U.S. patent application number 14/260856 was filed with the patent office on 2015-03-26 for anti-activin a antibodies and uses thereof.
This patent application is currently assigned to Amgen Inc.. The applicant listed for this patent is Amgen Inc.. Invention is credited to Qing Chen, Huiquan Han, Keith Soo-Nyung Kwak, Xiaolan Zhou.
Application Number | 20150086556 14/260856 |
Document ID | / |
Family ID | 39103486 |
Filed Date | 2015-03-26 |
United States Patent
Application |
20150086556 |
Kind Code |
A1 |
Han; Huiquan ; et
al. |
March 26, 2015 |
Anti-Activin A Antibodies and Uses Thereof
Abstract
The disclosure provides compositions and methods relating to or
derived from anti-activin A binding proteins, including antibodies.
In particular embodiments, the disclosure provides fully human,
humanized, and chimeric anti-activin A antibodies that bind human
activin A, activin A-binding fragments and derivatives of such
antibodies, and activin A-binding polypeptides comprising such
fragments. Other embodiments provide nucleic acids encoding such
antibodies, antibody fragments and derivatives and polypeptides,
cells comprising such polynucleotides, methods of making such
antibodies, antibody fragments and derivatives and polypeptides,
and methods of using such antibodies, antibody fragments and
derivatives and polypeptides, including methods of treating or
diagnosing subjects having activin A-related disorders or
conditions including cachexia related to gonadal cancer, other
cancers, rheumatoid arthritis, and other diseases.
Inventors: |
Han; Huiquan; (Thousand
Oaks, CA) ; Chen; Qing; (Oxnard, CA) ; Kwak;
Keith Soo-Nyung; (Thousand Oaks, CA) ; Zhou;
Xiaolan; (Newbury Park, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Amgen Inc. |
Thousand Oaks |
CA |
US |
|
|
Assignee: |
Amgen Inc.
Thousand Oaks
CA
|
Family ID: |
39103486 |
Appl. No.: |
14/260856 |
Filed: |
April 24, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13550447 |
Jul 16, 2012 |
8753627 |
|
|
14260856 |
|
|
|
|
11851884 |
Sep 7, 2007 |
8309082 |
|
|
13550447 |
|
|
|
|
60843430 |
Sep 8, 2006 |
|
|
|
60956653 |
Aug 17, 2007 |
|
|
|
Current U.S.
Class: |
424/139.1 ;
435/320.1; 435/331; 536/23.53 |
Current CPC
Class: |
C07K 2317/567 20130101;
A61P 1/00 20180101; A61P 43/00 20180101; A61P 35/00 20180101; A61P
3/04 20180101; A61P 5/06 20180101; A61P 29/00 20180101; A61P 9/10
20180101; C07K 2317/21 20130101; C07K 2317/56 20130101; A61P 37/00
20180101; A61K 2039/505 20130101; C07K 2317/14 20130101; A61P 19/02
20180101; C07K 2317/565 20130101; A61P 5/00 20180101; C07K 2317/76
20130101; A61P 7/00 20180101; C07K 16/22 20130101; C07K 2317/92
20130101; A61P 9/00 20180101 |
Class at
Publication: |
424/139.1 ;
536/23.53; 435/320.1; 435/331 |
International
Class: |
C07K 16/22 20060101
C07K016/22 |
Claims
1. A pharmaceutical composition comprising a pharmaceutically
acceptable excipient and an isolated antigen binding protein that
specifically binds a cysteine knot domain in Activin A, wherein the
antigen binding protein binds a region selected from the group
consisting of amino acids 11-33 of SEQ ID NO:1, amino acids 81-111
of SEQ ID NO:1, and amino acids 11-33 and 81-111 of SEQ ID
NO:1.
2. The composition of claim 1, wherein the protein, when bound to a
human activin A, inhibits binding of human activin A to human
activin A receptor.
3. The composition of claim 1, wherein the antigen binding protein
possesses at least one in vivo biological activity of a human
anti-Activin A antibody.
4. The composition of claim 3, wherein said biological activity is
selected from attenuation of cachexia, attenuating cachexia in
colon tumor-bearing mice, ameliorating the loss of body weight in
colon tumor-bearing mice, ameliorating the loss of body weight in a
collagen-induced animal model of rheumatoid arthritis, ameliorating
the loss of muscle mass in a collagen-induced animal model of
rheumatoid arthritis, ameliorating the loss of fat mass in a
collagen-induced animal model of rheumatoid arthritis, and
ameliorating the loss of body weight in a AAV-activin A transfected
animal model.
5. The composition of claim 1, wherein the protein is a fully human
isolated antibody.
6. The composition according to claim 5, wherein the antibody: a)
specifically binds to the cysteine knot region (amino acids C11-S33
and/or amino acids C81-E111) of activin A, wherein said antigen
binding protein inhibits the binding of activin A to activin A
receptor in vitro, or b) specifically binds to the cysteine knot
region (amino acids C11-S33 and/or amino acids C81-E111) of activin
A, wherein said antigen binding protein inhibits the binding of
activin A to activin A receptor in vivo.
7. The composition of claim 1, wherein the protein is an antibody
or antigen binding fragment thereof.
8. The composition of claim 7, wherein the isolated antibody or
antigen binding fragment thereof, that when bound to activin A: a
inhibits activin A; b. cross-competes with a reference antibody for
binding to activin A; c. binds to the same epitope of activin A as
said reference antibody; d. binds to activin A with substantially
the same Kd as said reference antibody; and/or e. binds to activin
A with substantially the smile off rate as said reference antibody;
wherein said reference antibody comprises a combination of light
chain and heavy chain variable domain sequences of the amino acid
sequence set forth in SEQ ID NOS: 9 and 10.
9. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof further comprises a
light chain constant sequence of the amino acid sequence set forth
in SEQ ID NO: 84 and a heavy chain constant sequence of the amino
acid sequence set forth in SEQ ID NO: 214.
10. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof has a binding affinity
(K.sub.D) for human activin A of less than or equal to
1.times.10.sup.-11 M.
11. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof further comprises a
light chain constant sequence of the amino acid sequence set forth
in SEQ ID NO: 84, 100, or 108, and/or a heavy chain constant
sequence of the amino acid sequence set forth in SEQ ID NO: 214,
215, or 221.
12. The pharmaceutical composition according to claim 1, further
comprising one or more substances selected from the group
consisting of a buffer, an antioxidant, a low molecular weight
polypeptide, a protein, an amino acid, a carbohydrate, a chelating
agent, and a stabilizer.
13. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof is a fully human
antibody.
14. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof is an IgG2
antibody.
15. The pharmaceutical composition of claim 7, wherein the isolated
antibody or antigen binding fragment thereof is an IgG2 kappa
antibody.
16. An isolated polynucleotide comprising a sequence that encodes
the isolated antigen binding protein, of claim 1.
17. A vector comprising the polynucleotide according to claim
16.
18. The vector according to claim 17, which is selected from the
group consisting of a plasmid, a viral vector, non-episomal
mammalian vector, expression vector and a recombinant expression
vector.
19. An isolated cell comprising a polynulceotide according to claim
16.
20. The isolated cell according to claim 19, which is a hybridoma
or a Chinese Hamster Ovary (CHO) cell.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 13/550,447, filed 16, Jul. 2012, and entitled
"ANTI-ACTIVIN A ANTIBODIES AND USES THEREOF"; which is a
continuation of U.S. patent application Ser. No. 11/851,884 (now
U.S. Pat. No. 8,309,082), filed 7 Sep. 2007, and entitled
"ANTI-ACTIVIN A ANTIBODIES AND USES THEREOF"; which claims benefit
of priority to U.S. Provisional Application Nos. 60/843,430 filed 8
Sep. 2006, and entitled "ANTI-ACTIVIN A ANTIBODIES AND USES
THEREOF"; and 60/956,653 filed 17 Aug. 2007, and entitled
"ANTI-ACTIVIN A ANTIBODIES AND USES THEREOF," all of which are
incorporated by reference herein in their entireties.
TECHNICAL FIELD
[0002] The present invention relates generally to cysteine knot
domains of activin A and antigen binding agents capable of binding
to activin A or fragments thereof.
SEQUENCE LISTING
[0003] The instant application contains a Sequence Listing which
has been submitted via EFS-Web and is hereby incorporated by
reference in its entirety. Said ASCII copy, created on Apr. 24,
2014, is named 26659US_sequencelisting.txt, and is 125 kilobytes in
size.
BACKGROUND OF THE INVENTION
[0004] Many serious disease states are accompanied by a condition
known as cachexia, which refers to loss of body cell mass. Body
cell mass (BCM) consists of muscle mass, visceral mass and immune
cell mass. BCM is the most active body component of the human body,
counting ninety-five percent of all metabolic activity. A five
percent loss of BCM leads to changed morbidity, loss of muscle
strength, altered metabolism and increased risk of infection. A
forty percent loss can result in death.
[0005] Examples of conditions in which cachexia plays a role in
determining the outcome of the underlying disease cover a range of
the major health problems today. In rheumatoid cachexia, rheumatoid
arthritis (RA) patients lose thirteen to fifteen percent of BCM.
Two-thirds of RA patients have cachexia, and this results in a two-
to five-fold higher mortality. Other related conditions include
rheumatoid cachectic obesity and hypercytokinaemic cachexia.
Cancer-related cachexia contributes significantly to the morbidity
and mortality, also affecting a patient's ability to tolerate
potentially life-saving therapies.
[0006] Because of the common role of activin A in a number of
widespread diseases, all of which have high rates of mortality,
there is a long-felt need in the art for compositions and methods
to prevent or reverse the disease-related cachexia. Such
compositions and methods are provided herein.
