful
prophylactically, e.g., to prevent or delay the appearance of male
infertility, low sperm count, impaired sperm motility, impaired
sperm viability, low testosterone levels, reduced libido, erectile
dysfunction, underdevelopment of testes, or excess apoptosis in
testes. The antisense compounds and methods of the invention are
also useful to retard the progression of male infertility, low
sperm count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, or excess apoptosis in testes.
[0275] The present invention also encompasses the use of siRNA to
treat or prevent a disorder related to reproduction in male
mammals. U.S. Patent Application Publication No. 2004/0023390 (the
entire contents of which are hereby incorporated by reference as if
fully set forth herein) teaches that double-stranded RNA (dsRNA)
can induce sequence-specific posttranscriptional gene silencing in
many organisms by a process known as RNA interference (RNAi).
However, in mammalian cells, dsRNA that is 30 base pairs or longer
can induce sequence-nonspecific responses that trigger a shut-down
of protein synthesis and even cell death through apoptosis. Recent
work shows that RNA fragments are the sequence-specific mediators
of RNAi (Elbashir et al., 2001, Nature 411:494-498). Interference
of gene expression by these small interfering RNA (siRNA) is now
recognized as a naturally occurring strategy for silencing genes in
C. elegans, Drosophila, plants, and in mouse embryonic stem cells,
oocytes and early embryos (Baulcombe, 1996, Plant Mol Biol.
32:79-88; Timmons & Fire, 1998, Nature 395:854; Wianny and
Zernicka-Goetz, 2000, Nat Cell Biol. 2:70-75; Svoboda et al., 2000,
Development 127:4147-4156).
[0276] In mammalian cell culture, a siRNA-mediated reduction in
gene expression has been accomplished by transfecting cells with
synthetic RNA nucleic acids (Elbashir et al., 2001, Nature
411:494-498). U.S. Patent Application Publication No. 2004/0023390,
the entire contents of which are hereby incorporated by reference
as if fully set forth herein, provides exemplary methods using a
viral vector containing an expression cassette containing a pol II
promoter operably-linked to a nucleic acid sequence encoding a
small interfering RNA molecule (siRNA) targeted against a gene of
interest.
[0277] As used herein, RNAi is the process of RNA interference. A
typical mRNA produces approximately 5,000 copies of a protein. RNAi
is a process that interferes with or significantly reduces the
number of protein copies made by an mRNA, preferably encoding
osteocalcin, OST-PTP, PTP-1B, or gamma-carboxylase. For example, a
double-stranded short interfering RNA (siRNA) molecule is
engineered to complement and match the protein-encoding nucleotide
sequence of the target mRNA to be interfered with. In certain
embodiments of the present invention, following intracellular
delivery, the siRNA molecule associates with an RNA-induced
silencing complex (RISC) and binds the target mRNA (such as mRNA
encoding osteocalcin, gamma-carboxylase, PTP-1B or OST-PTP) through
a base-pairing interaction and degrades it. The RISC remains
capable of degrading additional copies of the targeted mRNA. Other
forms of RNA such as short hairpin RNA and longer RNA molecules can
be used in the methods of the present invention. Longer molecules
cause cell death, for example by instigating apoptosis and inducing
an interferon response. Cell death was the major hurdle to
achieving RNAi in mammals because dsRNAs longer than 30 nucleotides
activated defense mechanisms that resulted in non-specific
degradation of RNA transcripts and a general shutdown of the host
cell. Using from about 20 to about 29 nucleotide siRNAs to mediate
gene-specific suppression in mammalian cells has apparently
overcome this obstacle. These siRNAs are long enough to cause gene
suppression but not of a length that induces an interferon
response. In a specific embodiment of the present invention, the
targets for suppression are osteocalcin mRNA, OST-PTP mRNA, PTP-1B
mRNA, or gamma-carboxylase mRNA. siRNA molecules useful in the
methods of the present invention include those sequences that bind
under stringent conditions to the human PTP-1B sequence of SEQ
ID:16, the human gamma-carboxylase sequence of SEQ ID:6, or the
mouse OST-PTP sequence of SEQ ID NO:10. siRNA molecules useful in
the methods of the present invention also include those sequences
that bind under stringent conditions to nucleic acids that are 80%,
85%, 90%, or 95% homologous to SEQ ID NO:16, SEQ ID NO:6 or SEQ ID
NO:10.
Formulation and Administration of Pharmaceutical Compositions
[0278] The present invention encompasses the use of the
polypeptides, nucleic acids, antibodies, small molecules and other
therapeutic agents described herein formulated in pharmaceutical
compositions to administer to a subject. The therapeutic agents
(also referred to as "active compounds") can be incorporated into
pharmaceutical compositions suitable for administration to a
subject, e.g., a human. Such compositions typically comprise the
polypeptides, nucleic acids, antibodies, small molecules and a
pharmaceutically acceptable carrier. Preferably, such compositions
are non-pyrogenic when administered to humans.
[0279] The pharmaceutical compositions of the invention are
administered in an amount sufficient to modulate the OST-PTP
signaling pathway or the PTP-1B signaling pathway involving
gamma-carboxylase and osteocalcin.
[0280] As used herein the language "pharmaceutically acceptable
carrier" is intended to include any and all solvents, binders,
diluents, disintegrants, lubricants, dispersion media, coatings,
antibacterial and antifungal agents, isotonic and absorption
delaying agents, and the like, compatible with pharmaceutical
administration. The use of such media and agents for
pharmaceutically active substances is well known in the art. As
long as any conventional media or agent is compatible with the
active compound, such media can be used in the compositions of the
invention. Supplementary active compounds or therapeutic agents can
also be incorporated into the compositions. A pharmaceutical
composition of the invention is formulated to be compatible with
its intended route of administration. Examples of routes of
administration include parenteral, e.g., intravenous, intradermal,
intranasal, subcutaneous, oral, inhalation, transdermal (topical),
transmucosal, and rectal administration.
[0281] The term "administer" is used in its broadest sense and
includes any method of introducing the compositions of the present
invention into a subject. This includes producing polypeptides or
polynucleotides in vivo as by transcription or translation of
polynucleotides that have been exogenously introduced into a
subject. Thus, polypeptides or nucleic acids produced in the
subject from the exogenous compositions are encompassed in the term
"administer."
[0282] Solutions or suspensions used for parenteral, intradermal,
or subcutaneous application can include the following components: a
sterile diluent such as water for injection, saline solution, fixed
oils, polyethylene glycols, glycerine, propylene glycol or other
synthetic solvents; antibacterial agents such as benzyl alcohol or
methyl parabens; antioxidants such as ascorbic acid or sodium
bisulfite; chelating agents such as ethylene diamine tetra acetic
acid; buffers such as acetates, citrates or phosphates and agents
for the adjustment of tonicity such as sodium chloride or dextrose.
pH can be adjusted with acids or bases, such as hydrochloric acid
or sodium hydroxide. The parenteral preparation can be enclosed in
ampoules, disposable syringes or multiple dose vials made of glass
or plastic.
[0283] Pharmaceutical compositions suitable for injectable use
include sterile aqueous solutions (where the therapeutic agents are
water soluble) or dispersions and sterile powders for the
extemporaneous preparation of sterile injectable solutions or
dispersion. For intravenous administration, suitable carriers
include physiological saline, bacteriostatic water, Cremophor
EL.RTM. (BASF, Parsippany, N.J.) or phosphate buffered saline
(PBS). In all cases, the composition must be sterile and should be
fluid to the extent that easy syringability exists. It should be
stable under the conditions of manufacture and storage and should
be preserved against the contaminating action of microorganisms
such as bacteria and fungi. The carrier can be a solvent or
dispersion medium containing, for example, water, ethanol, polyol
(for example, glycerol, propylene glycol, and liquid polyethylene
glycol, and the like), and suitable mixtures thereof. The proper
fluidity can be maintained, for example, by the use of a coating
such as lecithin, by the maintenance of the required particle size
in the case of dispersion and by the use of surfactants. Prevention
of the action of microorganisms can be achieved by various
antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In
many cases, it will be preferable to include isotonic agents, for
example, sugars, polyalcohols such as mannitol, sorbitol, sodium
chloride in the composition. Prolonged absorption of the injectable
compositions can be brought about by including in the composition
an agent which delays absorption, for example, aluminum
monostearate and gelatin.
[0284] Sterile injectable solutions can be prepared by
incorporating the active compound (e.g.,
undercarboxylated/uncarboxylated osteocalcin protein or
anti-OST-PTP antibody) in the required amount in an appropriate
solvent with one or a combination of the ingredients enumerated
above, as required, followed by filter sterilization. Generally,
dispersions are prepared by incorporating the active compound into
a sterile vehicle which contains a basic dispersion medium and the
required other ingredients from those enumerated above. In the case
of sterile powders for the preparation of sterile injectable
solutions, the preferred methods of preparation are vacuum drying
and freeze-drying which yield a powder of the active ingredient
plus any additional desired ingredient from a previously
sterile-filtered solution thereof.
[0285] Oral compositions generally include an inert diluent or an
edible carrier. They can be enclosed in gelatin capsules or
compressed into tablets. Depending on the specific conditions being
treated, pharmaceutical compositions of the present invention for
treatment of disorders relating to reproduction in male mammals can
be formulated and administered systemically or locally. Techniques
for formulation and administration can be found in "Remington: The
Science and Practice of Pharmacy" (20.sup.th edition, Gennaro (ed.)
and Gennaro, Lippincott, Williams & Wilkins, 2000). For oral
administration, the agent can be contained in enteric forms to
survive the stomach or further coated or mixed to be released in a
particular region of the GI tract by known methods. For the purpose
of oral therapeutic administration, the active compound can be
incorporated with excipients and used in the form of tablets,
troches, or capsules. Oral compositions can also be prepared using
a fluid carrier for use as a mouthwash, wherein the compound in the
fluid carrier is applied orally and swished and expectorated or
swallowed. Pharmaceutically compatible binding agents, and/or
adjuvant materials can be included as part of the composition. The
tablets, pills, capsules, troches and the like can contain any of
the following ingredients, or compounds of a similar nature: a
binder such as microcrystalline cellulose, gum tragacanth or
gelatin; an excipient such as starch or lactose, a disintegrating
agent such as alginic acid, PRIMOGEL.RTM., or corn starch; a
lubricant such as magnesium stearate or STEROTES.RTM.; a glidant
such as colloidal silicon dioxide; a sweetening agent such as
sucrose or saccharin; or a flavoring agent such as peppermint,
methyl salicylate, or orange flavoring.
[0286] For administration by inhalation, the compounds may be
delivered in the form of an aerosol spray from pressured container
or dispenser, which contains a suitable propellant, e.g., a gas
such as carbon dioxide, or a nebulizer.
[0287] Systemic administration can also be by transmucosal or
transdermal means. For transmucosal or transdermal administration,
penetrants appropriate to the barrier to be permeated are used in
the formulation. Such penetrants are generally known in the art,
and include, for example, for transmucosal administration,
detergents, bile salts, and fusidic acid derivatives. Transmucosal
administration can be accomplished through the use of nasal sprays
or suppositories. For transdermal administration, the active
compounds are formulated into ointments, salves, gels, or creams as
generally known in the art.
[0288] If appropriate, the compounds can also be prepared in the
form of suppositories (e.g., with conventional suppository bases
such as cocoa butter and other glycerides) or retention enemas for
rectal delivery.
[0289] In one embodiment, the active compounds are prepared with
carriers that will protect the compound against rapid elimination
from the body, such as a controlled release formulation, including
implants and microencapsulated delivery systems. Biodegradable,
biocompatible polymers can be used, such as ethylene vinyl acetate,
polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and
polylactic acid. Methods for preparation of such formulations will
be apparent to those skilled in the art. The materials can also be
obtained commercially from Alza Corporation and Nova
Pharmaceuticals, Inc. Liposomal suspensions (including liposomes
targeted to particular cells with, e.g., monoclonal antibodies) can
also be used as pharmaceutically acceptable carriers. These can be
prepared according to methods known to those skilled in the art,
for example, as described in U.S. Pat. No. 4,522,811.
[0290] It is especially advantageous to formulate oral or
parenteral compositions in unit dosage form for ease of
administration and uniformity of dosage. "Unit dosage form" as used
herein refers to physically discrete units suited as unitary
dosages for the subject to be treated; each unit containing a
predetermined quantity of active compound calculated to produce the
desired therapeutic effect in association with the required
pharmaceutical carrier. The specification for the unit dosage forms
of the invention are dictated by and directly dependent on the
unique characteristics of the active compound and the particular
therapeutic effect to be achieved, and the limitations inherent in
the art of compounding such an active compound for the treatment of
individuals.
[0291] As previously noted, the agent may be administered
continuously by pump or frequently during the day for extended
periods of time. In certain embodiments, the agent may be
administered at a rate of from about 0.3-100 ng/hour, preferably
about 1-75 ng/hour, more preferably about 5-50 ng/hour, and even
more preferably about 10-30 ng/hour. The agent may be administered
at a rate of from about 0.1-100 .mu.g/hr, preferably about 1-75
.mu.g/hr, more preferably about 5-50 .mu.g/hr, and even more
preferably about 10-30 .mu.g/hr. It will also be appreciated that
the effective dosage of antibody, protein, or polypeptide used for
treatment may increase or decrease over the course of a particular
treatment. Changes in dosage may result and become apparent from
monitoring the level of undercarboxylated/uncarboxylated
osteocalcin in a biological sample, preferably blood or serum.
[0292] In an embodiment of the invention, the agent can be
delivered by subcutaneous, long-term, automated drug delivery using
an osmotic pump to infuse a desired dose of the agent for a desired
time. Insulin pumps are widely available and are used by diabetics
to automatically deliver insulin over extended periods of time.
Such insulin pumps can be adapted to deliver the agent for use in
the methods of the present invention. The delivery rate of the
agent can be readily adjusted through a large range to accommodate
changing requirements of an individual (e.g., basal rates and bolus
doses). New pumps permit a periodic dosing manner, i.e., liquid is
delivered in periodic discrete doses of a small fixed volume rather
than in a continuous flow manner. The overall liquid delivery rate
for the device is controlled and adjusted by controlling and
adjusting the dosing period. The pump can be coupled with a
continuous monitoring device and remote unit, such as a system
described in U.S. Pat. No. 6,560,471, entitled "Analyte Monitoring
Device and Methods of Use." In such an arrangement, the hand-held
remote unit that controls the continuous blood monitoring device
could wirelessly communicate with and control both the blood
monitoring unit and the fluid delivery device delivering
therapeutic agents for use in the methods of the present
invention.
[0293] In some embodiments of the present invention, routine
experimentation may be used to determine the appropriate dosage
value for each patient by monitoring the effect of the therapeutic
agent on serum testosterone levels, which can be frequently and
easily monitored. The agent can be administered once or multiple
times per day. Serum testosterone levels can be monitored before
and during therapy to determine the appropriate amount of
therapeutic agent to administer to raise serum testosterone levels
or bring serum testosterone levels to normal and to maintain normal
levels over extended periods of time. In a preferred embodiment, a
patient is tested to determine if his serum testosterone levels are
significantly lower than normal levels (about 25% below) before
administering treatment with the therapeutic agent. The frequency
of administration may vary from a single dose per day to multiple
doses per day. Preferred routes of administration include oral,
intravenous and intraperitoneal, but other forms of administration
may be chosen as well.
[0294] A "therapeutically effective amount" of a protein or
polypeptide, small molecule, antibody, or nucleic acid is an amount
that achieves the desired therapeutic result. For example, if a
therapeutic agent is administered to treat or prevent a disorder
relating to reproduction in male mammals, a therapeutically
effective amount is an amount that ameliorates one or more symptoms
of the disorder, or produces at least one effect selected from the
group consisting of increasing fertility, raising sperm count,
increasing sperm motility, increasing sperm viability, increasing
serum testosterone levels, increasing libido, ameliorating erectile
dysfunction, reducing underdevelopment of testes, or reducing
excess apoptosis in testes.
[0295] A therapeutically effective amount of protein or
polypeptide, small molecule or nucleic acid for use in the present
invention typically varies and can be an amount sufficient to
achieve serum therapeutic agent levels typically of between about 1
nanogram per milliliter and about 10 micrograms per milliliter in
the subject, or an amount sufficient to achieve serum therapeutic
agent levels of between about 1 nanogram per milliliter and about 7
micrograms per milliliter in the subject. Other preferred serum
therapeutic agent levels include about 0.1 nanogram per milliliter
to about 3 micrograms per milliliter, about 0.5 nanograms per
milliliter to about 1 microgram per milliliter, about 1 nanogram
per milliliter to about 750 nanograms per milliliter, about 5
nanograms per milliliter to about 500 nanograms per milliliter, and
about 5 nanograms per milliliter to about 100 nanograms per
milliliter.
[0296] The amount of therapeutic agent disclosed herein to be
administered to a patient in the methods of the present invention
may range from about 5 mg/kg/day to about 500 mg/kg/day, from about
5 mg/kg/day to about 400 mg/kg/day, from about 5 mg/kg/day to about
300 mg/kg/day, from about 5 mg/kg/day to about 250 mg/kg/day, from
about 5 mg/kg/day to about 200 mg/kg/day, from about 5 mg/kg/day to
about 150 mg/kg/day, from about 5 mg/kg/day to about 100 mg/kg/day,
from about 5 mg/kg/day to about 75 mg/kg/day, from about 5
mg/kg/day to about 50 mg/kg/day, from about 5 mg/kg/day to about 40
mg/kg/day, from about 5 mg/kg/day to about 35 mg/kg/day, from about
5 mg/kg/day to about 30 mg/kg/day, from about 5 mg/kg/day to about
25 mg/kg/day, from about 5 mg/kg/day to about 24 mg/kg/day, from
about 5 mg/kg/day to about 23 mg/kg/day, from about 5 mg/kg/day to
about 22 mg/kg/day, from about 5 mg/kg/day to about 21 mg/kg/day,
from about 5 mg/kg/day to about 20 mg/kg/day, from about 5
mg/kg/day to about 19 mg/kg/day, from about 5 mg/kg/day to about 18
mg/kg/day, from about 5 mg/kg/day to about 17 mg/kg/day, from about
5 mg/kg/day to about 16 mg/kg/day, from about 5 mg/kg/day to about
15 mg/kg/day, from about 5 mg/kg/day to about 14 mg/kg/day, from
about 5 mg/kg/day to about 13 mg/kg/day, from about 5 mg/kg/day to
about 12 mg/kg/day, from about 5 mg/kg/day to about 11 mg/kg/day,
or from about 5 mg/kg/day to about 10 mg/kg/day.
[0297] Other dose ranges that may be used include from about 10
mg/kg/day to about 500 mg/kg/day, from about 10 mg/kg/day to about
400 mg/kg/day, from about 10 mg/kg/day to about 300 mg/kg/day, from
about 10 mg/kg/day to about 250 mg/kg/day, from about 10 mg/kg/day
to about 200 mg/kg/day, from about 10 mg/kg/day to about 150
mg/kg/day, from about 10 mg/kg/day to about 100 mg/kg/day, from
about 10 mg/kg/day to about 75 mg/kg/day, from about 10 mg/kg/day
to about 50 mg/kg/day, from about 10 mg/kg/day to about 45
mg/kg/day, from about 10 mg/kg/day to about 40 mg/kg/day, from
about 10 mg/kg/day to about 35 mg/kg/day, from about 10 mg/kg/day
to about 34 mg/kg/day, from about 10 mg/kg/day to about 33
mg/kg/day, from about 10 mg/kg/day to about 32 mg/kg/day, from
about 10 mg/kg/day to about 31 mg/kg/day, from about 10 mg/kg/day
to about 30 mg/kg/day, from about 10 mg/kg/day to about 29
mg/kg/day, from about 10 mg/kg/day to about 28 mg/kg/day, from
about 10 mg/kg/day to about 27 mg/kg/day, from about 10 mg/kg/day
to about 26 mg/kg/day, from about 10 mg/kg/day to about 25
mg/kg/day, from about 10 mg/kg/day to about 24 mg/kg/day, from
about 10 mg/kg/day to about 23 mg/kg/day, from about 10 mg/kg/day
to about 22 mg/kg/day, from about 10 mg/kg/day to about 21
mg/kg/day, from about 10 mg/kg/day to about 20 mg/kg/day, from
about 10 mg/kg/day to about 19 mg/kg/day, from about 10 mg/kg/day
to about 18 mg/kg/day, from about 10 mg/kg/day to about 17
mg/kg/day, from about 10 mg/kg/day to about 16 mg/kg/day, or from
about 10 mg/kg/day to about 15 mg/kg/day.
[0298] Other dose ranges that may be used include from about 15
mg/kg/day to about 500 mg/kg/day, from about 15 mg/kg/day to about
400 mg/kg/day, from about 15 mg/kg/day to about 300 mg/kg/day, from
about 15 mg/kg/day to about 250 mg/kg/day, from about 15 mg/kg/day
to about 200 mg/kg/day, from about 15 mg/kg/day to about 150
mg/kg/day, from about 15 mg/kg/day to about 100 mg/kg/day, from
about 15 mg/kg/day to about 75 mg/kg/day, from about 15 mg/kg/day
to about 50 mg/kg/day, from about 15 mg/kg/day to about 40
mg/kg/day, from about 15 mg/kg/day to about 30 mg/kg/day, from
about 15 mg/kg/day to about 25 mg/kg/day, or from about 15
mg/kg/day to about 20 mg/kg/day.
[0299] Other dose ranges that may be used include from about 20
mg/kg/day to about 500 mg/kg/day, from about 20 mg/kg/day to about
400 mg/kg/day, from about 20 mg/kg/day to about 300 mg/kg/day, from
about 20 mg/kg/day to about 250 mg/kg/day, from about 20 mg/kg/day
to about 200 mg/kg/day, from about 20 mg/kg/day to about 150
mg/kg/day, from about 20 mg/kg/day to about 100 mg/kg/day, from
about 20 mg/kg/day to about 75 mg/kg/day, from about 20 mg/kg/day
to about 50 mg/kg/day, from about 20 mg/kg/day to about 40
mg/kg/day, from about 20 mg/kg/day to about 30 mg/kg/day, or from
about 20 mg/kg/day to about 25 mg/kg/day.
[0300] Other dose ranges that may be used include from about 25
mg/kg/day to about 500 mg/kg/day, from about 25 mg/kg/day to about
400 mg/kg/day, from about 25 mg/kg/day to about 300 mg/kg/day, from
about 25 mg/kg/day to about 250 mg/kg/day, from about 25 mg/kg/day
to about 200 mg/kg/day, from about 25 mg/kg/day to about 150
mg/kg/day, from about 25 mg/kg/day to about 100 mg/kg/day, from
about 25 mg/kg/day to about 75 mg/kg/day, from about 25 mg/kg/day
to about 50 mg/kg/day, from about 25 mg/kg/day to about 40
mg/kg/day, or from about 25 mg/kg/day to about 30 mg/kg/day.
[0301] Other dose ranges that may be used include from about 30
mg/kg/day to about 500 mg/kg/day, from about 30 mg/kg/day to about
400 mg/kg/day, from about 30 mg/kg/day to about 300 mg/kg/day, from
about 30 mg/kg/day to about 250 mg/kg/day, from about 30 mg/kg/day
to about 200 mg/kg/day, from about 30 mg/kg/day to about 150
mg/kg/day, from about 30 mg/kg/day to about 100 mg/kg/day, from
about 30 mg/kg/day to about 75 mg/kg/day, from about 30 mg/kg/day
to about 50 mg/kg/day, or from about 30 mg/kg/day to about 40
mg/kg/day.
[0302] Other dose ranges that may be used include from about 40
mg/kg/day to about 500 mg/kg/day, from about 40 mg/kg/day to about
400 mg/kg/day, from about 40 mg/kg/day to about 300 mg/kg/day, from
about 40 mg/kg/day to about 250 mg/kg/day, from about 40 mg/kg/day
to about 200 mg/kg/day, from about 40 mg/kg/day to about 150
mg/kg/day, from about 40 mg/kg/day to about 100 mg/kg/day, from
about 40 mg/kg/day to about 75 mg/kg/day, from about 40 mg/kg/day
to about 60 mg/kg/day, or from about 40 mg/kg/day to about 50
mg/kg/day.
[0303] Other dose ranges that may be used include from about 50
mg/kg/day to about 500 mg/kg/day, from about 50 mg/kg/day to about
400 mg/kg/day, from about 50 mg/kg/day to about 300 mg/kg/day, from
about 50 mg/kg/day to about 250 mg/kg/day, from about 50 mg/kg/day
to about 200 mg/kg/day, from about 50 mg/kg/day to about 175
mg/kg/day, from about 50 mg/kg/day to about 150 mg/kg/day, from
about 50 mg/kg/day to about 125 mg/kg/day, from about 50 mg/kg/day
to about 100 mg/kg/day, from about 50 mg/kg/day to about 75
mg/kg/day, or from about 50 mg/kg/day to about 60 mg/kg/day.
[0304] Other dose ranges that may be used include from about 60
mg/kg/day to about 500 mg/kg/day, from about 60 mg/kg/day to about
400 mg/kg/day, from about 60 mg/kg/day to about 300 mg/kg/day, from
about 60 mg/kg/day to about 250 mg/kg/day, from about 60 mg/kg/day
to about 200 mg/kg/day, from about 60 mg/kg/day to about 175
mg/kg/day, from about 60 mg/kg/day to about 150 mg/kg/day, from
about 60 mg/kg/day to about 125 mg/kg/day, from about 60 mg/kg/day
to about 100 mg/kg/day, or from about 60 mg/kg/day to about 75
mg/kg/day.
[0305] Other dose ranges that may be used include from about 70
mg/kg/day to about 500 mg/kg/day, from about 70 mg/kg/day to about
400 mg/kg/day, from about 70 mg/kg/day to about 300 mg/kg/day, from
about 70 mg/kg/day to about 250 mg/kg/day, from about 70 mg/kg/day
to about 200 mg/kg/day, from about 70 mg/kg/day to about 175
mg/kg/day, from about 70 mg/kg/day to about 150 mg/kg/day, from
about 70 mg/kg/day to about 125 mg/kg/day, or from about 70
mg/kg/day to about 100 mg/kg/day.
[0306] Other dose ranges that may be used include from about 80
mg/kg/day to about 500 mg/kg/day, from about 80 mg/kg/day to about
400 mg/kg/day, from about 80 mg/kg/day to about 300 mg/kg/day, from
about 80 mg/kg/day to about 250 mg/kg/day, from about 80 mg/kg/day
to about 200 mg/kg/day, from about 80 mg/kg/day to about 175
mg/kg/day, from about 80 mg/kg/day to about 150 mg/kg/day, from
about 80 mg/kg/day to about 125 mg/kg/day, or from about 80
mg/kg/day to about 100 mg/kg/day.
[0307] Other dose ranges that may be used include from about 90
mg/kg/day to about 500 mg/kg/day, from about 90 mg/kg/day to about
400 mg/kg/day, from about 90 mg/kg/day to about 300 mg/kg/day, from
about 90 mg/kg/day to about 250 mg/kg/day, from about 90 mg/kg/day
to about 200 mg/kg/day, from about 90 mg/kg/day to about 175
mg/kg/day, from about 90 mg/kg/day to about 150 mg/kg/day, from
about 90 mg/kg/day to about 125 mg/kg/day, or from about 90
mg/kg/day to about 100 mg/kg/day.
[0308] Other dose ranges that may be used include from about 100
mg/kg/day to about 500 mg/kg/day, from about 100 mg/kg/day to about
400 mg/kg/day, from about 100 mg/kg/day to about 300 mg/kg/day,
from about 100 mg/kg/day to about 250 mg/kg/day, from about 100
mg/kg/day to about 200 mg/kg/day, from about 100 mg/kg/day to about
175 mg/kg/day, from about 100 mg/kg/day to about 150 mg/kg/day, or
from about 100 mg/kg/day to about 125 mg/kg/day.
[0309] Other dosages that may be used include about 5 mg/kg/day,
about 6 mg/kg/day, about 7 mg/kg/day, about 8 mg/kg/day, about 9
mg/kg/day, about 10 mg/kg/day, about 11 mg/kg/day, about 12
mg/kg/day, about 13 mg/kg/day, about 14 mg/kg/day, about 15
mg/kg/day, about 16 mg/kg/day, about 17 mg/kg/day, about 18
mg/kg/day, about 19 mg/kg/day, about 20 mg/kg/day, about 21
mg/kg/day, about 22 mg/kg/day, about 23 mg/kg/day, about 24
mg/kg/day, about 25 mg/kg/day, about 26 mg/kg/day, about 27
mg/kg/day, about 28 mg/kg/day, about 29 mg/kg/day, about 30
mg/kg/day, about 31 mg/kg/day, about 32 mg/kg/day, about 33
mg/kg/day, about 34 mg/kg/day, about 35 mg/kg/day, about 36
mg/kg/day, about 37 mg/kg/day, about 38 mg/kg/day, about 39
mg/kg/day, about 40 mg/kg/day, about 45 mg/kg/day, about 50
mg/kg/day, about 60 mg/kg/day, about 70 mg/kg/day, about 80
mg/kg/day, about 90 mg/kg/day, about 100 mg/kg/day, about 125
mg/kg/day, about 150 mg/kg/day, about 175 mg/kg/day, about 200
mg/kg/day, about 250 mg/kg/day, or about 350 mg/kg/day.
[0310] The skilled artisan will appreciate that certain factors may
influence the dosage required to effectively treat a subject,
including but not limited to the severity of the condition,
previous treatments, the general health and/or age of the subject,
and other disorders or diseases present.
[0311] Treatment of a subject with a therapeutically effective
amount of a protein, polypeptide, nucleotide or antibody can
include a single treatment or, preferably, can include a series of
treatments.
[0312] In certain embodiments, treatment of a subject with
undercarboxylated/uncarboxylated osteocalcin leads to
undercarboxylated/uncarboxylated osteocalcin being about 10%, about
15%, about 20%, about 25%, about 30%, about 35%, about 40%, about
45%, or about 50% of the total osteocalcin in the blood of the
patient.
[0313] It is understood that the appropriate dose of a small
molecule agent depends upon a number of factors within the ken of
the ordinarily skilled physician, veterinarian, or researcher. The
dose(s) of the small molecule will vary, for example, depending
upon the identity, size, and condition of the subject or sample
being treated, further depending upon the route by which the
composition is to be administered, and the effect which the
practitioner desires the small molecule to have. It is furthermore
understood that appropriate doses of a small molecule depend upon
the potency of the small molecule with respect to the expression or
activity to be modulated. When one or more of these small molecules
is to be administered to an animal (e.g., a human) in order to
modulate expression or activity of OST-PTP, PTP-1B, or
gamma-carboxylase, a relatively low dose may be prescribed at
first, with the dose subsequently increased until an appropriate
response is obtained. In addition, it is understood that the
specific dose level for any particular subject will depend upon a
variety of factors including the activity of the specific compound
employed, the age, body weight, general health, and diet of the
subject, the time of administration, the route of administration,
the rate of excretion, whether other drugs are being administered
to the patient, and the degree of expression or activity to be
modulated.
[0314] For prevention or treatment, a suitable subject can be an
individual who is suspected of having, has been diagnosed as
having, or is at risk of developing a disorder relating to
reproduction in male mammals.
[0315] Suitable routes of administration of the pharmaceutical
compositions useful in the methods of the present invention can
include oral, intestinal, parenteral, transmucosal, transdermal,
intramuscular, subcutaneous, transdermal, rectal, intramedullary,
intrathecal, intravenous, intraventricular, intraatrial,
intraaortal, intraarterial, or intraperitoneal administration. The
pharmaceutical compositions useful in the methods of the present
invention can be administered to the subject by a medical device,
such as, but not limited to, catheters, balloons, implantable
devices, biodegradable implants, prostheses, grafts, sutures,
patches, shunts, or stents. In one preferred embodiment, the
therapeutic agent (e.g., undercarboxylated/uncarboxylated
osteocalcin) can be coated on a stent for localized administration
to the target area. In this situation a slow release preparation of
undercarboxylated/uncarboxylated osteocalcin, for example, is
preferred.
[0316] The compounds of the invention may also be admixed,
encapsulated, conjugated or otherwise associated with other
molecules, molecule structures or mixtures of compounds, as for
example, liposomes, receptor targeted molecules, oral, rectal,
topical or other formulations, for assisting in uptake,
distribution and/or absorption. Representative United States
patents that teach the preparation of such uptake, distribution
and/or absorption assisting formulations and that may be consulted
by those skilled in the art for techniques useful for practicing
the present invention include, but are not limited to, U.S. Pat.
Nos. 5,108,921; 5,354,844; 5,416,016; 5,459,127; 5,521,291;
5,543,158; 5,547,932; 5,583,020; 5,591,721; 4,426,330; 4,534,899;
5,013,556; 5,108,921; 5,213,804; 5,227,170; 5,264,221; 5,356,633;
5,395,619; 5,416,016; 5,417,978; 5,462,854; 5,469,854; 5,512,295;
5,527,528; 5,534,259; 5,543,152; 5,556,948; 5,580,575; and
5,595,756, each of which is herein incorporated by reference.
[0317] In yet another aspect of the invention,
undercarboxylated/uncarboxylated osteocalcin is administered as a
pharmaceutical composition with a pharmaceutically acceptable
excipient. Exemplary pharmaceutical compositions for
undercarboxylated/uncarboxylated osteocalcin include injections as
solutions or injections as injectable self-setting or self-gelling
mineral polymer hybrids. Undercarboxylated/uncarboxylated
osteocalcin may be administered using a porous crystalline
biomimetic bioactive composition of calcium phosphate. See U.S.
Pat. Nos. 5,830,682; 6,514,514; and 6,511,958 and U.S. Patent
Application Publications Nos. 2006/0063699; 2006/0052327;
2003/199615; 2003/0158302; 2004/0157864; 2006/0292670; 2007/0099831
and 2006/0257492, all of which are incorporated herein in their
entirety by reference.
Methods of Treatment
[0318] The present invention provides methods for modulating the
level of undercarboxylated/uncarboxylated osteocalcin in male
mammals through modulating the OST-PTP signaling pathway or the
PTP-1B signaling pathway for treating or preventing a variety of
different disorders relating to reproduction in the male mammals.
In particular, the methods are used to inhibit OST-PTP
phosphorylase activity, inhibit PTP-1B phosphorylase activity,
reduce gamma-carboxylase activity, and/or increase
undercarboxylated/uncarboxylated osteocalcin. According to the
invention, the methods provide an amount of an agent effective to
treat or prevent a disorder associated with the OST-PTP signaling
pathway or the PTP-1B signaling pathway. The agent may be selected
from the group consisting of small molecules, antibodies and
nucleic acids. Such disorders include, but are not limited to, male
infertility, low sperm count, impaired sperm motility, impaired
sperm viability, low testosterone levels, reduced libido, erectile
dysfunction, underdevelopment of testes, and excess apoptosis in
testes.
[0319] In certain embodiments, the methods comprise identifying a
patient in need of treatment or prevention of male infertility, low
sperm count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, or excess apoptosis in testes and then
applying the methods disclosed herein to the patient.
[0320] In one embodiment of the invention, the method of treatment
comprises administering to a patient in need thereof a
therapeutically effective amount of
undercarboxylated/uncarboxylated osteocalcin sufficient to raise
the patient's blood level of undercarboxylated/uncarboxylated
osteocalcin compared to the pretreatment patient level. Preferably,
the patient is a male human. In another embodiment, the method of
treatment comprises administering to a patient in need thereof a
therapeutically effective amount of
undercarboxylated/uncarboxylated osteocalcin sufficient to raise
the ratio of undercarboxylated/uncarboxylated osteocalcin to total
osteocalcin in the patient's blood compared to the pretreatment
patient ratio.
[0321] In another aspect of the invention, a method is provided for
treating or preventing a disorder relating to reproduction in a
male mammal comprising administering to a male mammal in need
thereof undercarboxylated/uncarboxylated osteocalcin in a
therapeutically effective amount that produces at least one effect
selected from the group consisting of increasing fertility, raising
sperm count, increasing sperm motility, increasing sperm viability,
increasing serum testosterone levels, increasing libido,
ameliorating erectile dysfunction, reducing underdevelopment of
testes, and reducing excess apoptosis in testes, compared to
pretreatment levels. Preferably, the male mammal is a human.
[0322] In an embodiment of the invention, a method is provided for
treating or preventing a disorder relating to reproduction in a
male mammal comprising administering to a male mammal in need of
such treatment or prevention a therapeutically effective amount of
an agent that reduces OST-PTP expression or activity in
osteoblasts, or reduces PTP-1B expression or activity in
osteoblasts, sufficient to produce at least one effect selected
from the group consisting of increasing fertility, raising sperm
count, increasing sperm motility, increasing sperm viability,
increasing serum testosterone levels, increasing libido,
ameliorating erectile dysfunction, reducing underdevelopment of
testes, and reducing excess apoptosis in testes, compared to
pretreatment levels. Preferably, the patient is a human.
[0323] The present invention is directed to methods (i) for
treating or preventing a disorder relating to reproduction in a
male mammal comprising administering to a male mammal in need of
such treatment or prevention in a therapeutically effective amount
an agent that reduces gamma-carboxylase expression or activity in
osteoblasts sufficient to produce at least one effect selected from
the group consisting of increasing fertility, raising sperm count,
increasing sperm motility, increasing sperm viability, increasing
serum testosterone levels, increasing libido, ameliorating erectile
dysfunction, reducing underdevelopment of testes, and reducing
excess apoptosis in testes, compared to pretreatment levels
comprising administering to the male mammal in need of such
treatment or prevention in a therapeutically effective amount an
agent that reduces gamma-carboxylase expression or activity in
osteoblasts sufficient to increase fertility, raise sperm count,
increase sperm motility, increase sperm viability, increase serum
testosterone levels, increase libido, ameliorate erectile
dysfunction, reduce underdevelopment of testes, or reduce excess
apoptosis in testes. Preferably, the male mammal is a human. In an
embodiment of the invention, the agent is an isolated nucleic acid
that is selected from the group consisting of cDNA, antisense DNA,
antisense RNA, and small interfering RNA, which nucleic acid is
sufficiently complementary to the gene or mRNA encoding
gamma-carboxylase to permit specific hybridization to the gene or
mRNA, and wherein the hybridization prevents or reduces expression
of gamma-carboxylase in osteoblasts. In another embodiment of the
invention, the nucleic acid is conjugated to a phosphate group or
other targeting ligand to facilitate uptake by osteoblasts.
[0324] In the methods described herein, it will be understood that
"treating" a disease or disorder encompasses not only improving the
disease or disorder or its symptoms but also retarding the
progression of the disease or disorder or ameliorating the
deleterious effects of the disease or disorder.
[0325] The present invention also encompasses the use of gene
therapy for treatment of disorders relating to reproduction in male
mammals. This can be accomplished by introducing a gene encoding
osteocalcin or a biologically active fragment or variant thereof
into a vector, and transfecting or infecting cells from a patient
afflicted with the disorder or at a high risk of developing the
disorder with the vector, according to various methods known in the
art. The cells may be transfected or infected by ex vivo or by in
vivo methods.
[0326] Methods of gene therapy known in the art can be adapted for
use in the methods of the present invention. Adeno-associated virus
(AAV) is one of the most promising vectors for gene therapy and may
be used in the methods of the present invention. Conventional
methods of gene transfer and gene therapy are described in, e.g.,
Gene Therapy: Principles and Applications, ed. T. Blackenstein,
Springer Verlag, 1999; Gene Therapy Protocols (Methods in Molecular
Medicine), ed. P. D. Robbins, Humana Press, 1997; and Retro-vectors
for Human Gene Therapy, ed. C. P. Hodgson, Springer Verlag, 1996.
AAV is an attractive vector system for human gene therapy because
it is non-pathogenic for humans, it has a high frequency of
integration, and it can infect non-dividing cells, thus making it
useful for delivery of genes into mammalian cells both in tissue
culture and in whole animals. See, e.g., Muzyczka, 1992, Curr. Top.
Microbiol. Immunol., 158:97-129. Recent studies have demonstrated
AAV to be a potentially useful vector for gene delivery. LaFace et
al., 1998, Virology, 162:483-486; Zhou et al., 1993, Exp. Hematol.
(NY), 21:928-933; Flotte et al., 1993, Proc. Natl. Acad. Sci. USA
90:10613-10617; and Walsh et al., 1994, Blood 84:1492-1500.
Recombinant AAV vectors have been used successfully for in vitro
and in vivo transduction of marker genes (Kaplitt et al., 1994,
Nature Genetics, 8:148-154; Lebkowski et al., 1988, Mol. Cell.
Biol. 8:3988-3996; Samulski et al., 1989, J. Virol., 63:3822-3828;
Shelling & Smith, 1994, Gene Therapy 1:165-169; Yoder et al.,
1994, Blood, 82:suppl. 1:347A; Zhou et al., 1994, J. Exp. Med.,
179:1867-1875; Hermonat & Muzyczka, 1984, Proc. Natl. Acad.
Sci. USA., 81:6466-6470; Tratschin et al., 1984, Mol. Cell. Biol.,
4:2072-2081; McLaughlin et al., 1988, J. Virol., 62:1963-1973) as
well as genes involved in human diseases (Flotte et al., 1992, Am.
J. Respir. Cell Mol. Biol. 7:349-356; Luo et al., 1994, Blood,
82:suppl. 1,303A; Ohi et al., 1990, Gene, 89:279-282; Walsh et al.,
1992, Proc. Natl. Acad. Sci. USA 89:7257-7261; Wei et al., 1994,
Gene Therapy, 1:261-268).
[0327] In certain other embodiments, the gene of interest (e.g.,
osteocalcin) can be transferred into a target cell using a
retroviral vector. Retroviruses refer to viruses that belong to the
Retroviridae family, and include oncoviruses, foamy viruses
(Russell & Miller, 1996, J. Virol. 70:217-222; Wu et al., 1999,
J. Virol. 73:4498-4501, and lentiviruses (for example, HIV-1
(Naldini et al., 1996, Science 272:263-267; Poeschla et al., 1996,
Proc. Natl. Acad. Sci. USA 93:11395-11399; Srinivasakumar et al.,
1997, J. Virol. 71:5841-5848; Zufferey et al., 1997, Nat.
Biotechnol. 15:871-875; Kim et al., 1998, J. Virol. 72:811-816) and
feline immunodeficiency virus (Johnston et al., 1999, J. Virol.
73:4991-5000; Johnston & Power, 1999, Virol. 73:2491-2498;
Poeschla et al., 1998, Nat. Med. 4:354-357). The disclosures of
these publications may be adapted for use in the methods of the
present invention. Numerous gene therapy methods that take
advantage of retroviral vectors for treating a wide variety of
diseases are well-known in the art and can be adapted for use in
the methods of the present invention (see, e.g., U.S. Pat. Nos.
4,405,712 and 4,650,764; Friedmann, 1989, Science, 244:1275-1281;
Mulligan, 1993, Science, 260:926-932; Crystal, 1995, Science
270:404-410, and U.S. Pat. No. 6,899,871, each of which are
incorporated herein by reference in their entirety). An increasing
number of these methods are currently being applied in human
clinical trials (Morgan, 1993, BioPharm, 6:32-35; see also The
Development of Human Gene Therapy, Theodore Friedmann, Ed., Cold
Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999.
ISBN 0-87969-528-5, which is incorporated herein by reference in
its entirety).
[0328] Efficacy of the methods of treatment described herein can be
monitored by determining whether the methods ameliorate any of the
symptoms of the disease or disorder being treated. Alternatively,
one can monitor the level of serum undercarboxylated/uncarboxylated
osteocalcin (either in absolute terms or as a ratio of
undercarboxylated/uncarboxylated osteocalcin/total osteocalcin),
which levels should increase in response to therapy.
Methods of Male Contraception
[0329] The discovery of the previously unknown biochemical pathway
linking osteocalcin and reproductive biology in male mammals
provides methods of contraception for use in male mammals. In such
methods, a male mammal in need of contraception is administered a
pharmaceutical composition comprising a therapeutically effective
amount of an agent that antagonizes the effect of
undercarboxylated/uncarboxylated osteocalcin. In certain
embodiments, the agent has the effect of lowering the serum level
of undercarboxylated/uncarboxylated osteocalcin in the male mammal.
In certain embodiments, the agent acts as an antagonist of
undercarboxylated/uncarboxylated osteocalcin.
[0330] In certain embodiments, the male mammal in need of
contraception is a human.