BRIEF SUMMARY OF THE INVENTION
[0007] In one aspect, the present invention provides an isolated
antigen binding protein comprising either: a. a light chain CDR3
comprising a sequence selected from the group consisting of: i. a
light chain CDR3 sequence that differs by no more than a total of
two amino acid additions, substitutions, and/or deletions from a
CDR3 sequence selected from the group consisting of the light chain
CDR3 sequences of L1-L14; ii. X.sub.73 Q X.sub.74 X.sub.75 X.sub.76
X.sub.77 X.sub.78 X.sub.79 X.sub.80 (SEQ ID NO:132); iii. L Q H N
X.sub.81 Y X.sub.82 X.sub.83 T (SEQ ID NO:131); and iv. Q A W D
X.sub.84 S T X.sub.85 X.sub.86 (SEQ ID NO:248); b. a heavy chain
CDR3 comprising a sequence selected from the group consisting of:
i. a heavy chain CDR3 sequence that differs by no more than a total
of three amino acid additions, substitutions, and/or deletions from
a CDR3 sequence selected from the group consisting of the heavy
chain CDR3 sequences of H1-H14; ii. X.sub.87 X.sub.88 X.sub.89
X.sub.90 X.sub.91 X.sub.92 X.sub.93 X.sub.94 F D Y (SEQ ID NO:187);
iii. X.sub.95 X.sub.96 X.sub.97 Y X.sub.98 D X.sub.99 X.sub.100 G W
X.sub.101 X.sub.102 X.sub.103 (SEQ ID NO:188); iv. X.sub.104
X.sub.105 X.sub.106 X.sub.107 X.sub.108 X.sub.109 Y X.sub.110
X.sub.111 X.sub.112 X.sub.113 X.sub.114 X.sub.115 X.sub.116
X.sub.117 X.sub.118 (SEQ ID NO:249); or c. the light chain CDR3
sequence of (a) and the heavy chain CDR3 sequence of (b); wherein
X.sub.73 is a methionine residue, a glutamine residue, or an
arginine residue, X.sub.74 is an alanine residue, a tyrosine
residue, a glutamine residue, or a serine residue, X.sub.75 is a
leucine residue, a tyrosine residue, or an asparagine residue,
X.sub.76 is a glutamine residue, a serine residue, or a threonine
residue, X.sub.77 is a threonine residue, a tyrosine residue, or an
isoleucine residue, X.sub.78 is a proline residue or a serine
residue, X.sub.79 is a cysteine residue, a tryptophan residue, a
leucine residue, or a proline residue, X.sub.80 is a serine residue
or a threonine residue, X.sub.81 is a threonine residue or a serine
residue, X.sub.82 is a proline residue or a threonine residue,
X.sub.83 is a phenylalanine residue or a tryptophan residue,
X.sub.84 is an arginine residue or a serine residue, X.sub.85 is a
valine residue or an alanine residue, X.sub.86 is a valine residue
or no residue, X.sub.87 is a valine residue or no residue, X.sub.88
is a glutamine residue or no residue, X.sub.89 is an aspartate
residue, a tryptophan residue, or no residue, X.sub.90 is a serine
residue, a leucine residue, or no residue, X.sub.91 is an
isoleucine residue, a glutamate residue, or a glutamine residue,
X.sub.92 is an alanine residue, a leucine residue, or a glycine
residue, X.sub.93 is an alanine residue or a leucine residue,
X.sub.94 is a proline residue, a tyrosine residue, or a glycine
residue, X.sub.95 is an aspartate residue or no residue, X.sub.96
is a glutamine residue or no residue, X.sub.97 is an aspartate
residue or an alanine residue, X.sub.98 is a tyrosine residue or a
glycine residue, X.sub.99 is a serine residue or a tyrosine
residue, X.sub.100 is a serine residue or an arginine residue,
X.sub.101 is a phenylalanine residue or no residue, X.sub.102 is a
glycine residue or an aspartate residue, X.sub.103 is a histidine
residue or a proline residue, X.sub.104 is a glycine residue or no
residue, X.sub.105 is a serine residue, a glutamate residue, or no
residue, X.sub.106 is an arginine residue, a serine residue, or no
residue, X.sub.107 is an aspartate residue, an asparagine residue,
a serine residue, or a glutamine residue, X.sub.108 is a serine
residue, an arginine residue, or a tryptophan residue, X.sub.109 is
a glycine residue, an aspartate residue, an asparagine residue, a
tyrosine residue, or a leucine residue, X.sub.110 is a serine
residue, a glycine residue, an aspartate residue, or no residue,
X.sub.111 is a serine residue, a valine residue, an asparagine
residue, or a tyrosine residue, X.sub.112 is a serine residue, an
asparagine residue, a tyrosine residue, or a histidine residue,
X.sub.113 is a tryptophan residue, a tyrosine residue, or a
glutamine residue, X.sub.114 is a histidine residue, an aspartate
residue, a tyrosine residue, or no residue, X.sub.115 is a
phenylalanine residue, an alanine residue, or a glycine residue,
X.sub.116 an aspartate residue, a phenylalanine residue, a leucine
residue, or a methionine residue, X.sub.117 a tyrosine residue, or
an aspartate residue, X.sub.118 is an isoleucine residue, a valine
residue, or no residue, and the antigen binding protein binds
specifically to human activin A.
[0008] In another aspect, the isolated antigen binding protein
comprises an amino acid sequence selected from the group consisting
of: a. a light chain CDR1 sequence that differs by no more than a
total of six amino acid additions, substitutions, and/or deletions
from a CDR1 sequence of L1-L14; b. a light chain CDR2 sequence that
differs by no more than a total of two amino acid additions,
substitutions, and/or deletions from a CDR2 sequence of L1-L14; c.
a light chain CDR3 sequence that differs by no more than a total of
three amino acid additions, substitutions, and/or deletions from a
CDR3 sequence of L1-L14; d. a heavy chain CDR1 sequence that
differs by no more than a total of two amino acid additions,
substitutions, and/or deletions from a CDR1 sequence of H1-H14; e.
a heavy chain CDR2 sequence that differs by no more than a total of
five amino acid additions, substitutions, and/or deletions from a
CDR2 sequence of H1-H14; and f. a heavy chain CDR3 sequence that
differs by no more than a total of four amino acid additions,
substitutions, and/or deletions from a CDR3 sequence of H1-H14.
[0009] In a further aspect, the isolated antigen binding protein
comprises an amino acid sequence selected from the group consisting
of: a. a light chain CDR1 sequence that differs by no more than a
total of five amino acid additions, substitutions, and/or deletions
from a CDR1 sequence of L1-L14; b. a light chain CDR2 sequence that
differs by no more than a total of one amino acid addition,
substitution, or deletion from a CDR2 sequence of L1-L14; c. a
light chain CDR3 sequence that differs by no more than a total of
two amino acid additions, substitutions, and/or deletions from a
CDR3 sequence of L1-L14; d. a heavy chain CDR1 sequence that
differs by no more than a total of one amino acid addition,
substitution, or deletion from a CDR1 sequence of H1-H14; e. a
heavy chain CDR2 sequence that differs by no more than a total of
four amino acid additions, substitutions, and/or deletions from a
CDR2 sequence of H1-H14; and f. a heavy chain CDR3 sequence that
differs by no more than a total of three amino acid additions,
substitutions, and/or deletions from a CDR3 sequence of H1-H14.
[0010] In a further aspect, the isolated antigen binding protein
comprises an amino acid sequence selected from the group consisting
of: a. a light chain CDR1 sequence that differs by no more than a
total of four amino acid additions, substitutions, and/or deletions
from a CDR1 sequence of L1-L14; b. a light chain CDR2 sequence of
L1-L14; c. a light chain CDR3 sequence that differs by no more than
a total of one amino acid addition, substitution, or deletion from
a CDR3 sequence of L1-L14; d. a heavy chain CDR1 sequence of
H1-H14; e. a heavy chain CDR2 sequence that differs by no more than
a total of three amino acid additions, substitutions, and/or
deletions from a CDR2 sequence of H1-H14; and f. a heavy chain CDR3
sequence that differs by no more than a total of two amino acid
additions, substitutions, and/or deletions from a CDR3 sequence of
H1-H14.
[0011] In yet a further aspect, the isolated antigen binding
protein comprises an amino acid sequence selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR3 sequence of L1-L14; c. a heavy chain CDR2 sequence that
differs by no more than a total of two amino acid additions,
substitutions, and/or deletions from a CDR2 sequence of H1-H14; and
d. a heavy chain CDR3 sequence that differs by no more than a total
of one amino acid addition, substitution, or deletion from a CDR3
sequence of H1-H14.
[0012] In another aspect, the isolated antigen binding protein
comprises an amino acid sequence selected from the group consisting
of: a. a light chain CDR1 sequence that differs by no more than a
total of two amino acid additions, substitutions, and/or deletions
from a CDR1 sequence of L1-L14; b. a heavy chain CDR2 sequence that
differs by no more than a total of one amino acid addition,
substitution, or deletion from a CDR2 sequence of H1-H14; and c. a
heavy chain CDR3 sequence of H1-H14.
[0013] In a still further aspect, the isolated antigen binding
protein comprises an amino acid sequence selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of one amino acid addition, substitution, or
deletion from a CDR1 sequence of L1-L14; and b. a heavy chain CDR2
sequence of H1-H14.
[0014] In a yet further aspect, the isolated antigen binding
protein comprises a CDR1 sequence of L1-L14.
[0015] The isolated antigen binding protein may comprise a sequence
selected from the group consisting of: a. a light chain CDR1
sequence selected from the group consisting of: i.
(R/K)SSQS(L/I)L(H/Y)S(T/S)(G/N)(Y/N)(N/K)(-/K)YL(DN) (SEQ ID
NO:115); ii. RA(S/G)QGI(S/R)N(D/N)L-(V/G) (SEQ ID NO:250); iii.
RASQSISNYLNT (SEQ ID NO:251); and iv.
SG(D/E)K(L/W)G(D/E)K(F/Y)(A/V)(F/C) (SEQ ID NO:123); b. a light
chain CDR2 sequence selected from the group consisting of: i.
(H/Q/L)D(T/N/S)KRPS (SEQ ID NO:128); and ii. X.sub.40 X.sub.41 S
X.sub.42 X.sub.43 X.sub.44 S (SEQ ID NO:124), wherein X.sub.40 is
an alanine residue, a tryptophan residue, or a leucine residue,
X.sub.41 is a threonine residue, an alanine residue, or a glycine
residue, X.sub.42 is a serine residue, a methionine residue, or a
phenylalanine residue, X.sub.43 is a leucine residue or an arginine
residue, X.sub.44 is a glutamine residue, a glutamate residue, or
an alanine residue, c. a heavy chain CDR1 sequence selected from
the group consisting of: i. GGS(I/F)(N/S)(S/A)(-/G)(-/G)(F/Y)YWS
(SEQ ID NO:252); ii. G X.sub.27 X.sub.28 F X.sub.29 X.sub.30 Y
X.sub.31 X.sub.32 X.sub.33 (SEQ ID NO:139), wherein X.sub.27 is a
tyrosine residue or a phenylalanine residue, X.sub.28 is a
threonine residue or a serine residue, X.sub.29 is a threonine
residue, a serine residue, or an isoleucine residue, X.sub.30 is a
glycine residue or a serine residue, X.sub.31 is a tyrosine
residue, a glycine residue, or a tryptophan residue, X.sub.32 is an
isoleucine residue or a methionine residue, X.sub.33 is a histidine
residue or a glycine residue; and iii.
G(Y/F)TF(T/S)-(S/A)Y(G/W)(L/M/I)(S/H) (SEQ ID NO:140); d. a heavy
chain CDR2 sequence selected from the group consisting of: i.
(Y/E)I(S/Y/N)(Y/H)SG(S/G)T(Y/N)YNPSLK(S/R) (SEQ ID NO:142); ii.
(V/N)I(K/W)(Y/Q)DGS(N/E/T)(K/E)Y(H/Y)(A/V)DSVKG (SEQ ID NO:179);
and iii. X.sub.60 I X.sub.61 X.sub.62 X.sub.63 X.sub.64 X.sub.65
X.sub.66 T X.sub.67 X.sub.68 X.sub.69 X.sub.70 X.sub.71 X.sub.72 Q
G (SEQ ID NO:180), wherein X.sub.60 is a tryptophan residue or an
isoleucine residue, X.sub.61 is an asparagine residue, an
isoleucine residue, a serine residue, or a tyrosine residue,
X.sub.62 is a proline residue or an alanine residue, X.sub.63 is an
asparagine residue, a tyrosine residue, or a glycine residue,
X.sub.64 is a serine residue, an asparagine residue, or an
aspartate residue, X.sub.65 is a glycine residue or a serine
residue, X.sub.66 is a glycine residue, an asparagine residue, or
an aspartate residue, X.sub.67 is an asparagine residue or an
arginine residue, X.sub.68 is a tyrosine residue or a serine
residue, X.sub.69 is an alanine residue or a serine residue,
X.sub.70 is a glutamine residue or a proline residue, X.sub.71 is a
lysine residue or a serine residue, and X.sub.72 is a phenylalanine
residue or a leucine residue, wherein amino acid residue symbols
enclosed in parentheses identify alternative residues for the same
position in a sequence.
[0016] In certain aspects, the isolated antigen binding protein
comprises a heavy chain CDR3 sequence that differs by no more than
a total of two amino acid additions, substitutions, and/or
deletions from a CDR3 sequence of H1-H14.
[0017] In further aspects, the isolated antigen binding protein
comprises a heavy chain CDR3 sequence that differs by no more than
a total of one amino acid addition, substitution, or deletion from
a CDR3 sequence of H1-H14.
[0018] In yet further aspects, the isolated antigen binding protein
comprises a heavy chain CDR3 sequence of H1-H14.
[0019] In another aspect, the isolated antigen binding protein
comprises two amino acid sequences selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of six amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR2 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR2
sequence of L1-L14; c. a light chain CDR3 sequence that differs by
no more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR3 sequence of L1-L14; d. a heavy chain
CDR1 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR1
sequence of H1-H14; e. a heavy chain CDR2 sequence that differs by
no more than a total of five amino acid additions, substitutions,
and/or deletions from a CDR2 sequence of H1-H14; and f. a heavy
chain CDR3 sequence that differs by no more than a total of four
amino acid additions, substitutions, and/or deletions from a CDR3
sequence of H1-H14.
[0020] In a further aspect, the isolated antigen binding protein
comprises three amino acid sequences selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of six amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR2 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR2
sequence of L1-L14; c. a light chain CDR3 sequence that differs by
no more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR3 sequence of L1-L14; d. a heavy chain
CDR1 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR1
sequence of H1-H14; e. a heavy chain CDR2 sequence that differs by
no more than a total of five amino acid additions, substitutions,
and/or deletions from a CDR2 sequence of H1-H14; and f. a heavy
chain CDR3 sequence that differs by no more than a total of four
amino acid additions, substitutions, and/or deletions from a CDR3
sequence of H1-H14.
[0021] In another aspect, the isolated antigen binding protein
comprises four amino acid sequences selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of six amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR2 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR2
sequence of L1-L14; c. a light chain CDR3 sequence that differs by
no more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR3 sequence of L1-L14; d. a heavy chain
CDR1 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR1
sequence of H1-H14; e. a heavy chain CDR2 sequence that differs by
no more than a total of five amino acid additions, substitutions,
and/or deletions from a CDR2 sequence of H1-H14; and f. a heavy
chain CDR3 sequence that differs by no more than a total of four
amino acid additions, substitutions, and/or deletions from a CDR3
sequence of H1-H14.
[0022] In another aspect, the isolated antigen binding protein
comprises five amino acid sequences selected from the group
consisting of: a. a light chain CDR1 sequence that differs by no
more than a total of six amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR2 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR2
sequence of L1-L14; c. a light chain CDR3 sequence that differs by
no more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR3 sequence of L1-L14; d. a heavy chain
CDR1 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR1
sequence of H1-H14; e. a heavy chain CDR2 sequence that differs by
no more than a total of five amino acid additions, substitutions,
and/or deletions from a CDR2 sequence of H1-H14; and f. a heavy
chain CDR3 sequence that differs by no more than a total of four
amino acid additions, substitutions, and/or deletions from a CDR3
sequence of H1-H14.
[0023] In a still further aspect, the isolated antigen binding
protein comprises: a. a light chain CDR1 sequence that differs by
no more than a total of six amino acid additions, substitutions,
and/or deletions from a CDR1 sequence of L1-L14; b. a light chain
CDR2 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR2
sequence of L1-L14; c. a light chain CDR3 sequence that differs by
no more than a total of three amino acid additions, substitutions,
and/or deletions from a CDR3 sequence of L1-L14; d. a heavy chain
CDR1 sequence that differs by no more than a total of two amino
acid additions, substitutions, and/or deletions from a CDR1
sequence of H1-H14; e. a heavy chain CDR2 sequence that differs by
no more than a total of five amino acid additions, substitutions,
and/or deletions from a CDR2 sequence of H1-H14; and f. a heavy
chain CDR3 sequence that differs by no more than a total of four
amino acid additions, substitutions, and/or deletions from a CDR3
sequence of H1-H14.
[0024] In another aspect, the isolated antigen binding protein
comprises either: a. a light chain variable domain comprising: i. a
light chain CDR1 sequence; ii. a light chain CDR2 sequence; and
iii. a light chain CDR3 sequence; b. a heavy chain variable domain
comprising: i. a heavy chain CDR1 sequence; ii. a heavy chain CDR2
sequence; and iii. a heavy chain CDR3 sequence; or c. the light
chain variable domain of (a) and the heavy chain variable domain of
(b).
[0025] In one embodiment, the isolated antigen binding protein
comprises a combination of a light chain variable domain and a
heavy chain variable domain selected from the group of combinations
consisting of: L1H1, L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8,
L9H9, L10H10, L11H11, L12H12, L13H13, and L14H14.
[0026] In one embodiment, the isolated antigen binding protein
further comprises: the kappa light chain constant sequence of SEQ
ID NO:84, 100 or 108, and/or the heavy chain constant sequence of
SEQ ID NO:214, 215 or 221.
[0027] In one embodiment, the isolated antigen binding protein,
when bound to activin A: a. inhibits activin A; b. cross-competes
with a reference antibody for binding to activin A; c. binds to the
same epitope of activin A as said reference antibody; d. binds to
activin A with substantially the same Kd as said reference
antibody; or e. binds to activin A with substantially the same off
rate as said reference antibody; wherein the reference antibody
comprises a combination of light chain and heavy chain variable
domain sequences selected from the group of combinations consisting
of L1H1, L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8, L9H9, L10H10,
L11H11, L12H12, L13H13, and L14H14.
[0028] In one embodiment, the isolated antigen binding protein,
when bound to a human activin A, inhibits binding of activin A to
human activin A receptor; attenuates cachexia in colon
tumor-bearing mice; ameliorates the loss of body weight in colon
tumor-bearing mice; ameliorates the loss of body weight in a
collagen-induced animal model of rheumatoid arthritis; ameliorates
the loss of muscle mass in a collagen-induced animal model of
rheumatoid arthritis; ameliorates the loss of fat mass in a
collagen-induced animal model of rheumatoid arthritis; and/or
ameliorates the loss of body weight in a AAV-activin A transfected
animal model.
[0029] In one aspect, the isolated antigen binding protein
comprises: a. a human antibody; b. a humanized antibody; c. a
chimeric antibody; d. a monoclonal antibody; e. a polyclonal
antibody; f. a recombinant antibody; g. an antigen-binding antibody
fragment; h. a single chain antibody; i. a diabody; j. a triabody;
k. a tetrabody; l. a Fab fragment; m. a F(ab').sub.2 fragment; n. a
domain antibody; o. an IgD antibody; p. an IgE antibody; q. an IgM
antibody; r. an IgG1 antibody; s. an IgG2 antibody; t. an IgG3
antibody; u. an IgG4 antibody; or v. an IgG4 antibody having at
least one mutation in a hinge region that alleviates a tendency to
form intra-H chain disulfide bond.
[0030] Also provided is a human antigen binding protein specific
for activin A, wherein the antigen binding protein possesses at
least one in vivo biological activity of a human anti-activin A
antibody; such as the attenuation of cachexia.