[0331] In certain embodiments, the pharmaceutical compositions
useful in the methods of contraception comprise an agent that
increases the expression or activity of gamma-carboxylase, PTP-1B,
or OST-PTP. This results in a greater amount of osteocalcin being
present in the carboxylated state rather than the
undercarboxylated/uncarboxylated state. The agents that increase
the expression or activity of gamma-carboxylase, PTP-1B, or OST-PTP
may be antibodies (monoclonal or polyclonal) or fragments of
antibodies, small molecules, polypeptides or proteins, or nucleic
acids (e.g., antisense DNA or RNA, siRNA).
[0332] In other embodiments, the pharmaceutical compositions useful
in the methods of contraception comprise an agent that is a
"negative mimetic" of undercarboxylated/uncarboxylated osteocalcin.
A "negative mimetic" refers to a synthetic chemical compound that
has substantially the same structural characteristics of naturally
occurring undercarboxylated/uncarboxylated osteocalcin but
antagonizes the biological effects of naturally occurring
undercarboxylated/uncarboxylated osteocalcin. Such negative
mimetics may include, for instance, polypeptide- and
polynucleotide-like polymers having modified backbones, side
chains, and/or bases.
Diagnostics
[0333] The present invention provides methods and compositions for
diagnosing disorders related to reproduction in male mammals based
on decreased levels of undercarboxylated/uncarboxylated
osteocalcin. Such disorders include, but are not limited to, male
infertility, low sperm count, impaired sperm motility, impaired
sperm viability, low testosterone levels, reduced libido, erectile
dysfunction, underdevelopment of testes, and excess apoptosis in
testes.
[0334] In a specific embodiment of the invention, a method is
provided for diagnosing a patient having or at risk of developing a
disorder selected from the group consisting of male infertility,
low sperm count, impaired sperm motility, impaired sperm viability,
low testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, and excess apoptosis in testes,
comprising: (i) determining a patient level of
undercarboxylated/uncarboxylated osteocalcin in a biological sample
taken from the patient and a control level of
undercarboxylated/uncarboxylated osteocalcin in a biological sample
taken from a subject that does not have the disorder, (ii)
comparing the patient and control levels, and (iii) diagnosing the
patient as having or as being at risk of developing the disorder if
the patient level is lower than the control level.
[0335] "Biological samples" include solid and fluid body samples.
The biological samples of the present invention may include tissue,
organs, cells, protein or membrane extracts of cells, blood or
biological fluids such as blood, serum, ascites fluid or brain
fluid (e.g., cerebrospinal fluid). Preferably, the biological
sample is blood.
[0336] In another embodiment of the invention, a method is provided
for diagnosing a patient having or at risk of developing a disorder
selected from the group consisting of male infertility, low sperm
count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, and excess apoptosis in testes,
comprising: (i) determining a patient level of
undercarboxylated/uncarboxylated osteocalcin in a biological sample
taken from the patient; and (ii) comparing the patient level to a
standard level; where, if the patient level is lower than the
standard level, diagnosing the patient as having or at risk of
developing the disorder. In instances where the method is practiced
on male humans, the standard level can be a level of
undercarboxylated/uncarboxylated osteocalcin that has been
previously determined to be the normal range for men who are not at
risk of developing the disorder. In preferred embodiments, the
biological sample is blood, serum, plasma, cerebrospinal fluid,
urine, a cell sample, or a tissue sample.
[0337] A "standard level" of undercarboxylated/uncarboxylated
osteocalcin in male humans can include values of 0.1 ng/ml to 10
ng/ml, preferably 0.2 ng/ml to 7.5 ng/ml, more preferably 0.5 ng/ml
to 5 ng/ml, and even more preferably 1 ng/ml to 5 ng/ml of
undercarboxylated/uncarboxylated osteocalcin. A standard level of
undercarboxylated/uncarboxylated osteocalcin in humans can also
include about 0.1 ng/ml, about 0.5 ng/ml, about 1 ng/ml, about 2
ng/ml, about 3 ng/ml, about 4 ng/ml, about 5 ng/ml, about 6 ng/ml,
about 7 ng/ml, or about 10 ng/ml of
undercarboxylated/uncarboxylated osteocalcin.
[0338] In another embodiment of the invention, a method is provided
for diagnosing a patient having or at risk of developing a disorder
selected from the group consisting of male infertility, low sperm
count, impaired sperm motility, impaired sperm viability, low
testosterone levels, reduced libido, erectile dysfunction,
underdevelopment of testes, and excess apoptosis in testes,
comprising: (i) determining the ratio of
undercarboxylated/uncarboxylated osteocalcin to total osteocalcin
in a biological sample taken from the patient; and (ii) comparing
the ratio to a standard ratio; where, if the patient ratio is lower
than the standard ratio, diagnosing the patient as having or being
at risk of developing the disorder. In certain embodiments, the
standard ratio is 5%-10%, 10%-15%, 15%-20%, 20%-25%, 25%-30%, or
30%-35%. In certain embodiments, the standard ratio is about 5%,
6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%,
20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%,
33%, 34%, or 35%. Preferably, the patient is a male human. In
preferred embodiments, the biological sample is blood, serum,
plasma, cerebrospinal fluid, urine, a cell sample, or a tissue
sample.
[0339] Assays for detecting the levels of protein expression, e.g.,
osteocalcin expression, are well known to those of skill in the
art. Such assays include, for example, antibody-based immunoassays.
Methods for using antibodies as disclosed herein are particularly
applicable to the cells, tissues and other biological samples from
patient with disorders relating to reproduction in male mammals
that differentially express osteocalcin, OST-PTP, PTP-1B, or
gamma-carboxylase. The methods use antibodies that selectively bind
to the protein of interest and its fragments or variants.
[0340] The amount of osteocalcin in a biological sample may be
determined by an assay such as a radioimmunoassay, an
immunoradiometric assay, and/or an enzyme immunoassay. A
"radioimmunoassay" is a technique for detecting and measuring the
concentration of an antigen using a labeled (e.g., radioactively
labeled) form of the antigen. Examples of radioactive labels for
antigens include .sup.3H, .sup.14C, and .sup.125I. The
concentration of antigen (e.g., osteocalcin) in a biological sample
may be measured by having the antigen in the sample compete with a
labeled (e.g., radioactively, fluorescently) antigen for binding to
an antibody to the antigen. To ensure competitive binding between
the labeled antigen and the unlabeled antigen, the labeled antigen
is present in a concentration sufficient to saturate the binding
sites of the antibody. The higher the concentration of antigen in
the sample, the lower the concentration of labeled antigen that
will bind to the antibody.
[0341] In a radioimmunoassay, to determine the concentration of
labeled antigen bound to antibody, the antigen-antibody complex
must be separated from the free antigen. One method for separating
the antigen-antibody complex from the free antigen is by
precipitating the antigen-antibody complex with an anti-isotype
antiserum. Another method for separating the antigen-antibody
complex from the free antigen is by precipitating the
antigen-antibody complex with formalin-killed S. aureus. Yet
another method for separating the antigen-antibody complex from the
free antigen is by performing a "solid-phase radioimmunoassay"
where the antibody is linked (e.g., covalently) to Sepharose.RTM.
beads, polystyrene wells, polyvinylchloride wells, or microtiter
wells. By comparing the concentration of labeled antigen bound to
antibody to a standard curve based on samples having a known
concentration of antigen, the concentration of antigen in the
biological sample can be determined.
[0342] An "Immunoradiometric Assay" (IRMA) is an immunoassay in
which the antibody reagent is radioactively labeled. An IRMA
requires the production of a multivalent antigen conjugate, by
techniques such as conjugation to a protein, e.g., rabbit serum
albumin (RSA). The multivalent antigen conjugate must have at least
2 antigen residues per molecule and the antigen residues must be of
sufficient distance apart to allow binding by at least two
antibodies to the antigen. For example, in an IRMA the multivalent
antigen conjugate can be attached to a solid surface such as a
plastic sphere. Unlabeled "sample" antigen and antibody to antigen
which is radioactively labeled are added to a test tube containing
the multivalent antigen conjugate coated sphere. The antigen in the
sample competes with the multivalent antigen conjugate for antigen
antibody binding sites. After an appropriate incubation period, the
unbound reactants are removed by washing and the amount of
radioactivity on the solid phase is determined. The amount of bound
radioactive antibody is inversely proportional to the concentration
of antigen in the sample.
[0343] The most common enzyme immunoassay is the "Enzyme-Linked
Immunosorbent Assay (ELISA)." The "Enzyme-Linked Immunosorbent
Assay (ELISA)" is a technique for detecting and measuring the
concentration of an antigen using a labeled (e.g., enzyme linked)
form of the antibody. In a "sandwich ELISA," an antibody (e.g., to
osteocalcin) is linked to a solid phase (e.g., a microtiter plate)
and exposed to a biological sample containing antigen (e.g.,
osteocalcin). The solid phase is then washed to remove unbound
antigen. A labeled (e.g., enzyme linked) antibody is then bound to
the bound-antigen (if present) forming an antibody-antigen-antibody
sandwich. Examples of enzymes that can be linked to the antibody
include alkaline phosphatase, horseradish peroxidase, luciferase,
urease, and .beta.-galactosidase. The enzyme linked antibody reacts
with a substrate to generate a colored reaction product that can be
assayed.
[0344] In a "competitive ELISA," antibody is incubated with a
sample containing antigen (e.g., osteocalcin). The antigen-antibody
mixture is then contacted with an antigen-coated solid phase (e.g.,
a microtiter plate). The more antigen present in the sample, the
less free antibody that will be available to bind to the solid
phase. A labeled (e.g., enzyme linked) secondary antibody is then
added to the solid phase to determine the amount of primary
antibody bound to the solid phase.
[0345] In an "immunohistochemistry assay," a section of tissue is
tested for specific proteins by exposing the tissue to antibodies
that are specific for the protein that is being assayed. The
antibodies are then visualized by any of a number of methods to
determine the presence and amount of the protein present. Examples
of methods used to visualize antibodies are, for example, through
enzymes linked to the antibodies (e.g., luciferase, alkaline
phosphatase, horseradish peroxidase, or .beta.-galactosidase), or
chemical methods (e.g., DAB/Substrate chromagen).
[0346] In addition to detecting levels of protein expression, the
diagnostic assays of the invention may employ methods designed to
detect the level of RNA expression. Levels of RNA expression may be
determined using methods well known to those of skill in the art,
including, for example, the use of northern blots, RT-PCR or in
situ hybridizations.
[0347] Carboxylation of osteocalcin confers a greater affinity for
hydroxyapatite. Total osteocalcin may be measured by immunoassay
followed by incubation with hydroxyapatite and centrifugation. The
supernatant, which contains osteocalcin that has not adsorbed to
hydroxyapatite is then measured using the same immunoassay. The
results of this procedure can be expressed either as absolute
concentrations or as a ratio of undercarboxylated to carboxylated
osteocalcin.
[0348] Another procedure uses monoclonal antibodies that
distinguish the carboxylation state of all or some of the Glu/Gla
residues of osteocalcin. For example, GluOC4-5 (TaKaRa catalog no.
M171) reacts with human osteocalcin with glutamic acid residues
(decarboxylated) at positions 21 and 24, and does not react with
react with Gla-type osteocalcin.
[0349] For a review of osteocalcin measurement methods, see Lee et
al., 2000, Ann. Clin. Biochem. 37:432-446.
Drug Screening and Assays
[0350] Cell-based and non-cell based methods of drug screening are
provided to identify candidate agents that reduce OST-PTP, PTP-1B,
or gamma-carboxylase activity or expression, and/or increase the
level of undercarboxylated/uncarboxylated osteocalcin activity or
expression. Such agents find use in treating or preventing
disorders related to reproduction in male mammals. Such agents may
also be used to treat disorders characterized by decreased
testosterone production.
[0351] Non-cell based screening methods are provided to identify
compounds that bind to OST-PTP, PTP-1B, gamma-carboxylase or
osteocalcin and thereby modulate the activity of these
proteins.
[0352] Such non-cell based methods include a method to identify, or
assay for, an agent that binds to OST-PTP, the method comprising
the steps of: (i) providing a mixture comprising OST-PTP or a
fragment or variant thereof, (ii) contacting the mixture with a
candidate agent, (iii) determining whether the candidate agent
binds to the OST-PTP, wherein if the agent binds to the OST-PTP or
a fragment or variant thereof (iv) determining whether the agent
reduces the ability of OST-PTP to dephosphorylate gamma-carboxylase
and (v) administering the agent to a patient in need of treatment
for a disorder related to reproduction in male mammals. In certain
embodiments, the mixture comprises membrane fragments comprising
OST-PTP or a fragment or variant thereof.
[0353] A screening method is provided to identify or assay for an
agent that binds to the phosphatase 1 domain of OST-PTP, the method
comprising the steps of: (i) providing a mixture comprising the
phosphatase 1 domain of OST-PTP or a fragment or variant thereof,
(ii) contacting the mixture with an agent, (iii) determining
whether the agent binds to the phosphatase 1 domain of OST-PTP,
wherein if the agent binds to the phosphatase 1 domain of OST-PTP
or a fragment or variant thereof (iv) determining whether the agent
inhibits the phosphatase 1 domain of OST-PTP and, if the agent
inhibits the phosphatase 1 domain of OST-PTP (v) administering the
agent to a patient in need of treatment for a disorder related to
reproduction in male mammals.
[0354] A screening method is provided to identify or assay for an
agent that binds to PTP-1B, the method comprising the steps of: (i)
providing a mixture comprising PTP-1B or a fragment or variant
thereof, (ii) contacting the mixture with a candidate agent, (iii)
determining whether the candidate agent binds to the PTP-1B,
wherein if the agent binds to the PTP-1B or a fragment or variant
thereof (iv) determining whether the agent reduces the ability of
PTP-1B to dephosphorylate gamma-carboxylase and (v) administering
the agent to a patient in need of treatment for a disorder related
to reproduction in male mammals. In certain embodiments, the
mixture comprises membrane fragments comprising PTP-1B or a
fragment or variant thereof.
[0355] A screening method is provided to identify, or assay for, an
agent that binds to gamma-carboxylase, the method comprising the
steps of: (i) providing a mixture comprising the gamma-carboxylase
or a fragment or variant thereof, (ii) contacting the mixture with
an agent, (iii) determining whether the agent binds to the
gamma-carboxylase, wherein if the agent binds to the
gamma-carboxylase or a fragment or variant thereof (iv)
administering the agent to a patient in need of treatment for a
disorder related to reproduction in male mammals. The method may
further comprise the step of determining whether the agent reduces
gamma-carboxylase activity.
[0356] The binding of the agent to the target molecule in the
above-described assays may be determined through the use of
competitive binding assays. The competitor is a binding moiety
known to bind to the target molecule. Under certain circumstances,
there may be competitive binding as between the agent and the
binding moiety, with the binding moiety displacing the agent or the
agent displacing the binding moiety.
[0357] Either the agent or the competitor may be labeled. Either
the agent, or the competitor is added first to the protein for a
time sufficient to allow binding. Incubations may be performed at
any temperature which facilitates optimal binding, typically
between 4.degree. C. and 40.degree. C. Incubation periods may also
be chosen for optimum binding, but may also optimized to facilitate
rapid high throughput screening. Typically, between 0.1 and 1 hour
will be sufficient. Excess agent and competitor are generally
removed or washed away.
[0358] Using such assays, the competitor may be added first,
followed by the agent. Displacement of the competitor is an
indication that the agent is binding to the target molecule and
thus is capable of binding to, and potentially modulating, the
activity of the target molecule. In this embodiment, either
component can be labeled. Thus, for example, if the competitor is
labeled, the presence of label in the wash solution indicates
displacement by the agent.
[0359] In another example, the agent is added first, with
incubation and washing, followed by the competitor. The absence of
binding by the competitor may indicate that the agent is bound to
the target molecule with a higher affinity than the competitor.
Thus, if the agent is labeled, the presence of the label on the
target molecule, coupled with a lack of competitor binding, may
indicate that the agent is capable of binding to the target
molecule.
[0360] The method may comprise differential screening to identify
agents that are capable of modulating the activity of the target
molecule. In such an instance, the methods comprise combining the
target molecule and a competitor in a first sample. A second sample
comprises an agent, the target molecule, and a competitor. Addition
of the agent is performed under conditions which allow the
modulation of the activity of the target molecule. The binding of
the competitor is determined for both samples, and a change, or
difference in binding between the two samples indicates the
presence of an agent capable of binding to the target molecule and
potentially modulating its activity. That is, if the binding of the
competitor is different in the second sample relative to the first
sample, the agent is capable of binding to the target molecule.
[0361] Positive controls and negative controls may be used in the
assays. Preferably, all control and test samples are performed in
at least triplicate to obtain statistically significant results.
Incubation of all samples is for a time sufficient for the binding
of the agent to the target molecule. Following incubation, all
samples are washed free of non-specifically bound material and the
amount of bound, generally labeled agent determined. For example,
where a radiolabel is employed, the samples may be counted in a
scintillation counter to determine the amount of bound agent.
[0362] A variety of other reagents may be included in the screening
assays. These include reagents like salts, neutral proteins, e.g.
albumin, detergents, etc. which may be used to facilitate optimal
protein-protein binding and/or reduce non-specific or background
interactions. Also, reagents that otherwise improve the efficiency
of the assay, such as protease inhibitors, nuclease inhibitors,
anti-microbial agents, etc., may be used. The mixture of components
may be added in any order that provides for the requisite
binding.
[0363] Thus, in one example, the methods comprise combining a
sample comprising OST-PTP, PTP-1B, or gamma-carboxylase and an
agent, and evaluating the effect on OST-PTP, PTP-1B, or
gamma-carboxylase enzyme activity. By enzyme activity, specifically
OST-PTP, PTP-1B, or gamma-carboxylase enzyme activity, is meant one
or more of the biological activities associated with the enzyme.
For OST-PTP and PTP-1B, this activity is preferably the
dephosphorylation of gamma-carboxylase; for gamma-carboxylase, it
is the carboxylation of osteocalcin. The screening assays are
designed to find agents that reduce OST-PTP, PTP-1B, or
gamma-carboxylase activity, and/or increase levels of
undercarboxylated/uncarboxylated osteocalcin.
[0364] Specifically, a screening method is provided to identify an
agent that reduces OST-PTP activity, the method comprising the
steps of: (a) providing a control mixture comprising OST-PTP or a
fragment or variant thereof and a test mixture comprising OST-PTP
or a fragment or variant thereof, (b) contacting the test mixture
with an agent, (c) determining the level of activity of OST-PTP in
the test mixture and in the control mixture, (d) identifying the
agent as an agent that reduces OST-PTP activity if the level of
OST-PTP activity in the test mixture is lower than the level of
OST-PTP activity in the control mixture, and (e) administering the
identified agent to a patient in need of treatment for a disorder
related to reproduction in male mammals.
[0365] A screening method is provided to identify an agent that
reduces PTP-1B activity, the method comprising the steps of: (a)
providing a control mixture comprising PTP-1B or a fragment or
variant thereof and a test mixture comprising PTP-1B or a fragment
or variant thereof, (b) contacting the test mixture with an agent,
(c) determining the level of activity of PTP-1B in the test mixture
and in the control mixture, (d) identifying the agent as an agent
that reduces PTP-1B activity if the level of PTP-1B activity in the
test mixture is lower than the level of PTP-1B activity in the
control mixture, and (e) administering the identified agent to a
patient in need of treatment for a disorder related to reproduction
in male mammals.
[0366] A screening method is provided to identify an agent that
reduces gamma-carboxylase activity, the method comprising the steps
of: (a) providing a control mixture comprising gamma-carboxylase or
a fragment or variant thereof and a test mixture comprising
gamma-carboxylase or a fragment or variant thereof, (b) contacting
the test mixture with an agent, (c) determining the level of
activity of gamma-carboxylase in the test mixture and in the
control mixture, (d) identifying the agent as an agent that reduces
gamma-carboxylase activity if the level of gamma-carboxylase
activity in the test mixture is lower than the level of
gamma-carboxylase activity in the control mixture, and (e)
administering the identified agent to a patient in need of
treatment for a disorder related to reproduction in male
mammals.
[0367] The present invention also provides a screening method to
identify an agent that decarboxylates osteocalcin, the method
comprising the steps of: (a) providing a control mixture comprising
carboxylated osteocalcin and a test mixture comprising carboxylated
osteocalcin, (b) adding to the test mixture an agent, (c)
determining the level of carboxylated osteocalcin in the test
mixture and in the control mixture, (d) identifying the agent as an
agent that decarboxylates osteocalcin if the level of carboxylated
osteocalcin in the test mixture is lower than the level of
carboxylated osteocalcin in the control mixture, and (e)
administering the identified agent to a patient in need of
treatment for a disorder related to reproduction in male
mammals.
[0368] A cell-based method is provided for identifying an agent
that increases osteocalcin gene expression, the method comprising
steps: (a) determining a first expression level of osteocalcin in a
cell, (b) determining a second expression level of osteocalcin
after contact with a test agent; and (c) comparing the first
expression level with the second expression level, wherein if the
first expression level is lower than the second expression level
the agent is identified as an agent that increases osteocalcin gene
expression, and (e) administering the identified agent to a patient
in need of treatment for a disorder related to reproduction in male
mammals. The level of osteocalcin gene expression may be determined
by measuring the amount of osteocalcin mRNA made or the amount of
osteocalcin protein made. In certain embodiments, the cell is an
osteoblast.
[0369] The present invention also provides screening methods to
identify agents that activate GPRC6A and are suitable for use in
the prevention and treatment of a reproductive disorder in male
mammals. In certain embodiments, the method comprises:
[0370] (a) providing a cell that expresses GPRC6A;
[0371] (b) exposing the cell to a candidate substance; and
[0372] (c) determining if the candidate substance binds to and/or
activates the GPRC6A expressed by the cell.
[0373] Optionally, the method also comprises: (d) determining if
the candidate substance is suitable for use in the prevention and
treatment of a reproductive disorder in male mammals.
[0374] In certain embodiments, step (a) comprises providing Leydig
cells, testis explants, or cells that recombinantly express GPRC6A.
In certain embodiments, the cells that recombinantly express GPRC6A
are NIH 3T3 cells, HEK 293 cells, BHK cells, COS cells, CHO cells,
Xenopus oocytes, or insect cells. In certain embodiments, the
GPRC6A is human GPRC6A. In certain embodiments, the GPRC6A is
encoded by the nucleotide sequence shown in SEQ ID NO: 30. In
certain embodiments, the GPRC6A comprises the amino acid sequence
shown in SEQ ID NO: 31.
[0375] In certain embodiments, the candidate substance is from a
library of candidate substances. In certain embodiments, the entire
library of substances is exposed to the cell. In certain
embodiments, a portion of the library is exposed to the cell.
[0376] In certain embodiments, step (b) is carried out by growing
the cell in tissue culture and adding the candidate substance to
the medium in which the cell is growing or has been grown.
Alternatively, the medium in which the cell is growing or has been
grown may be removed and fresh medium containing the candidate
substance may be added the tissue culture plate or well in which
the cell is growing or has been grown.
[0377] In certain embodiments, step (c) comprises determining if
the candidate substance competes with labeled uncarboxlated
osteocalcin for binding to the GPRC6A. In certain embodiments, step
(c) comprises labeling the candidate substance and determining if
the labeled candidate substance binds to the GPRC6A expressed by
the cell.
[0378] In certain embodiments, step (c) comprises determining if
the candidate substance produces a physiological response in the
cell selected from the group consisting of: an increase in the
concentration of cAMP in the cell. an increase in testosterone
synthesis in the cell, an increase in the expression of StAR in the
cell, an increase in the expression of Cyp11a in the cell, an
increase in the expression of Cyp17 in the cell, an increase in the
expression of 3.beta.-HSD in the cell, an increase in the
expression of Grth in the cell, an increase in the expression of
tACE in the cell, an increase in CREB phosphorylation in the cell,
and a decrease in the amount cleaved Caspase 3 in the cell. The
physiological response may also be a combination of any of the
foregoing physiological responses. In certain embodiments, the
physiological response is an increase in the concentration of cAMP
in the cell together with a lack of an increase in tyrosine
phosphorylation, ERK activation, and intracellular calcium
accumulation. In embodiments where a physiological response is
determined, it may be advantageous to use a cell that does not
naturally express GPRC6A but that has been engineered to
recombinantly expresses GPRC6A. In such cases, the cell prior to
transformation to a state that recombinantly expresses GPRC6A can
serve as a negative control. In such case, the candidate substance
should evoke the physiological response in the cell that
recombinantly expresses GPRC6A but not in the negative control
cell.
[0379] In certain embodiments, step (c) comprises determining if
the candidate substance affects the binding of a G protein to the
GPRC6A. Here, too, it may be advantageous to use cells that
recombinantly express GPRC6A and to use those same cells before
transformation as negative controls. In certain embodiments, the
cell is co-transfected with a construct encoding GPRC6A and a
construct encoding a G, protein. See, e.g., Christiansen et al.,
2007, Br. J. Pharmacol. 150:798-807 and Pi et al., 2005, J. Biol.
Chem. 280:40201-40209.
[0380] In certain embodiments, step (d) comprises administering the
candidate substance to a male mammal and determining that the
candidate substance produces an effect in the male mammal selected
from the group consisting of increased fertility, raised sperm
count, increased sperm motility, increased sperm viability,
increased serum testosterone levels, increased libido, amelioration
of erectile dysfunction, reduction of the underdevelopment of
testes, and reduction of excess apoptosis in testes.
[0381] The present invention also provides screening methods to
identify agents that activate GPRC6A and are suitable for use in
the prevention and treatment of a reproductive disorder in male
mammals where the methods comprise:
[0382] (a) providing cell membranes containing GPRC6A protein;
[0383] (b) exposing the cell membranes to a candidate
substance;
[0384] (c) determining if the candidate substance binds to the
GPRC6A in the cell membranes; and
[0385] (d) determining if the candidate substance is suitable for
use in the prevention and treatment of a reproductive disorder in
male mammals.
[0386] In certain embodiments, step (a) comprises providing cell
membranes from Leydig cells, testis explants, or cells that
recombinantly express GPRC6A. In certain embodiments, the cells
that recombinantly express GPRC6A are NIH 3T3 cells, HEK 293 cells,
BHK cells, COS cells, CHO cells, Xenopus oocytes, or insect cells.
In certain embodiments, the GPRC6A is human GPRC6A. In certain
embodiments, the GPRC6A is encoded by the nucleotide sequence shown
in SEQ ID NO: 30. In certain embodiments, the GPRC6A comprises the
amino acid sequence shown in SEQ ID NO: 31
[0387] In certain embodiments, the candidate substance is from a
library of candidate substances. In certain embodiments, the entire
library of substances is exposed to the cell membranes. In certain
embodiments, a portion of the library is exposed to the cell
membranes.
[0388] In certain embodiments, step (c) comprises determining if
the candidate substance competes with labeled uncarboxlated
osteocalcin for binding to the GPRC6A. In certain embodiments, step
(c) comprises labeling the candidate substance and determining if
the labeled candidate substance binds to the GPRC6A in the cell
membranes.
[0389] In certain embodiments, step (d) comprises administering the
candidate substance to a male mammal and determining that the
candidate substance produces an effect in the male mammal selected
from the group consisting of increased fertility, raised sperm
count, increased sperm motility, increased sperm viability,
increased serum testosterone levels, increased libido, amelioration
of erectile dysfunction, reduction of the underdevelopment of
testes, and reduction of excess apoptosis in testes.
[0390] In certain embodiments of the methods disclosed above,
GPRC6A is the protein disclosed at GenBank accession no. AF502962.
The nucleotide and amino acid sequences disclosed at GenBank
accession no. AF502962 are shown in FIGS. 23 and 24 herein,
respectively.
[0391] In certain embodiments of the methods disclosed above,
GPRC6A is a protein homologous to the protein disclosed at GenBank
accession no. AF502962. In certain embodiments of the methods
disclosed above, GPRC6A is a protein having about 80-99%, about
85-97%, or about 90-95% amino acid sequence identity to the protein
disclosed at GenBank accession no. AF502962.
[0392] In certain embodiments of the methods disclosed above,
GPRC6A is the protein disclosed Wellendorph & Brauner-Osborne,
2004, Gene 335:37-46.
[0393] In certain embodiments of the present invention, the agents
identified by the methods of screening against GPRC6A are
administered to a male mammal in need of treatment for a disorder
related to reproduction. Accordingly, the present invention
includes a method of treating disorders related to reproduction in
male mammals comprising administering to a male mammal in need of
treatment for a disorder related to reproduction a pharmaceutical
composition comprising a therapeutically effective amount of an
agent that activates GPRC6A and a pharmaceutically acceptable
carrier or excipient.
[0394] In certain embodiments, the an agent that activates GPRC6A
is identified by a method comprising:
[0395] (a) providing a cell that expresses GPRC6A;
[0396] (b) exposing the cell to a candidate substance; and
[0397] (c) determining if the candidate substance binds to and/or
activates the GPRC6A expressed by the cell.
[0398] Agents that activate GPCR6A include ornithine, lysine, and
arginine (Christiansen et al., 2007, Br. J. Pharmacol.
150:798-807).
[0399] Gamma carboxylase catalyzes the posttranslational
modification of specific glutamic acid residues within osteocalcin
to form .gamma.-carboxyglutamic acid residues. In an embodiment of
the assays described herein, the level of gamma carboxylase
activity or decarboxylase activity is determined by measuring the
level of osteocalcin carboxylation.
[0400] Cells to be used in the screening or assaying methods
described herein include cells that naturally express OST-PTP, the
phosphatase 1 domain of OST-PTP, PTP-1B, gamma-carboxylase, or
osteocalcin as well as cells that have been genetically engineered
to express (or overexpress) OST-PTP, the phosphatase 1 domain of
OST-PTP, PTP-1B gamma-carboxylase, or osteocalcin. Such cells
include transformed osteoblasts that overexpress OST-PTP, the
phosphatase 1 domain of OST-PTP, PTP-1B, or gamma-carboxylase.
[0401] A method is provided for identifying an agent useful for
treating or preventing a disorder related to reproduction in male
mammals comprising: (a) providing an animal that has a disorder
related to reproduction in male mammals, (b) determining the amount
of undercarboxylated/uncarboxylated osteocalcin in a
pre-administration biological sample taken from the animal, (c)
administering an agent to the animal, (d) determining the amount of
undercarboxylated/uncarboxylated osteocalcin in a
post-administration biological sample taken from the animal, and
(e) identifying the agent as useful for treating or preventing the
disorder related to reproduction in male mammals if the amount of
undercarboxylated/uncarboxylated osteocalcin in the
post-administration biological sample is higher than the amount of
undercarboxylated/uncarboxylated osteocalcin in the
pre-administration biological sample.
[0402] The term "agent" as used herein includes any molecule, e.g.,
protein, oligopeptide, small organic molecule, polysaccharide,
polynucleotide, lipid, etc., or mixtures thereof. Some of the
agents can be used therapeutically. An agent may be OST-PTP,
PTP-1B, gamma-carboxylase, osteocalcin, or fragments thereof.
[0403] Generally, in the assays described herein, a plurality of
assay mixtures is run in parallel with different agent
concentrations to obtain a differential response to the various
concentrations. Typically, one of these concentrations serves as a
negative control, i.e., is at zero concentration or below the level
of detection.
[0404] Agents for use in screening encompass numerous chemical
classes, though typically they are organic molecules, preferably
small organic compounds having a molecular weight of more than 100
and less than about 2,500 daltons, preferably less than about 500
daltons. Agents comprise functional groups necessary for structural
interaction with proteins, particularly hydrogen bonding, and
typically include at least an amine, carbonyl, hydroxyl or carboxyl
group, preferably at least two of these functional chemical groups.
The agents often comprise cyclical carbon or heterocyclic
structures and/or aromatic or polyaromatic structures substituted
with one or more of the above functional groups. Agents are also
found among biomolecules including peptides, saccharides, fatty
acids, steroids, purines, pyrimidines, derivatives, structural
analogs or combinations thereof. Particularly preferred
biomolecules are peptides.
[0405] Libraries of high-purity small organic ligands and peptides
that have well-documented pharmacological activities are available
from numerous sources for use in the assays herein. One example is
an NCI diversity set which contains 1,866 drug-like compounds
(small, intermediate hydrophobicity). Another is an Institute of
Chemistry and Cell Biology (ICCB; maintained by Harvard Medical
School) set of known bioactives (467 compounds) which includes many
extended, flexible compounds. Some other examples of the ICCB
libraries are: Chem Bridge DiverSet E (16,320 compounds); Bionet 1
(4,800 compounds); CEREP (4,800 compounds); Maybridge 1 (8,800
compounds); Maybridge 2 (704 compounds); Maybridge HitFinder
(14,379 compounds); Peakdale 1 (2,816 compounds); Peakdale 2 (352
compounds); ChemDiv Combilab and International (28,864 compounds);
Mixed Commercial Plate 1 (352 compounds); Mixed Commercial Plate 2
(320 compounds); Mixed Commercial Plate 3 (251 compounds); Mixed
Commercial Plate 4 (331 compounds); ChemBridge Microformat (50,000
compounds); Commercial Diversity Set1 (5,056 compounds). Other NCI
Collections are: Structural Diversity Set, version 2 (1,900
compounds); Mechanistic Diversity Set (879 compounds); Open
Collection 1 (90,000 compounds); Open Collection 2 (10,240
compounds); Known Bioactives Collections: NINDS Custom Collection
(1,040 compounds); ICCB Bioactives 1 (489 compounds); SpecPlus
Collection (960 compounds); ICCB Discretes Collections. The
following ICCB compounds were collected individually from chemists
at the ICCB, Harvard, and other collaborating institutions: ICCB1
(190 compounds); ICCB2 (352 compounds); ICCB3 (352 compounds);
ICCB4 (352 compounds). Natural Product Extracts: NCI Marine
Extracts (352 wells); Organic fractions--NCI Plant and Fungal
Extracts (1,408 wells); Philippines Plant Extracts 1 (200 wells);
ICCB-ICG Diversity Oriented Synthesis (DOS) Collections; DDS1 (DOS
Diversity Set) (9600 wells). Compound libraries are also available
from commercial suppliers, such as ActiMol, Albany Molecular,
Bachem, Sigma-Aldrich, TimTec, and others.
[0406] Known and novel pharmacological agents identified in screens
may be further subjected to directed or random chemical
modifications, such as acylation, alkylation, esterification, or
amidification to produce structural analogs.
[0407] When screening, designing, or modifying compounds, other
factors to consider include the Lipinski rule-of-five (not more
than 5 hydrogen bond donors (OH and NH groups); not more than 10
hydrogen bond acceptors (notably N and O); molecular weight under
500 g/mol; partition coefficient log P less than 5), and Veber
criteria, which are recognized in the pharmaceutical art and relate
to properties and structural features that make molecules more or
less drug-like.
[0408] The agent may be a protein. By "protein" in this context is
meant at least two covalently attached amino acids, and includes
proteins, polypeptides, oligopeptides and peptides. The protein may
be made up of naturally occurring amino acids and peptide bonds, or
synthetic peptidomimetic structures. Thus "amino acid," or "peptide
residue," as used herein means both naturally occurring and
synthetic amino acids. For example, homo-phenylalanine, citrulline
and norleucine are considered amino acids for the purposes of the
invention. "Amino acids" also includes imino acid residues such as
proline and hydroxyproline. The side chains may be in either the
(R) or the (S) configuration. In the preferred embodiment, the
amino acids are in the (S) or L-configuration. If non-naturally
occurring side chains are used, non-amino acid substituents may be
used, for example to prevent or retard in vivo degradations.
[0409] The agent may be a naturally occurring protein or fragment
or variant of a naturally occurring protein. Thus, for example,
cellular extracts containing proteins, or random or directed
digests of proteinaceous cellular extracts, may be used. In this
way, libraries of prokaryotic and eukaryotic proteins may be made
for screening against one of the various proteins. Libraries of
bacterial, fungal, viral, and mammalian proteins, with the latter
being preferred, and human proteins being especially preferred, may
be used.
[0410] Agents may be peptides of from about 5 to about 30 amino
acids, with from about 5 to about 20 amino acids being preferred,
and from about 7 to about 15 being particularly preferred. The
peptides may be digests of naturally occurring proteins as is
outlined above, random peptides, or "biased" random peptides. By
"random" or grammatical equivalents herein is meant that each
nucleic acid and peptide consists of essentially random nucleotides
and amino acids, respectively. Since generally these random
peptides (or nucleic acids, discussed below) are chemically
synthesized, they may incorporate any nucleotide or amino acid at
any position. The synthetic process can be designed to generate
randomized proteins or nucleic acids, to allow the formation of all
or most of the possible combinations over the length of the
sequence, thus forming a library of randomized agent bioactive
proteinaceous agents.
[0411] The library may be fully randomized, with no sequence
preferences or constants at any position. Alternatively, the
library may be biased. That is, some positions within the sequence
are either held constant, or are selected from a limited number of
possibilities. For example, the nucleotides or amino acid residues
are randomized within a defined class, for example, of hydrophobic
amino acids, hydrophilic residues, sterically biased (either small
or large) residues, towards the creation of cysteines, for
cross-linking, prolines for SH3 domains, serines, threonines,
tyrosines or histidines for phosphorylation sites, etc., or to
purines, etc.
[0412] The agent may be an isolated nucleic acid, preferably
antisense, siRNA, or cDNA that binds to either the gene encoding
the protein of interest, or its mRNA, to block gene expression or
mRNA translation, respectively. By "nucleic acid" or
"oligonucleotide" or grammatical equivalents herein means at least
two nucleotides covalently linked together. Such nucleic acids will
generally contain phosphodiester bonds, although in some cases, as
outlined below, nucleic acid analogs are included that may have
alternate backbones, comprising, for example, phosphoramide
(Beaucage et al., 1993, Tetrahedron 49:1925 and references therein;
Letsinger, 1970, J. Org. Chem. 35:3800; Sprinzl et al., 1977, Eur.
J. Biochem. 81:579; Letsinger et al., 1986, Nucl. Acids Res.
14:3487; Sawai et al, 1984, Chem. Lett. 805; Letsinger et al.,
1988, J. Am. Chem. Soc. 110:4470; and Pauwels et al., 1986, Chemica
Scripta 26:141); phosphorothioate (Mag et al., 1991, Nucleic Acids
Res. 19:1437; and U.S. Pat. No. 5,644,048), phosphorodithioate
(Briu et al., 1989, J. Am. Chem. Soc. 111:2321);
O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides
and Analogues: A Practical Approach, Oxford University Press), and
peptide nucleic acid backbones and linkages (see Egholm, 1992, J.
Am. Chem. Soc. 114:1895; Meier et al., 1992, Chem. Int. Ed. Engl.
31:1008; Nielsen, 1993, Nature, 365:566; Carlsson et al., 1996,
Nature 380:207); all of which publications are incorporated by
reference and may be consulted by those skilled in the art for
guidance in designing nucleic acid agents for use in the methods
described herein.
[0413] Other analog nucleic acids include those with positive
backbones (Denpcy et al., 1995, Proc. Natl. Acad. Sci. USA
92:6097); non-ionic backbones (U.S. Pat. Nos. 5,386,023; 5,637,684;
5,602,240; 5,216,141; and 4,469,863; Kiedrowshi et al., 1991,
Angew. Chem. Intl. Ed. English 30:423; Letsinger et al., 1988, J.
Am. Chem. Soc. 110:4470; Letsinger et al., 1994, Nucleoside &
Nucleoside 13:1597; Chapters 2 and 3, ASC Symposium Series 580,
"Carbohydrate Modifications in Antisense Research," Ed. Y. S.
Sanghui and P. Dan Cook; Mesmaeker et al., 1994, Bioorganic &
Medicinal Chem. Lett. 4:395; Jeffs et al., 1994, J. Biomolecular
NMR 34:17); and non-ribose backbones, including those described in
U.S. Pat. Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC
Symposium Series 580, "Carbohydrate Modifications in antisense
Research," Ed. Y. S. Sanghui and P. Dan Cook. Nucleic acids
containing one or more carbocyclic sugars are also included within
the definition of nucleic acids that may be used as agents as
described herein. Several nucleic acid analogs are described in
Rawls, C & E News Jun. 2, 1997 page 35. All of these references
are hereby expressly incorporated by reference. These modifications
of the ribose-phosphate backbone may be done to facilitate the
addition of additional moieties such as labels, or to increase the
stability and half-life of such molecules in physiological
environments. In addition, mixtures of naturally occurring acids
and analogs can be made. Alternatively, mixtures of different
nucleic acid analogs, and mixtures of naturally occurring nucleic
acids and analogs may be made. The nucleic acids may be single
stranded or double stranded, or contain portions of both double
stranded or single stranded sequence. The nucleic acid may be DNA,
both genomic and cDNA, RNA or a hybrid, where the nucleic acid
contains any combination of deoxyribo- and ribo-nucleotides, and
any combination of bases, including uracil, adenine, thymine,
cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine,
isoguanine, etc.
[0414] As described above generally for proteins, nucleic acid
agents may be naturally occurring nucleic acids, random nucleic
acids, or "biased" random nucleic acids. For example, digests of
prokaryotic or eukaryotic genomes may be used as outlined above for
proteins.
[0415] The agents may be obtained from combinatorial chemical
libraries, a wide variety of which are available in the literature.
By "combinatorial chemical library" herein is meant a collection of
diverse chemical compounds generated in a defined or random manner,
generally by chemical synthesis. Millions of chemical compounds can
be synthesized through combinatorial mixing.
[0416] The determination of the binding of the agent to one of the
various proteins such as OST-PTP, PTP-1B, or gamma-carboxylase may
be done in a number of ways. In a preferred embodiment, the agent
is labeled, and binding determined directly. For example, this may
be done by attaching all or a portion of one of the various
proteins to a solid support, adding a labeled agent (for example an
agent comprising a radioactive or fluorescent label), washing off
excess reagent, and determining whether the label is present on the
solid support. Various blocking and washing steps may be utilized
as is known in the art.
[0417] By "labeled" herein is meant that the agent is either
directly or indirectly labeled with a label which provides a
detectable signal, e.g. a radioisotope (such as .sup.3H, .sup.14C,
.sup.32P, .sup.33P, .sup.35S, or .sup.125I), a fluorescent or
chemiluminescent compound (such as fluorescein isothiocyanate,
rhodamine, or luciferin), an enzyme (such as alkaline phosphatase,
beta-galactosidase or horseradish peroxidase), antibodies,
particles such as magnetic particles, or specific binding
molecules, etc. Specific binding molecules include pairs, such as
biotin and streptavidin, digoxin and antidigoxin, etc. For the
specific binding members, the complementary member would normally
be labeled with a molecule which provides for detection, in
accordance with known procedures, as outlined above. The label can
directly or indirectly provide a detectable signal. Only one of the
components may be labeled. Alternatively, more than one component
may be labeled with different labels.
[0418] Transgenic mice, including knock in and knock out mice, and
isolated cells from them (especially osteoblasts) that over or
under express the nucleic acids disclosed herein (e.g., cDNA for
Esp, PTP-1B, osteocalcin, gamma-carboxylase) can be made using
routine methods known in the art. In certain instances, nucleic
acids are inserted into the genome of the host organism operably
connected to and under the control of a promoter and regulatory
elements (endogenous or heterogeneous) that will cause the organism
to over express the nucleic acid gene or mRNA. One example of an
exogenous/heterogeneous promoter included in the transfecting
vector carrying the gene to be amplified is alpha 1(I) collagen.
Many such promoters are known in the art.
[0419] Human osteoblasts can be transfected with vectors carrying
the cDNA for human Esp, human PTP-1B, or human osteocalcin (or
fragments or variants thereof) operably linked to known promoters
and regulatory elements that cause the transfected human osteoblast
to overexpress osteocalcin (or fragments or variants thereof).
[0420] Disclosed herein are transgenic mice and mouse cells, and
transfected human cells overexpressing osteocalcin (or fragments or
variants thereof), OST-PTP, PTP-1B, or gamma-carboxylase. Also
disclosed herein are double mutant mice that have deletions of one
or both alleles for osteocalcin, Esp, and gamma-carboxylase, and
various combinations of double mutants.
[0421] Also disclosed herein are vectors carrying the cDNA or mRNA
encoding the proteins for insertion into the genome of a target
animal or cell. Such vectors can optionally include promoters and
regulatory elements operably linked to the cDNA or mRNA. By
"operably linked" is meant that promoters and regulatory elements
are connected to the cDNA or mRNA in such a way as to permit
expression of the cDNA or mRNA under the control of the promoters
and regulatory elements.