[0031] Further provided is a human antigen binding protein that
ameliorates the loss of body weight in colon tumor-bearing mice, or
that ameliorates the loss of body weight in a collagen-induced
animal model of rheumatoid arthritis.
[0032] Also provided is a human antigen binding protein that
ameliorates the loss of muscle mass in a collagen-induced animal
model of rheumatoid arthritis, that ameliorates the loss of fat
mass in a collagen-induced animal model of rheumatoid arthritis or
that ameliorates the loss of body weight in a AAV-activin A
transfected animal model.
[0033] Further provided is a human antigen binding protein specific
for activin A, wherein the antigen binding protein inhibits the
binding of activin A to activin A receptor in vitro.
[0034] Also provided is a human antigen binding protein specific
for activin A, wherein the antigen binding protein inhibits the
binding of activin A to activin A receptor in vivo.
[0035] In another aspect, provided is an isolated polynucleotide
comprising a sequence that encodes the light chain, the heavy
chain, or both of an antigen binding protein of the invention; the
polynucleotide may comprise a light chain variable domain nucleic
acid sequence of SEQ ID NO:1, 17, 33, 49, 65, 81, 97, 113, 129,
145, 161, 177, 193 or 209 and/or a heavy chain variable domain
nucleic acid sequence of SEQ ID NO:2, 18, 34, 50, 66, 82, 98, 114,
130, 146, 162, 178, 194 or 210.
[0036] Also provided is a plasmid comprising the isolated
polynucleotide; the plasmid may be an expression vector; and an
isolated cell is provided that comprises the polynucleotide; the
isolated cell may be a hybridoma, and the cell may be a CHO
cell.
[0037] Further provided is a method of making an antigen binding
protein that binds human activin A, comprising incubating the
isolated cell under conditions that allow it to express said
antigen binding protein.
[0038] Also provided is a pharmaceutical composition comprising the
antigen binding protein of the invention, a method of treating a
condition in a subject comprising administering to the subject the
pharmaceutical composition, wherein the condition is treatable by
reducing the activity of activin A in said subject; the subject may
be a human being, and the condition may be cachexia associated with
a tumor, wherein the tumor is a gonadal tumor, such as ovarian
cancer, benign prostatic hyperplasia, prostate intraepithelial
neoplasia, or prostate cancer, or wherein the tumor is bladder
cancer, Wilm's tumor, pancreatic cancer, breast cancer, bone
cancer, lung cancer, colorectal cancer, cervical cancer, synovial
sarcoma, vasoactive intestinal peptide secreting tumors,
glioblastoma, medulloblastoma, head and neck squamous cell cancer,
oral cancer, oral leukoplakia, anal cancer, esophageal cancer,
gastric cancer, bone cancer, or metastatic cancer; the condition
may be cachexia associated with a rheumatoid arthritis; or the
condition may be the need for decreasing activin A activity in a
subject.
[0039] In another aspect, the present invention provides a method
of maintaining muscle mass of a subject comprising administering to
said subject said pharmaceutical composition.
[0040] In another aspect, the present invention provides a method
of decreasing activin A activity in a subject in need thereof
comprising administering to said subject said pharmaceutical
composition.
[0041] In another aspect, the present invention provides antibodies
that are able to specifically bind amino acids K13-Y39 of activin A
in vitro or in vivo. In another aspect, the present invention
provides antibodies that are able to specifically bind amino acids
V82-N107 in vitro or in vivo.
BRIEF DESCRIPTION OF THE DRAWINGS
[0042] FIG. 1 provides the muscle mass change for collagen induced
arthritis mice treated with anti-activin A antibody A1.
[0043] FIG. 2 provides the fat mass change for collagen induced
arthritis mice treated with anti-activin A antibody A1.
[0044] FIG. 3 provides data showing that anti-activin A treatment
using antibodies A1, A2 and A3 prevents body weight loss in young
adult nude mice with an intramuscular CHO/Activin xenograft.
[0045] FIG. 4 provides NMR data showing that anti-activin A
treatment prevents loss of lean body mass in young adult nude mice
with an intramuscular CHO/Activin xenograft.
[0046] FIG. 5 provides the effect of anti-activin A antibody A1 on
body weight changes in AAV-activin A transduced mice.
[0047] FIG. 6 provides the gastrocnemius muscle mass in a CDF1
mouse Colon-26 cancer cachexis model with and without treatment
with anti-activin A antibody A1, eighteen days after tumor
inoculation.
[0048] FIG. 7 shows a model of activin A, with the region of
antibody binding circled. K21, K103 and X94 refer to lysine
residues at position 21 and 103, and a tyrosine residue at position
94.
[0049] FIGS. 8A-C are graphs showing the binding affinities of
antibodies A1, A2 and A3 as determined using KinExA. The
dissociation equilibrium constant was obtained from non-linear
regression of the competition curves using a dual-curve one-site
homogeneous binding model using the KinExA software.
[0050] FIG. 9 shows epitope regions that were not protected from
degradation by binding of antibodies A1, A2 or A3.
[0051] FIG. 10 is a graph showing binding affinities of antibodies
A1, A2, and A3 for intact activin A (indicated by lot 55), as well
as activin A that is cleaved at the tyrosine residue at amino acid
position number 94 (indicated by lot 38).
[0052] FIGS. 11A-D are graphs showing binding affinities of
antibodies A1, A2, and A3, as well as two commercially available
antibodies for activin A or activin B on immobilized antibody
surfaces.
[0053] FIG. 12 shows antibody binding to activin A/activin B
chimeras by antibody A1 and A2, as well as two commercially
available activin A antibodies.
[0054] FIG. 13 shows the amino acid sequences of activin A/activin
B chimeras utilized in the antibody testing described in FIG.
11.
[0055] FIG. 14 shows binding of several antibodies, including A1,
A2, and A3, to different epitopes of activin A; two commercially
available activin A antibodies were also tested.
DETAILED DESCRIPTION
[0056] The present invention relates to regions of the human
activin A that contain cysteine knot domains recognized by
antibodies that also bind to full-length activin A, and/or a region
of activin A that overlaps or encompasses a cysteine knot region of
activin A, and methods of making and using these cysteine knot
domains. The invention also provides antigen binding agents,
including antibodies, that specifically bind to activin A or
portions of activin A, and methods for using such binding agents.
The binding agents are useful to block or impair binding of human
activin A to one or more ligand.
[0057] Mortality from congestive heart failure (CHF) is related to
cachexia. In one study (Anker, S. D. and Coats, A. J., Chest
115:836-847, 1999), sixteen percent of an unselected CHF outpatient
population was cachectic. This state was predictive of impaired
prognosis independent of age, functional disease classification,
left ventricular ejection fraction, and peak oxygen consumption.
The mortality in the cachectic cohort was fifty percent at eighteen
months.
[0058] One pathway common to the disease progression in cancer,
rheumatoid arthritis, chronic renal failure, congestive heart
failure, and other conditions in which cachexia is a factor is the
activin A pathway. Muscle wasting and weakness are common in many
disease states and conditions including aging, cancer cachexia,
sepsis, denervation, disuse, inactivity, burns, HIV-acquired
immunodeficiency syndrome (AIDS), chronic kidney or heart failure,
unloading/microgravity, and muscular dystrophies. Activins and
inhibins are members of the TGF-beta superfamily. Activins and
inhibins function as stimulators and inhibitors, respectively, of
pituitary follicle-stimulating hormone (FSH) secretion and
biosynthesis. Activin A is the predominant form of activin. In
reproductive biology, activins and inhibins are important
regulators of the ovarian cycle and the ovulation process, and may
play a role in embryo implantation, and/or maintenance of
pregnancy. (O'Connor et al., Human Reproduction, V. 14, No. 3,
827-832, March 1999; Draper et al., Endocrin., V. 138, No. 7:
3042-3046; Jones, et al., Endocrin. V. 147, No. 2: 724-732,
February 2006). The identification of inhibins and activins in a
wide variety of tissues suggests that these factors play much
greater roles than the control of FSH secretion.
[0059] Activins interact with two structurally related classes of
serine/threonine kinase receptors (type I and type II). Inhibin
antagonizes activin by binding to the proteoglycan, betaglycan, and
forming a stable complex with and thereby sequestering type II
activin receptors while excluding type I receptors. Two major forms
of activin exist: activin A is a homodimer of .beta..sub.A-subunits
and activin B is a homodimer of .beta..sub.B-subunits. (Vale, et
al., Recent Prog Horm Res V. 44: 1-34, 1988). Heterodimers of an
.alpha.-subunit that is dissimilar to either .beta.-subunit results
in the functional antagonist inhibin.
[0060] The literature has shown that activin A is overexpressed
and/or localized in cancer tissues. For example, high levels of
serum activin A were found in women with endometrial and cervical
carcinoma (Petraglia, F. et al., Jour. Clin. Endocrin. Metab.
83:1194-1200, 1998). Activin A was overexpressed in stage IV
colorectal cancer (Wildi, S. et al., Gut 49:409-417, 2001). A role
of activin A in ovarian cancer was reported (Steller, M. D. et al.,
Mol. Cancer Res. 3:50-61, 2005).
[0061] The literature has also implicated activin A in renal
disease. (Yamashita, S. et al. J. Am. Soc. Nephrol. 15:91-101,
2004.) Serum immunoreactive activin A levels in normal subjects and
patients with disease were reported by Harada, K. et al. in J.
Clin. Endocrin. and Metab. 81:2125-2130, 1996. Activin A is a
potent activator of renal interstitial fibroblasts (Harada, K. et
al., J. Am. Soc. Nephrol. 15:91-101, 2004). Glomerular activin A
overexpression is linked to fibrosis in anti-Thy 1
glomerulonephritis (Gaedeke, J. et al., Neph. Dial. Transpl.
20:319-328, 2005).
[0062] Serum activin A levels in heart failure patients increased
according to disease severity (Yndestal et al., Circulation
109:1379-1385, 2004). In a rat model of heart failure, serum
activin A elevated immediately after myocardial infarct and
persisted for six months, and activin A immunostaining was
localized solely to cardiomyocytes (Yndestad et al., 2004).
Elevated levels of activin A were reported in heart failure
(Yndestad, A. et al., Circulation 109:1379-1385, 2004).
[0063] The present invention provides compositions, kits, and
methods relating to molecules that bind to the activin A, including
molecules that agonize or antagonize activin A, such as
anti-activin A antibodies, antibody fragments, and antibody
derivatives, e.g., antagonistic anti-activin A antibodies, antibody
fragments, or antibody derivatives. Also provided are compositions,
kits, and methods relating to molecules that specifically bind to a
portion of activin A, such as amino acids R13-Y39, or amino acids
V82-N107 of activin A. Such molecules may include antibodies,
antibody fragments, and antibody derivatives. Also provided are
nucleic acids, and derivatives and fragments thereof, comprising a
sequence of nucleotides that encodes all or a portion of a
polypeptide that binds to activin A, e.g., a nucleic acid encoding
all or part of an anti-activin A antibody, antibody fragment,
antibody variant, or antibody derivative, plasmids and vectors
comprising such nucleic acids, and cells or cell lines comprising
such nucleic acids and/or vectors and plasmids. The provided
methods include, for example, methods of making, identifying, or
isolating molecules that bind to activin A, such as anti-activin A
antibodies, methods of determining whether a molecule binds to
activin A, methods of making compositions, such as pharmaceutical
compositions, comprising a molecule that binds to activin A, and
methods for administering a molecule that binds activin A to a
subject, for example, methods for treating a condition mediated by
activin A, and for modulating a biological activity of activin A in
vivo or in vitro.
[0064] Polynucleotide and polypeptide sequences are indicated using
standard one- or three-letter abbreviations. Unless otherwise
indicated, polypeptide sequences have their amino termini at the
left and their carboxy termini at the right, and single-stranded
nucleic acid sequences, and the top strand of double-stranded
nucleic acid sequences, have their 5' termini at the left and their
3' termini at the right. A particular polypeptide or polynucleotide
sequence also can be described by explaining how it differs from a
reference sequence. Unless otherwise indicated, it is understood
that polynucleotide and polypeptide sequences include each nucleic
acid or amino acid listed, respectively, as well as the intervening
nucleic acids or amino acids. For example, the polypeptide sequence
R13-Y39 sets forth a polypeptide sequence that includes the amino
acids R13, and Y39, as well as the amino acids found between R13
and Y39 in the polypeptide sequence. Correspondingly, the
polynucleotide sequence C1-T5 sets forth a polynucleotide sequence
that includes nucleic acids C1, and T5, as well as nucleic acids at
positions 2, 3, and 4 of the sequence. Accordingly, designations of
SEQ ID NO: 1-5 likewise designates the inclusive group of SEQ ID
NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, and SEQ ID NO: 5.
Finally, amino acid groupings are also intended to be inclusive,
unless otherwise designated. For example, the phrase "amino acids
1-5 of SEQ ID NO: 28" includes amino acids at positions 1, 2, 3, 4,
and 5 of SEQ ID NO: 28.
[0065] Polynucleotide and polypeptide sequences of particular light
and heavy chain variable domains are shown below. Antibodies
comprising a light chain and heavy chain are designated by
combining the name of the light chain and the name of the heavy
chain variable domains. For example, "L4H7," indicates an antibody
comprising the light chain variable domain of L4 and the heavy
chain variable domain of H7.
[0066] Kappa light chain constant sequences are shown in SEQ ID
NO:84, 100 and 108, and heavy chain constant sequence are shown in
SEQ ID NO:214, 215 and 221. Polynucleotides encoding these
sequences are shown in, for the light chains, respectively, SEQ ID
NO:222, 223 and 239, and for the heavy chains, respectively, SEQ ID
NO:240, 241, and 242. Thus, in addition to the variable sequences
as disclosed herein, an antibody can comprise one or both of SEQ ID
NO:84 and 214; or SEQ ID NO:215 and 223; or SEQ ID NO:108 and
221.
[0067] In other embodiments, an antibody may comprise a specific
heavy or light chain, while the complementary light or heavy chain
variable domain remains unspecified. In particular, certain
embodiments herein include antibodies that bind a specific antigen
(such as activin A) by way of a specific light or heavy chain, such
that the complementary heavy or light chain may be promiscuous, or
even irrelevant, but may be determined by, for example, screening
combinatorial libraries. Portolano et al., J. Immunol. V. 150 (3),
pp. 880-887 (1993); Clackson et al., Nature v. 352 pp. 624-628
(1991).
[0068] Unless otherwise defined herein, scientific and technical
terms used in connection with the present invention shall have the
meanings that are commonly understood by those of ordinary skill in
the art. Further, unless otherwise required by context, singular
terms shall include pluralities and plural terms shall include the
singular. Generally, nomenclatures used in connection with, and
techniques of, cell and tissue culture, molecular biology,
immunology, microbiology, genetics and protein and nucleic acid
chemistry and hybridization described herein are those well known
and commonly used in the art. The methods and techniques of the
present invention are generally performed according to conventional
methods well known in the art and as described in various general
and more specific references that are cited and discussed
throughout the present specification unless otherwise indicated.
See, e.g., Sambrook et al. Molecular Cloning: A Laboratory Manual,
2d ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor,
N.Y. (1989) and Ausubel et al., Current Protocols in Molecular
Biology, Greene Publishing Associates (1992), and Harlow and Lane
Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y. (1990), which are incorporated
herein by reference. Enzymatic reactions and purification
techniques are performed according to manufacturer's
specifications, as commonly accomplished in the art or as described
herein. The terminology used in connection with, and the laboratory
procedures and techniques of, analytical chemistry, synthetic
organic chemistry, and medicinal and pharmaceutical chemistry
described herein are those well known and commonly used in the art.
Standard techniques can be used for chemical syntheses, chemical
analyses, pharmaceutical preparation, formulation, and delivery,
and treatment of patients.
[0069] The following terms, unless otherwise indicated, shall be
understood to have the following meanings:
[0070] The term "isolated molecule" (where the molecule is, for
example, a polypeptide, a polynucleotide, or an antibody) is a
molecule that by virtue of its origin or source of derivation (1)
is not associated with naturally associated components that
accompany it in its native state, (2) is substantially free of
other molecules from the same species (3) is expressed by a cell
from a different species, or (4) does not occur in nature. Thus, a
molecule that is chemically synthesized, or synthesized in a
cellular system different from the cell from which it naturally
originates, will be "isolated" from its naturally associated
components. A molecule also may be rendered substantially free of
naturally associated components by isolation, using purification
techniques well known in the art. Molecule purity or homogeneity
may be assayed by a number of means well known in the art. For
example, the purity of a polypeptide sample may be assayed using
polyacrylamide gel electrophoresis and staining of the gel to
visualize the polypeptide using techniques well known in the art.
For certain purposes, higher resolution may be provided by using
HPLC or other means well known in the art for purification.
[0071] The terms "activin A inhibitor" and "activin A antagonist"
are used interchangeably. Each is a molecule that detectably
inhibits at least one function of activin A. Conversely, an
"activin A agonist" is a molecule that detectably increases at
least one function of activin A. The inhibition caused by an
activin A inhibitor need not be complete so long as it is
detectable using an assay. Any assay of a function of activin A can
be used, examples of which are provided herein. Examples of
functions of activin A that can be inhibited by an activin A
inhibitor, or increased by an activin A agonist, include binding to
activin A. Examples of types of activin A inhibitors and activin A
agonists include, but are not limited to, activin A binding
polypeptides such as antigen binding proteins (e.g., activin A
inhibiting antiben binding proteins), antibodies, antibody
fragments, and antibody derivatives.
[0072] The terms "peptide," "polypeptide" and "protein" each refers
to a molecule comprising two or more amino acid residues joined to
each other by peptide bonds. These terms encompass, e.g., native
and artificial proteins, protein fragments and polypeptide analogs
(such as muteins, variants, and fusion proteins) of a protein
sequence as well as post-translationally, or otherwise covalently
or non-covalently, modified proteins. A peptide, polypeptide, or
protein may be monomeric or polymeric.
[0073] The term "polypeptide fragment" as used herein refers to a
polypeptide that has an amino-terminal and/or carboxy-terminal
deletion as compared to a corresponding full-length protein.
Fragments can be, for example, at least 5, 6, 7, 8, 9, 10, 11, 12,
13, 14, 15, 20, 50, 70, 80, 90, 100, 150 or 200 amino acids in
length. Fragments can also be, for example, at most 1,000, 750,
500, 250, 200, 175, 150, 125, 100, 90, 80, 70, 60, 50, 40, 30, 20,
15, 14, 13, 12, 11, or 10 amino acids in length. A fragment can
further comprise, at either or both of its ends, one or more
additional amino acids, for example, a sequence of amino acids from
a different naturally-occurring protein (e.g., an Fc or leucine
zipper domain) or an artificial amino acid sequence (e.g., an
artificial linker sequence).
[0074] Polypeptides of the invention include polypeptides that have
been modified in any way and for any reason, for example, to: (1)
reduce susceptibility to proteolysis, (2) reduce susceptibility to
oxidation, (3) alter binding affinity for forming protein
complexes, (4) alter binding affinities, and (4) confer or modify
other physicochemical or functional properties. Analogs include
muteins of a polypeptide. For example, single or multiple amino
acid substitutions (e.g., conservative amino acid substitutions)
may be made in the naturally occurring sequence (e.g., in the
portion of the polypeptide outside the domain(s) forming
intermolecular contacts). A "conservative amino acid substitution"
is one that does not substantially change the structural
characteristics of the parent sequence (e.g., a replacement amino
acid should not tend to break a helix that occurs in the parent
sequence, or disrupt other types of secondary structure that
characterize the parent sequence or are necessary for its
functionality). Examples of art-recognized polypeptide secondary
and tertiary structures are described in Proteins, Structures and
Molecular Principles (Creighton, Ed., W. H. Freeman and Company,
New York (1984)); Introduction to Protein Structure (C. Branden and
J. Tooze, eds., Garland Publishing, New York, N.Y. (1991)); and
Thornton et al. Nature 354:105 (1991), which are each incorporated
herein by reference.