[0422] Antisense and small interfering RNAs for use in reducing
expression of OST-PTP, PTP-1B, and/or gamma-carboxylase, thereby
treating or preventing a disorder related to reproduction in a male
mammal can be made that specifically hybridize to the gene and/or
mRNA encoding OST-PTP, PTP-1B, or gamma-carboxylase, respectively.
The sequence for mouse (OST-PTP, Ptprv) cDNA is set forth in SEQ ID
NO:10. The amino acid sequence for OST-PTP, Ptprv) protein is set
forth in SEQ ID NO:11. This cDNA, or antisense and small
interfering RNAs based on this cDNA, will hybridize with mRNA for
OST-PTP and thereby interfere with its translation. Reducing
OST-PTP expression will increase the level of
undercarboxylated/uncarboxylated osteocalcin, thereby providing a
therapeutic benefit with respect to disorders related to
reproduction in male mammals. The sequence for human PTP-1B cDNA is
set forth in SEQ ID NO:16. The amino acid sequence for human PTP-1B
protein is set forth in SEQ ID NO:17. This cDNA, or antisense and
small interfering RNAs based on this cDNA, will hybridize with mRNA
for human PTP-1B and thereby interfere with its translation.
Reducing human PTP-1B expression will increase the level of
undercarboxylated/uncarboxylated osteocalcin, thereby providing a
therapeutic benefit with respect to disorders related to
reproduction in male mammals. The cDNA for mouse gamma-carboxylase
is identified by SEQ ID NO:8, and its amino acid sequence is SEQ ID
NO:9. This cDNA, or antisense and small interfering RNAs based on
this cDNA, will hybridize with mRNA for gamma-carboxylase and
thereby interfere with its translation and is a preferred
embodiment. The cDNA for human gamma-carboxylase is identified by
SEQ ID NO:6, and the amino acid sequence is SEQ ID NO:7. Human
gamma-carboxylase cDNA can be used therapeutically to reduce
gamma-carboxylase expression to treat or prevent a disorder related
to reproduction in male humans.
[0423] The invention is illustrated herein by the following
examples, which should not be construed as limiting. The contents
of all references, pending patent applications and published
patents, cited throughout this application are hereby expressly
incorporated by reference. Those skilled in the art will understand
that this invention may be embodied in many different forms and
should not be construed as limited to the embodiments set forth
herein. Rather, these embodiments are provided so that this
disclosure will fully convey the invention to those skilled in the
art. Many modifications and other embodiments of the invention will
come to mind in one skilled in the art to which this invention
pertains having the benefit of the teachings presented in the
foregoing description. Although specific terms are employed, they
are used as in the art unless otherwise indicated.
EXAMPLES
Example 1
Male Osteocalcin-Deficient Mice have Decreased Fertility
[0424] Male mice in which both alleles of osteocalcin were
disrupted and non-functional (Osteocalcin-/- mice) that were
crossed with wild-type (WT) littermates show impaired fertility.
Whether the Osteocalcin- mutation was on the C57B1/6J or on the
129sv/ev genetic background, very few litters were obtained over
the course of 3 months. Moreover, the litters were of significantly
smaller size than those obtained when crossing WT male mice with WT
female mice. When 8 Osteocalcin-/- male mice were placed with 2 WT
female mice each from 6 to 12 weeks of age, only 17 pups were
obtained and the litter size was 4.25 pups per litter. In contrast,
when 8 WT male mice were placed with 2 WT female mice each for the
same period of time, 63 pups were obtained and the litter size was
also significantly larger (7.93 pups per litter) (FIG. 1).
Furthermore, it was observed that after 6 months of age, and unlike
what is the case for WT mice, male Osteocalcin -/- mice were
totally infertile. This reproduction phenotype was not observed in
Osteocalcin +/- mice (mice having a single allele of osteocalcin
disrupted).
Example 2
Male Mice have Abnormal Spermatogenesis in the Absence of
Osteocalcin
[0425] Testis weight was measured at different ages in male
Osteocalcin-deficient mice. As early as at 6 weeks of age, male
Osteocalcin -/- mice had significantly smaller testes than their WT
littermates and this phenotype progressively worsened over time
(FIG. 2A). Sperm count in the seminal fluid of Osteocalcin-/- and
WT littermate male mice was also measured. It was found that sperm
count was already decreased by 37% in 6 weeks old Osteocalcin -/-
mice and that this decrease reached 60% of the sperm count in WT
mice at 6 months of age (FIG. 2B).
Example 3
Esp-Deficient and Osteocalcin-Deficient Mice have Opposite
Reproductive Phenotypes
[0426] Esp encodes a phosphatase which decreases osteocalcin
bioactivity to such an extent that Esp-/- and Osteocalcin-/- mice
display metabolic abnormalities that are the mirror image of one
another (Hinoi et al., 2008, J. Cell Biol. 183:1235-1242; Ferron et
al., 2008, Proc. Natl. Acad. Sci. USA 105:5266-5270; Lee et al.,
2007, Cell 130:456-469). Esp-/- mice were tested for abnormalities
of spermatogenesis. As shown in FIG. 3A, Esp-/- mice had
significantly bigger testes than WT littermates at both 6 and 12
weeks of age. Moreover, their sperm count was significantly
increased (FIG. 3B). These data strongly suggest, although they do
not prove, that, as is the case for energy metabolism, Esp and
Osteocalcin are in the same genetic pathway and that it is the
uncarboxylated form of osteocalcin that regulates
spermatogenesis.
Example 4
Osteocalcin Regulates Germ Cell Apoptosis
[0427] The proliferation and apoptosis of germ cells in Osteocalcin
-/- or in Esp -/- mice were studied. When using BrdU labeling in
vivo, no abnormalities in germ cell proliferation in Osteocalcin
-/- or in the Esp -/- mice were detected at any time point (FIG.
4A). In contrast, study of apoptosis by TUNEL assay consistently
showed a significant increase in the apoptosis of germ cells in
Osteocalcin -/- mice as young as 2 weeks of age (FIG. 4B). In 12
week-old Osteocalcin -/- mutant mice, there was a 50% increase in
germ cell apoptosis compared to WT mice (FIG. 4B). Conversely, a
decrease was observed in the number of apoptotic germ cells in Esp
-/- mice compared to WT littermates at all time points analyzed
(FIG. 4C). Molecularly, it could be shown that Caspase 3, one of
the main effectors of apoptosis, was significantly more abundant in
Osteocalcin -/- than in WT testes (FIG. 4D).
[0428] The morphology of Leydig cells was studied by immunostaining
of 3-.beta.-hydroxysteroid dehydrogenase/.DELTA.-5-4 isomerase
(3.beta.-HSD). The number of Leydig cells was not significantly
affected by the absence of osteocalcin or Esp, nor was expression
of genes affecting cell proliferation (FIG. 14A and data not
shown). Nevertheless, Leydig cells appeared hypotrophic in Ocn-/-
testes as determined by the significant decrease of the ratio
between the Leydig cells and interstitial areas observed in Ocn-/-
compared to WT testes (FIG. 14B-C). Conversely, this ratio was
increased in Esp-/- testes (FIG. 14B-C).
[0429] The size of the epithelium in testis tubules was
significantly decreased in Ocn-/- mice, a feature suggesting that
osteocalcin regulates, presumably through its effect on
testosterone biosynthesis, germ cell numbers (FIG. 14D). In view of
this result, and since testosterone inhibits germ cell apoptosis
(Brinkworth et al., 1995, J. Reprod. Feral. 105:25-33; Henriksen et
al., 1995, Endocrinology 136:3285-3291; Sinha Hikim and Swerdloff,
1999, Rev. Reprod. 4:38-47), TUNEL assays were performed. Those
assays showed a 50% increase in germ cell apoptosis in Ocn-/-
compared to WT mice and a 50% decrease in Esp-/- testes (FIG. 14F).
In vivo BrdU labeling did not reveal any abnormalities in germ cell
proliferation in either Ocn-/- or Esp -/- mice (FIG. 20A).
[0430] Since osteocalcin favors testosterone synthesis by Leydig
cells, whether osteocalcin affects the expression of enzymes
necessary for testosterone biosynthesis such as StAR, Cyp11a,
Cyp17, and 3,.beta.-HSD was tested. Uncarboxylated osteocalcin
increased expression of these genes in Leydig cell cultures (FIGS.
14G and 14H). Accordingly, their expression was significantly
decreased in Ocn-/- and increased in Esp-/- testes (FIG. 14H),
while it was unaffected in Ocn-/- and Esp-/- ovaries or adrenal
glands (FIG. 21B-E). Of note, there was no change in expression of
Cyp19, the gene encoding the testosterone aromatase, or of HSD-17,
in Ocn-/- and Esp-/- testes (FIGS. 14G and 14H).
[0431] Further support for the notion that osteocalcin influences
germ cell apoptosis through testosterone was provided by an
examination of the expression of Gonadotropin Regulated Testicular
Helicase (Grth). This gene has emerged as an essential regulator of
spermatogenesis whose expression in germ cells is regulated by
testosterone and inhibits germ cell apoptosis (Dufau and
Tsai-Morris, 2007, Trends Endocrinol. Metab. 18:314-320; Sheng et
al., 2006, J. Biol. Chem. 281:35048-35056; Tsai-Morris et al.,
2007, Mol. Hum. Reprod. 13:887-892). Grth expression was decreased
in Ocn-/- and increased in Esp-/- testes (FIG. 14I). GRTH inhibits
activation of Caspase 3, a determinant of apoptosis (Gutti et al.,
2008, J. Biol. Chem. 283:17055-17064) and favors expression of
tACE, a protein favoring germ cell maturation. Consistent with
these notions, Western blot analyses showed an increase of cleaved
caspase 3 protein accumulation and a decrease of tACE in Ocn-/-
testes (FIG. 14J).
Example 5
Osteocalcin Regulates Testosterone Production
[0432] The low sperm count without any abnormality in proliferation
and the increase in apoptosis of germ cells suggested that the
reproduction phenotype of the Osteocalcin-/- males could be due to
a decrease in testosterone secretion or action. To determine if
that was the case, testosterone levels were measured in
Osteocalcin-/-, Esp-/-, and WT mice. As shown in FIG. 5, there was
a 70% decrease in the level of circulating testosterone in
Osteocalcin-/- male mice while, in contrast, this level was
increased in Esp-/- male mice.
[0433] To further prove that osteocalcin is a regulator of
testosterone synthesis, a well-characterized mouse Leydig cell
line, the TM3 cell line (Mather, 1980, Biol. Reprod. 23:243-252),
was used. These cells have been extensively used as a model of
Leydig cells for in vitro studies and have been shown to express
SF-1, an important transcriptional regulator of most genes involved
in testosterone biosynthesis (Mather, 1980, Biol. Reprod.
23:243-252; Cammas, 1997, Mol. Endocrinol. 11:867-876; Dakhova et
al., 2009, Endocrinology 150:404-412). TM3 cells were treated with
increasing amounts of osteocalcin and assayed for the expression of
genes encoding enzymes of the steroidogenic cascade. As shown in
FIG. 6, osteocalcin specifically increased the expression of StAR,
a cholesterol shuttle molecule, and of two cytochrome P450 steroid
hydroxylases (Cyp11a and Cyp17). Thus, whether looked at by in vivo
or cell-based assays, osteocalcin promotes testosterone
biosynthesis.
[0434] In a further series of experiments, supernatants of
mesenchymal cell cultures were assayed for their ability to affect
hormone production by testes and/or ovaries. In these cell-based
assays (FIG. 11A), of all those tested, the supernatants of
osteoblast cultures increased testosterone secretion by testis
explants to the largest extent (over 3 fold), while not affecting
estradiol and progesterone secretion by testes or ovaries (FIG.
11B-G). Since testosterone is produced by Leydig cells of the
testes, whether osteoblast-derived molecule(s) act directly on
Leydig cells was tested by culturing primary mouse Leydig cells in
the presence or absence of supernatants of osteoblast cultures or
cultures of other mesenchymal cell types. In the conditions of this
assay, supernatants of osteoblast cultures were the only ones able
to increase testosterone production by Leydig cells significantly
(more than 4 fold) (FIG. 11H). These experiments indicate that
osteoblasts are the cells of mesenchymal origin that affect
testosterone biosynthesis to the largest extent, and that they do
so through secreted molecule(s) acting on Leydig cells of the
testis. This novel endocrine function of osteoblasts was restricted
to androgen production. Adipocytes also enhanced sex steroid
hormone secretion, albeit to a lesser extent.
[0435] Several lines of evidence indicated that osteocalcin is the
osteoblast-derived hormone enhancing testosterone secretion by
Leydig cells. First, supernatants of wild type (WT) but not of
Osteocalcin (Ocn) -/- osteoblast cultures increased testosterone
production by testis explants and mouse Leydig cells (FIG. 12A-B).
Second, treating testis explants or Leydig cells with increasing
amounts of uncarboxylated osteocalcin, the active form of the
hormone, resulted in a dose-dependent increase in testosterone
secretion (FIG. 12C-D). Third, injection of osteocalcin in WT mice
increased circulating levels of testosterone (FIG. 12E). Fourth, to
determine if osteocalcin regulates male fertility in vivo, loss-
(Ocn-/- mice) and gain-of-function (Esp-/- mice) mouse models for
osteocalcin (Lee et al., 2007, Cell 130:456-469) were used. When
Ocn-/- males were crossed with WT female mice, the litter sizes
were nearly two-fold smaller than when WT males were crossed with
WT female mice (FIG. 12F). Conversely, the number of pups per
litter was consistently increased when Esp-/- males were bred with
WT female mice (FIG. 12F). The frequency of litters over a period
of 8 weeks was also decreased in the case of the loss-of-function
model and increased in the gain-of-function model (FIG. 12G).
Testis size and weight were significantly decreased in Ocn-/- and
increased in Esp-/- mice at 3 months of age (FIGS. 12H and 12I).
The weights of epididymides and seminal vesicles as well as sperm
count were also significantly decreased in Ocn-/- and increased in
Esp-/- mice (FIG. 12J-L). These abnormalities worsened over time
(FIGS. 12I and 12L).
[0436] Motility of sperm from both WT and Ocn-/- males was assessed
by videomicroscopy immediately after dissemination from the caudal
epididymis or after 2 hours of incubation under conditions known to
prepare sperm for fertilization (Suarez and Osman, 1987, Biol.
Reprod. 36:1191-1198). In both cases, the percentage of motile
sperm did not differ between Ocn-/- and WT mice (FIG. 18A).
Likewise, the percentage of abnormally shaped or dead sperm was
similar in WT and Ocn-/- mice (FIG. 18B-C).
[0437] Consistent with the fact that osteocalcin favors
testosterone synthesis in Leydig cells ex vivo, circulating levels
of testosterone were markedly decreased in Ocn-/- and increased in
Esp-/- mice. Circulating progesterone levels were similar in Ocn-/-
and WT mice and, although circulating levels of estradiol were
higher in Ocn-/- than in WT mice, they remained within the normal
range (FIG. 12M). The most likely explanation for this mild
increase in circulating estradiol levels in the Ocn-/- mice is that
the increase in the number of adipocytes caused by Osteocalcin
inactivation may result in an increase in the aromatization of
testosterone into estrogen in fat (Nelson and Bulun, 2001, J. Am.
Acad. Dermatol. 45:S116-124; Simpson et al., 2000, Trends
Endocrinol. Metab. 11:184-188; Simpson, 2003, J. Steroid Biochem.
Mol. Biol. 86:225-230). Estradiol levels were not affected in
Esp-/- mice. As predicted by the co-culture assays, female
fertility, ovary weight, morphology of the uterus, follicle
numbers, and circulating levels of steroid sex hormones were normal
in Ocn-/- female mice (FIG. 18D-L). Taken together, these cell
biology and genetic experiments identify osteocalcin as a secreted
molecule favoring male fertility by increasing testosterone
production by Leydig cells.
Example 6
Daily Osteocalcin Injections Affect Sperm Counts and Germ Cell
Apoptosis
[0438] WT mice (n=6) were injected daily with either 3 ng/g or 30
ng/g of uncarboxylated osteocalcin for 12 weeks. Uncarboxylated
osteocalcin, at both doses, significantly increased testis weight
and sperm count and decreased sperm cell apoptosis (FIG. 7A-C).
Likewise, serum testosterone levels were increased in
osteocalcin-injected mice compared to vehicle-injected mice (FIG.
7D). Hence, whether looked at by genetic models of loss-of-function
or gain-of-function of osteocalcin or by pharmacological means to
increase osteocalcin serum levels, osteocalcin acts as a regulator
of testosterone production and male germ cell production.
Example 7
Osteocalcin is not Expressed in Testis
[0439] Given the nature and severity of the Osteocalcin-/-
phenotype, a possible concern was that Osteocalcin could be in fact
expressed at low, but nevertheless biologically important, levels
in some cell types of the testis. This concern was even more
legitimate since Esp is known to be expressed in Sertoli cells
(Dacquin et al., 2004, Dev. Dyn. 229:826-834). To begin addressing
this concern, several different experiments were performed. First,
Osteocalcin expression in bone versus testes was compared by
quantitative PCR. A 1,000 fold higher expression in bone than in
testis was observed (FIG. 8A). Second, in situ hybridizations were
performed for Osteocalcin expression but failed to detect any
signal in the testis (FIG. 8B). Third, the Cherry gene, a
fluorescent reporter gene, was knocked into the Osteocalcin locus
to create Ocn-Cherry mice. Using this reporter, a strong signal
could be detected in osteoblasts but staining could not be detected
in testes (FIG. 8C). Taken together, these results, albeit
negative, strongly suggest that osteocalcin is not expressed in any
cell type of the testes.
[0440] Gene expression and cell-specific gene deletion experiments
were performed to further determine that osteocalcin regulates male
fertility as an osteoblast-secreted molecule, not as a
testis-secreted factor. When comparing Osteocalcin expression in
bone, testes, and ovaries by quantitative PCR (qPCR), it was
observed that Osteocalcin expression was more than 750 fold higher
in bone than in gonads; furthermore, Osteocalcin transcript or
protein was not detected in testes by in situ hybridization or
Western blot analyses (FIG. 13A-C). To be able to trace
Osteocalcin-expressing cells in vivo, the mCherry fluorescent
reporter gene was knocked into the Ocn locus (Ocn-mCherry mice)
(FIG. 19A-B). While the expected strong signal was observed in
osteoblasts, there was no detectable mCherry fluorescence in testes
(FIG. 13D). Thus, through multiple assays, Osteocalcin expression
was not detected in testes.
Example 8
Generation of a Foxed Allele for Osteocalcin
[0441] Although the expression study described above did not
identify Osteocalcin expression in Sertoli, germ cells or Leydig
cells of the testes, there remained a concern that the sensitivity
of the techniques used was not sufficient to detect a very low
expression of Osteocalcin in these cells and that such expression
could be the true cause of the reproduction phenotype observed in
the Osteocalcin -/- mice. To more formally exclude this
possibility, Osteocalcin cell-specific knockout lines may be
generated and analyzed. The first step toward this goal is to
generate a floxed allele of the Osteocalcin locus. Following the
same deletion strategy previously used to create the complete
knockout allele (Ducy et al., 1996, Nature 382:448-452), a
targeting vector harboring LoxP sites flanking the Osteocalcin
locus was generated (FIG. 9A). Upon recombination by the Cre
recombinase specifically expressed in a particular cell type, both
Osteocalcin genes should be deleted in those cells. As shown in
FIG. 9B, mice harboring this floxed allele have already been
obtained; such mice can be used to generate and analyze mice
lacking osteocalcin in a cell-specific manner.
[0442] Cell-specific loss- and gain-of-function models of
osteocalcin were generated by crossing mice harboring floxed
alleles of Ocn (FIG. 19C-D) or Esp with either the al (I)
Collagen-Cre transgenic mice or the Cyp17-iCre transgenic mice to
delete genes in osteoblasts or in Leydig cells only, respectively
(Bridges et al., 2008, Dev Dyn. 224:245-251). Testis size and
weight, epididymides and seminal vesicle weights, sperm count, and
circulating testosterone levels were all reduced in 12 week-old
Ocn.sub.Osb-/- mice while none of these parameters were affected in
mice lacking Osteocalcin in Leydig cells only (FIG. 13E-I). There
was a tight correlation between osteocalcin and testosterone
circulating levels in Ocn.sub.Osb-/- mice (FIG. 13J). Conversely,
Esp.sub.Osb-/- mice displayed testis abnormalities identical to
those of Esp-/- mice and that were the mirror image of Ocn-/- or
Ocn.sub.Osb-/- mice. Inactivation of Esp in Sertoli cells, where
this gene is expressed (Dacquin et al., 2004, Dev. Dyn.
229:826-834; Jamin et al., 2003, Mol. Cell. Endocrinol. 211:15-19),
had no detectable deleterious consequence on testis biology (FIG.
13K-N). Hence, it is only through its expression in osteoblasts
that osteocalcin promotes male fertility.
Example 9
Esp-Deficient Mice
[0443] Esp-deficient mice are mice in which one (+/-) or both
alleles (-/-) for OST-PTP have been inactivated in all of the cells
in the animal. The mice were made by homologous recombination of a
targeted OST-PTP allele with a transgene having a sequence encoding
a nuclear-localized LacZ cassette, which is homologously recombined
into exon 6 of the OST-PTP allele, such that the transgene is in
frame with the OST-PTP gene, and expression of the transgene is
operably linked to the native gene expression regulatory sequences
of the OST-PTP allele. The production of Esp-deficient mice is
described in more detail in International Patent Publication No. WO
2008 033518; Ducy et al., 1996, Nature 382:448-452; and Lee et al.,
2007, Cell 130:456-469.
Example 10
Osteocalcin-Deficient and Other Mice
[0444] "Osteocalcin-deficient mice" as used herein means a strain
of mice in which both osteocalcin alleles were deleted. Generation
of Osteocalcin-/- mice was previously reported (Ducy et al., 1996,
Nature 382:448-452). Exon 4 of osteocalcin gene 1 (OG1), coding for
the mature protein, and the entire osteocalcin gene 2 (OG2)
sequence, were deleted, while osteocalcin-related gene (ORG) was
left in place. Correct targeting resulted in the replacement of the
entire mature osteocalcin protein-coding sequences by the pGKNeo
selection cassette.
[0445] All experiments giving rise to the data shown in FIGS. 11-22
were performed on the 129-Sv (Taconic) genetic background. Control
littermates were used in all these experiments. Mouse genotypes
were determined by PCR. Strategies for generating transgenic mice
are depicted in FIGS. 9, 19, and 22.
Example 11
Laboratory Measurements
[0446] Blood was collected by heart puncture of isoflurane
anesthetized mice. Osteocalcin levels were quantified by IRMA
(Immunotopics kit).
Example 12
Gene Expression Analyses
[0447] Gene expression analyses were performed using real time PCR.
DNAse I-treated total RNA was converted to cDNA with the
SuperScript III kit (Invitrogen). Real-time PCR were performed
using the Taq SYBR Green Supermix with ROX (Biorad) on an MX3000
instrument (Stratagene); beta-actin amplification was used as an
internal reference for each sample. All primers were from
SuperArray.
Example 13
Recombinant Osteocalcin
[0448] Recombinant osteocalcin was bacterially produced and
purified on glutathione beads according to standard procedures.
Osteocalcin was then cleaved from the GST subunit using thrombin
digestion. Thrombin contamination was removed using an affinity
column. The purity of the product was qualitatively assessed by
SDS-PAGE. Bacteria do not have a gamma-carboxylase gene. Therefore,
recombinant osteocalcin produced in bacteria is always completely
undercarboxylated at all three sites.
Example 14
ELISA to Measure Undercarboxylated Osteocalcin
[0449] Carboxylation levels of osteocalcin in the serum are usually
assessed indirectly by hydroxyapatite (HA) pull down followed by
measurement of the unbound fraction of osteocalcin using a
commercially available radioimmunoassay (RIA). The HA assay is
based on the principle that undercarboxylated osteocalcin has a
decreased binding affinity for HA compared to carboxylated
osteocalcin. HA-based measurements of undercarboxylated osteocalcin
have some limitations, as this method requires a relatively large
volume of serum. Moreover, the HA pull down assay of osteocalcin is
a semi-quantitative method, as it does not precisely quantify the
serum concentration of undercarboxylated osteocalcin, but only
estimates the percentage of osteocalcin having a low HA affinity.
In order to measure more precisely undercarboxylated osteocalcin,
an enzyme-linked immunosorbent assay (ELISA) system was developed
for the quantification of mouse undercarboxylated osteocalcin.
[0450] Goats were immunized with full-length bacterially produced
fully uncarboxylated osteocalcin. Using affinity columns,
polyclonal antibodies were purified from these goat anti-sera that
recognized either the osteocalcin C-terminal region between amino
acids 25 and 46 (OC25-46) or the uncarboxylated central region
between amino acids 11 and 26 (unOC11-26). Dot blot analysis
verified that the OC25-46 antibodies recognized both uncarboxylated
and carboxylated osteocalcin, while the unOC11-26 recognized
specifically uncarboxylated osteocalcin. The OC25-46 antibodies
were next conjugated to horseradish peroxidase (HRP), while the
unOC11-26 antibodies were coated on ELISA plates using standard
procedures. To test the specificity of the ELISA system, different
concentrations of uncarboxylated or carboxylated osteocalcin were
incubated on the plate for 18 h at 4.degree. C., then the wells
were washed 5 times and incubated in the presence of the OC25-46
HRP conjugated antibodies for 1 h at room temperature. Following 5
washes, the immunocomplex was incubated with an HRP substrate, TMB,
which is converted to a blue compound by peroxidases. The reaction
was stopped with 0.18 M H.sub.2SO.sub.4 and absorbance (O.D.) at
450 nm was measured using an ELISA plate reader. As shown in FIG.
10, this assay allows the specific quantification of uncarboxylated
osteocalcin in a physiological concentration range (1 to 100
ng/ml).
Example 15
Preparation of Primary Leydig Cells and Testis Explants
[0451] Adult mouse Leydig cells were isolated by mechanical
dissociation of the testes followed by purification on a 0-90%
Percoll gradient (Hunter et al., 1982, Mol. Cell. Endocrinol.
25:35-47; Schumacher et al., 1978, FEBS Lett. 91:333-338). Primary
Leydig cells were cultured in Minimal Essential Medium
(MEM+GlutaMAX, Invitrogen) supplemented with 1.times. PenStrep, 25
mM HEPES, pH 7.4 and 0.07% BSA at 33.degree. C. in 5% CO.sub.2.
After 3 hours of attaching and starvation, cells were washed once
with culture medium and then used for experiments. The preparation
of testis explants was adapted from Powlin et al., 1998, Toxicol.
Sci. 46:61-74. Explants were washed 3 times with PBS 1.times. and
placed in serum free RPMI medium for 2 hours before being used for
experiments.
Example 16
Osteocalcin Stimulation of Leydig Cells or Testis Explants
[0452] Primary Leydig cells and testis explants were washed 3 times
with PBS 1.times. and stimulated with different doses of
recombinant osteocalcin prepared as previously described (Ferron et
al., 2008, Proc. Natl. Acad. Sci. USA 105:5266-5270) or with human
chorionic gonadotropin (hCG) as a positive control. After 1 hour,
an aliquot of medium was collected for measurements of
testosterone. Cells were then maintained for 3 additional hours and
lysed in 1 ml TRIZOL.RTM. (Invitrogen) for RNA isolation.
Example 17
Sperm Counts and Hormone Measurements
[0453] Caudal epididymides were minced in 1 ml PBS and the number
of cells released counted after 1 hour. The total sperm count was
assessed in the final suspension by using a hemacytometer (Dakhova
et al., 2009, Endocrinology 150:404-412). Circulating levels of
testosterone, estradiol (E2), and progesterone were measured by
radioimmunoassay (RIA) from Diagnostic Systems Laboratories
(Testosterone RIA DSL-4000, Estradiol RIA DSL-43100, and
Progesterone RIA-3900).
Example 18
Histology
[0454] One testis or ovary from each mouse was randomly selected
for molecular analysis and the other one was used for histology.
Specimens were collected, weighed, and fixed in Bouin's fixative
for histological analyses before being dehydrated through graded
ethanol, processed for paraffin embedding, and serially sectioned
at 5 .mu.m. For histological analysis, sections of testes and
ovaries were stained with periodic acid-Schiff and counterstained
with hematoxylin. TUNEL labeling was performed using the ApopTag
Peroxydase In Situ Apoptosis detection kit (Millipore-57100).
Apoptotic indices were determined by counting the total number of
TUNEL-positive cells or the number of TUNEL positive spermatocytes
for all stage tubules. Approximately 500 tubules were counted on at
least 4 cross-sections located at midtestis for each animal.
Example 19
Gene Expression Studies
[0455] RNA was purified from tissues, primary Leydig cells, or
cultured cells using TRIZOL.RTM. (Invitrogen). RNA isolation, cDNA
preparation, and qPCR analysis was carried out following standard
protocols. qPCR analyses were performed using specific quantitative
PCR primers from SABiosciences.
Example 20
cAMP Quantification
[0456] For cAMP measurements, TM3 Leydig cells were plated in 6 cm
dishes (10.sup.7 cells per dish) a day before experiment. Cells
were serum starved for 16 hours (in the presence of 0.1% BSA) then
pre-incubated in the presence of 0.5 mM IBMX for 30 minutes and
stimulated with the indicated concentration of osteocalcin (also in
the presence of 0.5 mM IBMX) for 30 minutes. cAMP concentration was
measured with the Parameter cAMP kit (R&D Systems, KGE002).
Example 21
Receptor Binding Assays
[0457] For binding studies, testes from 8-week old mice were snap
frozen in liquid nitrogen and 20 .mu.m thick sections were prepared
and desiccated overnight at +4.degree. C. under vacuum. On the
following day, sections were rehydrated in ice-cold binding buffer
(50 mM TrisHCl, pH 7.4, 10 mM MgCl.sub.2, 0.1 mM EDTA and 0.1% BSA)
for 15 minutes and incubated for 1 hour in the presence of
biotinylated osteocalcin. For competition assays, a 100-fold molar
excess of unlabeled osteocalcin, glycine, lysine, or hCG was added.
After 3 washes in cold PBS, sections were incubated for 1 hour in
the detection system containing 0.1% BSA (ABC Elite, Vector
Laboratories), washed again, and incubated with DAB peroxidase
substrate kit (Vector Laboratories) according to the manufacturer's
protocol. After a final wash, sections were mounted in water-based
mounting medium. As negative controls, sections incubated with the
detection system only (ABC Elite and DAB) or OstR-/- testis
sections (Basura et al., 2008, Hear. Res. 244:45-50) were used.
Example 22
Preparation, Purification, and Culture of Primary Mesenchymal
Cells
[0458] Primary osteoblasts were isolated from 5 day-old Ocn-/- or
WT littermate calvaria bones. Calvaria bones were dissected and
placed in digestion medium (.alpha.MEM, 1 mg/ml collagenase P (BM),
2.5% trypsin/EDTA) for 60 minutes at 37.degree. C. under vigorous
shaking. The cell suspension was transferred, free of bone pieces,
into a culture plate and cultured for 1 week in .alpha.MEM/10% FBS
(pH 6.9) and in mineralization medium (.alpha.MEM/10% FBS, 5 mM
.beta.-glycerophosphate and 10 .mu.g/ml ascorbic acid) thereafter.
Upon complete differentiation, cells were cultured for 24 hours in
a specific medium for primary Leydig cells or tissue explants
(testis or ovary) in the presence of 0.1% BSA. Supernatants were
collected, centrifuged to remove cell debris, and stored at
-80.degree. C.
[0459] Primary adipocytes were isolated from visceral fat pads
(white adipocytes), dissected, and minced in PBS. Tissues were
redigested for 1 hour at 37.degree. C. in 1 mg/ml collagenase (in
KRP buffer; 20 mM HEPES, 120 mM NaCl, 6 mM KCl, 1.2 mM MgSO.sub.4,
1 mM CaCl.sub.2, 0.6 mM Na.sub.2HPO.sub.4, 0.4 mM
NaH.sub.2PO.sub.4, 2.5 mM d-glucose, 2% BSA, pH 7.4) as described
(Ferron et al., 2008, Proc. Natl. Acad. Sci. USA 105:5266-5270; Lee
et al., 2007, Cell 130:456-469). Isolated white fat adipocytes were
then directly cultured for 2 hours in .alpha.MEM supplemented with
0.1% BSA. After 3 washes with PBS 1.times., adipocytes were
cultured for at least 8 hours in a specific medium for primary
Leydig cells or tissue explants (testis or ovary) in the presence
of 0.1% BSA. Supernatants were collected, centrifuged to remove
cell debris, and stored at -80.degree. C.
[0460] Primary fibroblasts were isolated from 5 day-old mice as
described (Hakkinen et al., 2001, Methods Cell Sci. 23:189-196).
Purified fibroblasts were cultured for at least 24 hours in a
specific medium for primary Leydig cells or tissue explants (testis
or ovary) in the presence of 0.1% BSA. Supernatants were collected,
centrifuged to remove cell debris, and stored at -80.degree. C.
[0461] Primary myoblasts were isolated from 5 day-old mice as
described (Springer and Blau, 1997, Somat. Cell Mol. Genet.
23:203-209). Purified myoblasts were cultured for at least 24 hours
in a specific medium for primary Leydig cells or tissue explants
(testis or ovary) in the presence of 0.1% BSA. Supernatants were
collected, centrifuged to remove cell debris, and stored at
-80.degree. C.
Example 23
Assays with Testis and Ovary Explants
[0462] Preparation of testis explants was adapted from Powlin et
al., 1998, Toxicol. Sci. 46:61-74). Testes from WT animals were
decapsulated and 30 mg of testicular parenchyma was placed into a
10 ml glass scintillation vial containing 5 ml of culture medium
(RPMI-1640, 5% FCS, 50 mg/ml soybean trypsin inhibitor) and used
for each different condition. The vial was capped, briefly
vortexed, and incubated vertically for 2 hours at 34.degree. C.
under vigorous shaking (175 rpm). Testes explants were then washed
3 times with PBS 1.times., placed in fresh serum free RPMI medium
for 2 hours, washed again 3 times with PBS 1.times., and incubated
for 1 hour with supernatants collected from various mesenchymal
cell cultures. At the end of the incubation period, 1.4 ml of
cultured medium were collected and centrifuged at 14,000 g for 5
minutes (4.degree. C.) to pellet all remaining testicular
parenchyma. The resulting supernatant was frozen at -80.degree. C.
until radioimmuno assays (RIA) were performed to measure the
circulating levels of testosterone, estradiol, or progesterone. As
a positive control, testis explants were cultured with medium
containing hCG (1 IU/ml). hCG binds to the LH receptor on Leydig
cells to stimulate testosterone production. This stimulation
confirmed the viability of the explants.
[0463] Preparation of ovary explants was adapted from (Powlin et
al., 1998, Toxicol. Sci. 46:61-74). Ovaries from WT animals were
removed, cleared of fat, weighed, thoroughly minced with scissors
into approximately <1 mm.sup.3, and placed into a 10 ml glass
scintillation vial containing 1 ml of culture medium (RPMI-1640, 5%
FCS, 50 mg/ml soybean trypsin inhibitor). Two ovaries were used for
each different condition. The vial was capped, briefly vortexed,
and incubated vertically for 2 hours at 34.degree. C. under
vigorous shaking (175 rpm). Ovary explants were then washed 3 times
with PBS 1.times., placed in fresh serum free RPMI medium for 2
hours, washed again 3 times with PBS 1.times., and incubated for 1
hour with supernatants collected from various mesenchymal cell
cultures. At the end of the incubation period, the culture medium
was centrifuged at 14,000 g for 5 min (4.degree. C.) to pellet all
remaining tissues. The resulting supernatant was frozen at
-80.degree. C. until analyzed for testosterone, estradiol, or
progesterone levels.
Example 24
Assessment of Estrus Cycle
[0464] Weanling WT or Ocn-/- female mice were inspected daily for
vaginal opening and estrus cycling was determined in sexually
mature WT or Ocn-/- female mice by light microscope analysis of
vaginal epithelial cell smears (Walters et al., 2007,
Endocrinology. 148:3674-3684). To define estrus cycle length, daily
vaginal samples were collected for 14 consecutive days.
Example 25
In Situ mRNA Hybridization
[0465] Ten .mu.m coronal sections of mouse testis or bone were cut
in a cryostat and mounted on positively charged microscope slides.
For hybridization, cryosections were incubated with DIG-labelled
riboprobe at 69.degree. C., followed by incubation with alkaline
phosphatase-conjugated anti-DIG antibody. Color development was
performed by incubation with NBT/BCIP.
Example 26
Immunohistochemistry and Immunofluorescence
[0466] Immunohistochemistry was performed according to Qin et al.,
2008, PLoS One 3:e3285. Mouse testes were fixed overnight in
Bouin's fixative, dehydrated through graded ethanol, processed for
paraffin embedding, and sectioned at 5 .mu.m. Goat polyclonal
anti-3.beta.-HSD (Santa Cruz Biotechnology) was used as primary
antibody and a biotinylated rabbit anti-goat antibody (Jackson
ImmunoResearch) was used as secondary antibody. The VECTASTAIN ABC
KIT.RTM. (Vector laboratories) and 3,3'-diaminobenzidine (DAB)
substrate kit (Vector laboratories) were used for reaction
development.
[0467] For immunofluorescence studies, animals were anesthetized
and perfused transcardially with ice-cold saline, followed by PFA
4%/PBS. Mouse testes and ovaries were dissected, postfixed
overnight in PFA 4%/PBS, and then cryoprotected by overnight
immersion in a 20% sucrose solution. Frozen testes or ovaries were
sliced in 20 .mu.m coronal sections using a cryotome, dried at room
temperature for 20 minutes, washed with PBS, and blocked with
appropriate serum for 1 hour. Sections were then incubated with
rabbit anti-OstR for 24 hours at 4.degree. C., rinsed, and
incubated with a donkey anti-rabbit antibody (Cy3; Jackson
immunoresearch).
Example 27
Germ Cell Proliferation
[0468] Proliferation analysis was performed by BrdU staining in 2
week-old WT and Ocn-/- mice (Wang et al., 2003, Endocrinology
144:5058-5064). Two hours before sacrifice, mice received an
intraperitoneal injection of BrdU (40 .mu.g/g body weight). BrdU
staining was performed on sections prepared as above using a BrdU
staining kit (Invitrogen, 93-3943) and hematoxylin
counterstain.
Example 28
Leydig Cell Analysis
[0469] Testes of WT, Ocn-/-, and Esp-/- mice were dissected and
fixed in Bouin's fixative for histological analyses. Tissues were
dehydrated through graded ethanol, processed for paraffin
embedding, serially sectioned at 5 .mu.m, and stained by
immunohistochemistry with anti-3.beta.-HSD as described above. The
ratio between Leydig cell area (reflected by immunostaining) and
interstitially area was measured by computer analysis using a
40.times. objective lens and an 8.times. ocular lens with test grid
by counting 100 test points in 35-40 sites, as described (Dakhova
et al., 2009, Endocrinology 150:404-412). The ratio percentage was
obtained by counting points over Leydig cells area and dividing by
the total number of points counted over interstitial area. The
total number of Leydig cells per testis was calculated by dividing
the total area of Leydig cells by the total number of Leydig cells
in this area (number of Leydig cells/mm.sup.2).
Example 29
Sperm Preparation and Hyperactivation
[0470] All routine chemicals and compounds were purchased from
Sigma-Aldrich with exceptions noted below. A mouse sperm
capacitating medium (Suarez and Osman, 1987, Biol. Reprod.
36:1191-1198; Suarez., 2008, Hum. Reprod. Update 14:647-657) was
used for incubating and washing sperm. The medium consisted of 110
mM NaCl, 2.68 mM KCl, 0.36 mM NaH.sub.2PO.sub.4, 25 mM NaHCO.sub.3,
25 mM 4-(2-hydroxyethyl)-/- piperazineethanesulfonic acid (HEPES)
(EMD), 5.56 mM glucose, 1.0 mM pyruvic acid, 0.006% penicillin G
(Na), 2.4 mM CaCl.sub.2, 0.49 mM MgCl.sub.2, and 20 mg/ml BSA
(EMD). The medium was adjusted to pH 7.6 and 290-310 mOsm/kg).
[0471] Sperm were obtained from freshly dissected epididymides as
follows. A 100 microliter droplet of medium was covered by mineral
oil in a 35.times.10 mm Petri dish (Falcon), which was equilibrated
in a 37.degree. C., 5% CO.sub.2 incubator prior to use. Caudal
epididymides were cleaned of fat and then blood was gently pushed
out of surface vessels. The epididymides were placed under the
mineral oil in the Petri dish. Several cuts were made in the coiled
tubules near the vas deferens and the thick fluid containing sperm
was gently pulled out of each cut using forceps and transferred
under the oil to the medium droplet. Sperm were allowed to disperse
for 10 minutes in the incubator and then were diluted with medium
to 5.times.106/ml. To promote capacitation and hyperactivation,
sperm were incubated at 37.degree. C. and 5% CO.sub.2 for 2
hours.
Example 30
Analysis of Sperm Motility
[0472] Samples of sperm were placed on slides on a 37.degree. C.
stage of a Zeiss Axiovert 35 microscope and videotaped at 30 Hz
using 200.times. bright field microscopy and stroboscopic
illumination provided by a 75 W xenon flash tube (Chadwick-Helmuth
Co., El Monte, Calif.). Videotaping was conducted using a
black-and-white Dage CCD 72 video camera (Dage-MTI, Inc., Michigan
City).
Example 31
Gper Expression Analysis in Testis and Ovary
[0473] Expression of the following 103 orphan GPCRs: Gpr1, Gpr101,
Gpr107, Gpr108, Gpr110, Gpr111, Gpr112, Gpr113, Gpr114, Gpr115,
Gpr116, Gpr119, Gpr12, Gpr120, Gpr123, Gpr124, Gpr125, Gpr126,
Gpr128, Gpr132, Gpr133, Gpr135, Gpr137, Gpr137b, Gpr137c, Gpr139,
Gpr141, Gpr142, Gpr143, Gpr144, Gpr146, Gpr149, Gpr15, Gpr150,
Gpr151, Gpr152, Gpr153, Gpr155, Gpr156, Gpr158, Gpr160, Gpr161,
Gpr162, Gpr165, Gpr17, Gpr171, Gpr172b, Gpr173, Gpr174, Gpr175,
Gpr176, Gpr177, Gpr179, Gpr18, Gpr180, Gpr182, Gpr183, Gpr19,
Gpr20, Gpr21, Gpr22, Gpr25, Gpr26, Gpr27, Gpr3, Gpr31, Gpr31c,
Gpr33, Gpr34, Gpr35, Gpr37, Gpr3711, Gpr39, Gpr4, Gpr44, Gpr45,
Gpr50, Gpr52, Gpr55, Gpr56, Gpr6, Gpr61, Gpr62, Gpr63, Gpr64,
Gpr65, Gpr68, Gpr75, Gpr77, Gpr81, Gpr82, Gpr83, Gpr84, Gpr85,
Gpr87, Gpr88, Gpr89, Gpr97, Gpr98, Gprc5a, Gprc5b, Gprc5c, Gprc5d,
Gprc6a, Tmem181, Lgr5, Lgr4, Lanc11, Mrgprh, Mrgprg, pgr151 were
tested by qPCR in testes and ovaries isolated from 8 week-old WT
mice. The 22 most highly expressed genes in testes were tested for
expression in primary Leydig cells and their expression in Leydig
cells was compared with their expression in whole testes. The
expression of four genes were specifically enriched in Leydig
cells.
Example 32
Western Blotting
[0474] Western blotting was performed according to standard
procedures. Frozen testes were homogenized and lysed with 1.times.
RIPA buffer. Membranes were blocked and then incubated overnight
with primary antibody in TBST-5% BSA, followed by incubation with
appropriate HRP-conjugated secondary antibody. Signals were
visualized with ECL. The following primary antibodies were used:
anti-phospho-tyrosin (9416), anti-pERK1/2 (4370), anti-ERK1/2
(9102), anti-pCREB (9198), anti-CREB (4820), anti-Cleaved Caspase-3
(Asp175) (9661) (all from Cell Signaling), and anti-tACE (H-300):
sc-13973 and anti-CHD5 (H-185): sc-68390 from Santa Cruz; the
anti-osteocalcin was described in Ferron et al., 2010, Biochem.
Biophys. Res. Comm. 397:691-696.
Example 33
Measurement of Intracellular Calcium
[0475] Isolated primary Leydig cells were resuspended in buffer
containing 95 mM NaCl, 4.8 mM KCl, 1.2 mM MgSO.sub.4, 1.2 mM
KH.sub.2PO.sub.4, 5.6 mM glucose, 25 mM NaHCO.sub.3, 1.7 mM
CaCl.sub.2, 0.25 mM sodium purivate, 1.times. PenStrep, 20 mM
HEPES, 0.3% BSA, pH 7.4 at 37.degree. C. (reagents from Sigma
Aldrich, except for sodium pyruvate, PenStrep and HEPES from
Invitrogen), plated at the density of 17-25000 cells/well on
96-well plate and placed in an incubator at 33.degree. C., 5%
CO.sub.2 for 2 hours. Afterward, the FLIPR dye (Calcium Plus Assay
Kit Dye, Molecular Devices) diluted in the same buffer supplemented
with 2.5 mM probenecid, pH 7.4 was exchanged for the previous
medium and incubated with the cells for an additional 30-45
minutes. Following the incubation with the dye, cells were placed
in a BD Pathway 855 High-Content Bioimager, recorded for 10-20
seconds to get baseline fluorescence, and then stimulated with
doses of osteocalcin ranging from 0.3 to 500 ng/ml as well as
control substances: medium, calcium ionophore A23187, 10% FBS, 400
.mu.M Arginine.sup.2+, 100 .mu.M ATP/UTP mix and recorded for an
additional 2-5 minutes. The probing time was varied between 1 and 5
seconds. Obtained images were analyzed for the change in
fluorescence using ImageJ 1.41.
Example 34
Chromatin Immunoprecipitation
[0476] Chromatin immunoprecipitation was performed on lysates from
TM3 Leydig cells using the ChIP AssayKit (Millipore, #17-295) and
an anti-CREB antibody (Cell Signaling, #4820). CREB binding sites
in the promoters of indicated genes were obtained from previous
bioinformatics analyzes (Zhang et al., 2005, Proc. Natl. Acad. Sci.
USA. 102:4459-4464). Binding of CREB to the indicated regions of
DNA was detected by PCR using the following primers: Cyp11a
hCRE-1364 forward 5'-CTCAGGTCTTCATGA TTGTGG-3' (SEQ ID NO:18),
reverse 5'-CGAAAGAGAGTGTATCCACC-3' (SEQ ID NO:19); Cyp11a hCRE-4176
forward 5'-CCTTTACGTGGAATAACATTCA-3' (SEQ ID NO:20), reverse
5'-ATAGGGAATCACGG TGTAGC-3' (SEQ ID NO:21); 3.beta.-HSD hCRE-993
forward 5'-GCAGCTTCAAGGATTACGTAA-3' (SEQ ID NO:22), reverse
5'-CATCTTGTGAACTGGTGGCT-3' (SEQ ID NO:23); HSD3beta hCRE-3109
forward 5'-TCCATAGA ACAGACTACCTAC-3' (SEQ ID NO:24), reverse
5'-GATCACAGCTGAGGAAGGC-3' (SEQ ID NO:25); StAR hCRE-40 forward
5'-TGATGCACCTCAGTTACTGG-3' (SEQ ID NO:26), reverse
5'-GCTGTGCATCATCA CTTGAG-3' (SEQ ID NO:27) and the region which did
not contain CREB binding sequence as a negative control forward
5'-CATACGTGCACTGTCTTAGC-3' (SEQ ID NO:28), reverse
5'-ACTCCTCCAGTAACTCCTTC-3' (SEQ ID NO:29).
Example 35
OstR, a G-Protein Coupled Receptor Transducing Osteocalcin Signals
in Leydig Cells
[0477] To better understand osteocalcin's molecular mode of action,
a search for a receptor expressed in Leydig cells that could
transduce osteocalcin's signal (OstR) was carried out. To that end,
a two-steps experimental strategy was used.
[0478] First, the signal transduction pathway used by osteocalcin
in Leydig cells was defined. For that purpose, Leydig cells were
treated with uncarboxylated osteocalcin and assayed for tyrosine
phosphorylation, ERK activation, intracellular calcium
accumulation, and cAMP production using in each case an appropriate
positive control. Osteocalcin consistently induced cAMP production
in Leydig cells to a level comparable to that induced by human
chorionic gonadotropin (hCG), the positive control, but did not
induce tyrosine phosphorylation, ERK activation, or intracellular
calcium accumulation in these cells (FIG. 15A-D). Since these data
implied that the osteocalcin receptor may be a G-protein coupled
receptor (GPCR), the second step of this experimental strategy took
advantage of the dichotomy of function of osteocalcin between males
and females. Specifically, a search was done for orphan GPCRs that
were expressed in testis at a level at least 5-fold higher than in
ovary. Twenty-two out of 103 orphan GPCRs tested were predominantly
expressed in testes; out of these 22, only 4 were enriched in
Leydig cells (FIG. 15E-F). Among them, GPRC6a stood out because its
deletion in all cells results in a metabolic and fertility
phenotype reminiscent of the one observed in Ocn-/- mice (Pi et
al., 2008, PLoS One 3:e3858).
[0479] Immunohistochemistry verified that Gprc6a is expressed only
in Leydig cells in testes and not in follicular cells of the ovary
(FIG. 15G and FIG. 21A). Post-natally, Gprc6a expression peaked
within the first week of life, when testosterone circulating levels
are elevated. Gprc6a expression then decreased but increase again
at 6 weeks of age, when circulating levels of testosterone also
rebound (FIG. 15I). Binding assays were performed on mouse testes
using biotinylated osteocalcin as a ligand. Under the conditions of
this assay, osteocalcin bound to Leydig cells and the specificity
of this binding was confirmed by several criteria (FIG. 15J).
First, there was no signal when using avidin-biotin alone; second,
there was no signal in other cellular compartments of the
testicular tubules; third, no binding was detected when using
GPRC6a-deficient testes; fourth, osteocalcin binding could be
competed away by an excess (100 fold) of unlabeled osteocalcin but
not by the same excess of hCG or of other molecules proposed as
ligands of GPRC6a (Wellendorph and Brauner-Osborne, 2004, Gene
335:37-46) (FIG. 15J). These data identify GPRC6a as a receptor of
osteocalcin in Leydig cells. Therefore, GPRC6a is also referred to
herein as OstR.
[0480] To define OstR function in Leydig cells in vivo,
OstR.sub.Leydig-/- mice were generated. Prior to analyzing these
OstR.sub.Leydig-/- mice, it was verified that OstR had been
deleted, although partially, in testis but not in other organs
(FIG. 22A-C). In OstR.sub.Leydig-/- male mice, testes size and
weight, epididymides and seminal vesicle weight, sperm count,
circulating testosterone levels, and Leydig cell area were all
reduced, as was the expression of Grth and the 3 genes controlling
testosterone biosynthesis that are regulated by osteocalcin (FIG.
16A-I). Accordingly, the number of apoptotic germ cells increased
compared to WT testes (FIG. 16J). To establish genetically that
OstR may be the signaling receptor for osteocalcin in Leydig cells,
compound mutant mice lacking one allele of Ocn and one allele of
OstR in Leydig cells only (Ocn+/-; OstR.sub.Leydig+/- mice) were
analyzed. Whether looking at testes, epididymides and seminal
vesicle weight, or sperm count, Ocn+/-; OstR.sub.Leydig+/- mice had
a phenotype identical to the one observed in OstR.sub.Leydig-/- and
Ocn.sub.Osb-/- mice (FIG. 16A-I).
Example 36
CREB is a Transcriptional Effector of Osteocalcin Signaling in
Leydig Cells
[0481] The observations that cAMP production increases in Leydig
cells treated with osteocalcin and that OstR is a GPCR implied that
CREB could be a transcriptional mediator of osteocalcin functions
in Leydig cells. The fact that osteocalcin treatment of Leydig
cells favors CREB phosphorylation supported this hypothesis (FIG.
17A). This contention was tested further through the generation of
mice lacking CREB in Leydig cells only (Creb.sub.Leydig-/-
mice).
[0482] Twelve week-old Creb.sub.Leydig-/- male mice displayed a
reduction in testis size and weight, in epididymides and seminal
vesicle weight, in sperm count, and in circulating testosterone
levels similar to the one seen in Ocn-/- and OstR.sub.Leydig-/-
mice (FIG. 17B-G). Creb.sub.Leydig-/- mice also demonstrated a
strong decrease in the expression of Grth and of the 4 genes
involved in testosterone biosynthesis whose expression is regulated
by osteocalcin (FIG. 17H-I). In agreement with these data, binding
sites for CREB were identified in the promoters of Cyp11a,
3.beta.-HSD and StAR (Zhang et al., 2005, Proc. Natl. Acad. Sci.
USA. 102:4459-4464) and CREB could bind to those promoter sites
(FIG. 17J). To establish that CREB acts downstream of OstR in
Leydig cells to regulate male fertility, compound heterozygous mice
lacking one copy of Creb and one copy of OstR in Leydig cells were
generated. The fertility phenotype of these Creb.sub.Leydig+/-;
OstR.sub.Leydig+/- male mice was similar to that observed in
Creb.sub.Leydig-/- or OStR.sub.Leydig cell-/- male mice (FIG.
17B-G). This decrease in male fertility was not observed in single
heterozygous mutant mice. Thus, CREB is a transcriptional mediator
of osteocalcin regulation of testosterone biosynthesis in Leydig
cells.
SEQUENCE LISTINGS
TABLE-US-00003 [0483] Human Osteocalcin cDNA SEQUENCE ID NO: 1
cgcagccacc gagacaccat gagagccctc acactcctcg ccctattggc cctggccgca
ctttgcatcg ctggccaggc aggtgcgaag cccagcggtg cagagtccag caaaggtgca
gcctttgtgt ccaagcagga gggcagcgag gtagtgaaga gacccaggcg ctacctgtat
caatggctgg gagccccagt cccctacccg gatcccctgg agcccaggag ggaggtgtgt
gagctcaatc cggactgtga cgagttggct gaccacatcg gctttcagga ggcctatcgg
cgcttctacg gcccggtcta gggtgtcgct ctgctggcct ggccggcaac cccagttctg
ctcctctcca ggcacccttc tttcctcttc cccttgccct tgccctgacc tcccagccct
atggatgtgg ggtccccatc atcccagctg ctcccaaata aactccagaa gaggaatctg
aaaaaaaaaa aaaaaaaa Human Osteocalcin amino acid sequence SEQUENCE
ID NO: 2 MRALTLLALL ALAALCIAGQ AGAKPSGAES SKGAAFVSKQ EGSEVVKRPR
RYLYQWLGAP VPYPDPLEPR REVCELNPDC DELADHIGFQ EAYRRFYGPV Mouse
osteocalcin gene 1 cDNA SEQUENCE ID NO: 3 agaacagaca agtcccacac
agcagcttgg cccagaccta gcagacacca tgaggaccat ctttctgctc actctgctga
ccctggctgc gctctgtctc tctgacctca cagatgccaa gcccagcggc cctgagtctg
acaaagcctt catgtccaag caggagggca ataaggtagt gaacagactc cggcgctacc
ttggagcctc agtccccagc ccagatcccc tggagcccac ccgggagcag tgtgagctta
accctgcttg tgacgagcta tcagaccagt atggcttgaa gaccgcctac aaacgcatct
atggtatcac tatttaggac ctgtgctgcc ctaaagccaa actctggcag ctcggctttg
gctgctctcc gggacttgat cctccctgtc ctctctctct gccctgcaag tatggatgtc
acagcagctc caaaataaag ttcagatgag gaagtgcaaa aaaaaaaaaa aaaa Mouse
osteocalcin gene 2 cDNA SEQUENCE ID NO: 4 gaacagacaa gtcccacaca
gcagcttggt gcacacctag cagacaccat gaggaccctc tctctgctca ctctgctggc
cctggctgcg ctctgtctct ctgacctcac agatcccaag cccagcggcc ctgagtctga
caaagccttc atgtccaagc aggagggcaa taaggtagtg aacagactcc ggcgctacct
tggagcctca gtccccagcc cagatcccct ggagcccacc cgggagcagt gtgagcttaa
ccctgcttgt gacgagctat cagaccagta tggcttgaag accgcctaca aacgcatcta
cggtatcact atttaggacc tgtgctgccc taaagccaaa ctctggcagc tcggctttgg
ctgctctccg ggacttgatc ctccctgtcc tctctctctg ccctgcaagt atggatgtca
cagcagctcc aaaataaagt tcagatgagg Mouse osteocalcin gene 1 and 2
amino acid sequence SEQUENCE ID NO: 5 MRTLSLLTLL ALAALCLSDL
TDPKPSGPES DKAFMSKQEG NKVVNRLRRY LGASVPSPDP LEPTREQCEL NPACDELSDQ
YGLKTAYKRI YGITI Human gamma-carboxylase cDNA SEQUENCE ID NO: 6
gtgacccacc tgcctcctcc gcagagcaat ggcggtgtct gccgggtccg cgcggacctc
gcccagctca gataaagtac agaaagacaa ggctgaactg atctcagggc ccaggcagga
cagccgaata gggaaactct tgggttttga gtggacagat ttgtccagtt ggcggaggct
ctgaatcgac caacggaccc tgcaagctta gctgtctttc gttttctttt tgggttcttg
atggtgctag acattcccca ggagcggggg ctcagctctc tggaccggaa gggctggatg
tgtgccgctt ccccttgctg gatgccctac gcccactgcc atgtatcttg tctacaccat
catgtttctg ggggcactgg gcatgatgct taccggataa gctgtgtgtt attcctgctg
ccatactggt atgtgtttct cctggacaag acatcatgga acaaccactc ctatctgtat
gggttgttgg cctttcagct gatgcaaacc actactggtc tgtggacggt ctgctgaatg
cccataggag gtgccccttt ggaactatgc agtgctccgt ggccagatct tcattgtgta
cttcattgcg ggtgtgaaaa agctggatgc agactgggtt gaaggctatt ccatggaata
tttgtcccgg cactggctct tcagtccctt caaactgctg ttgtctgagg agctgactag
cctgctggtc gtgcactggg gtgggctgct gcttgacctc tcagctggtt tcctgctctt
ttttgatgtc tcaagatcca ttggcctgtt ctttgtgtcc tacttccact gcatgaattc
ccagcttttc agcattggta tgttctccta cgtcatgctg gccagcagcc ctctcttctg
ctcccctgag tggcctcgga agctggtgtc ctactgcccc cgaaggttgc aacaactgtt
gcccctcaag gcagcccctc agcccagtgt ttcctgtgtg tataagagga gccggggcaa
aagtggccag aagccagggc tgcgccatca gctgggagct gccttcaccc tgctctacct
cctggagcag ctattcctgc cctattctca ttttctcacc cagggctata acaactggac
aaatgggctg tatggctatt cctgggacat gatggtgcac tcccgctccc accagcacgt
gaagatcacc taccgtgatg gccgcactgg cgaactgggc taccttaacc ctggggtatt
tacacagagt cggcgatgga aggatcatgc agacatgctg aagcaatatg ccacttgcct
gagccgcctg cttcccaagt ataatgtcac tgagccccag atctactttg atatttgggt
ctccatcaat gaccgcttcc agcagaggat ttttgaccct cgtgtggaca tcgtgcaggc
cgcttggtca ccctttcagc gcacatcctg ggtgcaacca ctcttgatgg acctgtctcc
ctggagggcc aagttacagg aaatcaagag cagcctagac aaccacactg aggtggtctt
cattgcagat ttccctggac tgcacttgga gaattttgtg agtgaagacc tgggcaacac
tagcatccag ctgctgcagg gggaagtgac tgtggagctt gtggcagaac agaagaacca
gactcttcga gagggagaaa aaatgcagtt gcctgctggt gagtaccata aggtgtatac
gacatcacct agcccttctt gctacatgta cgtctatgtc aacactacag agcttgcact
ggagcaagac ctggcatatc tgcaagaatt aaaggaaaag gtggagaatg gaagtgaaac
agggcctcta cccccagagc tgcagcctct gttggaaggg gaagtaaaag ggggccctga
gccaacacct ctggttcaga cctttcttag acgccaacaa aggctccagg agattgaacg
ccggcgaaat actcctttcc atgagcgatt cttccgcttc ttgttgcgaa agctctatgt
ctttcgccgc agcttcctga tgacttgtat ctcacttcga aatctgatat taggccgtcc
ttccctggag cagctggccc aggaggtgac ttatgcaaac ttgagaccct ttgaggcagt
tggagaactg aatccctcaa acacggattc ttcacattct aatcctcctg agtcaaatcc
tgatcctgtc cactcagagt tctgaagggg gccagatgtt gggtgcagat gtagaagcag
ccagtcacag acccattcta tgcaatggac atttatttga aaaaaattct caaaagtttt
tttttttttt ttgggggggc ggggttctaa agctgttttt aactccgaga ttacaactta
gaggaaccaa ggaaataaag caaataagat ttaacaaccc aagattaaga ggccaggaag
aggttagacg caatgtgaaa ctgtcctcct aggataaggt ttaaagtggc tttttggggg
ctgggtgccg tggctcacgc ctgtaatccc agcattttgg gaggctgagg tgggcagatc
acttgaggcc aggagttcga gaccagcctg gccaacatgg caaaacccct tctctactaa
aaatacaaaa attagccaga cgtggtggtg ggtgcctgta atccaactac ccaggaggct
gaggcatgag aatcgcttgg gcccaggagg tggaggttgc agtgagccga gatcgagcca
ctgcactcct gggcaacaga gcaagacttc gtctcaaaat aaataaataa agtggctctt
ggggaaaagc aatttaatgt accacgatga atagctaact gttcccaagt gtttgctatg
tgcaacacac cgcgtgagca gtgttacctg cattattaca ttaggctgag aggtaaaata
atttgcccga agacatacag ctagtgacga atggactgat ggtttgaact taacgtctat
ttgacttaag gtcctgcacc ctgccacttg taattttcag aatcactgat aatctgaaat
aatgcagctt aaaacatgtt ttcttaatta aaagtataaa aaaaaaaaaa aaaaaaaaaa
aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaa Human
gamma-carboxylase amino acid sequence SEQUENCE ID NO.: 7 MAVSAGSART
SPSSDKVQKD KAELISGPRQ DSRIGKLLGF EWTDLSSWRR LVTLLNRPTD PASLAVFRFL
FGFLMVLDIP QERGLSSLDR KYLDGLDVCR FPLLDALRPL PLDWMYLVYT IMFLGALGMM
LGLCYRISCV LFLLPYWYVF
LLDKTSWNNH SYLYGLLAFQ LTFMDANHYW SVDGLLNAHR RNAHVPLWNY AVLRGQIFIV
YFIAGVKKLD ADWVEGYSME YLSRHWLFSP FKLLLSEELT SLLVVHWGGL LLDLSAGFLL
FFDVSRSIGL FFVSYFHCMN SQLFSIGMFS YVMLASSPLF CSPEWPRKLV SYCPRRLQQL
LPLKAAPQPS VSCVYKRSRG KSGQKPGLRH QLGAAFTLLY LLEQLFLPYS HFLTQGYNNW
TNGLYGYSWD MMVHSRSHQH VKITYRDGRT GELGYLNPGV FTQSRRWKDH ADMLKQYATC
LSRLLPKYNV TEPQIYFDIW VSINDRFQQR IFDPRVDIVQ AAWSPFQRTS WVQPLLMDLS
PWRAKLQEIK SSLDNHTEVV FIADFPGLHL ENFVSEDLGN TSIQLLQGEV TVELVAEQKN
QTLREGEKMQ LPAGEYHKVY TTSPSPSCYM YVYVNTTELA LEQDLAYLQE LKEKVENGSE
TGPLPPELQP LLEGEVKGGP EPTPLVQTFL RRQQRLQEIE RRRNTPFHER FFRFLLRKLY
VFRRSFLMTC ISLRNLILGR PSLEQLAQEV TYANLRPFEA VGELNPSNTD SSHSNPPESN
PDPVHSEF Mouse gamma-carboxylase cDNA SEQUENCE ID NO: 8 agacagcaag
tctaagtctg gaggttccac tgggtccgac ctggctgcag agaggctcac ctgtccctgc
agtcatggct gtgcaccgcg gctccgcact ggttgctccc gcctcagata aagtacagaa
aaacaagtct gcacagacat caggactgaa acagggcagc cgaatggaga aaattttagg
gtttgaatgg acagatttat ctagctggca gagtgtcgtg accctgctta acaaaccaac
ggaccctgca aacctggctg tctttcgttt tctctttgct ttcttgatgc tgctggacat
tccccaggaa cgcggcctta gctccctgga ccgaaaatac ttggatgggc tggatgtgtg
ccgtttcccc ttgctggatg ccttgcgccc actgccactg gactggatgt atcttgtcta
caccatcatg tttctggggg cactgggcat gatgctgggg ctatgctacc ggctaagctg
tgtgttattc ctgctaccgt actggtacgt gtttctcctg gacaagactt cgtggaacaa
tcactcctat ctgtatggtt tgttggcctt tcagttgaca ttcatggatg caaaccacta
ctggtctgtg gatggcttgc tgaatgcccg aaagaagaat gctcacgtgc ccctttggaa
ctacacagtt ctgcgtggcc agatcttcat cgtgtacttc atcgcgggtg tgaagaagct
cgatgctgac tgggttgggg gctactccat ggagcacctg tcccggcact ggctcttcag
tcccttcaag ctggtgttgt cggaggagct gacaagcctg ctggtagtac actggtgtgg
gcttctcctt gacctctcgg ctggcttcct gctcttcttt gatgcctcca gacccgtcgg
cctgttcttc gtgtcctact ttcactgcat gaactcgcag ctcttcagca tcgggatgtt
tccctatgtc atgctggcca gcagccctct cttctgctca gctgaatggc ctcggaagtt
ggtagcccga tgcccgaaaa ggctgcaaga gctgctgccc accaaagccg ctcctcggcc
tagtgcttcc tgtgtgtata agaggtcccg gggcaaagct ggcccgaagc ccgggctgcg
ccaccagctg ggagccatct tcaccctgct ctacctccta gagcagctct tcctgcccta
ttcccacttc ctgacccagg gttacaataa ctggacaaat gggctgtatg gctattcctg
ggacatgatg gtgcactccc gctcccacca gcacgtaaag atcacctacc gcgacggcct
cacgggcgag ctaggctacc ttaaccctgg ggtattcaca cagagccggc gatggaagga
tcatgcagac atgctgaagc aatatgccac ttgcctgagc ctcctgcttc ccaagtacaa
tgtcactgag ccccagatct actttgatat ttgggtctcc atcaatgacc gcttccagca
gaggcttttt gaccctcgtg tggacatcgt gcaggctgtc tggtccccct tccagcgcac
accttgggtg cagccactct tgatggattt atctccctgg aggaccaagt tacaggatat
taagagcagt ctggacaacc acaccgaggt ggtcttcatt gcagatttcc ctgggcttca
cttggagaat tttgtgagtg aagacctggg caacactagc atccagctgc tgcagggaga
agtcaccgtg gaattggtgg cagaacagaa aaatcagact cttcaagaag gagagaaaat
gcagttgcct gctggagagt accataaagt ctatactgta tcatctagtc cttcctgcta
catgtacgtc tatgtcaaca ctacagaggt cgcactggag caagacctgg catatctgca
agaattaaag gagaaggtgg agaacggaag tgaaacaggg cccctgcctc cagaacttca
gcctcttttg gaaggggaag taaaaggggg ccctgagcca acacctctgg tccaaacttt
tctcagacga cagaggaagc tccaagaaat tgaacgcagg cgaaatagcc ctttccatga
gcgatttctc cgcttcgtgc tgcgaaagct ctacgtcttt cgacgcagct tcctgatgac
tcgaatttca ctccgaaacc tgctattagg ccgcccttcc ctagagcaac tagcccaaga
ggtgacatat gcaaacttgc gaccatttga accagttgat gagtcaagtg cttcaaacac
agattcttca aatcacccgt cagagccaga ttctgagcat gttcactctg agttctgagg
gatgtacaga tgctctgtgc agatgtgggg gcagcctgtt ataggcttat tgtctacgca
aagaacatat ttttggagaa aaatgatatg ggacaggctt tcacagtaca gcccaggctg
gcctcaaact catggttggt ccctctgctt cagcctgttt tgtaattaca tagtatcacc
aaacctagtt gcttttccct ttacattttt tccccttata agttctttaa aattatagct
tacatttttt cttttttctt tttttttttt ttgtattttt tctttgtcaa gacaggtctc
tctctgtgta gcactggctg tcctggaact cactctgtag tccaggctgg cctccaactc
agaaattctc ctgcctctgc ctcccaagtg ctgggattaa aggtgtgtgc caccacgccc
cactgggctt ttagttttta tagacaagat ttctccatgt agaccagacc agctctcctg
agtgctgaaa ttaaaggcac gggacatcac tacctggctt tcttattaaa cttgttttag
tggtctcaac aaaaa Mouse gamma-carboxylase amino acid sequence
SEQUENCE ID NO: 9 MAVHRGSALV APASDKVQKN KSAQTSGLKQ GSRMEKILGF
EWTDLSSWQS VVTLLNKPTD PANLAVFRFL FAFLMLLDIP QERGLSSLDR KYLDGLDVCR
FPLLDALRPL PLDWMYLVYT IMFLGALGMM LGLCYRLSCV LFLLPYWYVF LLDKTSWNNH
SYLYGLLAFQ LTFMDANHYW SVDGLLNARK KNAHVPLWNY TVLRGQIFIV YFIAGVKKLD
ADWVGGYSME HLSRHWLFSP FKLVLSEELT SLLVVHWCGL LLDLSAGFLL FFDASRPVGL
FFVSYFHCMN SQLFSIGMFP YVMLASSPLF CSAEWPRKLV ARCPKRLQEL LPTKAAPRPS
ASCVYKRSRG KAGPKPGLRH QLGAIFTLLY LLEQLFLPYS HFLTQGYNNW TNGLYGYSWD
MMVHSRSHQH VKITYRDGLT GELGYLNPGV FTQSRRWKDH ADMLKQYATC LSLLLPKYNV
TEPQIYFDIW VSINDRFQQR LFDPRVDIVQ AVWSPFQRTP WVQPLLMDLS PWRTKLQDIK
SSLDNHTEVV FIADFPGLHL ENFVSEDLGN TSIQLLQGEV TVELVAEQKN QTLQEGEKMQ
LPAGEYHKVY TVSSSPSCYM YVYVNTTEVA LEQDLAYLQE LKEKVENGSE TGPLPPELQP
LLEGEVKGGP EPTPLVQTFL RRQRKLQEIE RRRNSPFHER FLRFVLRKLY VFRRSFLMTR
ISLRNLLLGR PSLEQLAQEV TYANLRPFEP VDESSASNTD SSNHPSEPDS EHVHSEF
Mouse Esp (OST-PTP, Ptprv) cDNA SEQUENCE ID NO: 10 ggctgtggga
gagcagaaga ggagctggaa gagcagccta caacagctgt cgggagggac cagggctagt
tcacacttgg aagctgggat gccaggaccg gccctcctgc ctctctcggt ctccatcggc
ctcctggtca gctcactcca cactgagacg attctgaagt aagatgctcc tggctcctca
cagactctgc tacaagagac agagtgaagt gtccccaggg ctcagagcct ttgactctgc
tccttccctt cccacggctg agttggcaca ggagcacctg ggtgagctgc accagactta
agaagatgag gcccctgatt ctgttagctg ccctcctctg gctccaggac tctttggccc
aggaagatgt atgctcatcc ttggatggga gcccagacag gcagggtgga ggtccacctc
tgagtgtgaa cgtcagcagc cgcggaaagc ctaccagcct gtttctgagc tgggtagctg
cagagccagg tggatttgac tatgccctct gcctcagggc tatgaacttg tcgggttttc
cagaagggca acagctccaa gctcatacca acgagtccag ctttgagttc catggcctgg
tgccagggag tcgctaccag ctggaactga ctgtcctaag accctgttgg cagaatgtca
caattaccct cactgctcga actgccccta cagtggtccg tggactgcaa ctgcatagca
ctgggagccc agccagcctg gaagcctcat ggagcgatgc ctctggggat caagacagct
atcaacttct cctctaccac ccggaatccc acactctggc atgtaatgtc tctgtgtccc
ctgacaccct gtcttacaat tttggtgacc tcttgccagg tagtcagtat gtcttggagg
ttatcacctg ggctggcagt ctccatgcga agactagcat cctccaatgg acagagcctg
tccctcctga tcacctaaca ctgcgtgcct tgggtaccag tagcctgcaa gccttctgga
acagctctga aggggccacc
tggtttcacc tgatacttac agacctccta gagggtacca acctgaccaa agtggtcaga
caaggcatct caacccacac cttccttcgc ctgtctccgg gtacacctta ccagctgaag
atctgtgctg ctgctgggcc ccaccagatt tggggaccca atgccactga gtggacctat
ccctcttacc catctgacct ggtgctgacc cccttatgga atgagctctg ggcaagctgg
aaggcagggc agggagcccg ggatggctat gtactgaagt taagtgggcc agtggagaat
acaactactc tgggtcctga ggagtgcaac gctgtcttcc cagggcccct gcctccagga
cactacactt tggggctgag ggttctagct ggaccttatg atgcctgggt agagggcagt
atctggctgg ctgaatctgc tgctcgtccc atggaggtcc ctggtgccag actgtggcta
gaaggactgg aagctactaa gcaacctggg agacgggcgc tgctctattc tgttgatgcc
ccaggcctcc tagggaacat ctctgtgtct tctggtgcca ctcatgtcac cttctgtggc
ttggtacccg gagcgcacta cagggtggac attgcctcat ccatgggaga catcactcag
agcctcacag gctacacaag tcccctgcca ccacagtctc tggagatcat cagccggaac
agcccatctg acctgactat cggttgggct ccagcaccag ggcagatgga aggttataag
gtcacctggc atcaggatgg cagccagagg tcacctggcg accttgttga cttgggccct
gacatttcga gcctgactct gaaatctctg gtacctggtt cctgctacac cgtgtcagca
tgggcctggt ctgggaacct cagctctgac tctcagaaga ttcacagttg cacccgtccc
gctcctccca ccaacctgag cctgggcttt gcccaccagc ctgcaacact gagggcttcc
tggtgtcacc caccgggtgg cagggatgcc tttcagttac ggctttacag gctgaggccc
ctgacactgg aaagtgagaa gatcctatcc caggaggccc agaacttctc ctgggcccag
ctgcctgcag gctatgaatt ccaggtacag ctgtctacct tgtgggggtc ggaggagagc
ggcagtgcca acaccacagg ctggacaccc ccctcagctc ctacattggt aaatgtgacc
agtgaagccc ccacccagct ccacgtatcc tgggtccacg ctgctgggga ccggagcagc
taccaagtga ccctatacca ggagagcact cggacagcca ccagcattgt ggggcccaag
gcagacagca caagcttttg gggtttgact cctggcacta agtacaaggt ggaagccatc
tcctgggctg ggccccttta cactgcagca gccaacgttt ctgcttggac ctacccactc
acacccaatg agctgctcgc ctctatgcag gcaggcagtg ctgtggttaa cctggcctgg
cccagtggtc ccttggggca agggacatgc catgcccaac tctcagatgc tggacacctt
tcatgggagc aaccgctgtc gctaggccaa gacctcctca tgctaaggaa tcttatacca
ggacatacgg tttcattgtc tgtgaagtgt cgggcaggac cactccaggc ctccactcac
cccctggtgc tgtctgtaga gcctggccct gtggaagatg tgttctgtca acctgaggcc
acctacctgt ccctgaactg gacgatgcct actggagatg tggctgtctg tctggtggag
gtagagcagc tggtgccagg agggagcgct cattttgtct tccaggtcaa cacctcggag
gatgcacttc tgctgcccaa cttgacgccc accacttctt accgccttag cctcactgtg
ctgggtggga atcgccagtg gagccgggcg gttaccctgg tgtgcactac ttctgctgag
gtttggcacc ccccagagct agctgaggcc ccccaggtgg agctggggac agggatgggt
gtgacagtca cacgtggcat gtttggtaaa gatgacgggc agatccagtg gtatggcata
attgccacca tcaacatgac actggcccag ccttcccagg aagccatcaa ccacacatgg
tatgaccact actatagagg acatgactcc tacctggctc tcctgttccc aaaccccttc
tacccagagc cttgggctgt gccaagatcc tggacagtac ctgtgggtac agaggactgt
gacaacaccc aggagatatg caatgggcat ctcaagccag gcttccagta taggttcagc
attgcagcct ttagtaggct cagctctcca gagaccatcc tggccttctc cgccttctca
gagcctcagg ctagcatctc tctggtggcc atgcccctga cagttatgat ggggactgtg
gtgggctgca tcatcattgt gtgtgcagtg ctatgcttgt tgtgccggcg gcgcctgaag
ggaccaaggt cagagaagaa tggcttttcc caggagttga tgccttacaa cctgtggcgg
acccatcggc ccatccccag ccatagcttc cggcagagct atgaggccaa gagtgcacgt
gcacaccagg ccttcttcca ggaatttgag gagctgaagg aggtgggcaa ggaccagccc
agactagagg ctgagcatcc tgccaacatc accaagaacc ggtacccaca cgtgctacct
tatgaccact ccagggtcag gctgacccag ctatcaggag agcctcattc tgactacatc
aatgccaact tcatcccagg ctatagccac ccacaggaga tcattgccac ccaggggcct
ctcaaaaaga cggtcgagga cttctggcgg ttggtgtggg agcagcaagt ccacgtgatc
atcatgctaa ctgtgggcat ggagaatggg cgggtactgt gtgagcacta ctggccagtc
aactccacgc ctgtcaccca cggtcacatc accacccacc tcctggcaga ggaatctgag
gacgagtgga ccaggaggga attccagctg cagcacggtg cagagcaaaa acagaggcgc
gtgaagcagc tgcagttcac gacctggcca gaccacagtg tccccgaggc tcccagctct
ctgctcgctt ttgtggaact ggtgcaggag gaggtgaagg caactcaggg caaggggccc
atcctggtgc attgcagtgc gggtgtgggc aggacaggca cctttgtggc tctcttaccg
gctgttcgac aactagagga agaacaggtg gtcgatgtgt tcaacactgt gtacatactc
cggctgcacc ggcccctcat gatccagacc ttgagtcaat acatcttcct gcacagctgc
ctgctgaaca agattctgga agggccctct gacgcctcag actccggccc catccctgtg
atgaattttg cacaagcttg tgccaagagg gcagccaatg ccaatgccgg tttcttgaag
gagtacaggc tcctgaagca ggccatcaag gatgagactg gctctctgct gccctctcct
gactataatc agaacagcat cgcctcctgt catcattctc aggagcagtt ggccctggtg
gaggagagcc ctgctgataa catgctggca gcctcgctct tccctggtgg gccgtctggt
cgcgaccatg tggtgctgac tggctcggcc ggaccaaagg aactctggga aatggtgtgg
gaacatggcg cctatgtgct tgtctccctg ggtctgcctg ataccaagga gaagccacaa
gacatctggc caatggagat gcagcctatt gtcacagaca tggtgacagt gcacagagtg
gctgagagca acacagctgg ctggcccagt accctcatca gagttataca tggggacagt
gggacggaaa ggcaggttca atgcctgcag tttccacact gcgagactgg gagtgagctc
ccagctaaca ccctactgac cttccttgat gctgtgggcc agtgctgctc ccggggcaat
agcaagaagc cagggaccct gctcagtcac tccagcaagg tcacaaacca gctgagcacc
ttcttggcta tggaacagct gctacagcaa gcagggaccg agcgcacagt ggatgtcttc
agtgtggccc tgaagcagac acaggcctgt ggccttaaga ccccaacgct ggagcagtat
atctacctct acaactgtct gaacagcgca ttgaggaaca ggctgccccg agctaggaag
tgaccttgcc ctgctaggca tcacgttcca gcaatccacc caggcctggc ttccccagga
gaacagatct attcggcctc acgctgtcaa agggcagagt ctgggaataa agggtaaatc
tcgag Mouse Esp (OST-PTP, Ptprv) amino acid sequence SEQUENCE ID
NO: 11 MRPLILLAAL LWLQDSLAQE DVCSSLDGSP DRQGGGPPLS VNVSSRGKPT
SLFLSWVAAE PGGFDYALCL RAMNLSGFPE GQQLQAHTNE SSFEFHGLVP GSRYQLELTV
LRPCWQNVTI TLTARTAPTV VRGLQLHSTG SPASLEASWS DASGDQDSYQ LLLYHPESHT
LACNVSVSPD TLSYNFGDLL PGSQYVLEVI TWAGSLHAKT SILQWTEPVP PDHLTLRALG
TSSLQAFWNS SEGATWFHLI LTDLLEGTNL TKVVRQGIST HTFLRLSPGT PYQLKICAAA
GPHQIWGPNA TEWTYPSYPS DLVLTPLWNE LWASWKAGQG ARDGYVLKLS GPVENTTTLG
PEECNAVFPG PLPPGHYTLG LRVLAGPYDA WVEGSIWLAE SAARPMEVPG ARLWLEGLEA
TKQPGRRALL YSVDAPGLLG NISVSSGATH VTFCGLVPGA HYRVDIASSM GDITQSLTGY
TSPLPPQSLE IISRNSPSDL TIGWAPAPGQ MEGYKVTWHQ DGSQRSPGDL VDLGPDISSL
TLKSLVPGSC YTVSAWAWSG NLSSDSQKIH SCTRPAPPTN LSLGFAHQPA TLRASWCHPP
GGRDAFQLRL
YRLRPLTLES EKILSQEAQN FSWAQLPAGY EFQVQLSTLW GSEESGSANT TGWTPPSAPT
LVNVTSEAPT QLHVSWVHAA GDRSSYQVTL YQESTRTATS IVGPKADSTS FWGLTPGTKY
KVEAISWAGP LYTAAANVSA WTYPLTPNEL LASMQAGSAV VNLAWPSGPL GQGTCHAQLS
DAGHLSWEQP LSLGQDLLML RNLIPGHTVS LSVKCRAGPL QASTHPLVLS VEPGPVEDVF
CQPEATYLSL NWTMPTGDVA VCLVEVEQLV PGGSAHFVFQ VNTSEDALLL PNLTPTTSYR
LSLTVLGGNR QWSRAVTLVC TTSAEVWHPP ELAEAPQVEL GTGMGVTVTR GMFGKDDGQI
QWYGIIATIN MTLAQPSQEA INHTWYDHYY RGHDSYLALL FPNPFYPEPW AVPRSWTVPV
GTEDCDNTQE ICNGHLKPGF QYRFSIAAFS RLSSPETILA FSAFSEPQAS ISLVAMPLTV
MMGTVVGCII IVCAVLCLLC RRRLKGPRSE KNGFSQELMP YNLWRTHRPI PSHSFRQSYE
AKSARAHQAF FQEFEELKEV GKDQPRLEAE HPANITKNRY PHVLPYDHSR VRLTQLSGEP
HSDYINANFI PGYSHPQEII ATQGPLKKTV EDFWRLVWEQ QVHVIIMLTV GMENGRVLCE
HYWPVNSTPV THGHITTHLL AEESEDEWTR REFQLQHGAE QKQRRVKQLQ FTTWPDHSVP
EAPSSLLAFV ELVQEEVKAT QGKGPILVHC SAGVGRTGTF VALLPAVRQL EEEQVVDVFN
TVYILRLHRP LMIQTLSQYI FLHSCLLNKI LEGPSDASDS GPIPVMNFAQ ACAKRAANAN
AGFLKEYRLL KQAIKDETGS LLPSPDYNQN SIASCHHSQE QLALVEESPA DNMLAASLFP
GGPSGRDHVV LTGSAGPKEL WEMVWEHGAY VLVSLGLPDT KEKPQDIWPM EMQPIVTDMV
TVHRVAESNT AGWPSTLIRV IHGDSGTERQ VQCLQFPHCE TGSELPANTL LTFLDAVGQC
CSRGNSKKPG TLLSHSSKVT NQLSTFLAME QLLQQAGTER TVDVFSVALK QTQACGLKTP
TLEQYIYLYN CLNSALRNRL PRARK Mature human osteocalcin amino acid
sequence SEQUENCE ID NO: 12 YLYQWLGAPV PYPDPLEPRR EVCELNPDCD
ELADHIGFQE AYRRFYGPV human osteocalcin variant amino acid sequence
SEQUENCE ID NO: 13 YLYQWLGAPV PYPDPLX1PRR X2VCX3LNPDCD ELADHIGFQE
AYRRFYGPV SEQUENCE ID NO: 14 Rat Esp (OST-PTP, Ptprv) cDNA 1
agaacagcct acaacagctg ccttccggga gggaccaggc tagttcacac ttggaagttg