[0075] A "variant" of a polypeptide (e.g., an antibody) comprises
an amino acid sequence wherein one or more amino acid residues are
inserted into, deleted from and/or substituted into the amino acid
sequence relative to the native polypeptide sequence, and retains
essentially the same biological activity as the native polypeptide.
The biological activity of the polypeptide can be measured using
standard techniques in the art (for example, if the variant is an
antibody, its activity may be tested by binding assays, as
described herein). Variants of the invention include fragments,
analogs, recombinant polypeptides, synthetic polypeptides, and/or
fusion proteins. A "derivative" of a polypeptide is a polypeptide
(e.g., an antibody) that has been chemically modified, e.g., via
conjugation to another chemical moiety such as, for example,
polyethylene glycol, albumin (e.g., human serum albumin),
phosphorylation, and glycosylation. Unless otherwise indicated, the
term "antibody" includes, in addition to antibodies comprising two
full-length heavy chains and two full-length light chains,
derivatives, variants, fragments, and muteins thereof, examples of
which are described below.
[0076] An "antigen binding protein" is a protein comprising a
portion that binds to an antigen and, optionally, a scaffold or
framework portion that allows the antigen binding portion to adopt
a conformation that promotes binding of the antigen binding protein
to the antigen. Examples of antigen binding proteins include
antibodies, antibody fragments (e.g., an antigen binding portion of
an antibody), antibody derivatives, and antibody analogs. The
antigen binding protein can comprise, for example, an alternative
protein scaffold or artificial scaffold with grafted CDRs or CDR
derivatives. Such scaffolds include, but are not limited to,
antibody-derived scaffolds comprising mutations introduced to, for
example, stabilize the three-dimensional structure of the antigen
binding protein as well as wholly synthetic scaffolds comprising,
for example, a biocompatible polymer. See, for example, Korndorfer
et al., 2003, Proteins: Structure, Function, and Bioinformatics,
Volume 53, Issue 1:121-129; Roque et al., 2004, Biotechnol. Prog.
20:639-654. In addition, peptide antibody mimetics ("PAMs") can be
used, as well as scaffolds based on antibody mimetics utilizing
fibronection components as a scaffold.
[0077] An antigen binding protein can have, for example, the
structure of a naturally occurring immunoglobulin. An
"immunoglobulin" is a tetrameric molecule. In a naturally occurring
immunoglobulin, each tetramer is composed of two identical pairs of
polypeptide chains, each pair having one "light" (about 25 kDa) and
one "heavy" chain (about 50-70 kDa). The amino-terminal portion of
each chain includes a variable region of about 100 to 110 or more
amino acids primarily responsible for antigen recognition. The
carboxy-terminal portion of each chain defines a constant region
primarily responsible for effector function. Human light chains are
classified as kappa and lambda light chains. Heavy chains are
classified as mu, delta, gamma, alpha, or epsilon, and define the
antibody's isotype as IgM, IgD, IgG, IgA, and IgE, respectively.
Within light and heavy chains, the variable and constant regions
are joined by a "J" region of about 12 or more amino acids, with
the heavy chain also including a "D" region of about 10 more amino
acids. See generally, Fundamental Immunology Ch. 7 (Paul, W., ed.,
2nd ed. Raven Press, N.Y. (1989)) (incorporated by reference in its
entirety for all purposes). The variable regions of each
light/heavy chain pair form the antibody binding site such that an
intact immunoglobulin has two binding sites.
[0078] Naturally occurring immunoglobulin chains exhibit the same
general structure of relatively conserved framework regions (FR)
joined by three hypervariable regions, also called complementarity
determining regions or CDRs. From N-terminus to C-terminus, both
light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2,
FR3, CDR3 and FR4. The assignment of amino acids to each domain is
in accordance with the definitions of Kabat et al. in Sequences of
Proteins of Immunological Interest, 5.sup.th Ed., US Dept. of
Health and Human Services, PHS, NIH, NIH Publication no. 91-3242,
1991.
[0079] An "antibody" refers to an intact immunoglobulin or to an
antigen binding portion thereof that competes with the intact
antibody for specific binding, unless otherwise specified. Antigen
binding portions may be produced by recombinant DNA techniques or
by enzymatic or chemical cleavage of intact antibodies. Antigen
binding portions include, inter alia, Fab, Fab', F(ab').sub.2, Fv,
domain antibodies (dAbs), and complementarity determining region
(CDR) fragments, single-chain antibodies (scFv), chimeric
antibodies, diabodies, triabodies, tetrabodies, and polypeptides
that contain at least a portion of an immunoglobulin that is
sufficient to confer specific antigen binding to the
polypeptide.
[0080] A Fab fragment is a monovalent fragment having the V.sub.L,
V.sub.H, C.sub.L and C.sub.H1 domains; a F(ab').sub.2 fragment is a
bivalent fragment having two Fab fragments linked by a disulfide
bridge at the hinge region; a Fd fragment has the V.sub.H and
C.sub.H1 domains; an Fv fragment has the V.sub.L and V.sub.H
domains of a single arm of an antibody; and a dAb fragment has a
V.sub.H domain, a V.sub.L domain, or an antigen-binding fragment of
a V.sub.H or V.sub.L domain (U.S. Pat. Nos. 6,846,634, 6,696,245,
US App. Pub. No. 05/0202512, 04/0202995, 04/0038291, 04/0009507,
03/0039958, Ward et al., Nature 341:544-546, 1989).
[0081] A single-chain antibody (scFv) is an antibody in which a
V.sub.L and a V.sub.H region are joined via a linker (e.g., a
synthetic sequence of amino acid residues) to form a continuous
protein chain wherein the linker is long enough to allow the
protein chain to fold back on itself and form a monovalent antigen
binding site (see, e.g., Bird et al., 1988, Science 242:423-26 and
Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-83).
Diabodies are bivalent antibodies comprising two polypeptide
chains, wherein each polypeptide chain comprises V.sub.H and
V.sub.L domains joined by a linker that is too short to allow for
pairing between two domains on the same chain, thus allowing each
domain to pair with a complementary domain on another polypeptide
chain (see, e.g., Holliger et al., 1993, Proc. Natl. Acad. Sci. USA
90:6444-48, and Poljak et al., 1994, Structure 2:1121-23). If the
two polypeptide chains of a diabody are identical, then a diabody
resulting from their pairing will have two identical antigen
binding sites. Polypeptide chains having different sequences can be
used to make a diabody with two different antigen binding sites.
Similarly, tribodies and tetrabodies are antibodies comprising
three and four polypeptide chains, respectively, and forming three
and four antigen binding sites, respectively, which can be the same
or different.
[0082] Complementarity determining regions (CDRs) and framework
regions (FR) of a given antibody may be identified using the system
described by Kabat et al. in Sequences of Proteins of Immunological
Interest, 5th Ed., US Dept. of Health and Human Services, PHS, NIH,
NIH Publication no. 91-3242, 1991. One or more CDRs may be
incorporated into a molecule either covalently or noncovalently to
make it an antigen binding protein. An antigen binding protein may
incorporate the CDR(s) as part of a larger polypeptide chain, may
covalently link the CDR(s) to another polypeptide chain, or may
incorporate the CDR(s) noncovalently. The CDRs permit the antigen
binding protein to specifically bind to a particular antigen of
interest.
[0083] An antigen binding protein may have one or more binding
sites. If there is more than one binding site, the binding sites
may be identical to one another or may be different. For example, a
naturally occurring human immunoglobulin typically has two
identical binding sites, while a "bispecific" or "bifunctional"
antibody has two different binding sites.
[0084] The term "human antibody," also referred to as "fully human
antibody," includes all antibodies that have one or more variable
and constant regions derived from human immunoglobulin sequences.
In one embodiment, all of the variable and constant domains are
derived from human immunoglobulin sequences (a fully human
antibody). These antibodies may be prepared in a variety of ways,
examples of which are described below, including through the
immunization with an antigen of interest of a mouse that is
genetically modified to express antibodies derived from human heavy
and/or light chain-encoding genes.
[0085] A humanized antibody has a sequence that differs from the
sequence of an antibody derived from a non-human species by one or
more amino acid substitutions, deletions, and/or additions, such
that the humanized antibody is less likely to induce an immune
response, and/or induces a less severe immune response, as compared
to the non-human species antibody, when it is administered to a
human subject. In one embodiment, certain amino acids in the
framework and constant domains of the heavy and/or light chains of
the non-human species antibody are mutated to produce the humanized
antibody. In another embodiment, the constant domain(s) from a
human antibody are fused to the variable domain(s) of a non-human
species. In another embodiment, one or more amino acid residues in
one or more CDR sequences of a non-human antibody are changed to
reduce the likely immunogenicity of the non-human antibody when it
is administered to a human subject, wherein the changed amino acid
residues either are not critical for immunospecific binding of the
antibody to its antigen, or the changes to the amino acid sequence
that are made are conservative changes, such that the binding of
the humanized antibody to the antigen is not significantly worse
than the binding of the non-human antibody to the antigen. Examples
of how to make humanized antibodies may be found in U.S. Pat. Nos.
6,054,297, 5,886,152 and 5,877,293.
[0086] The term "chimeric antibody" refers to an antibody that
contains one or more regions from one antibody and one or more
regions from one or more other antibodies. In one embodiment, one
or more of the CDRs are derived from a human anti-activin A
antibody. In another embodiment, all of the CDRs are derived from a
human anti-activin A antibody. In another embodiment, the CDRs from
more than one human anti-activin A antibodies are mixed and matched
in a chimeric antibody. For instance, a chimeric antibody may
comprise a CDR1 from the light chain of a first human anti-activin
A antibody, a CDR2 and a CDR3 from the light chain of a second
human anti-activin A antibody, and the CDRs from the heavy chain
from a third anti-activin A antibody. Further, the framework
regions may be derived from one of the same anti-activin A
antibodies, from one or more different antibodies, such as a human
antibody, or from a humanized antibody. In one example of a
chimeric antibody, a portion of the heavy and/or light chain is
identical with, homologous to, or derived from an antibody from a
particular species or belonging to a particular antibody class or
subclass, while the remainder of the chain(s) is/are identical
with, homologous to, or derived from an antibody (-ies) from
another species or belonging to another antibody class or subclass.