61 ggatgccagg agcagccttc tgtcttccga ggccttcctg ggtctcctgg
tcagctcatt 121 ccacactgag atgattctaa agaaagatcc tcacacagac
tctgctggaa gaaacaaagt 181 gaagtgtccc cagactttat caggatgagg
cccctgattc tgttagctgc cctcctctgg 241 ctccagggct ttttggccga
ggacgacgca tgctcatcct tggaagggag cccagacagg 301 cagggtggag
gtccacttct gagtgtgaac gtcagtagcc atggaaagtc taccagcctg 361
tttctgagct gggtagctgc agagctgggc ggatttgact atgccctcag cctcaggagt
421 gtgaactcct caggttctcc agaagggcaa cagctccagg ctcacacaaa
tgagtccggc 481 tttgagttcc atggcctggt gccagggagt cgctaccagc
taaaactgac tgtcctaaga 541 ccctgttggc agaatgtcac aattaccctc
actgcccgaa ctgccccgac agtggtccgt 601 ggactgcagc tgcatagcgc
tgggagccca gccaggctgg aagcctcgtg gagtgatgcc 661 cctggagatc
aagacagcta ccaacttctc ctctaccacc tggaatccca aactctggca 721
tgcaatgtct ctgtgtcccc tgacaccctg tcttacagtt ttggcgacct tttgccaggt
781 actcagtatg tcttggaggt tatcacctgg gctggcagtc tccatgcgaa
gactagtatc 841 ctccagtgga cagagcctgt ccctcctgat cacctagcac
tacgtgcctt gggtaccagt 901 agcctgcaag ccttctggaa cagctctgaa
ggggccacct cgtttcacct gatgctcaca 961 gacctcctcg ggggcaccaa
cacgactgcg gtgatcagac aaggggtctc gacccacacc 1021 tttcttcacc
tatctccggg tacacctcat gagctgaaga tttgtgcttc tgctgggccc 1081
caccagatct ggggacccag tgccaccgag tggacctatc cctcttaccc atctgacctg
1141 gtgctgactc ccttacggaa tgagctctgg gccagctgga aggcagggct
gggagcccgg 1201 gacggctatg tactgaagtt aagtgggcca atggagagta
cgtctaccct gggcccggaa 1261 gagtgcaatg cagtcttccc agggcccctg
cctccgggac actacacttt gcagctgaag 1321 gttctagctg gaccttatga
tgcctgggtg gagggcagta cctggctggc tgaatctgct 1381 gcccttccca
gggaggtccc tggtgccaga ctgtggctag atggactgga agcttccaag 1441
cagcctggga gacgggcgct actctattct gacgatgccc caggctccct agggaacatc
1501 tctgtgccct ctggtgccac tcacgtcatt ttctgtggcc tggtacctgg
agcccactat 1561 agggtggaca ttgcctcatc cacgggggac atctctcaga
gcatctcagg ctatacaagt 1621 cccctgccac cgcagtcact ggaggtcatc
agcaggagca gcccatctga cctgactatt 1681 gcttggggtc cagcaccagg
gcagctggaa ggttataagg ttacctggca tcaggatggc 1741 agccagaggt
ctcctggcga ccttgttgac ttgggccctg acactttgag cctgactctg 1801
aaatctctgg tacccggctc ctgctacacc gtgtcagcat gggcctgggc cgggaacctc
1861 gactctgact ctcagaagat tcacagctgc acccgccccg ctcctcccac
caacctgagt 1921 ctgggctttg cccaccagcc tgcggcactg aaggcttcct
ggtatcaccc accgggtggc 1981 agggatgcct ttcacttacg gctttacagg
ctgaggcctc tgacactgga aagtgagaag 2041 gtcctacctc gggaggccca
gaacttctcc tgggcccagc tgactgcagg ctgtgagttc 2101 caggtacagc
tgtctacctt gtgggggtct gagagaagca gcagtgccaa cgccacaggc 2161
tggacacccc cttcagctcc tacactggta aacgtgacca gcgatgctcc tacccagctc
2221 caagtatcct gggcccacgt tcctgggggc cggagccgct accaagtgac
cctataccag 2281 gagagtaccc ggacagccac cagcatcatg gggcccaagg
aagatggcac gagctttttg 2341 ggtttgactc ctggcactaa gtacaaggtg
gaagtcatct cctgggctgg gcccctctac 2401 actgcagcag ccaacgtttc
tgcctggacc tacccactca tacccaatga gctgctcgtg 2461 tcaatgcagg
caggcagtgc tgtggttaac ctggcctggc ccagtggtcc cctggggcaa 2521
ggggcatgcc acgcccaact ctcagatgct ggacacctct catgggagca acccctgaaa
2581 ctaggccaag agctcttcat gctaagggat ctcacaccag gacataccat
ctcgatgtca 2641 gtgaggtgtc gggcagggcc gctccaggcc tctacgcacc
ttgtggtgct gtctgtggag 2701 cctggccctg tggaagatgt gctctgtcat
ccagaggcca cctacctggc cctgaactgg 2761 acgatgcctg ctggagacgt
ggatgtctgt ctggtggtgg tagagcggct ggtgccggga 2821 gggggcactc
attttgtctt ccaggtcaac acctcagggg atgctcttct gttgcccaac 2881
ttgatgccca ccacttctta ccgccttagc ctcaccgttc tgggcaggaa tagtcggtgg
2941 agccgggcgg tttccctggt gtgcagtact tctgctgagg cttggcaccc
cccagagcta 3001 gctgagcccc cccaggtgga gctggggaca gggatgggtg
tgacagtcat gcgtggcatg 3061 tttggtaaag atgacgggca gatccagtgg
tatggcataa ttgccaccat caacatgacg 3121 ctggcccagc cttcccggga
agccatcaat tacacatggt atgaccacta ctatagagga 3181 tgtgagtcct
tcctggctct cctgttccca aaccccttct acccagagcc ttgggctggg 3241
ccaagatcct ggacagtacc tgtgggtact gaggactgtg acaacaccca agagatatgc
3301 aatgggcgtc tcaagtcagg cttccagtat aggttcagcg ttgtggcctt
tagtaggctc 3361 aacactccag agaccatcct cgccttctcg gccttctcag
agccccgggc cagcatctct 3421 ctggcgatca ttcccctgac agttatgctg
ggggctgtgg tgggcagcat tgtcattgtg 3481 tgtgcagtgc tatgcttgct
ccgctggcgg tgcctgaagg gaccaagatc agagaaggat 3541 ggcttttcca
aggagctgat gccttacaac ctgtggcgga cccatcggcc tatccccatc 3601
catagcttcc ggcagagcta tgaggccaag agcgcacatg cacaccagac cttcttccag
3661 gaatttgagg agttgaagga ggtaggcaag gaccagcccc gactagaggc
tgagcatccg 3721 gacaacatca tcaagaaccg gtacccacac gtgctgccct
atgaccactc cagggtcagg 3781 ctgacccagc taccaggaga gcctcattct
gactacatca atgccaactt catcccaggc 3841 tatagccaca cacaggagat
cattgccacc caggggcctc tcaaaaagac gctagaggac 3901 ttctggcggt
tggtatggga gcagcaagtc cacgtgatca tcatgctgac tgtgggcatg 3961
gagaacgggc gggtactgtg tgagcactac tggccagcca actccacgcc tgttactcac
4021 ggtcacatca ccatccacct cctggcagag gagcctgagg atgagtggac
caggagggaa 4081 ttccagctgc agcacggtac cgagcaaaaa cagaggcgag
tgaagcagct gcagttcact 4141 acctggccag accacagtgt cccggaggct
cccagctctc tgctcgcttt tgtagaactg 4201 gtacaggagc aggtgcaggc
cactcagggc aagggaccca tcctggtgca ttgcagtgct 4261 ggcgtgggga
ggacaggcac ctttgtggct ctcttgcggc tactgcgaca actagaggaa 4321
gagaaggtgg ccgatgtgtt caacactgtg tacatactcc ggttgcaccg gcccctcatg
4381 atccagaccc tgagtcaata catcttcctg cacagttgcc tgctgaacaa
gattctggaa 4441 gggccccctg acagctccga ctccggcccc atctctgtga
tggattttgc acaggcttgt 4501 gccaagaggg cagccaacgc caatgctggt
ttcttgaagg agtacaagct cctgaagcag 4561 gccatcaagg atgggactgg
ctctctgctg ccccctcctg actacaatca gaacagcatt 4621 gtctcccgtc
gtcattctca ggagcagttc gccctggtgg aggagtgccc tgaggatagc 4681
atgctggaag cctcactctt ccctggtggt ccgtctggtt gtgatcatgt ggtgctgact
4741 ggctcagccg gaccaaagga actctgggaa atggtgtggg agcatgatgc
ccatgtgctc 4801 gtctccctgg gcctgcctga taccaaggag aagccaccag
acatctggcc agtggagatg 4861 cagcctattg tcacagacat ggtgacagtg
cacagagtgt ctgagagcaa cacaacaact 4921 ggctggccca gcaccctctt
cagagtcata cacggggaga gtggaaagga aaggcaggtt 4981 caatgcctgc
aatttccatg ctctgagtct gggtgtgagc tcccagctaa caccctactg 5041
accttccttg atgctgtggg ccagtgctgc ttccggggca agagcaagaa gccagggacc
5101 ctgctcagcc actccagcaa aaacacaaac cagctgggca ccttcttggc
tatggaacag 5161 ctgttacagc aagcagggac agagcgcaca gtggacgtct
tcaatgtggc cctgaagcag 5221 tcacaggcct gcggccttat gaccccaaca
ctggagcagt atatctacct ctacaactgt 5281 ctgaacagcg cactgctgaa
cgggctgccc agagctggga agtggcctgc gccctgctag 5341 gcgtcatgtt
ccagcaaatc cacccaggcc tgacttccct aggagagtgg atccaccggg 5401
cctcacactg tccaagggca gagtccagga ataaagagac atggtc Rat Esp
(OST-PTP, Ptprv) amino acid sequence SEQUENCE ID NO: 15
MRPLILLAALLWLQGFLAEDDACSSLEGSPDRQGGGPLLSVNVS
SHGKSTSLFLSWVAAELGGFDYALSLRSVNSSGSPEGQQLQAHTNESGFEFHGLVPGS
RYQLKLTVLRPCWQNVTITLTARTAPTVVRGLQLHSAGSPARLEASWSDAPGDQDSYQ
LLLYHLESQTLACNVSVSPDTLSYSFGDLLPGTQYVLEVITWAGSLHAKTSILQWTEP
VPPDHLALRALGTSSLQAFWNSSEGATSFHLMLTDLLGGTNTTAVIRQGVSTHTFLHL
SPGTPHELKICASAGPHQIWGPSATEWTYPSYPSDLVLTPLRNELWASWKAGLGARDG
YVLKLSGPMESTSTLGPEECNAVFPGPLPPGHYTLQLKVLAGPYDAWVEGSTWLAESA
ALPREVPGARLWLDGLEASKQPGRRALLYSDDAPGSLGNISVPSGATHVIFCGLVPGA
HYRVDIASSTGDISQSISGYTSPLPPQSLEVISRSSPSDLTIAWGPAPGQLEGYKVTW
HQDGSQRSPGDLVDLGPDTLSLTLKSLVPGSCYTVSAWAWAGNLDSDSQKIHSCTRPA
PPTNLSLGFAHQPAALKASWYHPPGGRDAFHLRLYRLRPLTLESEKVLPREAQNFSWA
QLTAGCEFQVQLSTLWGSERSSSANATGWTPPSAPTLVNVTSDAPTQLQVSWAHVPGG
RSRYQVTLYQESTRTATSIMGPKEDGTSFLGLTPGTKYKVEVISWAGPLYTAAANVSA
WTYPLIPNELLVSMQAGSAVVNLAWPSGPLGQGACHAQLSDAGHLSWEQPLKLGQELF
MLRDLTPGHTISMSVRCRAGPLQASTHLVVLSVEPGPVEDVLCHPEATYLALNWTMPA
GDVDVCLVVVERLVPGGGTHFVFQVNTSGDALLLPNLMPTTSYRLSLTVLGRNSRWSR
AVSLVCSTSAEAWHPPELAEPPQVELGTGMGVTVMRGMFGKDDGQIQWYGIIATINMT
LAQPSREAINYTWYDHYYRGCESFLALLFPNPFYPEPWAGPRSWTVPVGTEDCDNTQE
ICNGRLKSGFQYRFSVVAFSRLNTPETILAFSAFSEPRASISLAIIPLTVMLGAVVGS
IVIVCAVLCLLRWRCLKGPRSEKDGFSKELMPYNLWRTHRPIPIHSFRQSYEAKSAHA
HQTFFQEFEELKEVGKDQPRLEAEHPDNIIKNRYPHVLPYDHSRVRLTQLPGEPHSDY
INANFIPGYSHTQEIIATQGPLKKTLEDFWRLVWEQQVHVIIMLTVGMENGRVLCEHY
WPANSTPVTHGHITIHLLAEEPEDEWTRREFQLQHGTEQKQRRVKQLQFTTWPDHSVP
EAPSSLLAFVELVQEQVQATQGKGPILVHCSAGVGRTGTFVALLRLLRQLEEEKVADV
FNTVYILRLHRPLMIQTLSQYIFLHSCLLNKILEGPPDSSDSGPISVMDFAQACAKRA
ANANAGFLKEYKLLKQAIKDGTGSLLPPPDYNQNSIVSRRHSQEQFALVEECPEDSML
EASLFPGGPSGCDHVVLTGSAGPKELWEMVWEHDAHVLVSLGLPDTKEKPPDIWPVEM
QPIVTDMVTVHRVSESNTTTGWPSTLFRVIHGESGKERQVQCLQFPCSESGCELPANT
LLTFLDAVGQCCFRGKSKKPGTLLSHSSKNTNQLGTFLAMEQLLQQAGTERTVDVFNV
ALKQSQACGLMTPTLEQYIYLYNCLNSALLNGLPRAGKWPAPC Human PTP-1B cDNA
GenBank HUMPTPBX Accession no. M31724 SEQUENCE ID NO: 16 1
gggcgggcct cggggctaag agcgcgacgc ctagagcggc agacggcgca gtgggccgag
61 aaggaggcgc agcagccgcc ctggcccgtc atggagatgg aaaaggagtt
cgagcagatc 121 gacaagtccg ggagctgggc ggccatttac caggatatcc
gacatgaagc cagtgacttc 181 ccatgtagag tggccaagct tcctaagaac
aaaaaccgaa ataggtacag agacgtcagt 241 ccctttgacc atagtcggat
taaactacat caagaagata atgactatat caacgctagt 301 ttgataaaaa
tggaagaagc ccaaaggagt tacattctta cccagggccc tttgcctaac 361
acatgcggtc acttttggga gatggtgtgg gagcagaaaa gcaggggtgt cgtcatgctc
421 aacagagtga tggagaaagg ttcgttaaaa tgcgcacaat actggccaca
aaaagaagaa 481 aaagagatga tctttgaaga cacaaatttg aaattaacat
tgatctctga agatatcaag 541 tcatattata cagtgcgaca gctagaattg
gaaaacctta caacccaaga aactcgagag 601 atcttacatt tccactatac
cacatggcct gactttggag tccctgaatc accagcctca 661 ttcttgaact
ttcttttcaa agtccgagag tcagggtcac tcagcccgga gcacgggccc 721
ttgtggtgc actgcagtgc aggcatcggc aggtctggaa ccttctgtct ggctgatacc
781 tgcctcctgc tgatggacaa gaggaaagac ccttcttccg ttgatatcaa
gaaagtgctg 841 ttagaaatga ggaagtttcg gatggggttg atccagacag
ccgaccagct gcgcttctcc 901 tacctggctg tgatcgaagg tgccaaattc
atcatggggg actcttccgt gcaggatcag 961 tggaaggagc tttcccacga
ggacctggag cccccacccg agcatatccc cccacctccc 1021 cggccaccca
aacgaatcct ggagccacac aatgggaaat gcagggagtt cttcccaaat 1081
caccagtggg tgaaggaaga gacccaggag gataaagact gccccatcaa ggaagaaaaa
1141 ggaagcccct taaatgccgc accctacggc atcgaaagca tgagtcaaga
cactgaagtt 1201 agaagtcggg tcgtgggggg aagtcttcga ggtgcccagg
ctgcctcccc agccaaaggg 1261 gagccgtcac tgcccgagaa ggacgaggac
catgcactga gttactggaa gcccttcctg 1321 gtcaacatgt gcgtggctac
ggtcctcacg gccggcgctt acctctgcta caggttcctg 1381 ttcaacagca
acacatagcc tgaccctcct ccactccacc tccacccact gtccgcctct 1441
gcccgcagag cccacgcccg actagcaggc atgccgcggt aggtaagggc cgccggaccg
1501 cgtagagagc cgggccccgg acggacgttg gttctgcact aaaacccatc
ttccccggat 1561 gtgtgtctca cccctcatcc ttttactttt tgccccttcc
actttgagta ccaaatccac 1621 aagccatttt ttgaggagag tgaaagagag
taccatgctg gcggcgcaga gggaaggggc 1681 ctacacccgt cttggggctc
gccccaccca gggctccctc ctggagcatc ccaggcggcg 1741 cacgccaaca
gcccccccct tgaatctgca gggagcaact ctccactcca tatttattta 1801
aacaattttt tccccaaagg catccatagt gcactagcat tttcttgaac caataatgta
1861 ttaaaatttt ttgatgtcag ccttgcatca agggctttat caaaaagtac
aataataaat 1921 cctcaggtag tactgggaat ggaaggcttt gccatgggcc
tgctgcgtca gaccagtact 1981 gggaaggagg acggttgtaa gcagttgtta
tttagtgata ttgtgggtaa cgtgagaaga 2041 tagaacaatg ctataatata
taatgaacac gtgggtattt aataagaaac atgatgtgag 2101 attactttgt
cccgcttatt ctcctccctg ttatctgcta gatctagttc tcaatcactg 2161
ctcccccgtg tgtattagaa tgcatgtaag gtcttcttgt gtcctgatga aaaatatgtg
2221 cttgaaatga gaaactttga tctctgctta ctaatgtgcc ccatgtccaa
gtccaacctg 2281 cctgtgcatg acctgatcat tacatggctg tggttcctaa
gcctgttgct gaagtcattg 2341 tcgctcagca atagggtgca gttttccagg
aataggcatt tgctaattcc tggcatgaca 2401 ctctagtgac ttcctggtga
ggcccagcct gtcctggtac agcagggtct tgctgtaact 2461 cagacattcc
aagggtatgg gaagccatat tcacacctca cgctctggac atgatttagg 2521
gaagcaggga caccccccgc cccccacctt tgggatcagc ctccgccatt ccaagtcaac
2581 actcttcttg agcagaccgt gatttggaag agaggcacct gctggaaacc
acacttcttg 2641 aaacagcctg ggtgacggtc ctttaggcag cctgccgccg
tctctgtccc ggttcacctt 2701 gccgagagag gcgcgtctgc cccaccctca
aaccctgtgg ggcctgatgg tgctcacgac 2761 tcttcctgca aagggaactg
aagacctcca cattaagtgg ctttttaaca tgaaaaacac 2821 ggcagctgta
gctcccgagc tactctcttg ccagcatttt cacattttgc ctttctcgtg 2881
gtagaagcca gtacagagaa attctgtggt gggaacattc gaggtgtcac cctgcagagc
2941 tatggtgagg tgtggataag gcttaggtgc caggctgtaa gcattctgag
ctggcttgtt 3001 gtttttaagt cctgtatatg tatgtagtag tttgggtgtg
tatatatagt agcatttcaa 3061 aatggacgta ctggtttaac ctcctatcct
tggagagcag ctggctctcc accttgttac 3121 acattatgtt agagaggtag
cgagctgctc tgctatatgc cttaagccaa tatttactca 3181 tcaggtcatt
attttttaca atggccatgg aataaaccat ttttacaaaa ataaaaacaa 3241 aaaaagc
Human PTP-1B amino acid sequence GenBank HUMPTPBX Accession no.
M31724 SEQUENCE ID NO: 17
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRN
RYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQ
KSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLEL
ENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAG
IGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIE
GAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWV
KEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEP
SLPEKDEDHALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
TABLE-US-00004 TABLE 2 SEQ ID NO: Amino GenBank cDNA Acid Accession
No: Human Osteocalcin cDNA 1 2 NM_199173 Mouse osteocalcin gene 1 3
5 NM_007541 Mouse osteocalcin gene 2 4 5 NM_001032298 Human
Gamma-glutamyl carboxylase 6 7 NM_000821 Mouse Gamma-glutamyl
carboxylase 8 9 NM_019802 Mouse Esp (OST-PTP, Ptprv) 10 11
NM_007955 Rat (OST-PTP, Ptprv) 14 15 L36884 Human PTP-1B 16 17
M31724
Sequence CWU 1
1
311498DNAHomo sapiensCDS(19)..(318) 1cgcagccacc gagacacc atg aga
gcc ctc aca ctc ctc gcc cta ttg gcc 51 Met Arg Ala Leu Thr Leu Leu
Ala Leu Leu Ala 1 5 10 ctg gcc gca ctt tgc atc gct ggc cag gca ggt
gcg aag ccc agc ggt 99Leu Ala Ala Leu Cys Ile Ala Gly Gln Ala Gly
Ala Lys Pro Ser Gly 15 20 25 gca gag tcc agc aaa ggt gca gcc ttt
gtg tcc aag cag gag ggc agc 147Ala Glu Ser Ser Lys Gly Ala Ala Phe
Val Ser Lys Gln Glu Gly Ser 30 35 40 gag gta gtg aag aga ccc agg
cgc tac ctg tat caa tgg ctg gga gcc 195Glu Val Val Lys Arg Pro Arg
Arg Tyr Leu Tyr Gln Trp Leu Gly Ala 45 50 55 cca gtc ccc tac ccg
gat ccc ctg gag ccc agg agg gag gtg tgt gag 243Pro Val Pro Tyr Pro
Asp Pro Leu Glu Pro Arg Arg Glu Val Cys Glu 60 65 70 75 ctc aat ccg
gac tgt gac gag ttg gct gac cac atc ggc ttt cag gag 291Leu Asn Pro
Asp Cys Asp Glu Leu Ala Asp His Ile Gly Phe Gln Glu 80 85 90 gcc
tat cgg cgc ttc tac ggc ccg gtc tagggtgtcg ctctgctggc 338Ala Tyr
Arg Arg Phe Tyr Gly Pro Val 95 100 ctggccggca accccagttc tgctcctctc
caggcaccct tctttcctct tccccttgcc 398cttgccctga cctcccagcc
ctatggatgt ggggtcccca tcatcccagc tgctcccaaa 458taaactccag
aagaggaatc tgaaaaaaaa aaaaaaaaaa 4982100PRTHomo sapiens 2Met Arg
Ala Leu Thr Leu Leu Ala Leu Leu Ala Leu Ala Ala Leu Cys 1 5 10 15
Ile Ala Gly Gln Ala Gly Ala Lys Pro Ser Gly Ala Glu Ser Ser Lys 20
25 30 Gly Ala Ala Phe Val Ser Lys Gln Glu Gly Ser Glu Val Val Lys
Arg 35 40 45 Pro Arg Arg Tyr Leu Tyr Gln Trp Leu Gly Ala Pro Val
Pro Tyr Pro 50 55 60 Asp Pro Leu Glu Pro Arg Arg Glu Val Cys Glu
Leu Asn Pro Asp Cys 65 70 75 80 Asp Glu Leu Ala Asp His Ile Gly Phe
Gln Glu Ala Tyr Arg Arg Phe 85 90 95 Tyr Gly Pro Val 100 3494DNAmus
musculus 3agaacagaca agtcccacac agcagcttgg cccagaccta gcagacacca
tgaggaccat 60ctttctgctc actctgctga ccctggctgc gctctgtctc tctgacctca
cagatgccaa 120gcccagcggc cctgagtctg acaaagcctt catgtccaag
caggagggca ataaggtagt 180gaacagactc cggcgctacc ttggagcctc
agtccccagc ccagatcccc tggagcccac 240ccgggagcag tgtgagctta
accctgcttg tgacgagcta tcagaccagt atggcttgaa 300gaccgcctac
aaacgcatct atggtatcac tatttaggac ctgtgctgcc ctaaagccaa
360actctggcag ctcggctttg gctgctctcc gggacttgat cctccctgtc
ctctctctct 420gccctgcaag tatggatgtc acagcagctc caaaataaag
ttcagatgag gaagtgcaaa 480aaaaaaaaaa aaaa 4944470DNAmus
musculusCDS(49)..(333) 4gaacagacaa gtcccacaca gcagcttggt gcacacctag
cagacacc atg agg acc 57 Met Arg Thr 1 ctc tct ctg ctc act ctg ctg
gcc ctg gct gcg ctc tgt ctc tct gac 105Leu Ser Leu Leu Thr Leu Leu
Ala Leu Ala Ala Leu Cys Leu Ser Asp 5 10 15 ctc aca gat ccc aag ccc
agc ggc cct gag tct gac aaa gcc ttc atg 153Leu Thr Asp Pro Lys Pro
Ser Gly Pro Glu Ser Asp Lys Ala Phe Met 20 25 30 35 tcc aag cag gag
ggc aat aag gta gtg aac aga ctc cgg cgc tac ctt 201Ser Lys Gln Glu
Gly Asn Lys Val Val Asn Arg Leu Arg Arg Tyr Leu 40 45 50 gga gcc
tca gtc ccc agc cca gat ccc ctg gag ccc acc cgg gag cag 249Gly Ala
Ser Val Pro Ser Pro Asp Pro Leu Glu Pro Thr Arg Glu Gln 55 60 65
tgt gag ctt aac cct gct tgt gac gag cta tca gac cag tat ggc ttg
297Cys Glu Leu Asn Pro Ala Cys Asp Glu Leu Ser Asp Gln Tyr Gly Leu
70 75 80 aag acc gcc tac aaa cgc atc tac ggt atc act att taggacctgt
343Lys Thr Ala Tyr Lys Arg Ile Tyr Gly Ile Thr Ile 85 90 95
gctgccctaa agccaaactc tggcagctcg gctttggctg ctctccggga cttgatcctc
403cctgtcctct ctctctgccc tgcaagtatg gatgtcacag cagctccaaa
ataaagttca 463gatgagg 470595PRTmus musculus 5Met Arg Thr Leu Ser
Leu Leu Thr Leu Leu Ala Leu Ala Ala Leu Cys 1 5 10 15 Leu Ser Asp
Leu Thr Asp Pro Lys Pro Ser Gly Pro Glu Ser Asp Lys 20 25 30 Ala
Phe Met Ser Lys Gln Glu Gly Asn Lys Val Val Asn Arg Leu Arg 35 40
45 Arg Tyr Leu Gly Ala Ser Val Pro Ser Pro Asp Pro Leu Glu Pro Thr
50 55 60 Arg Glu Gln Cys Glu Leu Asn Pro Ala Cys Asp Glu Leu Ser
Asp Gln 65 70 75 80 Tyr Gly Leu Lys Thr Ala Tyr Lys Arg Ile Tyr Gly
Ile Thr Ile 85 90 95 63236DNAhomo sapiensCDS(29)..(2302)
6gtgacccacc tgcctcctcc gcagagca atg gcg gtg tct gcc ggg tcc gcg 52
Met Ala Val Ser Ala Gly Ser Ala 1 5 cgg acc tcg ccc agc tca gat aaa
gta cag aaa gac aag gct gaa ctg 100Arg Thr Ser Pro Ser Ser Asp Lys
Val Gln Lys Asp Lys Ala Glu Leu 10 15 20 atc tca ggg ccc agg cag
gac agc cga ata ggg aaa ctc ttg ggt ttt 148Ile Ser Gly Pro Arg Gln
Asp Ser Arg Ile Gly Lys Leu Leu Gly Phe 25 30 35 40 gag tgg aca gat
ttg tcc agt tgg cgg agg ctg gtg acc ctg ctg aat 196Glu Trp Thr Asp
Leu Ser Ser Trp Arg Arg Leu Val Thr Leu Leu Asn 45 50 55 cga cca
acg gac cct gca agc tta gct gtc ttt cgt ttt ctt ttt ggg 244Arg Pro
Thr Asp Pro Ala Ser Leu Ala Val Phe Arg Phe Leu Phe Gly 60 65 70
ttc ttg atg gtg cta gac att ccc cag gag cgg ggg ctc agc tct ctg
292Phe Leu Met Val Leu Asp Ile Pro Gln Glu Arg Gly Leu Ser Ser Leu
75 80 85 gac cgg aaa tac ctt gat ggg ctg gat gtg tgc cgc ttc ccc
ttg ctg 340Asp Arg Lys Tyr Leu Asp Gly Leu Asp Val Cys Arg Phe Pro
Leu Leu 90 95 100 gat gcc cta cgc cca ctg cca ctt gac tgg atg tat
ctt gtc tac acc 388Asp Ala Leu Arg Pro Leu Pro Leu Asp Trp Met Tyr
Leu Val Tyr Thr 105 110 115 120 atc atg ttt ctg ggg gca ctg ggc atg
atg ctg ggc ctg tgc tac cgg 436Ile Met Phe Leu Gly Ala Leu Gly Met
Met Leu Gly Leu Cys Tyr Arg 125 130 135 ata agc tgt gtg tta ttc ctg
ctg cca tac tgg tat gtg ttt ctc ctg 484Ile Ser Cys Val Leu Phe Leu
Leu Pro Tyr Trp Tyr Val Phe Leu Leu 140 145 150 gac aag aca tca tgg
aac aac cac tcc tat ctg tat ggg ttg ttg gcc 532Asp Lys Thr Ser Trp
Asn Asn His Ser Tyr Leu Tyr Gly Leu Leu Ala 155 160 165 ttt cag cta
aca ttc atg gat gca aac cac tac tgg tct gtg gac ggt 580Phe Gln Leu
Thr Phe Met Asp Ala Asn His Tyr Trp Ser Val Asp Gly 170 175 180 ctg
ctg aat gcc cat agg agg aat gcc cac gtg ccc ctt tgg aac tat 628Leu
Leu Asn Ala His Arg Arg Asn Ala His Val Pro Leu Trp Asn Tyr 185 190
195 200 gca gtg ctc cgt ggc cag atc ttc att gtg tac ttc att gcg ggt
gtg 676Ala Val Leu Arg Gly Gln Ile Phe Ile Val Tyr Phe Ile Ala Gly
Val 205 210 215 aaa aag ctg gat gca gac tgg gtt gaa ggc tat tcc atg
gaa tat ttg 724Lys Lys Leu Asp Ala Asp Trp Val Glu Gly Tyr Ser Met
Glu Tyr Leu 220 225 230 tcc cgg cac tgg ctc ttc agt ccc ttc aaa ctg
ctg ttg tct gag gag 772Ser Arg His Trp Leu Phe Ser Pro Phe Lys Leu
Leu Leu Ser Glu Glu 235 240 245 ctg act agc ctg ctg gtc gtg cac tgg
ggt ggg ctg ctg ctt gac ctc 820Leu Thr Ser Leu Leu Val Val His Trp
Gly Gly Leu Leu Leu Asp Leu 250 255 260 tca gct ggt ttc ctg ctc ttt
ttt gat gtc tca aga tcc att ggc ctg 868Ser Ala Gly Phe Leu Leu Phe
Phe Asp Val Ser Arg Ser Ile Gly Leu 265 270 275 280 ttc ttt gtg tcc
tac ttc cac tgc atg aat tcc cag ctt ttc agc att 916Phe Phe Val Ser
Tyr Phe His Cys Met Asn Ser Gln Leu Phe Ser Ile 285 290 295 ggt atg
ttc tcc tac gtc atg ctg gcc agc agc cct ctc ttc tgc tcc 964Gly Met
Phe Ser Tyr Val Met Leu Ala Ser Ser Pro Leu Phe Cys Ser 300 305 310
cct gag tgg cct cgg aag ctg gtg tcc tac tgc ccc cga agg ttg caa
1012Pro Glu Trp Pro Arg Lys Leu Val Ser Tyr Cys Pro Arg Arg Leu Gln
315 320 325 caa ctg ttg ccc ctc aag gca gcc cct cag ccc agt gtt tcc
tgt gtg 1060Gln Leu Leu Pro Leu Lys Ala Ala Pro Gln Pro Ser Val Ser
Cys Val 330 335 340 tat aag agg agc cgg ggc aaa agt ggc cag aag cca
ggg ctg cgc cat 1108Tyr Lys Arg Ser Arg Gly Lys Ser Gly Gln Lys Pro
Gly Leu Arg His 345 350 355 360 cag ctg gga gct gcc ttc acc ctg ctc
tac ctc ctg gag cag cta ttc 1156Gln Leu Gly Ala Ala Phe Thr Leu Leu
Tyr Leu Leu Glu Gln Leu Phe 365 370 375 ctg ccc tat tct cat ttt ctc
acc cag ggc tat aac aac tgg aca aat 1204Leu Pro Tyr Ser His Phe Leu
Thr Gln Gly Tyr Asn Asn Trp Thr Asn 380 385 390 ggg ctg tat ggc tat
tcc tgg gac atg atg gtg cac tcc cgc tcc cac 1252Gly Leu Tyr Gly Tyr
Ser Trp Asp Met Met Val His Ser Arg Ser His 395 400 405 cag cac gtg
aag atc acc tac cgt gat ggc cgc act ggc gaa ctg ggc 1300Gln His Val
Lys Ile Thr Tyr Arg Asp Gly Arg Thr Gly Glu Leu Gly 410 415 420 tac
ctt aac cct ggg gta ttt aca cag agt cgg cga tgg aag gat cat 1348Tyr
Leu Asn Pro Gly Val Phe Thr Gln Ser Arg Arg Trp Lys Asp His 425 430
435 440 gca gac atg ctg aag caa tat gcc act tgc ctg agc cgc ctg ctt
ccc 1396Ala Asp Met Leu Lys Gln Tyr Ala Thr Cys Leu Ser Arg Leu Leu
Pro 445 450 455 aag tat aat gtc act gag ccc cag atc tac ttt gat att
tgg gtc tcc 1444Lys Tyr Asn Val Thr Glu Pro Gln Ile Tyr Phe Asp Ile
Trp Val Ser 460 465 470 atc aat gac cgc ttc cag cag agg att ttt gac
cct cgt gtg gac atc 1492Ile Asn Asp Arg Phe Gln Gln Arg Ile Phe Asp
Pro Arg Val Asp Ile 475 480 485 gtg cag gcc gct tgg tca ccc ttt cag
cgc aca tcc tgg gtg caa cca 1540Val Gln Ala Ala Trp Ser Pro Phe Gln
Arg Thr Ser Trp Val Gln Pro 490 495 500 ctc ttg atg gac ctg tct ccc
tgg agg gcc aag tta cag gaa atc aag 1588Leu Leu Met Asp Leu Ser Pro
Trp Arg Ala Lys Leu Gln Glu Ile Lys 505 510 515 520 agc agc cta gac
aac cac act gag gtg gtc ttc att gca gat ttc cct 1636Ser Ser Leu Asp
Asn His Thr Glu Val Val Phe Ile Ala Asp Phe Pro 525 530 535 gga ctg
cac ttg gag aat ttt gtg agt gaa gac ctg ggc aac act agc 1684Gly Leu
His Leu Glu Asn Phe Val Ser Glu Asp Leu Gly Asn Thr Ser 540 545 550
atc cag ctg ctg cag ggg gaa gtg act gtg gag ctt gtg gca gaa cag
1732Ile Gln Leu Leu Gln Gly Glu Val Thr Val Glu Leu Val Ala Glu Gln
555 560 565 aag aac cag act ctt cga gag gga gaa aaa atg cag ttg cct
gct ggt 1780Lys Asn Gln Thr Leu Arg Glu Gly Glu Lys Met Gln Leu Pro
Ala Gly 570 575 580 gag tac cat aag gtg tat acg aca tca cct agc cct
tct tgc tac atg 1828Glu Tyr His Lys Val Tyr Thr Thr Ser Pro Ser Pro
Ser Cys Tyr Met 585 590 595 600 tac gtc tat gtc aac act aca gag ctt
gca ctg gag caa gac ctg gca 1876Tyr Val Tyr Val Asn Thr Thr Glu Leu
Ala Leu Glu Gln Asp Leu Ala 605 610 615 tat ctg caa gaa tta aag gaa
aag gtg gag aat gga agt gaa aca ggg 1924Tyr Leu Gln Glu Leu Lys Glu
Lys Val Glu Asn Gly Ser Glu Thr Gly 620 625 630 cct cta ccc cca gag
ctg cag cct ctg ttg gaa ggg gaa gta aaa ggg 1972Pro Leu Pro Pro Glu
Leu Gln Pro Leu Leu Glu Gly Glu Val Lys Gly 635 640 645 ggc cct gag
cca aca cct ctg gtt cag acc ttt ctt aga cgc caa caa 2020Gly Pro Glu
Pro Thr Pro Leu Val Gln Thr Phe Leu Arg Arg Gln Gln 650 655 660 agg
ctc cag gag att gaa cgc cgg cga aat act cct ttc cat gag cga 2068Arg
Leu Gln Glu Ile Glu Arg Arg Arg Asn Thr Pro Phe His Glu Arg 665 670
675 680 ttc ttc cgc ttc ttg ttg cga aag ctc tat gtc ttt cgc cgc agc
ttc 2116Phe Phe Arg Phe Leu Leu Arg Lys Leu Tyr Val Phe Arg Arg Ser
Phe 685 690 695 ctg atg act tgt atc tca ctt cga aat ctg ata tta ggc
cgt cct tcc 2164Leu Met Thr Cys Ile Ser Leu Arg Asn Leu Ile Leu Gly
Arg Pro Ser 700 705 710 ctg gag cag ctg gcc cag gag gtg act tat gca
aac ttg aga ccc ttt 2212Leu Glu Gln Leu Ala Gln Glu Val Thr Tyr Ala
Asn Leu Arg Pro Phe 715 720 725 gag gca gtt gga gaa ctg aat ccc tca
aac acg gat tct tca cat tct 2260Glu Ala Val Gly Glu Leu Asn Pro Ser
Asn Thr Asp Ser Ser His Ser 730 735 740 aat cct cct gag tca aat cct
gat cct gtc cac tca gag ttc 2302Asn Pro Pro Glu Ser Asn Pro Asp Pro
Val His Ser Glu Phe 745 750 755 tgaagggggc cagatgttgg gtgcagatgt
agaagcagcc agtcacagac ccattctatg 2362caatggacat ttatttgaaa
aaaattctca aaagtttttt tttttttttt gggggggcgg 2422ggttctaaag
ctgtttttaa ctccgagatt acaacttaga ggaaccaagg aaataaagca
2482aataagattt aacaacccaa gattaagagg ccaggaagag gttagacgca
atgtgaaact 2542gtcctcctag gataaggttt aaagtggctt tttgggggct
gggtgccgtg gctcacgcct 2602gtaatcccag cattttggga ggctgaggtg
ggcagatcac ttgaggccag gagttcgaga 2662ccagcctggc caacatggca
aaaccccttc tctactaaaa atacaaaaat tagccagacg 2722tggtggtggg
tgcctgtaat ccaactaccc aggaggctga ggcatgagaa tcgcttgggc
2782ccaggaggtg gaggttgcag tgagccgaga tcgagccact gcactcctgg
gcaacagagc 2842aagacttcgt ctcaaaataa ataaataaag tggctcttgg
ggaaaagcaa tttaatgtac 2902cacgatgaat agctaactgt tcccaagtgt
ttgctatgtg caacacaccg cgtgagcagt 2962gttacctgca ttattacatt
aggctgagag gtaaaataat ttgcccgaag acatacagct 3022agtgacgaat
ggactgatgg tttgaactta acgtctattt gacttaaggt cctgcaccct
3082gccacttgta attttcagaa tcactgataa tctgaaataa tgcagcttaa
aacatgtttt 3142cttaattaaa agtataaaaa aaaaaaaaaa aaaaaaaaaa
aaaaaaaaaa aaaaaaaaaa 3202aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa
32367758PRThomo sapiens 7Met Ala Val Ser Ala Gly Ser Ala Arg Thr
Ser Pro Ser Ser Asp Lys 1 5 10 15 Val Gln Lys Asp Lys Ala Glu Leu
Ile Ser Gly Pro Arg Gln Asp Ser 20 25 30 Arg Ile Gly Lys Leu Leu
Gly Phe Glu Trp Thr Asp Leu Ser Ser Trp 35 40 45 Arg Arg Leu Val
Thr Leu Leu Asn Arg Pro Thr Asp Pro Ala Ser Leu 50 55 60 Ala Val
Phe Arg Phe Leu Phe Gly Phe Leu Met Val Leu Asp Ile Pro 65 70 75 80
Gln Glu Arg Gly Leu Ser Ser Leu Asp Arg Lys Tyr Leu Asp Gly Leu 85
90 95 Asp Val Cys Arg
Phe Pro Leu Leu Asp Ala Leu Arg Pro Leu Pro Leu 100 105 110 Asp Trp
Met Tyr Leu Val Tyr Thr Ile Met Phe Leu Gly Ala Leu Gly 115 120 125
Met Met Leu Gly Leu Cys Tyr Arg Ile Ser Cys Val Leu Phe Leu Leu 130
135 140 Pro Tyr Trp Tyr Val Phe Leu Leu Asp Lys Thr Ser Trp Asn Asn
His 145 150 155 160 Ser Tyr Leu Tyr Gly Leu Leu Ala Phe Gln Leu Thr
Phe Met Asp Ala 165 170 175 Asn His Tyr Trp Ser Val Asp Gly Leu Leu
Asn Ala His Arg Arg Asn 180 185 190 Ala His Val Pro Leu Trp Asn Tyr
Ala Val Leu Arg Gly Gln Ile Phe 195 200 205 Ile Val Tyr Phe Ile Ala
Gly Val Lys Lys Leu Asp Ala Asp Trp Val 210 215 220 Glu Gly Tyr Ser
Met Glu Tyr Leu Ser Arg His Trp Leu Phe Ser Pro 225 230 235 240 Phe
Lys Leu Leu Leu Ser Glu Glu Leu Thr Ser Leu Leu Val Val His 245 250
255 Trp Gly Gly Leu Leu Leu Asp Leu Ser Ala Gly Phe Leu Leu Phe Phe
260 265 270 Asp Val Ser Arg Ser Ile Gly Leu Phe Phe Val Ser Tyr Phe
His Cys 275 280 285 Met Asn Ser Gln Leu Phe Ser Ile Gly Met Phe Ser
Tyr Val Met Leu 290 295 300 Ala Ser Ser Pro Leu Phe Cys Ser Pro Glu
Trp Pro Arg Lys Leu Val 305 310 315 320 Ser Tyr Cys Pro Arg Arg Leu
Gln Gln Leu Leu Pro Leu Lys Ala Ala 325 330 335 Pro Gln Pro Ser Val
Ser Cys Val Tyr Lys Arg Ser Arg Gly Lys Ser 340 345 350 Gly Gln Lys
Pro Gly Leu Arg His Gln Leu Gly Ala Ala Phe Thr Leu 355 360 365 Leu
Tyr Leu Leu Glu Gln Leu Phe Leu Pro Tyr Ser His Phe Leu Thr 370 375
380 Gln Gly Tyr Asn Asn Trp Thr Asn Gly Leu Tyr Gly Tyr Ser Trp Asp
385 390 395 400 Met Met Val His Ser Arg Ser His Gln His Val Lys Ile
Thr Tyr Arg 405 410 415 Asp Gly Arg Thr Gly Glu Leu Gly Tyr Leu Asn
Pro Gly Val Phe Thr 420 425 430 Gln Ser Arg Arg Trp Lys Asp His Ala
Asp Met Leu Lys Gln Tyr Ala 435 440 445 Thr Cys Leu Ser Arg Leu Leu
Pro Lys Tyr Asn Val Thr Glu Pro Gln 450 455 460 Ile Tyr Phe Asp Ile
Trp Val Ser Ile Asn Asp Arg Phe Gln Gln Arg 465 470 475 480 Ile Phe
Asp Pro Arg Val Asp Ile Val Gln Ala Ala Trp Ser Pro Phe 485 490 495
Gln Arg Thr Ser Trp Val Gln Pro Leu Leu Met Asp Leu Ser Pro Trp 500
505 510 Arg Ala Lys Leu Gln Glu Ile Lys Ser Ser Leu Asp Asn His Thr
Glu 515 520 525 Val Val Phe Ile Ala Asp Phe Pro Gly Leu His Leu Glu
Asn Phe Val 530 535 540 Ser Glu Asp Leu Gly Asn Thr Ser Ile Gln Leu
Leu Gln Gly Glu Val 545 550 555 560 Thr Val Glu Leu Val Ala Glu Gln
Lys Asn Gln Thr Leu Arg Glu Gly 565 570 575 Glu Lys Met Gln Leu Pro
Ala Gly Glu Tyr His Lys Val Tyr Thr Thr 580 585 590 Ser Pro Ser Pro