Also included are fragments of such antibodies that exhibit the
desired biological activity (i.e., the ability to specifically bind
activin A).
[0087] Fragments or analogs of antibodies can be readily prepared
by those of ordinary skill in the art following the teachings of
this specification and using techniques well-known in the art.
Preferred amino- and carboxy-termini of fragments or analogs occur
near boundaries of functional domains. Structural and functional
domains can be identified by comparison of the nucleotide and/or
amino acid sequence data to public or proprietary sequence
databases. Computerized comparison methods can be used to identify
sequence motifs or predicted protein conformation domains that
occur in other proteins of known structure and/or function. Methods
to identify protein sequences that fold into a known
three-dimensional structure are known. See, e.g., Bowie et al.,
1991, Science 253:164.
[0088] Additionally, antigen specific (i.e., activin A specific)
antibodies can be produced by methods known in the art by using a
specific VL or VH domain to screen a library of the complementary
variable domain. Such methods of producing antibodies are known in
the art. For example, antibody fragments fused to another protein,
such as a minor coat protein, can be used to enrich phage with
antigen. Then, using a random combinatorial library of rearranged
heavy (VH) and light (VL) chains from mice immune to the antigen
(e.g., activin A), diverse libraries of antibody fragments are
displayed on the surface of the phage. These libraries can be
screened for complementary variable domains, and the domains
purified by, for example, affinity column. See Clackson et al.,
Nature, V. 352 pp. 624-628 (1991).
[0089] In another example, individual VL or VH chains from an
antibody (i.e., activin A antibody) can be used to search for other
VH or VL chains that could form antigen-binding fragments (or Fab),
with the same specificity. Thus, random combinations of VH and VL
chain Ig genes can be expresses as antigen-binding fragments in a
bacteriophage library (such as fd or lambda phage). For instance, a
combinatorial library may be generated by utilizing the parent VL
or VH chain library combined with antigen-binding specific VL or VH
chain libraries, respectively. The combinatorial libraries may then
be screened by conventional techniques, for example by using
radioactively labeled probe (such as radioactively labeled activin
A). See, for example, Portolano et al., J. Immunol. V. 150 (3) pp.
880-887 (1993).
[0090] A "CDR grafted antibody" is an antibody comprising one or
more CDRs derived from an antibody of a particular species or
isotype and the framework of another antibody of the same or
different species or isotype.
[0091] A "multi-specific antibody" is an antibody that recognizes
more than one epitope on one or more antigens. A subclass of this
type of antibody is a "bi-specific antibody" which recognizes two
distinct epitopes on the same or different antigens.
[0092] An "antigen binding domain," "antigen binding region," or
"antigen binding site" is a portion of an antigen binding protein
that contains amino acid residues (or other moieties) that interact
with an antigen and contribute to the antigen binding protein's
specificity and affinity for the antigen. For an antibody that
specifically binds to its antigen, this will include at least part
of at least one of its CDR domains.
[0093] An "epitope" is the portion of a molecule that is bound by
an antigen binding protein (e.g., by an antibody). An epitope can
comprise non-contiguous portions of the molecule (e.g., in a
polypeptide, amino acid residues that are not contiguous in the
polypeptide's primary sequence but that, in the context of the
polypeptide's tertiary and quaternary structure, are near enough to
each other to be bound by an antigen binding protein), and includes
the end sequence amino acids listed. For example the polypeptide
sequence R13-Y39 includes amino acids R13, and Y39, as well as the
amino acids found between R13 and Y39 in the sequence. In
embodiments in which the epitope comprises non-contiguous portions
of a molecule, the sequences will be noted accordingly.
[0094] The "percent identity" of two polynucleotide or two
polypeptide sequences is determined by comparing the sequences
using the GAP computer program (a part of the GCG Wisconsin
Package, version 10.3 (Accelrys, San Diego, Calif.)) using its
default parameters.
[0095] The terms "polynucleotide," "oligonucleotide" and "nucleic
acid" are used interchangeably throughout and include DNA molecules
(e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of
the DNA or RNA generated using nucleotide analogs (e.g., peptide
nucleic acids and non-naturally occurring nucleotide analogs), and
hybrids thereof. The nucleic acid molecule can be single-stranded
or double-stranded. In one embodiment, the nucleic acid molecules
of the invention comprise a contiguous open reading frame encoding
an antibody, or a fragment, derivative, mutein, or variant thereof,
of the invention.
[0096] Two single-stranded polynucleotides are "the complement" of
each other if their sequences can be aligned in an anti-parallel
orientation such that every nucleotide in one polynucleotide is
opposite its complementary nucleotide in the other polynucleotide,
without the introduction of gaps, and without unpaired nucleotides
at the 5' or the 3' end of either sequence. A polynucleotide is
"complementary" to another polynucleotide if the two
polynucleotides can hybridize to one another under moderately
stringent conditions. Thus, a polynucleotide can be complementary
to another polynucleotide without being its complement.
[0097] A "vector" is a nucleic acid that can be used to introduce
another nucleic acid linked to it into a cell. One type of vector
is a "plasmid," which refers to a linear or circular double
stranded DNA molecule into which additional nucleic acid segments
can be ligated. Another type of vector is a viral vector (e.g.,
replication defective retroviruses, adenoviruses and
adeno-associated viruses), wherein additional DNA segments can be
introduced into the viral genome. Certain vectors are capable of
autonomous replication in a host cell into which they are
introduced (e.g., bacterial vectors comprising a bacterial origin
of replication and episomal mammalian vectors). Other vectors
(e.g., non-episomal mammalian vectors) are integrated into the
genome of a host cell upon introduction into the host cell, and
thereby are replicated along with the host genome. An "expression
vector" is a type of vector that can direct the expression of a
chosen polynucleotide.
[0098] A nucleotide sequence is "operably linked" to a regulatory
sequence if the regulatory sequence affects the expression (e.g.,
the level, timing, or location of expression) of the nucleotide
sequence. A "regulatory sequence" is a nucleic acid that affects
the expression (e.g., the level, timing, or location of expression)
of a nucleic acid to which it is operably linked. The regulatory
sequence can, for example, exert its effects directly on the
regulated nucleic acid, or through the action of one or more other
molecules (e.g., polypeptides that bind to the regulatory sequence
and/or the nucleic acid). Examples of regulatory sequences include
promoters, enhancers and other expression control elements (e.g.,
polyadenylation signals). Further examples of regulatory sequences
are described in, for example, Goeddel, 1990, Gene Expression
Technology: Methods in Enzymology 185, Academic Press, San Diego,
Calif. and Baron et al., 1995, Nucleic Acids Res. 23:3605-06.
[0099] A "host cell" is a cell that can be used to express a
nucleic acid, e.g., a nucleic acid of the invention. A host cell
can be a prokaryote, for example, E. coli, or it can be a
eukaryote, for example, a single-celled eukaryote (e.g., a yeast or
other fungus), a plant cell (e.g., a tobacco or tomato plant cell),
an animal cell (e.g., a human cell, a monkey cell, a hamster cell,
a rat cell, a mouse cell, or an insect cell) or a hybridoma.
Example 3 herein described the use of CS-9 cells. Examples of other
host cells include the COS-7 line of monkey kidney cells (ATCC CRL
1651) (see Gluzman et al., 1981, Cell 23:175), L cells, C127 cells,
3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells or
their derivatives such as Veggie CHO and related cell lines which
grow in serum-free media (see Rasmussen et al., 1998,
Cytotechnology 28:31), HeLa cells, BHK (ATCC CRL 10) cell lines,
the CV1/EBNA cell line derived from the African green monkey kidney
cell line CV1 (ATCC CCL 70) (see McMahan et al., 1991, EMBO J.
10:2821), human embryonic kidney cells such as 293, 293 EBNA or MSR
293, human epidermal A431 cells, human Colo205 cells, other
transformed primate cell lines, normal diploid cells, cell strains
derived from in vitro culture of primary tissue, primary explants,
HL-60, U937, HaK or Jurkat cells. Typically, a host cell is a
cultured cell that can be transformed or transfected with a
polypeptide-encoding nucleic acid, which can then be expressed in
the host cell. The phrase "recombinant host cell" can be used to
denote a host cell that has been transformed or transfected with a
nucleic acid to be expressed. A host cell also can be a cell that
comprises the nucleic acid but does not express it at a desired
level unless a regulatory sequence is introduced into the host cell
such that it becomes operably linked with the nucleic acid. It is
understood that the term host cell refers not only to the
particular subject cell but to the progeny or potential progeny of
such a cell. Because certain modifications may occur in succeeding
generations due to, e.g., mutation or environmental influence, such
progeny may not, in fact, be identical to the parent cell, but are
still included within the scope of the term as used herein.
Antigen Binding Proteins
[0100] In one aspect, the present invention provides antigen
binding proteins (e.g., antibodies, antibody fragments, antibody
derivatives, antibody muteins, and antibody variants), that bind to
activin A, e.g., human activin A.
[0101] Antigen binding proteins in accordance with the present
invention include antigen binding proteins that inhibit a
biological activity of activin A. For example, antigen binding
proteins may attenuate cachexia, and this activity can be present
when the antigen binding protein is fully human, such as a fully
human antibody.
[0102] Different antigen binding proteins may bind to different
domains or cysteine knot domains of activin A or act by different
mechanisms of action. Examples include but are not limited to
antigen binding proteins that specifically bind one or more
particular cysteine knot domains, or regions interspersed between
disulfide bonds, including regions spanning from about amino acids
4-12, amino acids 11-81, amino acids 11-33, amino acids 13-39,
amino acids 40-113, amino acids 44-115, amino acids 81-111, and/or
amino acids 82-107 of SEQ ID NO:1. As indicated herein inter alia,
the domain region are designated such as to be inclusive of the
group, unless otherwise indicated. For example, amino acids 4-12
refers to nine amino acids: amino acids at positions 4, and 12, as
well as the seven intervening amino acids in the sequence. Other
examples include antigen binding proteins that inhibit binding of
activin A to its receptor. An antigen binding protein need not
completely inhibit an activin A-induced activity to find use in the
present invention; rather, antigen binding proteins that reduce a
particular activity of activin A are contemplated for use as well.