Ser Cys Tyr Met Tyr Val Tyr Val Asn Thr Thr Glu 595 600 605 Leu Ala
Leu Glu Gln Asp Leu Ala Tyr Leu Gln Glu Leu Lys Glu Lys 610 615 620
Val Glu Asn Gly Ser Glu Thr Gly Pro Leu Pro Pro Glu Leu Gln Pro 625
630 635 640 Leu Leu Glu Gly Glu Val Lys Gly Gly Pro Glu Pro Thr Pro
Leu Val 645 650 655 Gln Thr Phe Leu Arg Arg Gln Gln Arg Leu Gln Glu
Ile Glu Arg Arg 660 665 670 Arg Asn Thr Pro Phe His Glu Arg Phe Phe
Arg Phe Leu Leu Arg Lys 675 680 685 Leu Tyr Val Phe Arg Arg Ser Phe
Leu Met Thr Cys Ile Ser Leu Arg 690 695 700 Asn Leu Ile Leu Gly Arg
Pro Ser Leu Glu Gln Leu Ala Gln Glu Val 705 710 715 720 Thr Tyr Ala
Asn Leu Arg Pro Phe Glu Ala Val Gly Glu Leu Asn Pro 725 730 735 Ser
Asn Thr Asp Ser Ser His Ser Asn Pro Pro Glu Ser Asn Pro Asp 740 745
750 Pro Val His Ser Glu Phe 755 82905DNAmus musculusCDS(75)..(2345)
8agacagcaag tctaagtctg gaggttccac tgggtccgac ctggctgcag agaggctcac
60ctgtccctgc agtc atg gct gtg cac cgc ggc tcc gca ctg gtt gct ccc
110 Met Ala Val His Arg Gly Ser Ala Leu Val Ala Pro 1 5 10 gcc tca
gat aaa gta cag aaa aac aag tct gca cag aca tca gga ctg 158Ala Ser
Asp Lys Val Gln Lys Asn Lys Ser Ala Gln Thr Ser Gly Leu 15 20 25
aaa cag ggc agc cga atg gag aaa att tta ggg ttt gaa tgg aca gat
206Lys Gln Gly Ser Arg Met Glu Lys Ile Leu Gly Phe Glu Trp Thr Asp
30 35 40 tta tct agc tgg cag agt gtc gtg acc ctg ctt aac aaa cca
acg gac 254Leu Ser Ser Trp Gln Ser Val Val Thr Leu Leu Asn Lys Pro
Thr Asp 45 50 55 60 cct gca aac ctg gct gtc ttt cgt ttt ctc ttt gct
ttc ttg atg ctg 302Pro Ala Asn Leu Ala Val Phe Arg Phe Leu Phe Ala
Phe Leu Met Leu 65 70 75 ctg gac att ccc cag gaa cgc ggc ctt agc
tcc ctg gac cga aaa tac 350Leu Asp Ile Pro Gln Glu Arg Gly Leu Ser
Ser Leu Asp Arg Lys Tyr 80 85 90 ttg gat ggg ctg gat gtg tgc cgt
ttc ccc ttg ctg gat gcc ttg cgc 398Leu Asp Gly Leu Asp Val Cys Arg
Phe Pro Leu Leu Asp Ala Leu Arg 95 100 105 cca ctg cca ctg gac tgg
atg tat ctt gtc tac acc atc atg ttt ctg 446Pro Leu Pro Leu Asp Trp
Met Tyr Leu Val Tyr Thr Ile Met Phe Leu 110 115 120 ggg gca ctg ggc
atg atg ctg ggg cta tgc tac cgg cta agc tgt gtg 494Gly Ala Leu Gly
Met Met Leu Gly Leu Cys Tyr Arg Leu Ser Cys Val 125 130 135 140 tta
ttc ctg cta ccg tac tgg tac gtg ttt ctc ctg gac aag act tcg 542Leu
Phe Leu Leu Pro Tyr Trp Tyr Val Phe Leu Leu Asp Lys Thr Ser 145 150
155 tgg aac aat cac tcc tat ctg tat ggt ttg ttg gcc ttt cag ttg aca
590Trp Asn Asn His Ser Tyr Leu Tyr Gly Leu Leu Ala Phe Gln Leu Thr
160 165 170 ttc atg gat gca aac cac tac tgg tct gtg gat ggc ttg ctg
aat gcc 638Phe Met Asp Ala Asn His Tyr Trp Ser Val Asp Gly Leu Leu
Asn Ala 175 180 185 cga aag aag aat gct cac gtg ccc ctt tgg aac tac
aca gtt ctg cgt 686Arg Lys Lys Asn Ala His Val Pro Leu Trp Asn Tyr
Thr Val Leu Arg 190 195 200 ggc cag atc ttc atc gtg tac ttc atc gcg
ggt gtg aag aag ctc gat 734Gly Gln Ile Phe Ile Val Tyr Phe Ile Ala
Gly Val Lys Lys Leu Asp 205 210 215 220 gct gac tgg gtt ggg ggc tac
tcc atg gag cac ctg tcc cgg cac tgg 782Ala Asp Trp Val Gly Gly Tyr
Ser Met Glu His Leu Ser Arg His Trp 225 230 235 ctc ttc agt ccc ttc
aag ctg gtg ttg tcg gag gag ctg aca agc ctg 830Leu Phe Ser Pro Phe
Lys Leu Val Leu Ser Glu Glu Leu Thr Ser Leu 240 245 250 ctg gta gta
cac tgg tgt ggg ctt ctc ctt gac ctc tcg gct ggc ttc 878Leu Val Val
His Trp Cys Gly Leu Leu Leu Asp Leu Ser Ala Gly Phe 255 260 265 ctg
ctc ttc ttt gat gcc tcc aga ccc gtc ggc ctg ttc ttc gtg tcc 926Leu
Leu Phe Phe Asp Ala Ser Arg Pro Val Gly Leu Phe Phe Val Ser 270 275
280 tac ttt cac tgc atg aac tcg cag ctc ttc agc atc ggg atg ttt ccc
974Tyr Phe His Cys Met Asn Ser Gln Leu Phe Ser Ile Gly Met Phe Pro
285 290 295 300 tat gtc atg ctg gcc agc agc cct ctc ttc tgc tca gct
gaa tgg cct 1022Tyr Val Met Leu Ala Ser Ser Pro Leu Phe Cys Ser Ala
Glu Trp Pro 305 310 315 cgg aag ttg gta gcc cga tgc ccg aaa agg ctg
caa gag ctg ctg ccc 1070Arg Lys Leu Val Ala Arg Cys Pro Lys Arg Leu
Gln Glu Leu Leu Pro 320 325 330 acc aaa gcc gct cct cgg cct agt gct
tcc tgt gtg tat aag agg tcc 1118Thr Lys Ala Ala Pro Arg Pro Ser Ala
Ser Cys Val Tyr Lys Arg Ser 335 340 345 cgg ggc aaa gct ggc ccg aag
ccc ggg ctg cgc cac cag ctg gga gcc 1166Arg Gly Lys Ala Gly Pro Lys
Pro Gly Leu Arg His Gln Leu Gly Ala 350 355 360 atc ttc acc ctg ctc
tac ctc cta gag cag ctc ttc ctg ccc tat tcc 1214Ile Phe Thr Leu Leu
Tyr Leu Leu Glu Gln Leu Phe Leu Pro Tyr Ser 365 370 375 380 cac ttc
ctg acc cag ggt tac aat aac tgg aca aat ggg ctg tat ggc 1262His Phe
Leu Thr Gln Gly Tyr Asn Asn Trp Thr Asn Gly Leu Tyr Gly 385 390 395
tat tcc tgg gac atg atg gtg cac tcc cgc tcc cac cag cac gta aag
1310Tyr Ser Trp Asp Met Met Val His Ser Arg Ser His Gln His Val Lys
400 405 410 atc acc tac cgc gac ggc ctc acg ggc gag cta ggc tac ctt
aac cct 1358Ile Thr Tyr Arg Asp Gly Leu Thr Gly Glu Leu Gly Tyr Leu
Asn Pro 415 420 425 ggg gta ttc aca cag agc cgg cga tgg aag gat cat
gca gac atg ctg 1406Gly Val Phe Thr Gln Ser Arg Arg Trp Lys Asp His
Ala Asp Met Leu 430 435 440 aag caa tat gcc act tgc ctg agc ctc ctg
ctt ccc aag tac aat gtc 1454Lys Gln Tyr Ala Thr Cys Leu Ser Leu Leu
Leu Pro Lys Tyr Asn Val 445 450 455 460 act gag ccc cag atc tac ttt
gat att tgg gtc tcc atc aat gac cgc 1502Thr Glu Pro Gln Ile Tyr Phe
Asp Ile Trp Val Ser Ile Asn Asp Arg 465 470 475 ttc cag cag agg ctt
ttt gac cct cgt gtg gac atc gtg cag gct gtc 1550Phe Gln Gln Arg Leu
Phe Asp Pro Arg Val Asp Ile Val Gln Ala Val 480 485 490 tgg tcc ccc
ttc cag cgc aca cct tgg gtg cag cca ctc ttg atg gat 1598Trp Ser Pro
Phe Gln Arg Thr Pro Trp Val Gln Pro Leu Leu Met Asp 495 500 505 tta
tct ccc tgg agg acc aag tta cag gat att aag agc agt ctg gac 1646Leu
Ser Pro Trp Arg Thr Lys Leu Gln Asp Ile Lys Ser Ser Leu Asp 510 515
520 aac cac acc gag gtg gtc ttc att gca gat ttc cct ggg ctt cac ttg
1694Asn His Thr Glu Val Val Phe Ile Ala Asp Phe Pro Gly Leu His Leu
525 530 535 540 gag aat ttt gtg agt gaa gac ctg ggc aac act agc atc
cag ctg ctg 1742Glu Asn Phe Val Ser Glu Asp Leu Gly Asn Thr Ser Ile
Gln Leu Leu 545 550 555 cag gga gaa gtc acc gtg gaa ttg gtg gca gaa
cag aaa aat cag act 1790Gln Gly Glu Val Thr Val Glu Leu Val Ala Glu
Gln Lys Asn Gln Thr 560 565 570 ctt caa gaa gga gag aaa atg cag ttg
cct gct gga gag tac cat aaa 1838Leu Gln Glu Gly Glu Lys Met Gln Leu
Pro Ala Gly Glu Tyr His Lys 575 580 585 gtc tat act gta tca tct agt
cct tcc tgc tac atg tac gtc tat gtc 1886Val Tyr Thr Val Ser Ser Ser
Pro Ser Cys Tyr Met Tyr Val Tyr Val 590 595 600 aac act aca gag gtc
gca ctg gag caa gac ctg gca tat ctg caa gaa 1934Asn Thr Thr Glu Val
Ala Leu Glu Gln Asp Leu Ala Tyr Leu Gln Glu 605 610 615 620 tta aag
gag aag gtg gag aac gga agt gaa aca ggg ccc ctg cct cca 1982Leu Lys
Glu Lys Val Glu Asn Gly Ser Glu Thr Gly Pro Leu Pro Pro 625 630 635
gaa ctt cag cct ctt ttg gaa ggg gaa gta aaa ggg ggc cct gag cca
2030Glu Leu Gln Pro Leu Leu Glu Gly Glu Val Lys Gly Gly Pro Glu Pro
640 645 650 aca cct ctg gtc caa act ttt ctc aga cga cag agg aag ctc
caa gaa 2078Thr Pro Leu Val Gln Thr Phe Leu Arg Arg Gln Arg Lys Leu
Gln Glu 655 660 665 att gaa cgc agg cga aat agc cct ttc cat gag cga
ttt ctc cgc ttc 2126Ile Glu Arg Arg Arg Asn Ser Pro Phe His Glu Arg
Phe Leu Arg Phe 670 675 680 gtg ctg cga aag ctc tac gtc ttt cga cgc
agc ttc ctg atg act cga 2174Val Leu Arg Lys Leu Tyr Val Phe Arg Arg
Ser Phe Leu Met Thr Arg 685 690 695 700 att tca ctc cga aac ctg cta
tta ggc cgc cct tcc cta gag caa cta 2222Ile Ser Leu Arg Asn Leu Leu
Leu Gly Arg Pro Ser Leu Glu Gln Leu 705 710 715 gcc caa gag gtg aca
tat gca aac ttg cga cca ttt gaa cca gtt gat 2270Ala Gln Glu Val Thr
Tyr Ala Asn Leu Arg Pro Phe Glu Pro Val Asp 720 725 730 gag tca agt
gct tca aac aca gat tct tca aat cac ccg tca gag cca 2318Glu Ser Ser
Ala Ser Asn Thr Asp Ser Ser Asn His Pro Ser Glu Pro 735 740 745 gat
tct gag cat gtt cac tct gag ttc tgagggatgt acagatgctc 2365Asp Ser
Glu His Val His Ser Glu Phe 750 755 tgtgcagatg tgggggcagc
ctgttatagg cttattgtct acgcaaagaa catatttttg 2425gagaaaaatg
atatgggaca ggctttcaca gtacagccca ggctggcctc aaactcatgg
2485ttggtccctc tgcttcagcc tgttttgtaa ttacatagta tcaccaaacc
tagttgcttt 2545tccctttaca ttttttcccc ttataagttc tttaaaatta
tagcttacat tttttctttt 2605ttcttttttt tttttttgta ttttttcttt
gtcaagacag gtctctctct gtgtagcact 2665ggctgtcctg gaactcactc
tgtagtccag gctggcctcc aactcagaaa ttctcctgcc 2725tctgcctccc
aagtgctggg attaaaggtg tgtgccacca cgccccactg ggcttttagt
2785ttttatagac aagatttctc catgtagacc agaccagctc tcctgagtgc
tgaaattaaa 2845ggcacgggac atcactacct ggctttctta ttaaacttgt
tttagtggtc tcaacaaaaa 29059757PRTmus musculus 9Met Ala Val His Arg
Gly Ser Ala Leu Val Ala Pro Ala Ser Asp Lys 1 5 10 15 Val Gln Lys
Asn Lys Ser Ala Gln Thr Ser Gly Leu Lys Gln Gly Ser 20 25 30 Arg
Met Glu Lys Ile Leu Gly Phe Glu Trp Thr Asp Leu Ser Ser Trp 35 40
45 Gln Ser Val Val Thr Leu Leu Asn Lys Pro Thr Asp Pro Ala Asn Leu
50 55 60 Ala Val Phe Arg Phe Leu Phe Ala Phe Leu Met Leu Leu Asp
Ile Pro 65 70 75 80 Gln Glu Arg Gly Leu Ser Ser Leu Asp Arg Lys Tyr
Leu Asp Gly Leu 85 90 95 Asp Val Cys Arg Phe Pro Leu Leu Asp Ala
Leu Arg Pro Leu Pro Leu 100 105 110 Asp Trp Met Tyr Leu Val Tyr Thr
Ile Met Phe Leu Gly Ala Leu Gly 115 120 125 Met Met Leu Gly Leu Cys
Tyr Arg Leu Ser Cys Val Leu Phe Leu Leu 130 135 140 Pro Tyr Trp Tyr
Val Phe Leu Leu Asp Lys Thr Ser Trp Asn Asn His 145 150 155 160 Ser
Tyr Leu Tyr Gly Leu Leu Ala Phe Gln Leu Thr Phe Met Asp Ala 165 170
175 Asn His Tyr Trp Ser Val Asp Gly Leu Leu Asn Ala Arg Lys Lys Asn
180 185 190 Ala His Val Pro Leu Trp Asn Tyr Thr Val Leu Arg Gly Gln
Ile Phe 195 200 205 Ile Val Tyr Phe Ile Ala Gly Val Lys Lys Leu Asp
Ala Asp Trp Val 210 215 220 Gly Gly Tyr Ser Met Glu
His Leu Ser Arg His Trp Leu Phe Ser Pro 225 230 235 240 Phe Lys Leu
Val Leu Ser Glu Glu Leu Thr Ser Leu Leu Val Val His 245 250 255 Trp
Cys Gly Leu Leu Leu Asp Leu Ser Ala Gly Phe Leu Leu Phe Phe 260 265
270 Asp Ala Ser Arg Pro Val Gly Leu Phe Phe Val Ser Tyr Phe His Cys
275 280 285 Met Asn Ser Gln Leu Phe Ser Ile Gly Met Phe Pro Tyr Val
Met Leu 290 295 300 Ala Ser Ser Pro Leu Phe Cys Ser Ala Glu Trp Pro
Arg Lys Leu Val 305 310 315 320 Ala Arg Cys Pro Lys Arg Leu Gln Glu
Leu Leu Pro Thr Lys Ala Ala 325 330 335 Pro Arg Pro Ser Ala Ser Cys
Val Tyr Lys Arg Ser Arg Gly Lys Ala 340 345 350 Gly Pro Lys Pro Gly
Leu Arg His Gln Leu Gly Ala Ile Phe Thr Leu 355 360 365 Leu Tyr Leu
Leu Glu Gln Leu Phe Leu Pro Tyr Ser His Phe Leu Thr 370 375 380 Gln
Gly Tyr Asn Asn Trp Thr Asn Gly Leu Tyr Gly Tyr Ser Trp Asp 385 390
395 400 Met Met Val His Ser Arg Ser His Gln His Val Lys Ile Thr Tyr
Arg 405 410 415 Asp Gly Leu Thr Gly Glu Leu Gly Tyr Leu Asn Pro Gly
Val Phe Thr 420 425 430 Gln Ser Arg Arg Trp Lys Asp His Ala Asp Met
Leu Lys Gln Tyr Ala 435 440 445 Thr Cys Leu Ser Leu Leu Leu Pro Lys
Tyr Asn Val Thr Glu Pro Gln 450 455 460 Ile Tyr Phe Asp Ile Trp Val
Ser Ile Asn Asp Arg Phe Gln Gln Arg 465 470 475 480 Leu Phe Asp Pro
Arg Val Asp Ile Val Gln Ala Val Trp Ser Pro Phe 485 490 495 Gln Arg
Thr Pro Trp Val Gln Pro Leu Leu Met Asp Leu Ser Pro Trp 500 505 510
Arg Thr Lys Leu Gln Asp Ile Lys Ser Ser Leu Asp Asn His Thr Glu 515
520 525 Val Val Phe Ile Ala Asp Phe Pro Gly Leu His Leu Glu Asn Phe
Val 530 535 540 Ser Glu Asp Leu Gly Asn Thr Ser Ile Gln Leu Leu Gln
Gly Glu Val 545 550 555 560 Thr Val Glu Leu Val Ala Glu Gln Lys Asn
Gln Thr Leu Gln Glu Gly 565 570 575 Glu Lys Met Gln Leu Pro Ala Gly
Glu Tyr His Lys Val Tyr Thr Val 580 585 590 Ser Ser Ser Pro Ser Cys
Tyr Met Tyr Val Tyr Val Asn Thr Thr Glu 595 600 605 Val Ala Leu Glu
Gln Asp Leu Ala Tyr Leu Gln Glu Leu Lys Glu Lys 610 615 620 Val Glu
Asn Gly Ser Glu Thr Gly Pro Leu Pro Pro Glu Leu Gln Pro 625 630 635
640 Leu Leu Glu Gly Glu Val Lys Gly Gly Pro Glu Pro Thr Pro Leu Val
645 650 655 Gln Thr Phe Leu Arg Arg Gln Arg Lys Leu Gln Glu Ile Glu
Arg Arg 660 665 670 Arg Asn Ser Pro Phe His Glu Arg Phe Leu Arg Phe
Val Leu Arg Lys 675 680 685 Leu Tyr Val Phe Arg Arg Ser Phe Leu Met
Thr Arg Ile Ser Leu Arg 690 695 700 Asn Leu Leu Leu Gly Arg Pro Ser
Leu Glu Gln Leu Ala Gln Glu Val 705 710 715 720 Thr Tyr Ala Asn Leu
Arg Pro Phe Glu Pro Val Asp Glu Ser Ser Ala 725 730 735 Ser Asn Thr
Asp Ser Ser Asn His Pro Ser Glu Pro Asp Ser Glu His 740 745 750 Val
His Ser Glu Phe 755 105555DNAmus musculusCDS(316)..(5430)
10ggctgtggga gagcagaaga ggagctggaa gagcagccta caacagctgt cgggagggac
60cagggctagt tcacacttgg aagctgggat gccaggaccg gccctcctgc ctctctcggt
120ctccatcggc ctcctggtca gctcactcca cactgagacg attctgaagt
aagatgctcc 180tggctcctca cagactctgc tacaagagac agagtgaagt
gtccccaggg ctcagagcct 240ttgactctgc tccttccctt cccacggctg
agttggcaca ggagcacctg ggtgagctgc 300accagactta agaag atg agg ccc
ctg att ctg tta gct gcc ctc ctc tgg 351 Met Arg Pro Leu Ile Leu Leu
Ala Ala Leu Leu Trp 1 5 10 ctc cag gac tct ttg gcc cag gaa gat gta
tgc tca tcc ttg gat ggg 399Leu Gln Asp Ser Leu Ala Gln Glu Asp Val
Cys Ser Ser Leu Asp Gly 15 20 25 agc cca gac agg cag ggt gga ggt
cca cct ctg agt gtg aac gtc agc 447Ser Pro Asp Arg Gln Gly Gly Gly
Pro Pro Leu Ser Val Asn Val Ser 30 35 40 agc cgc gga aag cct acc
agc ctg ttt ctg agc tgg gta gct gca gag 495Ser Arg Gly Lys Pro Thr
Ser Leu Phe Leu Ser Trp Val Ala Ala Glu 45 50 55 60 cca ggt gga ttt
gac tat gcc ctc tgc ctc agg gct atg aac ttg tcg 543Pro Gly Gly Phe
Asp Tyr Ala Leu Cys Leu Arg Ala Met Asn Leu Ser 65 70 75 ggt ttt
cca gaa ggg caa cag ctc caa gct cat acc aac gag tcc agc 591Gly Phe
Pro Glu Gly Gln Gln Leu Gln Ala His Thr Asn Glu Ser Ser 80 85 90
ttt gag ttc cat ggc ctg gtg cca ggg agt cgc tac cag ctg gaa ctg
639Phe Glu Phe His Gly Leu Val Pro Gly Ser Arg Tyr Gln Leu Glu Leu
95 100 105 act gtc cta aga ccc tgt tgg cag aat gtc aca att acc ctc
act gct 687Thr Val Leu Arg Pro Cys Trp Gln Asn Val Thr Ile Thr Leu
Thr Ala 110 115 120 cga act gcc cct aca gtg gtc cgt gga ctg caa ctg
cat agc act ggg 735Arg Thr Ala Pro Thr Val Val Arg Gly Leu Gln Leu
His Ser Thr Gly 125 130 135 140 agc cca gcc agc ctg gaa gcc tca tgg
agc gat gcc tct ggg gat caa 783Ser Pro Ala Ser Leu Glu Ala Ser Trp
Ser Asp Ala Ser Gly Asp Gln 145 150 155 gac agc tat caa ctt ctc ctc
tac cac ccg gaa tcc cac act ctg gca 831Asp Ser Tyr Gln Leu Leu Leu
Tyr His Pro Glu Ser His Thr Leu Ala 160 165 170 tgt aat gtc tct gtg
tcc cct gac acc ctg tct tac aat ttt ggt gac 879Cys Asn Val Ser Val
Ser Pro Asp Thr Leu Ser Tyr Asn Phe Gly Asp 175 180 185 ctc ttg cca
ggt agt cag tat gtc ttg gag gtt atc acc tgg gct ggc 927Leu Leu Pro
Gly Ser Gln Tyr Val Leu Glu Val Ile Thr Trp Ala Gly 190 195 200 agt
ctc cat gcg aag act agc atc ctc caa tgg aca gag cct gtc cct 975Ser
Leu His Ala Lys Thr Ser Ile Leu Gln Trp Thr Glu Pro Val Pro 205 210
215 220 cct gat cac cta aca ctg cgt gcc ttg ggt acc agt agc ctg caa
gcc 1023Pro Asp His Leu Thr Leu Arg Ala Leu Gly Thr Ser Ser Leu Gln
Ala 225 230 235 ttc tgg aac agc tct gaa ggg gcc acc tgg ttt cac ctg
ata ctt aca 1071Phe Trp Asn Ser Ser Glu Gly Ala Thr Trp Phe His Leu
Ile Leu Thr 240 245 250 gac ctc cta gag ggt acc aac ctg acc aaa gtg
gtc aga caa ggc atc 1119Asp Leu Leu Glu Gly Thr Asn Leu Thr Lys Val
Val Arg Gln Gly Ile 255 260 265 tca acc cac acc ttc ctt cgc ctg tct
ccg ggt aca cct tac cag ctg 1167Ser Thr His Thr Phe Leu Arg Leu Ser
Pro Gly Thr Pro Tyr Gln Leu 270 275 280 aag atc tgt gct gct gct ggg
ccc cac cag att tgg gga ccc aat gcc 1215Lys Ile Cys Ala Ala Ala Gly
Pro His Gln Ile Trp Gly Pro Asn Ala 285 290 295 300 act gag tgg acc
tat ccc tct tac cca tct gac ctg gtg ctg acc ccc 1263Thr Glu Trp Thr
Tyr Pro Ser Tyr Pro Ser Asp Leu Val Leu Thr Pro 305 310 315 tta tgg
aat gag ctc tgg gca agc tgg aag gca ggg cag gga gcc cgg 1311Leu Trp
Asn Glu Leu Trp Ala Ser Trp Lys Ala Gly Gln Gly Ala Arg 320 325 330
gat ggc tat gta ctg aag tta agt ggg cca gtg gag aat aca act act
1359Asp Gly Tyr Val Leu Lys Leu Ser Gly Pro Val Glu Asn Thr Thr Thr
335 340 345 ctg ggt cct gag gag tgc aac gct gtc ttc cca ggg ccc ctg
cct cca 1407Leu Gly Pro Glu Glu Cys Asn Ala Val Phe Pro Gly Pro Leu
Pro Pro 350 355 360 gga cac tac act ttg ggg ctg agg gtt cta gct gga
cct tat gat gcc 1455Gly His Tyr Thr Leu Gly Leu Arg Val Leu Ala Gly
Pro Tyr Asp Ala 365 370 375 380 tgg gta gag ggc agt atc tgg ctg gct
gaa tct gct gct cgt ccc atg 1503Trp Val Glu Gly Ser Ile Trp Leu Ala
Glu Ser Ala Ala Arg Pro Met 385 390 395 gag gtc cct ggt gcc aga ctg
tgg cta gaa gga ctg gaa gct act aag 1551Glu Val Pro Gly Ala Arg Leu
Trp Leu Glu Gly Leu Glu Ala Thr Lys 400 405 410 caa cct ggg aga cgg
gcg ctg ctc tat tct gtt gat gcc cca ggc ctc 1599Gln Pro Gly Arg Arg
Ala Leu Leu Tyr Ser Val Asp Ala Pro Gly Leu 415 420 425 cta ggg aac
atc tct gtg tct tct ggt gcc act cat gtc acc ttc tgt 1647Leu Gly Asn
Ile Ser Val Ser Ser Gly Ala Thr His Val Thr Phe Cys 430 435 440 ggc
ttg gta ccc gga gcg cac tac agg gtg gac att gcc tca tcc atg 1695Gly
Leu Val Pro Gly Ala His Tyr Arg Val Asp Ile Ala Ser Ser Met 445 450
455 460 gga gac atc act cag agc ctc aca ggc tac aca agt ccc ctg cca
cca 1743Gly Asp Ile Thr Gln Ser Leu Thr Gly Tyr Thr Ser Pro Leu Pro
Pro 465 470 475 cag tct ctg gag atc atc agc cgg aac agc cca tct gac
ctg act atc 1791Gln Ser Leu Glu Ile Ile Ser Arg Asn Ser Pro Ser Asp
Leu Thr Ile 480 485 490 ggt tgg gct cca gca cca ggg cag atg gaa ggt
tat aag gtc acc tgg 1839Gly Trp Ala Pro Ala Pro Gly Gln Met Glu Gly
Tyr Lys Val Thr Trp 495 500 505 cat cag gat ggc agc cag agg tca cct
ggc gac ctt gtt gac ttg ggc 1887His Gln Asp Gly Ser Gln Arg Ser Pro
Gly Asp Leu Val Asp Leu Gly 510 515 520 cct gac att tcg agc ctg act
ctg aaa tct ctg gta cct ggt tcc tgc 1935Pro Asp Ile Ser Ser Leu Thr
Leu Lys Ser Leu Val Pro Gly Ser Cys 525 530 535 540 tac acc gtg tca
gca tgg gcc tgg tct ggg aac ctc agc tct gac tct 1983Tyr Thr Val Ser
Ala Trp Ala Trp Ser Gly Asn Leu Ser Ser Asp Ser 545 550 555 cag aag
att cac agt tgc acc cgt ccc gct cct ccc acc aac ctg agc 2031Gln Lys
Ile His Ser Cys Thr Arg Pro Ala Pro Pro Thr Asn Leu Ser 560 565 570
ctg ggc ttt gcc cac cag cct gca aca ctg agg gct tcc tgg tgt cac
2079Leu Gly Phe Ala His Gln Pro Ala Thr Leu Arg Ala Ser Trp Cys His
575 580 585 cca ccg ggt ggc agg gat gcc ttt cag tta cgg ctt tac agg
ctg agg 2127Pro Pro Gly Gly Arg Asp Ala Phe Gln Leu Arg Leu Tyr Arg
Leu Arg 590 595 600 ccc ctg aca ctg gaa agt gag aag atc cta tcc cag
gag gcc cag aac 2175Pro Leu Thr Leu Glu Ser Glu Lys Ile Leu Ser Gln
Glu Ala Gln Asn 605 610 615 620 ttc tcc tgg gcc cag ctg cct gca ggc
tat gaa ttc cag gta cag ctg 2223Phe Ser Trp Ala Gln Leu Pro Ala Gly
Tyr Glu Phe Gln Val Gln Leu 625 630 635 tct acc ttg tgg ggg tcg gag
gag agc ggc agt gcc aac acc aca ggc 2271Ser Thr Leu Trp Gly Ser Glu
Glu Ser Gly Ser Ala Asn Thr Thr Gly 640 645 650 tgg aca ccc ccc tca
gct cct aca ttg gta aat gtg acc agt gaa gcc 2319Trp Thr Pro Pro Ser
Ala Pro Thr Leu Val Asn Val Thr Ser Glu Ala 655 660 665 ccc acc cag
ctc cac gta tcc tgg gtc cac gct gct ggg gac cgg agc 2367Pro Thr Gln
Leu His Val Ser Trp Val His Ala Ala Gly Asp Arg Ser 670 675 680 agc
tac caa gtg acc cta tac cag gag agc act cgg aca gcc acc agc 2415Ser
Tyr Gln Val Thr Leu Tyr Gln Glu Ser Thr Arg Thr Ala Thr Ser 685 690
695 700 att gtg ggg ccc aag gca gac agc aca agc ttt tgg ggt ttg act
cct 2463Ile Val Gly Pro Lys Ala Asp Ser Thr Ser Phe Trp Gly Leu Thr
Pro 705 710 715 ggc act aag tac aag gtg gaa gcc atc tcc tgg gct ggg
ccc ctt tac 2511Gly Thr Lys Tyr Lys Val Glu Ala Ile Ser Trp Ala Gly
Pro Leu Tyr 720 725 730 act gca gca gcc aac gtt tct gct tgg acc tac
cca ctc aca ccc aat 2559Thr Ala Ala Ala Asn Val Ser Ala Trp Thr Tyr
Pro Leu Thr Pro Asn 735 740 745 gag ctg ctc gcc tct atg cag gca ggc
agt gct gtg gtt aac ctg gcc 2607Glu Leu Leu Ala Ser Met Gln Ala Gly
Ser Ala Val Val Asn Leu Ala 750 755 760 tgg ccc agt ggt ccc ttg ggg
caa ggg aca tgc cat gcc caa ctc tca 2655Trp Pro Ser Gly Pro Leu Gly
Gln Gly Thr Cys His Ala Gln Leu Ser 765 770 775 780 gat gct gga cac
ctt tca tgg gag caa ccg ctg tcg cta ggc caa gac 2703Asp Ala Gly His
Leu Ser Trp Glu Gln Pro Leu Ser Leu Gly Gln Asp 785 790 795 ctc ctc
atg cta agg aat ctt ata cca gga cat acg gtt tca ttg tct 2751Leu Leu
Met Leu Arg Asn Leu Ile Pro Gly His Thr Val Ser Leu Ser 800 805 810
gtg aag tgt cgg gca gga cca ctc cag gcc tcc act cac ccc ctg gtg
2799Val Lys Cys Arg Ala Gly Pro Leu Gln Ala Ser Thr His Pro Leu Val
815 820 825 ctg tct gta gag cct ggc cct gtg gaa gat gtg ttc tgt caa
cct gag 2847Leu Ser Val Glu Pro Gly Pro Val Glu Asp Val Phe Cys Gln
Pro Glu 830 835 840 gcc acc tac ctg tcc ctg aac tgg acg atg cct act
gga gat gtg gct 2895Ala Thr Tyr Leu Ser Leu Asn Trp Thr Met Pro Thr
Gly Asp Val Ala 845 850 855 860 gtc tgt ctg gtg gag gta gag cag ctg
gtg cca gga ggg agc gct cat 2943Val Cys Leu Val Glu Val Glu Gln Leu
Val Pro Gly Gly Ser Ala His 865 870 875 ttt gtc ttc cag gtc aac acc
tcg gag gat gca ctt ctg ctg ccc aac 2991Phe Val Phe Gln Val Asn Thr
Ser Glu Asp Ala Leu Leu Leu Pro Asn 880 885 890 ttg acg ccc acc act
tct tac cgc ctt agc ctc act gtg ctg ggt ggg 3039Leu Thr Pro Thr Thr
Ser Tyr Arg Leu Ser Leu Thr Val Leu Gly Gly 895 900 905 aat cgc cag
tgg agc cgg gcg gtt acc ctg gtg tgc act act tct gct 3087Asn Arg Gln
Trp Ser Arg Ala Val Thr Leu Val Cys Thr Thr Ser Ala 910 915 920 gag
gtt tgg cac ccc cca gag cta gct gag gcc ccc cag gtg gag ctg 3135Glu
Val Trp His Pro Pro Glu Leu Ala Glu Ala Pro Gln Val Glu Leu 925 930
935 940 ggg aca ggg atg ggt gtg aca gtc aca cgt ggc atg ttt ggt aaa
gat 3183Gly Thr Gly Met Gly Val Thr Val Thr Arg Gly Met Phe Gly Lys
Asp 945 950 955 gac ggg cag atc cag tgg tat ggc ata att gcc acc atc
aac atg aca 3231Asp Gly Gln Ile Gln Trp Tyr Gly Ile Ile Ala Thr Ile
Asn Met Thr 960 965 970 ctg gcc cag cct tcc cag gaa gcc atc aac cac
aca tgg tat gac cac 3279Leu Ala Gln Pro Ser Gln Glu Ala Ile Asn His
Thr Trp Tyr Asp His 975 980 985 tac tat aga gga cat gac tcc tac ctg
gct ctc ctg ttc cca aac ccc 3327Tyr Tyr Arg Gly His Asp Ser Tyr Leu
Ala Leu Leu Phe Pro Asn Pro
990 995 1000 ttc tac cca gag cct tgg gct gtg cca aga tcc tgg aca
gta cct 3372Phe Tyr Pro Glu Pro Trp Ala Val Pro Arg Ser Trp Thr Val
Pro 1005 1010 1015 gtg ggt aca gag gac tgt gac aac acc cag gag ata
tgc aat ggg 3417Val Gly Thr Glu Asp Cys Asp Asn Thr Gln Glu Ile Cys
Asn Gly 1020 1025 1030 cat ctc aag cca ggc ttc cag tat agg ttc agc
att gca gcc ttt 3462His Leu Lys Pro Gly Phe Gln Tyr Arg Phe Ser Ile
Ala Ala Phe 1035 1040 1045 agt agg ctc agc tct cca gag acc atc ctg
gcc ttc tcc gcc ttc 3507Ser Arg Leu Ser Ser Pro Glu Thr Ile Leu Ala
Phe Ser Ala Phe 1050 1055 1060 tca gag cct cag gct agc atc tct ctg
gtg gcc atg ccc ctg aca 3552Ser Glu Pro Gln Ala Ser Ile Ser Leu Val
Ala Met Pro Leu Thr 1065 1070 1075 gtt atg atg ggg act gtg gtg ggc
tgc atc atc att gtg tgt gca 3597Val Met Met Gly Thr Val Val Gly Cys
Ile Ile Ile Val Cys Ala 1080 1085 1090 gtg cta tgc ttg ttg tgc cgg
cgg cgc ctg aag gga cca agg tca 3642Val Leu Cys Leu Leu Cys Arg Arg
Arg Leu Lys Gly Pro Arg Ser 1095 1100 1105 gag aag aat ggc ttt tcc
cag gag ttg atg cct tac aac ctg tgg 3687Glu Lys Asn Gly Phe Ser Gln
Glu Leu Met Pro Tyr Asn Leu Trp 1110 1115 1120 cgg acc cat cgg ccc
atc ccc agc cat agc ttc cgg cag agc tat 3732Arg Thr His Arg Pro Ile
Pro Ser His Ser Phe Arg Gln Ser Tyr 1125 1130 1135 gag gcc aag agt
gca cgt gca cac cag gcc ttc ttc cag gaa ttt 3777Glu Ala Lys Ser Ala
Arg Ala His Gln Ala Phe Phe Gln Glu Phe 1140 1145 1150 gag gag ctg
aag gag gtg ggc aag gac cag ccc aga cta gag gct 3822Glu Glu Leu Lys
Glu Val Gly Lys Asp Gln Pro Arg Leu Glu Ala 1155 1160 1165 gag cat
cct gcc aac atc acc aag aac cgg tac cca cac gtg cta 3867Glu His Pro
Ala Asn Ile Thr Lys Asn Arg Tyr Pro His Val Leu 1170 1175 1180 cct
tat gac cac tcc agg gtc agg ctg acc cag cta tca gga gag 3912Pro Tyr
Asp His Ser Arg Val Arg Leu Thr Gln Leu Ser Gly Glu 1185 1190 1195
cct cat tct gac tac atc aat gcc aac ttc atc cca ggc tat agc 3957Pro
His Ser Asp Tyr Ile Asn Ala Asn Phe Ile Pro Gly Tyr Ser 1200 1205
1210 cac cca cag gag atc att gcc acc cag ggg cct ctc aaa aag acg
4002His Pro Gln Glu Ile Ile Ala Thr Gln Gly Pro Leu Lys Lys Thr
1215 1220 1225 gtc gag gac ttc tgg cgg ttg gtg tgg gag cag caa gtc
cac gtg 4047Val Glu Asp Phe Trp Arg Leu Val Trp Glu Gln Gln Val His
Val 1230 1235 1240 atc atc atg cta act gtg ggc atg gag aat ggg cgg
gta ctg tgt 4092Ile Ile Met Leu Thr Val Gly Met Glu Asn Gly Arg Val
Leu Cys 1245 1250 1255 gag cac tac tgg cca gtc aac tcc acg cct gtc
acc cac ggt cac 4137Glu His Tyr Trp Pro Val Asn Ser Thr Pro Val Thr
His Gly His 1260 1265 1270 atc acc acc cac ctc ctg gca gag gaa tct
gag gac gag tgg acc 4182Ile Thr Thr His Leu Leu Ala Glu Glu Ser Glu
Asp Glu Trp Thr 1275 1280 1285 agg agg gaa ttc cag ctg cag cac ggt
gca gag caa aaa cag agg 4227Arg Arg Glu Phe Gln Leu Gln His Gly Ala
Glu Gln Lys Gln Arg 1290 1295 1300 cgc gtg aag cag ctg cag ttc acg
acc tgg cca gac cac agt gtc 4272Arg Val Lys Gln Leu Gln Phe Thr Thr
Trp Pro Asp His Ser Val 1305 1310 1315 ccc gag gct ccc agc tct ctg
ctc gct ttt gtg gaa ctg gtg cag 4317Pro Glu Ala Pro Ser Ser Leu Leu
Ala Phe Val Glu Leu Val Gln 1320 1325 1330 gag gag gtg aag gca act
cag ggc aag ggg ccc atc ctg gtg cat 4362Glu Glu Val Lys Ala Thr Gln
Gly Lys Gly Pro Ile Leu Val His 1335 1340 1345 tgc agt gcg ggt gtg
ggc agg aca ggc acc ttt gtg gct ctc tta 4407Cys Ser Ala Gly Val Gly
Arg Thr Gly Thr Phe Val Ala Leu Leu 1350 1355 1360 ccg gct gtt cga
caa cta gag gaa gaa cag gtg gtc gat gtg ttc 4452Pro Ala Val Arg Gln
Leu Glu Glu Glu Gln Val Val Asp Val Phe 1365 1370 1375 aac act gtg
tac ata ctc cgg ctg cac cgg ccc ctc atg atc cag 4497Asn Thr Val Tyr
Ile Leu Arg Leu His Arg Pro Leu Met Ile Gln 1380 1385 1390 acc ttg
agt caa tac atc ttc ctg cac agc tgc ctg ctg aac aag 4542Thr Leu Ser
Gln Tyr Ile Phe Leu His Ser Cys Leu Leu Asn Lys 1395 1400 1405 att
ctg gaa ggg ccc tct gac gcc tca gac tcc ggc ccc atc cct 4587Ile Leu
Glu Gly Pro Ser Asp Ala Ser Asp Ser Gly Pro Ile Pro 1410 1415 1420
gtg atg aat ttt gca caa gct tgt gcc aag agg gca gcc aat gcc 4632Val
Met Asn Phe Ala Gln Ala Cys Ala Lys Arg Ala Ala Asn Ala 1425 1430
1435 aat gcc ggt ttc ttg aag gag tac agg ctc ctg aag cag gcc atc
4677Asn Ala Gly Phe Leu Lys Glu Tyr Arg Leu Leu Lys Gln Ala Ile
1440 1445 1450 aag gat gag act ggc tct ctg ctg ccc tct cct gac tat
aat cag 4722Lys Asp Glu Thr Gly Ser Leu Leu Pro Ser Pro Asp Tyr Asn
Gln 1455 1460 1465 aac agc atc gcc tcc tgt cat cat tct cag gag cag
ttg gcc ctg 4767Asn Ser Ile Ala Ser Cys His His Ser Gln Glu Gln Leu
Ala Leu 1470 1475 1480 gtg gag gag agc cct gct gat aac atg ctg gca
gcc tcg ctc ttc 4812Val Glu Glu Ser Pro Ala Asp Asn Met Leu Ala Ala
Ser Leu Phe 1485 1490 1495 cct ggt ggg ccg tct ggt cgc gac cat gtg
gtg ctg act ggc tcg 4857Pro Gly Gly Pro Ser Gly Arg Asp His Val Val
Leu Thr Gly Ser 1500 1505 1510 gcc gga cca aag gaa ctc tgg gaa atg
gtg tgg gaa cat ggc gcc 4902Ala Gly Pro Lys Glu Leu Trp Glu Met Val
Trp Glu His Gly Ala 1515 1520 1525 tat gtg ctt gtc tcc ctg ggt ctg
cct gat acc aag gag aag cca 4947Tyr Val Leu Val Ser Leu Gly Leu Pro
Asp Thr Lys Glu Lys Pro 1530 1535 1540 caa gac atc tgg cca atg gag
atg cag cct att gtc aca gac atg 4992Gln Asp Ile Trp Pro Met Glu Met
Gln Pro Ile Val Thr Asp Met 1545 1550 1555 gtg aca gtg cac aga gtg
gct gag agc aac aca gct ggc tgg ccc 5037Val Thr Val His Arg Val Ala
Glu Ser Asn Thr Ala Gly Trp Pro 1560 1565 1570 agt acc ctc atc aga
gtt ata cat ggg gac agt ggg acg gaa agg 5082Ser Thr Leu Ile Arg Val
Ile His Gly Asp Ser Gly Thr Glu Arg 1575 1580 1585 cag gtt caa tgc
ctg cag ttt cca cac tgc gag act ggg agt gag 5127Gln Val Gln Cys Leu
Gln Phe Pro His Cys Glu Thr Gly Ser Glu 1590 1595 1600 ctc cca gct
aac acc cta ctg acc ttc ctt gat gct gtg ggc cag 5172Leu Pro Ala Asn
Thr Leu Leu Thr Phe Leu Asp Ala Val Gly Gln 1605 1610 1615 tgc tgc
tcc cgg ggc aat agc aag aag cca ggg acc ctg ctc agt 5217Cys Cys Ser
Arg Gly Asn Ser Lys Lys Pro Gly Thr Leu Leu Ser 1620 1625 1630 cac
tcc agc aag gtc aca aac cag ctg agc acc ttc ttg gct atg 5262His Ser
Ser Lys Val Thr Asn Gln Leu Ser Thr Phe Leu Ala Met 1635 1640 1645
gaa cag ctg cta cag caa gca ggg acc gag cgc aca gtg gat gtc 5307Glu
Gln Leu Leu Gln Gln Ala Gly Thr Glu Arg Thr Val Asp Val 1650 1655
1660 ttc agt gtg gcc ctg aag cag aca cag gcc tgt ggc ctt aag acc
5352Phe Ser Val Ala Leu Lys Gln Thr Gln Ala Cys Gly Leu Lys Thr
1665 1670 1675 cca acg ctg gag cag tat atc tac ctc tac aac tgt ctg
aac agc 5397Pro Thr Leu Glu Gln Tyr Ile Tyr Leu Tyr Asn Cys Leu Asn
Ser 1680 1685 1690 gca ttg agg aac agg ctg ccc cga gct agg aag
tgaccttgcc 5440Ala Leu Arg Asn Arg Leu Pro Arg Ala Arg Lys 1695
1700 1705 ctgctaggca tcacgttcca gcaatccacc caggcctggc ttccccagga
gaacagatct 5500attcggcctc acgctgtcaa agggcagagt ctgggaataa
agggtaaatc tcgag 5555111705PRTmus musculus 11Met Arg Pro Leu Ile
Leu Leu Ala Ala Leu Leu Trp Leu Gln Asp Ser 1 5 10 15 Leu Ala Gln
Glu Asp Val Cys Ser Ser Leu Asp Gly Ser Pro Asp Arg 20 25 30 Gln
Gly Gly Gly Pro Pro Leu Ser Val Asn Val Ser Ser Arg Gly Lys 35 40
45 Pro Thr Ser Leu Phe Leu Ser Trp Val Ala Ala Glu Pro Gly Gly Phe
50 55 60 Asp Tyr Ala Leu Cys Leu Arg Ala Met Asn Leu Ser Gly Phe
Pro Glu 65 70 75 80 Gly Gln Gln Leu Gln Ala His Thr Asn Glu Ser Ser
Phe Glu Phe His 85 90 95 Gly Leu Val Pro Gly Ser Arg Tyr Gln Leu
Glu Leu Thr Val Leu Arg 100 105 110 Pro Cys Trp Gln Asn Val Thr Ile
Thr Leu Thr Ala Arg Thr Ala Pro 115 120 125 Thr Val Val Arg Gly Leu
Gln Leu His Ser Thr Gly Ser Pro Ala Ser 130 135 140 Leu Glu Ala Ser
Trp Ser Asp Ala Ser Gly Asp Gln Asp Ser Tyr Gln 145 150 155 160 Leu
Leu Leu Tyr His Pro Glu Ser His Thr Leu Ala Cys Asn Val Ser 165 170
175 Val Ser Pro Asp Thr Leu Ser Tyr Asn Phe Gly Asp Leu Leu Pro Gly
180 185 190 Ser Gln Tyr Val Leu Glu Val Ile Thr Trp Ala Gly Ser Leu
His Ala 195 200 205 Lys Thr Ser Ile Leu Gln Trp Thr Glu Pro Val Pro
Pro Asp His Leu 210 215 220 Thr Leu Arg Ala Leu Gly Thr Ser Ser Leu
Gln Ala Phe Trp Asn Ser 225 230 235 240 Ser Glu Gly Ala Thr Trp Phe
His Leu Ile Leu Thr Asp Leu Leu Glu 245 250 255 Gly Thr Asn Leu Thr
Lys Val Val Arg Gln Gly Ile Ser Thr His Thr 260 265 270 Phe Leu Arg
Leu Ser Pro Gly Thr Pro Tyr Gln Leu Lys Ile Cys Ala 275 280 285 Ala
Ala Gly Pro His Gln Ile Trp Gly Pro Asn Ala Thr Glu Trp Thr 290 295
300 Tyr Pro Ser Tyr Pro Ser Asp Leu Val Leu Thr Pro Leu Trp Asn Glu
305 310 315 320 Leu Trp Ala Ser Trp Lys Ala Gly Gln Gly Ala Arg Asp
Gly Tyr Val 325 330 335 Leu Lys Leu Ser Gly Pro Val Glu Asn Thr Thr
Thr Leu Gly Pro Glu 340 345 350 Glu Cys Asn Ala Val Phe Pro Gly Pro
Leu Pro Pro Gly His Tyr Thr 355 360 365 Leu Gly Leu Arg Val Leu Ala
Gly Pro Tyr Asp Ala Trp Val Glu Gly 370 375 380 Ser Ile Trp Leu Ala
Glu Ser Ala Ala Arg Pro Met Glu Val Pro Gly 385 390 395 400 Ala Arg
Leu Trp Leu Glu Gly Leu Glu Ala Thr Lys Gln Pro Gly Arg 405 410 415
Arg Ala Leu Leu Tyr Ser Val Asp Ala Pro Gly Leu Leu Gly Asn Ile 420
425 430 Ser Val Ser Ser Gly Ala Thr His Val Thr Phe Cys Gly Leu Val
Pro 435 440 445 Gly Ala His Tyr Arg Val Asp Ile Ala Ser Ser Met Gly
Asp Ile Thr 450 455 460 Gln Ser Leu Thr Gly Tyr Thr Ser Pro Leu Pro
Pro Gln Ser Leu Glu 465 470 475 480 Ile Ile Ser Arg Asn Ser Pro Ser
Asp Leu Thr Ile Gly Trp Ala Pro 485 490 495 Ala Pro Gly Gln Met Glu
Gly Tyr Lys Val Thr Trp His Gln Asp Gly 500 505 510 Ser Gln Arg Ser
Pro Gly Asp Leu Val Asp Leu Gly Pro Asp Ile Ser 515 520 525 Ser Leu
Thr Leu Lys Ser Leu Val Pro Gly Ser Cys Tyr Thr Val Ser 530 535 540
Ala Trp Ala Trp Ser Gly Asn Leu Ser Ser Asp Ser Gln Lys Ile His 545
550 555 560 Ser Cys Thr Arg Pro Ala Pro Pro Thr Asn Leu Ser Leu Gly
Phe Ala 565 570 575 His Gln Pro Ala Thr Leu Arg Ala Ser Trp Cys His
Pro Pro Gly Gly 580 585 590 Arg Asp Ala Phe Gln Leu Arg Leu Tyr Arg
Leu Arg Pro Leu Thr Leu 595 600 605 Glu Ser Glu Lys Ile Leu Ser Gln
Glu Ala Gln Asn Phe Ser Trp Ala 610 615 620 Gln Leu Pro Ala Gly Tyr
Glu Phe Gln Val Gln Leu Ser Thr Leu Trp 625 630 635 640 Gly Ser Glu
Glu Ser Gly Ser Ala Asn Thr Thr Gly Trp Thr Pro Pro 645 650 655 Ser
Ala Pro Thr Leu Val Asn Val Thr Ser Glu Ala Pro Thr Gln Leu 660 665
670 His Val Ser Trp Val His Ala Ala Gly Asp Arg Ser Ser Tyr Gln Val
675 680 685 Thr Leu Tyr Gln Glu Ser Thr Arg Thr Ala Thr Ser Ile Val
Gly Pro 690 695 700 Lys Ala Asp Ser Thr Ser Phe Trp Gly Leu Thr Pro
Gly Thr Lys Tyr 705 710 715 720 Lys Val Glu Ala Ile Ser Trp Ala Gly
Pro Leu Tyr Thr Ala Ala Ala 725 730 735 Asn Val Ser Ala Trp Thr Tyr
Pro Leu Thr Pro Asn Glu Leu Leu Ala 740 745 750 Ser Met Gln Ala Gly
Ser Ala Val Val Asn Leu Ala Trp Pro Ser Gly 755 760 765 Pro Leu Gly
Gln Gly Thr Cys His Ala Gln Leu Ser Asp Ala Gly His 770 775 780 Leu
Ser Trp Glu Gln Pro Leu Ser Leu Gly Gln Asp Leu Leu Met Leu 785 790
795 800 Arg Asn Leu Ile Pro Gly His Thr Val Ser Leu Ser Val Lys Cys
Arg 805 810 815 Ala Gly Pro Leu Gln Ala Ser Thr His Pro Leu Val Leu
Ser Val Glu 820 825 830 Pro Gly Pro Val Glu Asp Val Phe Cys Gln Pro
Glu Ala Thr Tyr Leu 835 840 845 Ser Leu Asn Trp Thr Met Pro Thr Gly
Asp Val Ala Val Cys Leu Val 850 855 860 Glu Val Glu Gln Leu Val Pro
Gly Gly Ser Ala His Phe Val Phe Gln 865 870 875 880 Val Asn Thr Ser
Glu Asp Ala Leu Leu Leu Pro Asn Leu Thr Pro Thr 885 890 895 Thr Ser
Tyr Arg Leu Ser Leu Thr Val Leu Gly Gly Asn Arg Gln Trp 900 905 910
Ser Arg Ala Val Thr Leu Val Cys Thr Thr Ser Ala Glu Val Trp His 915
920 925 Pro Pro Glu Leu Ala Glu Ala Pro Gln Val Glu Leu Gly Thr Gly
Met 930 935 940 Gly Val Thr Val Thr Arg Gly Met Phe Gly Lys Asp Asp
Gly Gln Ile 945 950 955 960 Gln Trp Tyr Gly Ile Ile Ala Thr Ile Asn
Met Thr Leu Ala Gln Pro 965 970 975 Ser Gln Glu Ala Ile Asn His Thr
Trp
Tyr Asp His Tyr Tyr Arg Gly 980 985 990 His Asp Ser Tyr Leu Ala Leu
Leu Phe Pro Asn Pro Phe Tyr Pro Glu 995 1000 1005 Pro Trp Ala Val
Pro Arg Ser Trp Thr Val Pro Val Gly Thr Glu 1010 1015 1020 Asp Cys
Asp Asn Thr Gln Glu Ile Cys Asn Gly His Leu Lys Pro 1025 1030 1035
Gly Phe Gln Tyr Arg Phe Ser Ile Ala Ala Phe Ser Arg Leu Ser 1040
1045 1050 Ser Pro Glu Thr Ile Leu Ala Phe Ser Ala Phe Ser Glu Pro
Gln 1055 1060 1065 Ala Ser Ile Ser Leu Val Ala Met Pro Leu Thr Val
Met Met Gly 1070 1075 1080 Thr Val Val Gly Cys Ile Ile Ile Val Cys
Ala Val Leu Cys Leu 1085 1090 1095 Leu Cys Arg Arg Arg Leu Lys Gly
Pro Arg Ser Glu Lys Asn Gly 1100 1105 1110 Phe Ser Gln Glu Leu Met
Pro Tyr Asn Leu Trp Arg Thr His Arg 1115 1120 1125 Pro Ile Pro Ser
His Ser Phe Arg Gln Ser Tyr Glu Ala Lys Ser 1130 1135 1140 Ala Arg
Ala His Gln Ala Phe Phe Gln Glu Phe Glu Glu Leu Lys 1145 1150 1155
Glu Val Gly Lys Asp Gln Pro Arg Leu Glu Ala Glu His Pro Ala 1160
1165 1170 Asn Ile Thr Lys Asn Arg Tyr Pro His Val Leu Pro Tyr Asp
His 1175 1180 1185 Ser Arg Val Arg Leu Thr Gln Leu Ser Gly Glu Pro
His Ser Asp 1190 1195 1200 Tyr Ile Asn Ala Asn Phe Ile Pro Gly Tyr
Ser His Pro Gln Glu 1205 1210 1215 Ile Ile Ala Thr Gln Gly Pro Leu
Lys Lys Thr Val Glu Asp Phe 1220 1225 1230 Trp Arg Leu Val Trp Glu
Gln Gln Val His Val Ile Ile Met Leu 1235 1240 1245 Thr Val Gly Met
Glu Asn Gly Arg Val Leu Cys Glu His Tyr Trp 1250 1255 1260 Pro Val
Asn Ser Thr Pro Val Thr His Gly His Ile Thr Thr His 1265 1270 1275
Leu Leu Ala Glu Glu Ser Glu Asp Glu Trp Thr Arg Arg Glu Phe 1280
1285 1290 Gln Leu Gln His Gly Ala Glu Gln Lys Gln Arg Arg Val Lys
Gln 1295 1300 1305 Leu Gln Phe Thr Thr Trp Pro Asp His Ser Val Pro
Glu Ala Pro 1310 1315 1320 Ser Ser Leu Leu Ala Phe Val Glu Leu Val
Gln Glu Glu Val Lys 1325 1330 1335 Ala Thr Gln Gly Lys Gly Pro Ile
Leu Val His Cys Ser Ala Gly 1340 1345 1350 Val Gly Arg Thr Gly Thr
Phe Val Ala Leu Leu Pro Ala Val Arg 1355 1360 1365 Gln Leu Glu Glu
Glu Gln Val Val Asp Val Phe Asn Thr Val Tyr 1370 1375 1380 Ile Leu
Arg Leu His Arg Pro Leu Met Ile Gln Thr Leu Ser Gln 1385 1390 1395
Tyr Ile Phe Leu His Ser Cys Leu Leu Asn Lys Ile Leu Glu Gly 1400
1405 1410 Pro Ser Asp Ala Ser Asp Ser Gly Pro Ile Pro Val Met Asn
Phe 1415 1420 1425 Ala Gln Ala Cys Ala Lys Arg Ala Ala Asn Ala Asn
Ala Gly Phe 1430 1435 1440 Leu Lys Glu Tyr Arg Leu Leu Lys Gln Ala
Ile Lys Asp Glu Thr 1445 1450 1455 Gly Ser Leu Leu Pro Ser Pro Asp
Tyr Asn Gln Asn Ser Ile Ala 1460 1465 1470 Ser Cys His His Ser Gln
Glu Gln Leu Ala Leu Val Glu Glu Ser 1475 1480 1485 Pro Ala Asp Asn
Met Leu Ala Ala Ser Leu Phe Pro Gly Gly Pro 1490 1495 1500 Ser Gly
Arg Asp His Val Val Leu Thr Gly Ser Ala Gly Pro Lys 1505 1510 1515
Glu Leu Trp Glu Met Val Trp Glu His Gly Ala Tyr Val Leu Val 1520
1525 1530 Ser Leu Gly Leu Pro Asp Thr Lys Glu Lys Pro Gln Asp Ile
Trp 1535 1540 1545 Pro Met Glu Met Gln Pro Ile Val Thr Asp Met Val
Thr Val His 1550 1555 1560 Arg Val Ala Glu Ser Asn Thr Ala Gly Trp
Pro Ser Thr Leu Ile 1565 1570 1575 Arg Val Ile His Gly Asp Ser Gly
Thr Glu Arg Gln Val Gln Cys 1580 1585 1590 Leu Gln Phe Pro His Cys
Glu Thr Gly Ser Glu Leu Pro Ala Asn 1595 1600 1605 Thr Leu Leu Thr
Phe Leu Asp Ala Val Gly Gln Cys Cys Ser Arg 1610 1615 1620 Gly Asn
Ser Lys Lys Pro Gly Thr Leu Leu Ser His Ser Ser Lys 1625 1630 1635
Val Thr Asn Gln Leu Ser Thr Phe Leu Ala Met Glu Gln Leu Leu 1640
1645 1650 Gln Gln Ala Gly Thr Glu Arg Thr Val Asp Val Phe Ser Val
Ala 1655 1660 1665 Leu Lys Gln Thr Gln Ala Cys Gly Leu Lys Thr Pro
Thr Leu Glu 1670 1675 1680 Gln Tyr Ile Tyr Leu Tyr Asn Cys Leu Asn
Ser Ala Leu Arg Asn 1685 1690 1695 Arg Leu Pro Arg Ala Arg Lys 1700
1705 1249PRThomo sapiens 12Tyr Leu Tyr Gln Trp Leu Gly Ala Pro Val
Pro Tyr Pro Asp Pro Leu 1 5 10 15 Glu Pro Arg Arg Glu Val Cys Glu
Leu Asn Pro Asp Cys Asp Glu Leu 20 25 30 Ala Asp His Ile Gly Phe
Gln Glu Ala Tyr Arg Arg Phe Tyr Gly Pro 35 40 45 Val 1349PRThomo
sapiensVARIANT(17)..(17)Xaa can be any amino acid. 13Tyr Leu Tyr
Gln Trp Leu Gly Ala Pro Val Pro Tyr Pro Asp Pro Leu 1 5 10 15 Xaa
Pro Arg Arg Xaa Val Cys Xaa Leu Asn Pro Asp Cys Asp Glu Leu 20 25
30 Ala Asp His Ile Gly Phe Gln Glu Ala Tyr Arg Arg Phe Tyr Gly Pro
35 40 45 Val 145136DNARattus norvegicusCDS(1)..(5136) 14atg agg ccc
ctg att ctg tta gct gcc ctc ctc tgg ctc cag ggc ttt 48Met Arg Pro
Leu Ile Leu Leu Ala Ala Leu Leu Trp Leu Gln Gly Phe 1 5 10 15 ttg
gcc gag gac gac gca tgc tca tcc ttg gaa ggg agc cca gac agg 96Leu
Ala Glu Asp Asp Ala Cys Ser Ser Leu Glu Gly Ser Pro Asp Arg 20 25
30 cag ggt gga ggt cca ctt ctg agt gtg aac gtc agt agc cat gga aag
144Gln Gly Gly Gly Pro Leu Leu Ser Val Asn Val Ser Ser His Gly Lys
35 40 45 tct acc agc ctg ttt ctg agc tgg gta gct gca gag ctg ggc
gga ttt 192Ser Thr Ser Leu Phe Leu Ser Trp Val Ala Ala Glu Leu Gly
Gly Phe 50 55 60 gac tat gcc ctc agc ctc agg agt gtg aac tcc tca
ggt tct cca gaa 240Asp Tyr Ala Leu Ser Leu Arg Ser Val Asn Ser Ser
Gly Ser Pro Glu 65 70 75 80 ggg caa cag ctc cag gct cac aca aat gag
tcc ggc ttt gag ttc cat 288Gly Gln Gln Leu Gln Ala His Thr Asn Glu
Ser Gly Phe Glu Phe His 85 90 95 ggc ctg gtg cca ggg agt cgc tac
cag cta aaa ctg act gtc cta aga 336Gly Leu Val Pro Gly Ser Arg Tyr
Gln Leu Lys Leu Thr Val Leu Arg 100 105 110 ccc tgt tgg cag aat gtc
aca att acc ctc act gcc cga act gcc ccg 384Pro Cys Trp Gln Asn Val
Thr Ile Thr Leu Thr Ala Arg Thr Ala Pro 115 120 125 aca gtg gtc cgt
gga ctg cag ctg cat agc gct ggg agc cca gcc agg 432Thr Val Val Arg
Gly Leu Gln Leu His Ser Ala Gly Ser Pro Ala Arg 130 135 140 ctg gaa
gcc tcg tgg agt gat gcc cct gga gat caa gac agc tac caa 480Leu Glu
Ala Ser Trp Ser Asp Ala Pro Gly Asp Gln Asp Ser Tyr Gln 145 150 155
160 ctt ctc ctc tac cac ctg gaa tcc caa act ctg gca tgc aat gtc tct
528Leu Leu Leu Tyr His Leu Glu Ser Gln Thr Leu Ala Cys Asn Val Ser
165 170 175 gtg tcc cct gac acc ctg tct tac agt ttt ggc gac ctt ttg
cca ggt 576Val Ser Pro Asp Thr Leu Ser Tyr Ser Phe Gly Asp Leu Leu
Pro Gly 180 185 190 act cag tat gtc ttg gag gtt atc acc tgg gct ggc
agt ctc cat gcg 624Thr Gln Tyr Val Leu Glu Val Ile Thr Trp Ala Gly
Ser Leu His Ala 195 200 205 aag act agt atc ctc cag tgg aca gag cct
gtc cct cct gat cac cta 672Lys Thr Ser Ile Leu Gln Trp Thr Glu Pro
Val Pro Pro Asp His Leu 210 215 220 gca cta cgt gcc ttg ggt acc agt
agc ctg caa gcc ttc tgg aac agc 720Ala Leu Arg Ala Leu Gly Thr Ser
Ser Leu Gln Ala Phe Trp Asn Ser 225 230 235 240 tct gaa ggg gcc acc
tcg ttt cac ctg atg ctc aca gac ctc ctc ggg 768Ser Glu Gly Ala Thr
Ser Phe His Leu Met Leu Thr Asp Leu Leu Gly 245 250 255 ggc acc aac
acg act gcg gtg atc aga caa ggg gtc tcg acc cac acc 816Gly Thr Asn
Thr Thr Ala Val Ile Arg Gln Gly Val Ser Thr His Thr 260 265 270 ttt
ctt cac cta tct ccg ggt aca cct cat gag ctg aag att tgt gct 864Phe
Leu His Leu Ser Pro Gly Thr Pro His Glu Leu Lys Ile Cys Ala 275 280
285 tct gct ggg ccc cac cag atc tgg gga ccc agt gcc acc gag tgg acc
912Ser Ala Gly Pro His Gln Ile Trp Gly Pro Ser Ala Thr Glu Trp Thr
290 295 300 tat ccc tct tac cca tct gac ctg gtg ctg act ccc tta cgg
aat gag 960Tyr Pro Ser Tyr Pro Ser Asp Leu Val Leu Thr Pro Leu Arg
Asn Glu 305 310 315 320 ctc tgg gcc agc tgg aag gca ggg ctg gga gcc
cgg gac ggc tat gta 1008Leu Trp Ala Ser Trp Lys Ala Gly Leu Gly Ala
Arg Asp Gly Tyr Val 325 330 335 ctg aag tta agt ggg cca atg gag agt
acg tct acc ctg ggc ccg gaa 1056Leu Lys Leu Ser Gly Pro Met Glu Ser
Thr Ser Thr Leu Gly Pro Glu 340 345 350 gag tgc aat gca gtc ttc cca
ggg ccc ctg cct ccg gga cac tac act 1104Glu Cys Asn Ala Val Phe Pro
Gly Pro Leu Pro Pro Gly His Tyr Thr 355 360 365 ttg cag ctg aag gtt
cta gct gga cct tat gat gcc tgg gtg gag ggc 1152Leu Gln Leu Lys Val
Leu Ala Gly Pro Tyr Asp Ala Trp Val Glu Gly 370 375 380 agt acc tgg
ctg gct gaa tct gct gcc ctt ccc agg gag gtc cct ggt 1200Ser Thr Trp
Leu Ala Glu Ser Ala Ala Leu Pro Arg Glu Val Pro Gly 385 390 395 400
gcc aga ctg tgg cta gat gga ctg gaa gct tcc aag cag cct ggg aga
1248Ala Arg Leu Trp Leu Asp Gly Leu Glu Ala Ser Lys Gln Pro Gly Arg
405 410 415 cgg gcg cta ctc tat tct gac gat gcc cca ggc tcc cta ggg
aac atc 1296Arg Ala Leu Leu Tyr Ser Asp Asp Ala Pro Gly Ser Leu Gly
Asn Ile 420 425 430 tct gtg ccc tct ggt gcc act cac gtc att ttc tgt
ggc ctg gta cct 1344Ser Val Pro Ser Gly Ala Thr His Val Ile Phe Cys
Gly Leu Val Pro 435 440 445 gga gcc cac tat agg gtg gac att gcc tca
tcc acg ggg gac atc tct 1392Gly Ala His Tyr Arg Val Asp Ile Ala Ser
Ser Thr Gly Asp Ile Ser 450 455 460 cag agc atc tca ggc tat aca agt
ccc ctg cca ccg cag tca ctg gag 1440Gln Ser Ile Ser Gly Tyr Thr Ser
Pro Leu Pro Pro Gln Ser Leu Glu 465 470 475 480 gtc atc agc agg agc
agc cca tct gac ctg act att gct tgg ggt cca 1488Val Ile Ser Arg Ser
Ser Pro Ser Asp Leu Thr Ile Ala Trp Gly Pro 485 490 495 gca cca ggg
cag ctg gaa ggt tat aag gtt acc tgg cat cag gat ggc 1536Ala Pro Gly
Gln Leu Glu Gly Tyr Lys Val Thr Trp His Gln Asp Gly 500 505 510 agc
cag agg tct cct ggc gac ctt gtt gac ttg ggc cct gac act ttg 1584Ser
Gln Arg Ser Pro Gly Asp Leu Val Asp Leu Gly Pro Asp Thr Leu 515 520
525 agc ctg act ctg aaa tct ctg gta ccc ggc tcc tgc tac acc gtg tca
1632Ser Leu Thr Leu Lys Ser Leu Val Pro Gly Ser Cys Tyr Thr Val Ser
530 535 540 gca tgg gcc tgg gcc ggg aac ctc gac tct gac tct cag aag
att cac 1680Ala Trp Ala Trp Ala Gly Asn Leu Asp Ser Asp Ser Gln Lys
Ile His 545 550 555 560 agc tgc acc cgc ccc gct cct ccc acc aac ctg
agt ctg ggc ttt gcc 1728Ser Cys Thr Arg Pro Ala Pro Pro Thr Asn Leu
Ser Leu Gly Phe Ala 565 570 575 cac cag cct gcg gca ctg aag gct tcc
tgg tat cac cca ccg ggt ggc 1776His Gln Pro Ala Ala Leu Lys Ala Ser
Trp Tyr His Pro Pro Gly Gly 580 585 590 agg gat gcc ttt cac tta cgg
ctt tac agg ctg agg cct ctg aca ctg 1824Arg Asp Ala Phe His Leu Arg
Leu Tyr Arg Leu Arg Pro Leu Thr Leu 595 600 605 gaa agt gag aag gtc
cta cct cgg gag gcc cag aac ttc tcc tgg gcc 1872Glu Ser Glu Lys Val
Leu Pro Arg Glu Ala Gln Asn Phe Ser Trp Ala 610 615 620 cag ctg act
gca ggc tgt gag ttc cag gta cag ctg tct acc ttg tgg 1920Gln Leu Thr
Ala Gly Cys Glu Phe Gln Val Gln Leu Ser Thr Leu Trp 625 630 635 640
ggg tct gag aga agc agc agt gcc aac gcc aca ggc tgg aca ccc cct
1968Gly Ser Glu Arg Ser Ser Ser Ala Asn Ala Thr Gly Trp Thr Pro Pro
645 650 655 tca gct cct aca ctg gta aac gtg acc agc gat gct cct acc
cag ctc 2016Ser Ala Pro Thr Leu Val Asn Val Thr Ser Asp Ala Pro Thr
Gln Leu 660 665 670 caa gta tcc tgg gcc cac gtt cct ggg ggc cgg agc
cgc tac caa gtg 2064Gln Val Ser Trp Ala His Val Pro Gly Gly Arg Ser
Arg Tyr Gln Val 675 680 685 acc cta tac cag gag agt acc cgg aca gcc
acc agc atc atg ggg ccc 2112Thr Leu Tyr Gln Glu Ser Thr Arg Thr Ala
Thr Ser Ile Met Gly Pro 690 695 700 aag gaa gat ggc acg agc ttt ttg
ggt ttg act cct ggc act aag tac 2160Lys Glu Asp Gly Thr Ser Phe Leu
Gly Leu Thr Pro Gly Thr Lys Tyr 705 710 715 720 aag gtg gaa gtc atc
tcc tgg gct ggg ccc ctc tac act gca gca gcc 2208Lys Val Glu Val Ile
Ser Trp Ala Gly Pro Leu Tyr Thr Ala Ala Ala 725 730 735 aac gtt tct
gcc tgg acc tac cca ctc ata ccc aat gag ctg ctc gtg 2256Asn Val Ser
Ala Trp Thr Tyr Pro Leu Ile Pro Asn Glu Leu Leu Val 740 745 750 tca
atg cag gca ggc agt gct gtg gtt aac ctg gcc tgg ccc agt ggt 2304Ser
Met Gln Ala Gly Ser Ala Val Val Asn Leu Ala Trp Pro Ser Gly 755 760
765 ccc ctg ggg caa ggg gca tgc cac gcc caa ctc tca gat gct gga cac
2352Pro Leu Gly Gln Gly Ala Cys His Ala Gln Leu Ser Asp Ala Gly His
770 775 780 ctc tca tgg gag caa ccc ctg aaa cta ggc caa gag ctc ttc
atg cta 2400Leu Ser Trp Glu Gln Pro Leu Lys Leu Gly Gln Glu Leu Phe
Met Leu 785 790 795 800 agg gat ctc aca cca gga cat acc atc tcg atg
tca gtg agg tgt cgg 2448Arg Asp Leu Thr Pro Gly His Thr Ile Ser Met
Ser Val Arg Cys Arg 805 810 815 gca ggg ccg ctc cag gcc tct acg cac
ctt gtg gtg ctg tct gtg gag 2496Ala Gly Pro Leu Gln Ala Ser Thr His
Leu Val Val Leu Ser Val Glu 820 825 830
cct ggc cct gtg gaa gat gtg ctc tgt cat cca gag gcc acc tac ctg
2544Pro Gly Pro Val Glu Asp Val Leu Cys His Pro Glu Ala Thr Tyr Leu
835 840 845 gcc ctg aac tgg acg atg cct gct gga gac gtg gat gtc tgt
ctg gtg 2592Ala Leu Asn Trp Thr Met Pro Ala Gly Asp Val Asp Val Cys
Leu Val 850 855 860 gtg gta gag cgg ctg gtg ccg gga ggg ggc act cat
ttt gtc ttc cag 2640Val Val Glu Arg Leu Val Pro Gly Gly Gly Thr His
Phe Val Phe Gln 865 870 875 880 gtc aac acc tca ggg gat gct ctt ctg
ttg ccc aac ttg atg ccc acc 2688Val Asn Thr Ser Gly Asp Ala Leu Leu
Leu Pro Asn Leu Met Pro Thr 885 890 895 act tct tac cgc ctt agc ctc
acc gtt ctg ggc agg aat agt cgg tgg 2736Thr Ser Tyr Arg Leu Ser Leu
Thr Val Leu Gly Arg Asn Ser Arg Trp 900 905 910 agc cgg gcg gtt tcc
ctg gtg tgc agt act tct gct gag gct tgg cac 2784Ser Arg Ala Val Ser
Leu Val Cys Ser Thr Ser Ala Glu Ala Trp His 915 920 925 ccc cca gag
cta gct gag ccc ccc cag gtg gag ctg ggg aca ggg atg 2832Pro Pro Glu
Leu Ala Glu Pro Pro Gln Val Glu Leu Gly Thr Gly Met 930 935 940 ggt
gtg aca gtc atg cgt ggc atg ttt ggt aaa gat gac ggg cag atc 2880Gly
Val Thr Val Met Arg Gly Met Phe Gly Lys Asp Asp Gly Gln Ile 945 950
955 960 cag tgg tat ggc ata att gcc acc atc aac atg acg ctg gcc cag
cct 2928Gln Trp Tyr Gly Ile Ile Ala Thr Ile Asn Met Thr Leu Ala Gln
Pro 965 970 975 tcc cgg gaa gcc atc aat tac aca tgg tat gac cac tac
tat aga gga 2976Ser Arg Glu Ala Ile Asn Tyr Thr Trp Tyr Asp His Tyr
Tyr Arg Gly 980 985 990 tgt gag tcc ttc ctg gct ctc ctg ttc cca aac
ccc ttc tac cca gag 3024Cys Glu Ser Phe Leu Ala Leu Leu Phe Pro Asn
Pro Phe Tyr Pro Glu 995 1000 1005 cct tgg gct ggg cca aga tcc tgg
aca gta cct gtg ggt act gag 3069Pro Trp Ala Gly Pro Arg Ser Trp Thr
Val Pro Val Gly Thr Glu 1010 1015 1020 gac tgt gac aac acc caa gag
ata tgc aat ggg cgt ctc aag tca 3114Asp Cys Asp Asn Thr Gln Glu Ile
Cys Asn Gly Arg Leu Lys Ser 1025 1030 1035 ggc ttc cag tat agg ttc
agc gtt gtg gcc ttt agt agg ctc aac 3159Gly Phe Gln Tyr Arg Phe Ser
Val Val Ala Phe Ser Arg Leu Asn 1040 1045 1050 act cca gag acc atc
ctc gcc ttc tcg gcc ttc tca gag ccc cgg 3204Thr Pro Glu Thr Ile Leu
Ala Phe Ser Ala Phe Ser Glu Pro Arg 1055 1060 1065 gcc agc atc tct
ctg gcg atc att ccc ctg aca gtt atg ctg ggg 3249Ala Ser Ile Ser Leu
Ala Ile Ile Pro Leu Thr Val Met Leu Gly 1070 1075 1080 gct gtg gtg
ggc agc att gtc att gtg tgt gca gtg cta tgc ttg 3294Ala Val Val Gly
Ser Ile Val Ile Val Cys Ala Val Leu Cys Leu 1085 1090 1095 ctc cgc
tgg cgg tgc ctg aag gga cca aga tca gag aag gat ggc 3339Leu Arg Trp
Arg Cys Leu Lys Gly Pro Arg Ser Glu Lys Asp Gly 1100 1105 1110 ttt
tcc aag gag ctg atg cct tac aac ctg tgg cgg acc cat cgg 3384Phe Ser
Lys Glu Leu Met Pro Tyr Asn Leu Trp Arg Thr His Arg 1115 1120 1125
cct atc ccc atc cat agc ttc cgg cag agc tat gag gcc aag agc 3429Pro
Ile Pro Ile His Ser Phe Arg Gln Ser Tyr Glu Ala Lys Ser 1130 1135
1140 gca cat gca cac cag acc ttc ttc cag gaa ttt gag gag ttg aag
3474Ala His Ala His Gln Thr Phe Phe Gln Glu Phe Glu Glu Leu Lys
1145 1150 1155 gag gta ggc aag gac cag ccc cga cta gag gct gag cat
ccg gac 3519Glu Val Gly Lys Asp Gln Pro Arg Leu Glu Ala Glu His Pro
Asp 1160 1165 1170 aac atc atc aag aac cgg tac cca cac gtg ctg ccc
tat gac cac 3564Asn Ile Ile Lys Asn Arg Tyr Pro His Val Leu Pro Tyr
Asp His 1175 1180 1185 tcc agg gtc agg ctg acc cag cta cca gga gag
cct cat tct gac 3609Ser Arg Val Arg Leu Thr Gln Leu Pro Gly Glu Pro
His Ser Asp 1190 1195 1200 tac atc aat gcc aac ttc atc cca ggc tat
agc cac aca cag gag 3654Tyr Ile Asn Ala Asn Phe Ile Pro Gly Tyr Ser
His Thr Gln Glu 1205 1210 1215 atc att gcc acc cag ggg cct ctc aaa
aag acg cta gag gac ttc 3699Ile Ile Ala Thr Gln Gly Pro Leu Lys Lys
Thr Leu Glu Asp Phe 1220 1225 1230 tgg cgg ttg gta tgg gag cag caa
gtc cac gtg atc atc atg ctg 3744Trp Arg Leu Val Trp Glu Gln Gln Val
His Val Ile Ile Met Leu 1235 1240 1245 act gtg ggc atg gag aac ggg
cgg gta ctg tgt gag cac tac tgg 3789Thr Val Gly Met Glu Asn Gly Arg
Val Leu Cys Glu His Tyr Trp 1250 1255 1260 cca gcc aac tcc acg cct
gtt act cac ggt cac atc acc atc cac 3834Pro Ala Asn Ser Thr Pro Val
Thr His Gly His Ile Thr Ile His 1265 1270 1275 ctc ctg gca gag gag
cct gag gat gag tgg acc agg agg gaa ttc 3879Leu Leu Ala Glu Glu Pro
Glu Asp Glu Trp Thr Arg Arg Glu Phe 1280 1285 1290 cag ctg cag cac
ggt acc gag caa aaa cag agg cga gtg aag cag 3924Gln Leu Gln His Gly
Thr Glu Gln Lys Gln Arg Arg Val Lys Gln 1295 1300 1305 ctg cag ttc
act acc tgg cca gac cac agt gtc ccg gag gct ccc 3969Leu Gln Phe Thr
Thr Trp Pro Asp His Ser Val Pro Glu Ala Pro 1310 1315 1320 agc tct
ctg ctc gct ttt gta gaa ctg gta cag gag cag gtg cag 4014Ser Ser Leu
Leu Ala Phe Val Glu Leu Val Gln Glu Gln Val Gln 1325 1330 1335 gcc
act cag ggc aag gga ccc atc ctg gtg cat tgc agt gct ggc 4059Ala Thr
Gln Gly Lys Gly Pro Ile Leu Val His Cys Ser Ala Gly 1340 1345 1350
gtg ggg agg aca ggc acc ttt gtg gct ctc ttg cgg cta ctg cga 4104Val
Gly Arg Thr Gly Thr Phe Val Ala Leu Leu Arg Leu Leu Arg 1355 1360
1365 caa cta gag gaa gag aag gtg gcc gat gtg ttc aac act gtg tac
4149Gln Leu Glu Glu Glu Lys Val Ala Asp Val Phe Asn Thr Val Tyr
1370 1375 1380 ata ctc cgg ttg cac cgg ccc ctc atg atc cag acc ctg
agt caa 4194Ile Leu Arg Leu His Arg Pro Leu Met Ile Gln Thr Leu Ser
Gln 1385 1390 1395 tac atc ttc ctg cac agt tgc ctg ctg aac aag att
ctg gaa ggg 4239Tyr Ile Phe Leu His Ser Cys Leu Leu Asn Lys Ile Leu
Glu Gly 1400 1405 1410 ccc cct gac agc tcc gac tcc ggc ccc atc tct
gtg atg gat ttt 4284Pro Pro Asp Ser Ser Asp Ser Gly Pro Ile Ser Val
Met Asp Phe 1415 1420 1425 gca cag gct tgt gcc aag agg gca gcc aac
gcc aat gct ggt ttc 4329Ala Gln Ala Cys Ala Lys Arg Ala Ala Asn Ala
Asn Ala Gly Phe 1430 1435 1440 ttg aag gag tac aag ctc ctg aag cag
gcc atc aag gat ggg act 4374Leu Lys Glu Tyr Lys Leu Leu Lys Gln Ala
Ile Lys Asp Gly Thr 1445 1450 1455 ggc tct ctg ctg ccc cct cct gac
tac aat cag aac agc att gtc 4419Gly Ser Leu Leu Pro Pro Pro Asp Tyr
Asn Gln Asn Ser Ile Val 1460 1465 1470 tcc cgt cgt cat tct cag gag
cag ttc gcc ctg gtg gag gag tgc 4464Ser Arg Arg His Ser Gln Glu Gln
Phe Ala Leu Val Glu Glu Cys 1475 1480 1485 cct gag gat agc atg ctg
gaa gcc tca ctc ttc cct ggt ggt ccg 4509Pro Glu Asp Ser Met Leu Glu
Ala Ser Leu Phe Pro Gly Gly Pro 1490 1495 1500 tct ggt tgt gat cat
gtg gtg ctg act ggc tca gcc gga cca aag 4554Ser Gly Cys Asp His Val
Val Leu Thr Gly Ser Ala Gly Pro Lys 1505 1510 1515 gaa ctc tgg gaa
atg gtg tgg gag cat gat gcc cat gtg ctc gtc 4599Glu Leu Trp Glu Met
Val Trp Glu His Asp Ala His Val Leu Val 1520 1525 1530 tcc ctg ggc
ctg cct gat acc aag gag aag cca cca gac atc tgg 4644Ser Leu Gly Leu
Pro Asp Thr Lys Glu Lys Pro Pro Asp Ile Trp 1535 1540 1545 cca gtg
gag atg cag cct att gtc aca gac atg gtg aca gtg cac 4689Pro Val Glu
Met Gln Pro Ile Val Thr Asp Met Val Thr Val His 1550 1555 1560 aga
gtg tct gag agc aac aca aca act ggc tgg ccc agc acc ctc 4734Arg Val
Ser Glu Ser Asn Thr Thr Thr Gly Trp Pro Ser Thr Leu 1565 1570 1575
ttc aga gtc ata cac ggg gag agt gga aag gaa agg cag gtt caa 4779Phe
Arg Val Ile His Gly Glu Ser Gly Lys Glu Arg Gln Val Gln 1580 1585
1590 tgc ctg caa ttt cca tgc tct gag tct ggg tgt gag ctc cca gct
4824Cys Leu Gln Phe Pro Cys Ser Glu Ser Gly Cys Glu Leu Pro Ala
1595 1600 1605 aac acc cta ctg acc ttc ctt gat gct gtg ggc cag tgc
tgc ttc 4869Asn Thr Leu Leu Thr Phe Leu Asp Ala Val Gly Gln Cys Cys
Phe 1610 1615 1620 cgg ggc aag agc aag aag cca ggg acc ctg ctc agc
cac tcc agc 4914Arg Gly Lys Ser Lys Lys Pro Gly Thr Leu Leu Ser His
Ser Ser 1625 1630 1635 aaa aac aca aac cag ctg ggc acc ttc ttg gct
atg gaa cag ctg 4959Lys Asn Thr Asn Gln Leu Gly Thr Phe Leu Ala Met
Glu Gln Leu 1640 1645 1650 tta cag caa gca ggg aca gag cgc aca gtg
gac gtc ttc aat gtg 5004Leu Gln Gln Ala Gly Thr Glu Arg Thr Val Asp
Val Phe Asn Val 1655 1660 1665 gcc ctg aag cag tca cag gcc tgc ggc
ctt atg acc cca aca ctg 5049Ala Leu Lys Gln Ser Gln Ala Cys Gly Leu
Met Thr Pro Thr Leu 1670 1675 1680 gag cag tat atc tac ctc tac aac
tgt ctg aac agc gca ctg ctg 5094Glu Gln Tyr Ile Tyr Leu Tyr Asn Cys
Leu Asn Ser Ala Leu Leu 1685 1690 1695 aac ggg ctg ccc aga gct ggg
aag tgg cct gcg ccc tgc tag 5136Asn Gly Leu Pro Arg Ala Gly Lys Trp
Pro Ala Pro Cys 1700 1705 1710 151711PRTRattus norvegicus 15Met Arg
Pro Leu Ile Leu Leu Ala Ala Leu Leu Trp Leu Gln Gly Phe 1 5 10 15
Leu Ala Glu Asp Asp Ala Cys Ser Ser Leu Glu Gly Ser Pro Asp Arg 20
25 30 Gln Gly Gly Gly Pro Leu Leu Ser Val Asn Val Ser Ser His Gly
Lys 35 40 45 Ser Thr Ser Leu Phe Leu Ser Trp Val Ala Ala Glu Leu
Gly Gly Phe 50 55 60 Asp Tyr Ala Leu Ser Leu Arg Ser Val Asn Ser
Ser Gly Ser Pro Glu 65 70 75 80 Gly Gln Gln Leu Gln Ala His Thr Asn
Glu Ser Gly Phe Glu Phe His 85 90 95 Gly Leu Val Pro Gly Ser Arg
Tyr Gln Leu Lys Leu Thr Val Leu Arg 100 105 110 Pro Cys Trp Gln Asn
Val Thr Ile Thr Leu Thr Ala Arg Thr Ala Pro 115 120 125 Thr Val Val
Arg Gly Leu Gln Leu His Ser Ala Gly Ser Pro Ala Arg 130 135 140 Leu
Glu Ala Ser Trp Ser Asp Ala Pro Gly Asp Gln Asp Ser Tyr Gln 145 150
155 160 Leu Leu Leu Tyr His Leu Glu Ser Gln Thr Leu Ala Cys Asn Val
Ser 165 170 175 Val Ser Pro Asp Thr Leu Ser Tyr Ser Phe Gly Asp Leu
Leu Pro Gly 180 185 190 Thr Gln Tyr Val Leu Glu Val Ile Thr Trp Ala
Gly Ser Leu His Ala 195 200 205 Lys Thr Ser Ile Leu Gln Trp Thr Glu
Pro Val Pro Pro Asp His Leu 210 215 220 Ala Leu Arg Ala Leu Gly Thr
Ser Ser Leu Gln Ala Phe Trp Asn Ser 225 230 235 240 Ser Glu Gly Ala
Thr Ser Phe His Leu Met Leu Thr Asp Leu Leu Gly 245 250 255 Gly Thr
Asn Thr Thr Ala Val Ile Arg Gln Gly Val Ser Thr His Thr 260 265 270
Phe Leu His Leu Ser Pro Gly Thr Pro His Glu Leu Lys Ile Cys Ala 275
280 285 Ser Ala Gly Pro His Gln Ile Trp Gly Pro Ser Ala Thr Glu Trp
Thr 290 295 300 Tyr Pro Ser Tyr Pro Ser Asp Leu Val Leu Thr Pro Leu
Arg Asn Glu 305 310 315 320 Leu Trp Ala Ser Trp Lys Ala Gly Leu Gly
Ala Arg Asp Gly Tyr Val 325 330 335 Leu Lys Leu Ser Gly Pro Met Glu
Ser Thr Ser Thr Leu Gly Pro Glu 340 345 350 Glu Cys Asn Ala Val Phe
Pro Gly Pro Leu Pro Pro Gly His Tyr Thr 355 360 365 Leu Gln Leu Lys
Val Leu Ala Gly Pro Tyr Asp Ala Trp Val Glu Gly 370 375 380 Ser Thr
Trp Leu Ala Glu Ser Ala Ala Leu Pro Arg Glu Val Pro Gly 385 390 395
400 Ala Arg Leu Trp Leu Asp Gly Leu Glu Ala Ser Lys Gln Pro Gly Arg
405 410 415 Arg Ala Leu Leu Tyr Ser Asp Asp Ala Pro Gly Ser Leu Gly
Asn Ile 420 425 430 Ser Val Pro Ser Gly Ala Thr His Val Ile Phe Cys
Gly Leu Val Pro 435 440 445 Gly Ala His Tyr Arg Val Asp Ile Ala Ser
Ser Thr Gly Asp Ile Ser 450 455 460 Gln Ser Ile Ser Gly Tyr Thr Ser
Pro Leu Pro Pro Gln Ser Leu Glu 465 470 475 480 Val Ile Ser Arg Ser
Ser Pro Ser Asp Leu Thr Ile Ala Trp Gly Pro 485 490 495 Ala Pro Gly
Gln Leu Glu Gly Tyr Lys Val Thr Trp His Gln Asp Gly 500 505 510 Ser
Gln Arg Ser Pro Gly Asp Leu Val Asp Leu Gly Pro Asp Thr Leu 515 520
525 Ser Leu Thr Leu Lys Ser Leu Val Pro Gly Ser Cys Tyr Thr Val Ser
530 535 540 Ala Trp Ala Trp Ala Gly Asn Leu Asp Ser Asp Ser Gln Lys
Ile His 545 550 555 560 Ser Cys Thr Arg Pro Ala Pro Pro Thr Asn Leu
Ser Leu Gly Phe Ala 565 570 575 His Gln Pro Ala Ala Leu Lys Ala Ser
Trp Tyr His Pro Pro Gly Gly 580 585 590 Arg Asp Ala Phe His Leu Arg
Leu Tyr Arg Leu Arg Pro Leu Thr Leu 595 600 605 Glu Ser Glu Lys Val
Leu Pro Arg Glu Ala Gln Asn Phe Ser Trp Ala 610 615 620 Gln Leu Thr
Ala Gly Cys Glu Phe Gln Val Gln Leu Ser Thr Leu Trp 625 630 635 640
Gly Ser Glu Arg Ser Ser Ser Ala Asn Ala Thr Gly Trp Thr Pro Pro 645
650 655 Ser Ala Pro Thr Leu Val Asn Val Thr Ser Asp Ala Pro Thr Gln
Leu 660 665 670 Gln Val Ser Trp Ala His Val Pro Gly Gly Arg Ser Arg
Tyr Gln Val 675 680 685 Thr Leu Tyr Gln Glu Ser Thr Arg Thr Ala Thr
Ser Ile Met Gly Pro 690 695 700
Lys Glu Asp Gly Thr Ser Phe Leu Gly Leu Thr Pro Gly Thr Lys Tyr 705
710 715 720 Lys Val Glu Val Ile Ser Trp Ala Gly Pro Leu Tyr Thr Ala
Ala Ala 725 730 735 Asn Val Ser Ala Trp Thr Tyr Pro Leu Ile Pro Asn
Glu Leu Leu Val 740 745 750 Ser Met Gln Ala Gly Ser Ala Val Val Asn
Leu Ala Trp Pro Ser Gly 755 760 765 Pro Leu Gly Gln Gly Ala Cys His
Ala Gln Leu Ser Asp Ala Gly His 770 775 780 Leu Ser Trp Glu Gln Pro
Leu Lys Leu Gly Gln Glu Leu Phe Met Leu 785 790 795 800 Arg Asp Leu
Thr Pro Gly His Thr Ile Ser Met Ser Val Arg Cys Arg 805 810 815 Ala
Gly Pro Leu Gln Ala Ser Thr His Leu Val Val Leu Ser Val Glu 820 825
830 Pro Gly Pro Val Glu Asp Val Leu Cys His Pro Glu Ala Thr Tyr Leu
835 840 845 Ala Leu Asn Trp Thr Met Pro Ala Gly Asp Val Asp Val Cys
Leu Val 850 855 860 Val Val Glu Arg Leu Val Pro Gly Gly Gly Thr His
Phe Val Phe Gln 865 870 875 880 Val Asn Thr Ser Gly Asp Ala Leu Leu
Leu Pro Asn Leu Met Pro Thr 885 890 895 Thr Ser Tyr Arg Leu Ser Leu
Thr Val Leu Gly Arg Asn Ser Arg Trp 900 905 910 Ser Arg Ala Val Ser
Leu Val Cys Ser Thr Ser Ala Glu Ala Trp His 915 920 925 Pro Pro Glu
Leu Ala Glu Pro Pro Gln Val Glu Leu Gly Thr Gly Met 930 935 940 Gly
Val Thr Val Met Arg Gly Met Phe Gly Lys Asp Asp Gly Gln Ile 945 950
955 960 Gln Trp Tyr Gly Ile Ile Ala Thr Ile Asn Met Thr Leu Ala Gln
Pro 965 970 975 Ser Arg Glu Ala Ile Asn Tyr Thr Trp Tyr Asp His Tyr
Tyr Arg Gly 980 985 990 Cys Glu Ser Phe Leu Ala Leu Leu Phe Pro Asn
Pro Phe Tyr Pro Glu 995 1000 1005 Pro Trp Ala Gly Pro Arg Ser Trp
Thr Val Pro Val Gly Thr Glu 1010 1015 1020 Asp Cys Asp Asn Thr Gln
Glu Ile Cys Asn Gly Arg Leu Lys Ser 1025 1030 1035 Gly Phe Gln Tyr
Arg Phe Ser Val Val Ala Phe Ser Arg Leu Asn 1040 1045 1050 Thr Pro
Glu Thr Ile Leu Ala Phe Ser Ala Phe Ser Glu Pro Arg 1055 1060 1065
Ala Ser Ile Ser Leu Ala Ile Ile Pro Leu Thr Val Met Leu Gly 1070
1075 1080 Ala Val Val Gly Ser Ile Val Ile Val Cys Ala Val Leu Cys
Leu 1085 1090 1095 Leu Arg Trp Arg Cys Leu Lys Gly Pro Arg Ser Glu
Lys Asp Gly 1100 1105 1110 Phe Ser Lys Glu Leu Met Pro Tyr Asn Leu
Trp Arg Thr His Arg 1115 1120 1125 Pro Ile Pro Ile His Ser Phe Arg
Gln Ser Tyr Glu Ala Lys Ser 1130 1135 1140 Ala His Ala His Gln Thr
Phe Phe Gln Glu Phe Glu Glu Leu Lys 1145 1150 1155 Glu Val Gly Lys
Asp Gln Pro Arg Leu Glu Ala Glu His Pro Asp 1160 1165 1170 Asn Ile
Ile Lys Asn Arg Tyr Pro His Val Leu Pro Tyr Asp His 1175 1180 1185
Ser Arg Val Arg Leu Thr Gln Leu Pro Gly Glu Pro His Ser Asp 1190
1195 1200 Tyr Ile Asn Ala Asn Phe Ile Pro Gly Tyr Ser His Thr Gln
Glu 1205 1210 1215 Ile Ile Ala Thr Gln Gly Pro Leu Lys Lys Thr Leu
Glu Asp Phe 1220 1225 1230 Trp Arg Leu Val Trp Glu Gln Gln Val His
Val Ile Ile Met Leu 1235 1240 1245 Thr Val Gly Met Glu Asn Gly Arg
Val Leu Cys Glu His Tyr Trp 1250 1255 1260 Pro Ala Asn Ser Thr Pro
Val Thr His Gly His Ile Thr Ile His 1265 1270 1275 Leu Leu Ala Glu
Glu Pro Glu Asp Glu Trp Thr Arg Arg Glu Phe 1280 1285 1290 Gln Leu
Gln His Gly Thr Glu Gln Lys Gln Arg Arg Val Lys Gln 1295 1300 1305
Leu Gln Phe Thr Thr Trp Pro Asp His Ser Val Pro Glu Ala Pro 1310
1315 1320 Ser Ser Leu Leu Ala Phe Val Glu Leu Val Gln Glu Gln Val
Gln 1325 1330 1335 Ala Thr Gln Gly Lys Gly Pro Ile Leu Val His Cys
Ser Ala Gly 1340 1345 1350 Val Gly Arg Thr Gly Thr Phe Val Ala Leu
Leu Arg Leu Leu Arg 1355 1360 1365 Gln Leu Glu Glu Glu Lys Val Ala
Asp Val Phe Asn Thr Val Tyr 1370 1375 1380 Ile Leu Arg Leu His Arg
Pro Leu Met Ile Gln Thr Leu Ser Gln 1385 1390 1395 Tyr Ile Phe Leu
His Ser Cys Leu Leu Asn Lys Ile Leu Glu Gly 1400 1405 1410 Pro Pro
Asp Ser Ser Asp Ser Gly Pro Ile Ser Val Met Asp Phe 1415 1420 1425
Ala Gln Ala Cys Ala Lys Arg Ala Ala Asn Ala Asn Ala Gly Phe 1430
1435 1440 Leu Lys Glu Tyr Lys Leu Leu Lys Gln Ala Ile Lys Asp Gly
Thr 1445 1450 1455 Gly Ser Leu Leu Pro Pro Pro Asp Tyr Asn Gln Asn
Ser Ile Val 1460 1465 1470 Ser Arg Arg His Ser Gln Glu Gln Phe Ala
Leu Val Glu Glu Cys 1475 1480 1485 Pro Glu Asp Ser Met Leu Glu Ala
Ser Leu Phe Pro Gly Gly Pro 1490 1495 1500 Ser Gly Cys Asp His Val
Val Leu Thr Gly Ser Ala Gly Pro Lys 1505 1510 1515 Glu Leu Trp Glu
Met Val Trp Glu His Asp Ala His Val Leu Val 1520 1525 1530 Ser Leu
Gly Leu Pro Asp Thr Lys Glu Lys Pro Pro Asp Ile Trp 1535 1540 1545
Pro Val Glu Met Gln Pro Ile Val Thr Asp Met Val Thr Val His 1550
1555 1560 Arg Val Ser Glu Ser Asn Thr Thr Thr Gly Trp Pro Ser Thr
Leu 1565 1570 1575 Phe Arg Val Ile His Gly Glu Ser Gly Lys Glu Arg
Gln Val Gln 1580 1585 1590 Cys Leu Gln Phe Pro Cys Ser Glu Ser Gly
Cys Glu Leu Pro Ala 1595 1600 1605 Asn Thr Leu Leu Thr Phe Leu Asp
Ala Val Gly Gln Cys Cys Phe 1610 1615 1620 Arg Gly Lys Ser Lys Lys
Pro Gly Thr Leu Leu Ser His Ser Ser 1625 1630 1635 Lys Asn Thr Asn
Gln Leu Gly Thr Phe Leu Ala Met Glu Gln Leu 1640 1645 1650 Leu Gln
Gln Ala Gly Thr Glu Arg Thr Val Asp Val Phe Asn Val 1655 1660 1665
Ala Leu Lys Gln Ser Gln Ala Cys Gly Leu Met Thr Pro Thr Leu 1670
1675 1680 Glu Gln Tyr Ile Tyr Leu Tyr Asn Cys Leu Asn Ser Ala Leu
Leu 1685 1690 1695 Asn Gly Leu Pro Arg Ala Gly Lys Trp Pro Ala Pro
Cys 1700 1705 1710 163247DNAHomo sapiensCDS(91)..(1395)
16gggcgggcct cggggctaag agcgcgacgc ctagagcggc agacggcgca gtgggccgag
60aaggaggcgc agcagccgcc ctggcccgtc atg gag atg gaa aag gag ttc gag
114 Met Glu Met Glu Lys Glu Phe Glu 1 5 cag atc gac aag tcc ggg agc
tgg gcg gcc att tac cag gat atc cga 162Gln Ile Asp Lys Ser Gly Ser
Trp Ala Ala Ile Tyr Gln Asp Ile Arg 10 15 20 cat gaa gcc agt gac
ttc cca tgt aga gtg gcc aag ctt cct aag aac 210His Glu Ala Ser Asp
Phe Pro Cys Arg Val Ala Lys Leu Pro Lys Asn 25 30 35 40 aaa aac cga
aat agg tac aga gac gtc agt ccc ttt gac cat agt cgg 258Lys Asn Arg
Asn Arg Tyr Arg Asp Val Ser Pro Phe Asp His Ser Arg 45 50 55 att
aaa cta cat caa gaa gat aat gac tat atc aac gct agt ttg ata 306Ile
Lys Leu His Gln Glu Asp Asn Asp Tyr Ile Asn Ala Ser Leu Ile 60 65
70 aaa atg gaa gaa gcc caa agg agt tac att ctt acc cag ggc cct ttg
354Lys Met Glu Glu Ala Gln Arg Ser Tyr Ile Leu Thr Gln Gly Pro Leu
75 80 85 cct aac aca tgc ggt cac ttt tgg gag atg gtg tgg gag cag
aaa agc 402Pro Asn Thr Cys Gly His Phe Trp Glu Met Val Trp Glu Gln
Lys Ser 90 95 100 agg ggt gtc gtc atg ctc aac aga gtg atg gag aaa
ggt tcg tta aaa 450Arg Gly Val Val Met Leu Asn Arg Val Met Glu Lys
Gly Ser Leu Lys 105 110 115 120 tgc gca caa tac tgg cca caa aaa gaa
gaa aaa gag atg atc ttt gaa 498Cys Ala Gln Tyr Trp Pro Gln Lys Glu
Glu Lys Glu Met Ile Phe Glu 125 130 135 gac aca aat ttg aaa tta aca
ttg atc tct gaa gat atc aag tca tat 546Asp Thr Asn Leu Lys Leu Thr
Leu Ile Ser Glu Asp Ile Lys Ser Tyr 140 145 150 tat aca gtg cga cag
cta gaa ttg gaa aac ctt aca acc caa gaa act 594Tyr Thr Val Arg Gln
Leu Glu Leu Glu Asn Leu Thr Thr Gln Glu Thr 155 160 165 cga gag atc
tta cat ttc cac tat acc aca tgg cct gac ttt gga gtc 642Arg Glu Ile
Leu His Phe His Tyr Thr Thr Trp Pro Asp Phe Gly Val 170 175 180 cct
gaa tca cca gcc tca ttc ttg aac ttt ctt ttc aaa gtc cga gag 690Pro
Glu Ser Pro Ala Ser Phe Leu Asn Phe Leu Phe Lys Val Arg Glu 185 190
195 200 tca ggg tca ctc agc ccg gag cac ggg ccc gtt gtg gtg cac tgc
agt 738Ser Gly Ser Leu Ser Pro Glu His Gly Pro Val Val Val His Cys
Ser 205 210 215 gca ggc atc ggc agg tct gga acc ttc tgt ctg gct gat
acc tgc ctc 786Ala Gly Ile Gly Arg Ser Gly Thr Phe Cys Leu Ala Asp
Thr Cys Leu 220 225 230 ctg ctg atg gac aag agg aaa gac cct tct tcc
gtt gat atc aag aaa 834Leu Leu Met Asp Lys Arg Lys Asp Pro Ser Ser
Val Asp Ile Lys Lys 235 240 245 gtg ctg tta gaa atg agg aag ttt cgg
atg ggg ttg atc cag aca gcc 882Val Leu Leu Glu Met Arg Lys Phe Arg
Met Gly Leu Ile Gln Thr Ala 250 255 260 gac cag ctg cgc ttc tcc tac
ctg gct gtg atc gaa ggt gcc aaa ttc 930Asp Gln Leu Arg Phe Ser Tyr
Leu Ala Val Ile Glu Gly Ala Lys Phe 265 270 275 280 atc atg ggg gac
tct tcc gtg cag gat cag tgg aag gag ctt tcc cac 978Ile Met Gly Asp
Ser Ser Val Gln Asp Gln Trp Lys Glu Leu Ser His 285 290 295 gag gac
ctg gag ccc cca ccc gag cat atc ccc cca cct ccc cgg cca 1026Glu Asp
Leu Glu Pro Pro Pro Glu His Ile Pro Pro Pro Pro Arg Pro 300 305 310
ccc aaa cga atc ctg gag cca cac aat ggg aaa tgc agg gag ttc ttc
1074Pro Lys Arg Ile Leu Glu Pro His Asn Gly Lys Cys Arg Glu Phe Phe
315 320 325 cca aat cac cag tgg gtg aag gaa gag acc cag gag gat aaa
gac tgc 1122Pro Asn His Gln Trp Val Lys Glu Glu Thr Gln Glu Asp Lys
Asp Cys 330 335 340 ccc atc aag gaa gaa aaa gga agc ccc tta aat gcc
gca ccc tac ggc 1170Pro Ile Lys Glu Glu Lys Gly Ser Pro Leu Asn Ala
Ala Pro Tyr Gly 345 350 355 360 atc gaa agc atg agt caa gac act gaa
gtt aga agt cgg gtc gtg ggg 1218Ile Glu Ser Met Ser Gln Asp Thr Glu
Val Arg Ser Arg Val Val Gly 365 370 375 gga agt ctt cga ggt gcc cag
gct gcc tcc cca gcc aaa ggg gag ccg 1266Gly Ser Leu Arg Gly Ala Gln
Ala Ala Ser Pro Ala Lys Gly Glu Pro 380 385 390 tca ctg ccc gag aag
gac gag gac cat gca ctg agt tac tgg aag ccc 1314Ser Leu Pro Glu Lys
Asp Glu Asp His Ala Leu Ser Tyr Trp Lys Pro 395 400 405 ttc ctg gtc
aac atg tgc gtg gct acg gtc ctc acg gcc ggc gct tac 1362Phe Leu Val
Asn Met Cys Val Ala Thr Val Leu Thr Ala Gly Ala Tyr 410 415 420 ctc
tgc tac agg ttc ctg ttc aac agc aac aca tagcctgacc ctcctccact
1415Leu Cys Tyr Arg Phe Leu Phe Asn Ser Asn Thr 425 430 435
ccacctccac ccactgtccg cctctgcccg cagagcccac gcccgactag caggcatgcc
1475gcggtaggta agggccgccg gaccgcgtag agagccgggc cccggacgga
cgttggttct 1535gcactaaaac ccatcttccc cggatgtgtg tctcacccct
catcctttta ctttttgccc 1595cttccacttt gagtaccaaa tccacaagcc
attttttgag gagagtgaaa gagagtacca 1655tgctggcggc gcagagggaa
ggggcctaca cccgtcttgg ggctcgcccc acccagggct 1715ccctcctgga
gcatcccagg cggcgcacgc caacagcccc ccccttgaat ctgcagggag
1775caactctcca ctccatattt atttaaacaa ttttttcccc aaaggcatcc
atagtgcact 1835agcattttct tgaaccaata atgtattaaa attttttgat
gtcagccttg catcaagggc 1895tttatcaaaa agtacaataa taaatcctca
ggtagtactg ggaatggaag gctttgccat 1955gggcctgctg cgtcagacca
gtactgggaa ggaggacggt tgtaagcagt tgttatttag 2015tgatattgtg
ggtaacgtga gaagatagaa caatgctata atatataatg aacacgtggg
2075tatttaataa gaaacatgat gtgagattac tttgtcccgc ttattctcct
ccctgttatc 2135tgctagatct agttctcaat cactgctccc ccgtgtgtat
tagaatgcat gtaaggtctt 2195cttgtgtcct gatgaaaaat atgtgcttga
aatgagaaac tttgatctct gcttactaat 2255gtgccccatg tccaagtcca
acctgcctgt gcatgacctg atcattacat ggctgtggtt 2315cctaagcctg
ttgctgaagt cattgtcgct cagcaatagg gtgcagtttt ccaggaatag
2375gcatttgcta attcctggca tgacactcta gtgacttcct ggtgaggccc
agcctgtcct 2435ggtacagcag ggtcttgctg taactcagac attccaaggg
tatgggaagc catattcaca 2495cctcacgctc tggacatgat ttagggaagc
agggacaccc cccgcccccc acctttggga 2555tcagcctccg ccattccaag
tcaacactct tcttgagcag accgtgattt ggaagagagg 2615cacctgctgg
aaaccacact tcttgaaaca gcctgggtga cggtccttta ggcagcctgc
2675cgccgtctct gtcccggttc accttgccga gagaggcgcg tctgccccac
cctcaaaccc 2735tgtggggcct gatggtgctc acgactcttc ctgcaaaggg
aactgaagac ctccacatta 2795agtggctttt taacatgaaa aacacggcag
ctgtagctcc cgagctactc tcttgccagc 2855attttcacat tttgcctttc
tcgtggtaga agccagtaca gagaaattct gtggtgggaa 2915cattcgaggt
gtcaccctgc agagctatgg tgaggtgtgg ataaggctta ggtgccaggc
2975tgtaagcatt ctgagctggc ttgttgtttt taagtcctgt atatgtatgt
agtagtttgg 3035gtgtgtatat atagtagcat ttcaaaatgg acgtactggt
ttaacctcct atccttggag 3095agcagctggc tctccacctt gttacacatt
atgttagaga ggtagcgagc tgctctgcta 3155tatgccttaa gccaatattt
actcatcagg tcattatttt ttacaatggc catggaataa 3215accattttta
caaaaataaa aacaaaaaaa gc 324717435PRTHomo sapiens 17Met Glu Met Glu
Lys Glu Phe Glu Gln Ile Asp Lys Ser Gly Ser Trp 1 5 10 15 Ala Ala
Ile Tyr Gln Asp Ile Arg His Glu Ala Ser Asp Phe Pro Cys 20 25 30
Arg Val Ala Lys Leu Pro Lys Asn Lys Asn Arg Asn Arg Tyr Arg Asp 35
40 45 Val Ser Pro Phe Asp His Ser Arg Ile Lys Leu His Gln Glu Asp
Asn 50 55 60 Asp Tyr Ile Asn Ala Ser Leu Ile Lys Met Glu Glu Ala
Gln Arg Ser 65 70 75 80 Tyr Ile Leu Thr Gln Gly Pro Leu Pro Asn Thr
Cys Gly His Phe Trp 85 90 95 Glu Met Val Trp Glu Gln Lys Ser Arg
Gly Val Val Met Leu Asn Arg 100 105 110 Val Met Glu Lys Gly Ser Leu
Lys Cys Ala Gln Tyr Trp Pro Gln Lys 115 120 125 Glu Glu Lys Glu Met
Ile Phe Glu Asp Thr Asn Leu Lys Leu Thr Leu 130 135 140 Ile Ser Glu
Asp Ile Lys Ser Tyr Tyr Thr Val Arg Gln Leu Glu Leu 145 150 155 160
Glu Asn Leu Thr Thr Gln Glu Thr Arg Glu Ile Leu His Phe His Tyr 165
170 175 Thr Thr Trp Pro Asp Phe Gly Val Pro Glu Ser Pro Ala Ser Phe
Leu 180 185
190 Asn Phe Leu Phe Lys Val Arg Glu Ser Gly Ser Leu Ser Pro Glu His
195 200 205 Gly Pro Val Val Val His Cys Ser Ala Gly Ile Gly Arg Ser
Gly Thr 210 215 220 Phe Cys Leu Ala Asp Thr Cys Leu Leu Leu Met Asp
Lys Arg Lys Asp 225 230 235 240 Pro Ser Ser Val Asp Ile Lys Lys Val
Leu Leu Glu Met Arg Lys Phe 245 250 255 Arg Met Gly Leu Ile Gln Thr
Ala Asp Gln Leu Arg Phe Ser Tyr Leu 260 265 270 Ala Val Ile Glu Gly
Ala Lys Phe Ile Met Gly Asp Ser Ser Val Gln 275 280 285 Asp Gln Trp
Lys Glu Leu Ser His Glu Asp Leu Glu Pro Pro Pro Glu 290 295 300 His
Ile Pro Pro Pro Pro Arg Pro Pro Lys Arg Ile Leu Glu Pro His 305 310
315 320 Asn Gly Lys Cys Arg Glu Phe Phe Pro Asn His Gln Trp Val Lys
Glu 325 330 335 Glu Thr Gln Glu Asp Lys Asp Cys Pro Ile Lys Glu Glu
Lys Gly Ser 340 345 350 Pro Leu Asn Ala Ala Pro Tyr Gly Ile Glu Ser
Met Ser Gln Asp Thr 355 360 365 Glu Val Arg Ser Arg Val Val Gly Gly
Ser Leu Arg Gly Ala Gln Ala 370 375 380 Ala Ser Pro Ala Lys Gly Glu
Pro Ser Leu Pro Glu Lys Asp Glu Asp 385 390 395 400 His Ala Leu Ser
Tyr Trp Lys Pro Phe Leu Val Asn Met Cys Val Ala 405 410 415 Thr Val
Leu Thr Ala Gly Ala Tyr Leu Cys Tyr Arg Phe Leu Phe Asn 420 425 430
Ser Asn Thr 435 1821DNAunknownsynthetic primer 18ctcaggtctt
catgattgtg g 211920DNAunknownsynthetic primer 19cgaaagagag
tgtatccacc 202022DNAunknownsynthetic primer 20cctttacgtg gaataacatt
ca 222120DNAunknownsynthetic primer 21atagggaatc acggtgtagc
202221DNAunknownsynthetic primer 22gcagcttcaa ggattacgta a
212320DNAunknownsynthetic primer 23catcttgtga actggtggct
202421DNAunknownsynthetic primer 24tccatagaac agactaccta c
212519DNAunknownsynthetic primer 25gatcacagct gaggaaggc
192620DNAunknownsynthetic primer 26tgatgcacct cagttactgg
202720DNAunknownsynthetic primer 27gctgtgcatc atcacttgag
202820DNAunknownsynthetic primer 28catacgtgca ctgtcttagc
202920DNAunknownsynthetic primer 29actcctccag taactccttc
20302860DNAHomo sapiensCDS(23)..(2803) 30actgagcaaa tgagatagaa ac
atg gca ttc tta att ata cta att acc tgc 52 Met Ala Phe Leu Ile Ile
Leu Ile Thr Cys 1 5 10 ttt gtg att att ctt gct act tca cag cct tgc
cag acc cct gat gac 100Phe Val Ile Ile Leu Ala Thr Ser Gln Pro Cys
Gln Thr Pro Asp Asp 15 20 25 ttt gtg gct gcc act tct ccg gga cat
atc ata att gga ggt ttg ttt 148Phe Val Ala Ala Thr Ser Pro Gly His
Ile Ile Ile Gly Gly Leu Phe 30 35 40 gct att cat gaa aaa atg ttg
tcc tca gaa gac tct ccc aga cga cca 196Ala Ile His Glu Lys Met Leu
Ser Ser Glu Asp Ser Pro Arg Arg Pro 45 50 55 caa atc cag gag tgt
gtt ggc ttt gaa ata tca gtt ttt ctt caa act 244Gln Ile Gln Glu Cys
Val Gly Phe Glu Ile Ser Val Phe Leu Gln Thr 60 65 70 ctt gcc atg
ata cac agc att gag atg atc aac aat tca aca ctc tta 292Leu Ala Met
Ile His Ser Ile Glu Met Ile Asn Asn Ser Thr Leu Leu 75 80 85 90 tct
gga gtc aaa ctg ggg tat gaa atc tat gac act tgt aca gaa gtc 340Ser
Gly Val Lys Leu Gly Tyr Glu Ile Tyr Asp Thr Cys Thr Glu Val 95 100
105 aca gtg gca atg gca gcc act ctg agg ttt ctt tct aaa ttc aac tgc
388Thr Val Ala Met Ala Ala Thr Leu Arg Phe Leu Ser Lys Phe Asn Cys
110 115 120 tcc aga gaa act gtg gag ttt aag tgt gac tat tcc agc tac
atg cca 436Ser Arg Glu Thr Val Glu Phe Lys Cys Asp Tyr Ser Ser Tyr
Met Pro 125 130 135 aga gtt aag gct gtc ata ggt tct ggg tac tca gaa
ata act atg gct 484Arg Val Lys Ala Val Ile Gly Ser Gly Tyr Ser Glu
Ile Thr Met Ala 140 145 150 gtc tcc agg atg ttg aat tta cag ctc atg
cca cag gtg ggt tat gaa 532Val Ser Arg Met Leu Asn Leu Gln Leu Met
Pro Gln Val Gly Tyr Glu 155 160 165 170 tca act gca gaa atc ctg agt
gac aaa att cgc ttt cct tca ttt tta 580Ser Thr Ala Glu Ile Leu Ser
Asp Lys Ile Arg Phe Pro Ser Phe Leu 175 180 185 cgg act gtg ccc agt
gac ttc cat caa att aaa gca atg gct cac ctg 628Arg Thr Val Pro Ser
Asp Phe His Gln Ile Lys Ala Met Ala His Leu 190 195 200 att cag aaa
tct ggt tgg aac tgg att ggc atc ata acc aca gat gat 676Ile Gln Lys
Ser Gly Trp Asn Trp Ile Gly Ile Ile Thr Thr Asp Asp 205 210 215 gac
tat gga cga ttg gct ctt aac act ttt ata att cag gct gaa gca 724Asp
Tyr Gly Arg Leu Ala Leu Asn Thr Phe Ile Ile Gln Ala Glu Ala 220 225
230 aat aac gtg tgc ata gcc ttc aaa gag gtt ctt cca gcc ttt ctt tca
772Asn Asn Val Cys Ile Ala Phe Lys Glu Val Leu Pro Ala Phe Leu Ser
235 240 245 250 gat aat acc att gaa gtc aga atc aat cgg aca ctg aag
aaa atc att 820Asp Asn Thr Ile Glu Val Arg Ile Asn Arg Thr Leu Lys
Lys Ile Ile 255 260 265 tta gaa gcc cag gtt aat gtc att gtg gta ttt
ctg agg caa ttc cat 868Leu Glu Ala Gln Val Asn Val Ile Val Val Phe
Leu Arg Gln Phe His 270 275 280 gtt ttt gat ctc ttc aat aaa gcc att
gaa atg aat ata aat aag atg 916Val Phe Asp Leu Phe Asn Lys Ala Ile
Glu Met Asn Ile Asn Lys Met 285 290 295 tgg att gct agt gat aat tgg
tca act gcc acc aag att acc acc att 964Trp Ile Ala Ser Asp Asn Trp
Ser Thr Ala Thr Lys Ile Thr Thr Ile 300 305 310 cct aat gtt aaa aag
att ggc aaa gtt gta ggg ttt gcc ttt aga aga 1012Pro Asn Val Lys Lys
Ile Gly Lys Val Val Gly Phe Ala Phe Arg Arg 315 320 325 330 ggg aat
ata tcc tct ttc cat tcc ttt ctt caa aat ctg cac ttg ctt 1060Gly Asn
Ile Ser Ser Phe His Ser Phe Leu Gln Asn Leu His Leu Leu 335 340 345
ccc agt gac agt cac aaa ctc tta cat gaa tat gcc atg cat tta tct
1108Pro Ser Asp Ser His Lys Leu Leu His Glu Tyr Ala Met His Leu Ser
350 355 360 gcc tgc gca tat gtc aag gac act gat ttg agt caa tgc ata
ttc aat 1156Ala Cys Ala Tyr Val Lys Asp Thr Asp Leu Ser Gln Cys Ile
Phe Asn 365 370 375 cat tct caa agg act ttg gcc tac aag gct aac aag
gct ata gaa agg 1204His Ser Gln Arg Thr Leu Ala Tyr Lys Ala Asn Lys
Ala Ile Glu Arg 380 385 390 aac ttc gtc atg aga aat gac ttc ctc tgg
gac tat gct gag cca gga 1252Asn Phe Val Met Arg Asn Asp Phe Leu Trp
Asp Tyr Ala Glu Pro Gly 395 400 405 410 ctc att cat agt att cag ctt
gca gtg ttt gcc ctt ggt tat gcc att 1300Leu Ile His Ser Ile Gln Leu
Ala Val Phe Ala Leu Gly Tyr Ala Ile 415 420 425 cgg gat ctg tgt caa
gct cgt gac tgt cag aac ccc aac gcc ttt caa 1348Arg Asp Leu Cys Gln
Ala Arg Asp Cys Gln Asn Pro Asn Ala Phe Gln 430 435 440 cca tgg gag
tta ctt ggt gtg cta aaa aat gtg aca ttc act gat gga 1396Pro Trp Glu
Leu Leu Gly Val Leu Lys Asn Val Thr Phe Thr Asp Gly 445 450 455 tgg
aat tca ttt cat ttt gat gct cac ggg gat tta aat act gga tat 1444Trp
Asn Ser Phe His Phe Asp Ala His Gly Asp Leu Asn Thr Gly Tyr 460 465
470 gat gtt gtg ctc tgg aag gag atc aat gga cac atg act gtc act aag
1492Asp Val Val Leu Trp Lys Glu Ile Asn Gly His Met Thr Val Thr Lys
475 480 485 490 atg gca gaa tat gac cta cag aat gat gtc ttc atc atc
cca gat cag 1540Met Ala Glu Tyr Asp Leu Gln Asn Asp Val Phe Ile Ile
Pro Asp Gln 495 500 505 gaa aca aaa aat gag ttc agg aat ctt aag caa
att caa tct aaa tgc 1588Glu Thr Lys Asn Glu Phe Arg Asn Leu Lys Gln
Ile Gln Ser Lys Cys 510 515 520 tcc aag gaa tgc agt cct ggg caa atg
aag aaa act aca aga agt caa 1636Ser Lys Glu Cys Ser Pro Gly Gln Met
Lys Lys Thr Thr Arg Ser Gln 525 530 535 cac atc tgt tgc tat gaa tgt
cag aac tgt cct gaa aat cat tac act 1684His Ile Cys Cys Tyr Glu Cys
Gln Asn Cys Pro Glu Asn His Tyr Thr 540 545 550 aat cag aca gat atg
cct cac tgc ctt tta tgc aac aac aaa act cac 1732Asn Gln Thr Asp Met
Pro His Cys Leu Leu Cys Asn Asn Lys Thr His 555 560 565 570 tgg gcc
cct gtt agg agc act atg tgc ttt gaa aag gaa gtg gaa tat 1780Trp Ala
Pro Val Arg Ser Thr Met Cys Phe Glu Lys Glu Val Glu Tyr 575 580 585
ctc aac tgg aat gac tcc ttg gcc atc cta ctc ctg att ctc tcc cta
1828Leu Asn Trp Asn Asp Ser Leu Ala Ile Leu Leu Leu Ile Leu Ser Leu
590 595 600 ctg gga atc ata ttt gtt ctg gtt gtt ggc ata ata ttt aca
aga aac 1876Leu Gly Ile Ile Phe Val Leu Val Val Gly Ile Ile Phe Thr
Arg Asn 605 610 615 ctg aac aca cct gtt gtg aaa tca tcc ggg gga tta
aga gtc tgc tat 1924Leu Asn Thr Pro Val Val Lys Ser Ser Gly Gly Leu
Arg Val Cys Tyr 620 625 630 gtg atc ctt ctc tgt cat ttc ctc aat ttt
gcc agc acg agc ttt ttc 1972Val Ile Leu Leu Cys His Phe Leu Asn Phe
Ala Ser Thr Ser Phe Phe 635 640 645 650 att gga gaa cca caa gac ttc
aca tgt aaa acc agg cag aca atg ttt 2020Ile Gly Glu Pro Gln Asp Phe
Thr Cys Lys Thr Arg Gln Thr Met Phe 655 660 665 gga gtg agc ttt act
ctt tgc atc tcc tgc att ttg acg aag tct ctg 2068Gly Val Ser Phe Thr
Leu Cys Ile Ser Cys Ile Leu Thr Lys Ser Leu 670 675 680 aaa att ttg
cta gcc ttc agc ttt gat ccc aaa tta cag aaa ttt ctg 2116Lys Ile Leu
Leu Ala Phe Ser Phe Asp Pro Lys Leu Gln Lys Phe Leu 685 690 695 aag
tgc ctc tat aga ccg atc ctt att atc ttc act tgc acg ggc atc 2164Lys
Cys Leu Tyr Arg Pro Ile Leu Ile Ile Phe Thr Cys Thr Gly Ile 700 705
710 cag gtt gtc att tgc aca ctc tgg cta atc ttt gca gca cct act gta
2212Gln Val Val Ile Cys Thr Leu Trp Leu Ile Phe Ala Ala Pro Thr Val
715 720 725 730 gag gtg aat gtc tcc ttg ccc aga gtc atc atc ctg gag
tgt gag gag 2260Glu Val Asn Val Ser Leu Pro Arg Val Ile Ile Leu Glu
Cys Glu Glu 735 740 745 gga tcc ata ctt gca ttt ggc acc atg ctg ggc
tac att gcc atc ctg 2308Gly Ser Ile Leu Ala Phe Gly Thr Met Leu Gly
Tyr Ile Ala Ile Leu 750 755 760 gcc ttc att tgc ttc ata ttt gct ttc
aaa ggc aaa tat gag aat tac 2356Ala Phe Ile Cys Phe Ile Phe Ala Phe
Lys Gly Lys Tyr Glu Asn Tyr 765 770 775 aat gaa gcc aaa ttc att aca
ttt ggc atg ctc att tac ttc ata gct 2404Asn Glu Ala Lys Phe Ile Thr
Phe Gly Met Leu Ile Tyr Phe Ile Ala 780 785 790 tgg atc aca ttc atc
cct atc tat gct acc aca ttt ggc aaa tat gta 2452Trp Ile Thr Phe Ile
Pro Ile Tyr Ala Thr Thr Phe Gly Lys Tyr Val 795 800 805 810 cca gct
gtg gag att att gtc ata tta ata tct aac tat gga atc ctg 2500Pro Ala
Val Glu Ile Ile Val Ile Leu Ile Ser Asn Tyr Gly Ile Leu 815 820 825
tat tgc aca ttc atc ccc aaa tgc tat gtt att att tgt aag caa gag
2548Tyr Cys Thr Phe Ile Pro Lys Cys Tyr Val Ile Ile Cys Lys Gln Glu
830 835 840 att aac aca aag tct gcc ttt ctc aag atg atc tac agt tat
tct tcc 2596Ile Asn Thr Lys Ser Ala Phe Leu Lys Met Ile Tyr Ser Tyr
Ser Ser 845 850 855 cat agt gtg agc agc att gcc ctg agt cct gct tca
ctg gac tcc atg 2644His Ser Val Ser Ser Ile Ala Leu Ser Pro Ala Ser
Leu Asp Ser Met 860 865 870 agc ggc aat gtc aca atg acc aat ccc agc
tct agt ggc aag tct gca 2692Ser Gly Asn Val Thr Met Thr Asn Pro Ser
Ser Ser Gly Lys Ser Ala 875 880 885 890 acc tgg cag aaa agc aaa gat
ctt cag gca caa gca ttt gca cac ata 2740Thr Trp Gln Lys Ser Lys Asp
Leu Gln Ala Gln Ala Phe Ala His Ile 895 900 905 tgc agg gaa aat gcc
aca agt gta tct aaa act ttg cct cga aaa aga 2788Cys Arg Glu Asn Ala
Thr Ser Val Ser Lys Thr Leu Pro Arg Lys Arg 910 915 920 atg tca agt
ata tga ataagcctta ggagatgcca cattccagaa taaaatgttt 2843Met Ser Ser
Ile 925 ccagggtctt tgcatct 286031926PRTHomo sapiens 31Met Ala Phe
Leu Ile Ile Leu Ile Thr Cys Phe Val Ile Ile Leu Ala 1 5 10 15 Thr
Ser Gln Pro Cys Gln Thr Pro Asp Asp Phe Val Ala Ala Thr Ser 20 25
30 Pro Gly His Ile Ile Ile Gly Gly Leu Phe Ala Ile His Glu Lys Met
35 40 45 Leu Ser Ser Glu Asp Ser Pro Arg Arg Pro Gln Ile Gln Glu
Cys Val 50 55 60 Gly Phe Glu Ile Ser Val Phe Leu Gln Thr Leu Ala
Met Ile His Ser 65 70 75 80 Ile Glu Met Ile Asn Asn Ser Thr Leu Leu
Ser Gly Val Lys Leu Gly 85 90 95 Tyr Glu Ile Tyr Asp Thr Cys Thr
Glu Val Thr Val Ala Met Ala Ala 100 105 110 Thr Leu Arg Phe Leu Ser
Lys Phe Asn Cys Ser Arg Glu Thr Val Glu 115 120 125 Phe Lys Cys Asp
Tyr Ser Ser Tyr Met Pro Arg Val Lys Ala Val Ile 130 135 140 Gly Ser
Gly Tyr Ser Glu Ile Thr Met Ala Val Ser Arg Met Leu Asn 145 150 155
160 Leu Gln Leu Met Pro Gln Val Gly Tyr Glu Ser Thr Ala Glu Ile Leu
165 170 175 Ser Asp Lys Ile Arg Phe Pro Ser Phe Leu Arg Thr Val Pro
Ser Asp 180 185 190 Phe His Gln Ile Lys Ala Met Ala His Leu Ile Gln
Lys Ser Gly Trp 195 200 205 Asn Trp Ile Gly Ile Ile Thr Thr Asp Asp
Asp Tyr Gly Arg Leu Ala 210 215 220 Leu Asn Thr Phe Ile Ile Gln Ala
Glu Ala Asn Asn Val Cys Ile Ala 225 230 235 240 Phe Lys Glu Val Leu
Pro Ala Phe Leu Ser Asp Asn Thr Ile Glu Val 245 250
255 Arg Ile Asn Arg Thr Leu Lys Lys Ile Ile Leu Glu Ala Gln Val Asn
260 265 270 Val Ile Val Val Phe Leu Arg Gln Phe His Val Phe Asp Leu
Phe Asn 275 280 285 Lys Ala Ile Glu Met Asn Ile Asn Lys Met Trp Ile
Ala Ser Asp Asn 290 295 300 Trp Ser Thr Ala Thr Lys Ile Thr Thr Ile
Pro Asn Val Lys Lys Ile 305 310 315 320 Gly Lys Val Val Gly Phe Ala
Phe Arg Arg Gly Asn Ile Ser Ser Phe 325 330 335 His Ser Phe Leu Gln
Asn Leu His Leu Leu Pro Ser Asp Ser His Lys 340 345 350 Leu Leu His
Glu Tyr Ala Met His Leu Ser Ala Cys Ala Tyr Val Lys 355 360 365 Asp
Thr Asp Leu Ser Gln Cys Ile Phe Asn His Ser Gln Arg Thr Leu 370 375
380 Ala Tyr Lys Ala Asn Lys Ala Ile Glu Arg Asn Phe Val Met Arg Asn
385 390 395 400 Asp Phe Leu Trp Asp Tyr Ala Glu Pro Gly Leu Ile His
Ser Ile Gln 405 410 415 Leu Ala Val Phe Ala Leu Gly Tyr Ala Ile Arg
Asp Leu Cys Gln Ala 420 425 430 Arg Asp Cys Gln Asn Pro Asn Ala Phe
Gln Pro Trp Glu Leu Leu Gly 435 440 445 Val Leu Lys Asn Val Thr Phe
Thr Asp Gly Trp Asn Ser Phe His Phe 450 455 460 Asp Ala His Gly Asp
Leu Asn Thr Gly Tyr Asp Val Val Leu Trp Lys 465 470 475 480 Glu Ile
Asn Gly His Met Thr Val Thr Lys Met Ala Glu Tyr Asp Leu 485 490 495
Gln Asn Asp Val Phe Ile Ile Pro Asp Gln Glu Thr Lys Asn Glu Phe 500
505 510 Arg Asn Leu Lys Gln Ile Gln Ser Lys Cys Ser Lys Glu Cys Ser
Pro 515 520 525 Gly Gln Met Lys Lys Thr Thr Arg Ser Gln His Ile Cys
Cys Tyr Glu 530 535 540 Cys Gln Asn Cys Pro Glu Asn His Tyr Thr Asn
Gln Thr Asp Met Pro 545 550 555 560 His Cys Leu Leu Cys Asn Asn Lys
Thr His Trp Ala Pro Val Arg Ser 565 570 575 Thr Met Cys Phe Glu Lys
Glu Val Glu Tyr Leu Asn Trp Asn Asp Ser 580 585 590 Leu Ala Ile Leu
Leu Leu Ile Leu Ser Leu Leu Gly Ile Ile Phe Val 595 600 605 Leu Val
Val Gly Ile Ile Phe Thr Arg Asn Leu Asn Thr Pro Val Val 610 615 620
Lys Ser Ser Gly Gly Leu Arg Val Cys Tyr Val Ile Leu Leu Cys His 625
630 635 640 Phe Leu Asn Phe Ala Ser Thr Ser Phe Phe Ile Gly Glu Pro
Gln Asp 645 650 655 Phe Thr Cys Lys Thr Arg Gln Thr Met Phe Gly Val
Ser Phe Thr Leu 660 665 670 Cys Ile Ser Cys Ile Leu Thr Lys Ser Leu
Lys Ile Leu Leu Ala Phe 675 680 685 Ser Phe Asp Pro Lys Leu Gln Lys
Phe Leu Lys Cys Leu Tyr Arg Pro 690 695 700 Ile Leu Ile Ile Phe Thr
Cys Thr Gly Ile Gln Val Val Ile Cys Thr 705 710 715 720 Leu Trp Leu
Ile Phe Ala Ala Pro Thr Val Glu Val Asn Val Ser Leu 725 730 735 Pro
Arg Val Ile Ile Leu Glu Cys Glu Glu Gly Ser Ile Leu Ala Phe 740 745
750 Gly Thr Met Leu Gly Tyr Ile Ala Ile Leu Ala Phe Ile Cys Phe Ile
755 760 765 Phe Ala Phe Lys Gly Lys Tyr Glu Asn Tyr Asn Glu Ala Lys
Phe Ile 770 775 780 Thr Phe Gly Met Leu Ile Tyr Phe Ile Ala Trp Ile
Thr Phe Ile Pro 785 790 795 800 Ile Tyr Ala Thr Thr Phe Gly Lys Tyr
Val Pro Ala Val Glu Ile Ile 805 810 815 Val Ile Leu Ile Ser Asn Tyr
Gly Ile Leu Tyr Cys Thr Phe Ile Pro 820 825 830 Lys Cys Tyr Val Ile
Ile Cys Lys Gln Glu Ile Asn Thr Lys Ser Ala 835 840 845 Phe Leu Lys
Met Ile Tyr Ser Tyr Ser Ser His Ser Val Ser Ser Ile 850 855 860 Ala
Leu Ser Pro Ala Ser Leu Asp Ser Met Ser Gly Asn Val Thr Met 865 870
875 880 Thr Asn Pro Ser Ser Ser Gly Lys Ser Ala Thr Trp Gln Lys Ser
Lys 885 890 895 Asp Leu Gln Ala Gln Ala Phe Ala His Ile Cys Arg Glu
Asn Ala Thr 900 905 910 Ser Val Ser Lys Thr Leu Pro Arg Lys Arg Met
Ser Ser Ile 915 920 925
* * * * *