(Discussions herein of particular mechanisms of action for activin
A-binding antigen binding proteins in treating particular diseases
are illustrative only, and the methods presented herein are not
bound thereby.)
[0103] In another aspect, the present invention provides antigen
binding proteins that comprise a light chain variable region
selected from the group consisting of A1-A14 or a heavy chain
variable region selected from the group consisting of A1-A14, and
fragments, derivatives, muteins, and variants thereof. Such an
antigen binding protein can be denoted using the nomenclature
"LxHy", wherein "x" corresponds to the number of the light chain
variable region and "y" corresponds to the number of the heavy
chain variable region as they are labeled in the sequences below.
That is to say, for example, that "A1HC" denotes the heavy chain
variable region of antibody A1; "A1LC" denotes the light chain
variable region of antibody A1, and so forth. More generally
speaking, "L2H1" refers to an antigen binding protein with a light
chain variable region comprising the amino acid sequence of L2 and
a heavy chain variable region comprising the amino acid sequence of
H1. For clarity, all ranges denoted by at least two members of a
group include all members of the group between and including the
end range members. Thus, the group range A1-A14, includes all
members between A1 and A14, as well as members A1 and A14
themselves. The group range A4-A6 includes members A4, A5, and A6,
etc.
[0104] Also shown below are the locations of the CDRs, or
Complementarity Determining Regions (shaded and underlined) that
create part of the antigen-binding site, while the Framework
Regions (FRs) are the intervening segments of these variable domain
sequences. In both light chain variable regions and heavy chain
variable regions there are three CDRs (CDR 1-3) and four FRs (FR
1-4). The CDR regions of each light and heavy chain also are
grouped by antibody type (A1, A2, A3, etc.). Antigen binding
proteins of the invention include, for example, antigen binding
proteins having a combination of light chain and heavy chain
variable domains selected from the group of combinations consisting
of L1H1 (antibody A1), L2H2 (antibody A2), L3H3 (antibody A3), L4H4
(antibody A4), L5H5 (antibody A5), L6H6 (antibody A6), L7H7
(antibody A7), L8H8 (antibody A8), L9H9 (antibody A9), L10H10
(antibody A10), L11H11 (antibody A11), L12H12 (antibody A12),
L13H13 (antibody A13), and L14H14 (antibody A14).
TABLE-US-00001 Antibodies A1-A14 heavy and light chain variable
region polynucleotides (also referred to herein as H1-H14 and
L1-L14). A1 HC (SEQ ID NO: 2)
CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAA
GGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGTTATGGTCTCAGCTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCATCCCTTACAATGGTA
ACACAAACTCTGCACAGAAACTCCAGGGCAGAGTCACCATGACCACAGACACATCC
ACGAGCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTA
TTTCTGTGCGAGAGACAGGGACTACGGTGTCAATTATGATGCTTTTGATATCTGGGG
CCAAGGGACAATGGTCACCGTCTCTTCA A1 LC (SEQ ID NO: 1)
TCCTATGAGGTGACTCAGGCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGC
ATCACCTGCTCTGGAGATAAATTGGGGGATAAATATGCTTGTTGGTATCAGCAGAAG
CCAGGCCAGTCCCCTGTGCTGGTCATCTATCAAGATAGCAAGCGGCCCTCAGGGATC
CCTGAGCGATTCTCTGGCTCCAACTCTGGAAACACAGCCACTCTGACCATCAGCGGG
ACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACTGC
GGTATTCGGCGGAGGGACCAAGCTGACCGTCCTA A2 HC (SEQ ID NO: 18)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAG
ACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGTTACGGCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTA
ATAAATACCATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCC
AAGAACACGCTGTATCTGCAAGTGAACAGCCTGAGAGCCGAGGACACGGCTGTGTA
TTACTGTGTGAGAAGTCGGAACTGGAACTACGACAACTACTACTACGGTCTGGACGT
CTGGGGCCAAGGGACCACGGTCACCGTCTCCTCAG A2 LC (SEQ ID NO: 17)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATAATTTAGGCTGGTATCAGCA
GAAACCAGGGAAAGCCCCTAAGCGCCTGATTTATGCTGCATCCAGTTTGCAAAGTG
GGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCA
GCAGTCTGCAGCCTGAAGATTTTACAACTTATTACTGTCTACAGCATAATAGTTACC
CGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA A3 HC (SEQ ID NO: 34)
GAGGTGCAGTTGGTGGAGTCTGGGGGAGGCTTGGTCCAGCCTGGGGGGTCCCTGAG
ACTCTCCTGTGCAGCCTCTGGATTCACCTTTAGTAGTTATTGGATGAGCTGGGTCCGC
CAGGCTCCAGGGAAGGGGCTGGAGTGCGTGGCCAACATAAAGCAAGATGGAAGTG
AGGAATACTATGTGGACTCTGTGAAGGGCCGATTCACCATCTCCAGAGACAACGCC
AAGAATTCACTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTA
TTACTGTGCGAGAGGTAGCAGCAGCTGGTACTACTACAACTACGGTATGGACGTCTG
GGGCCAAGGGACCACGGTCACCGTCTCCTCA A3 LC (SEQ ID NO: 33)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCA
GAAACCAGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTG
GGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCA
GCAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCGACAGCAAAATACTTACC
CGCTCACTTTCGGCGGAGGGACCAAGGTGGAGATCAAA A4 HC (SEQ ID NO: 50)
CAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAA
GGTCTCCTGCAAGGCTTCTGGATACACCTTCACCGGCTACTATATCCACTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAACCCTAACAGTGGTG
GCACAAACTATGCACAGAAGTTTCAGGGCAGGGTCACCATGACCAGGGACACGTCC
ATCAGCACAGCCTACATGGAGCTGAGCAGGCTGAGATCTGACGACACGGCCGTGTA
TTTCTGTGCGAGAGATTCGGGGTATAGCAGCAGCTGGCACTTTGACTACTGGGGCCA
GGGAACCCTGGTCACCGTCTCCTCA A4 LC (SEQ ID NO: 49)
GATATTGTGATGACTCAGTCTCCACTCTCCCTGCCCGTCACCCCTGGAGAGCCGGCC
TCCATCTCCTGCAGGTCTAGTCAGAGCCTCCTGCATAGTACTGGATACAACTATTTG
GATTGGTACCTGCAGAAGCCAGGGCAGTCTCCACAGCTCCTGATCTATTTGGGTTCT
TTTCGGGCCTCCGGGGTCCCTGACAGGTTCAGTGGCAGTGGGTCAGGCACAGATTTT
ACACTGAAAATCAGCAGAGTGGAGGCTGAGGATGTTGGGGTTTATTACTGCATGCA
AGCTCTCCAAACTCCGTGCAGTTTTGGCCAGGGGACCAAGCTGGAGATCAAG A5 HC (SEQ ID
NO: 66) CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCGGAGACCCTGTC
CCTCACCTGCACTGTCTCTGGTGGCTCCATCAATAGTTTCTACTGGAGCTGGATCCGG
CAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACAGTGGGAGCAC
CAACTACAATCCCTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGAC
CCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACTG
TGCGAGAGACAGTATAGCAGCCCCCTTTGACTACTGGGGCCAGGGAACCCTGGTCA
CCGTCTCCTCAGCTTCCACCAAGGGCCCATCCGTCTTCCCCCTGGCGCCCTGCTCCAG
GAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCG
AACCGGTGACGGTGTCGTGGAACTCATGCGCCCT A5 LC (SEQ ID NO: 65)
GACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCC
ACCATCACCTGCAAGTCCAGCCAGAGTATTTTATACAGTTCCAACAATAAGAAGTAT
CTAGTTTGGTACCAGCAGAAACCAGGACAGCCTCCTAAGCTGATCATTTACTGGACA
TCTATGCGGGAATCCGGGGTCCCTGACCGATTCAGTGGCAGCGGGTCTGGGACAGA
TTTCACTCTCACCATCAACAGCCTGCAGGCTGAAGATGTGGCAGTTTATTACTGTCA
GCAATATTATAGTACTCCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA A6 HC (SEQ
ID NO: 82) CAGGTGCAGCTACAGCAGTGGGGCGCAGGACTGTTGAAGCCTTCGGAGACCCTGTC
CCTCACCTGCGCTGTCTATGGTGGGTCCTTCAGTGCTTACTACTGGAGCTGGATCCGC
CAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGGAAATCAATCATAGTGGAGGCAC
CAACTACAACCCGTCCCTCAAGAGTCGAGTCACCATATCAGTAGACACGTCCAAGA
ACCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCCGCGGACACGGCTGTGTATTACT
GTGCGAGAGTACAGTGGCTCGAACTGGCCTACTTTGACTACTGGGGCCAGGGAACC
CTGGTCACCGTCTCCTCA A6 LC (SEQ ID NO: 81)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAAGTCAGAGCATTAGCAACTATTTAAATTGGTATCAGCAG
AGACCAGGGAAAGCCCCTAAGCTCCTGATCTATGCTACATCCAGTTTGCAAAGTGGG
GTCCCATCAAGGTTCAGTGGCAGTGGATCTGGGACAGATTTCACTCTCACCATCAGC
AGTCTGCAACCTGAAGATTTTGTAAGTTACTACTGTCAACAGAGTTACAGTATTTCG
CCCACTTTCGGCGGCGGGACCAAGGTGGAGAACAAA A7 HC (SEQ ID NO: 98)
CAGGTGCAGCTGGTGGACTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAG
ACTCTCCTGTGCAGCGTCTGGATTCACCTTCATTAGCTATGGCATGCACTGGGTCCGC
CAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATCTGGTATGATGGAAGTAC
TGAATACTATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCCAA
GAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATT
ACTGTGCGAGAGAGAGGCAGTGGCTCTACCACTACGGTATGGACGTCTGGGGCCAA
GGGACCACGGTCACCGTCTCCTCA A7 LC (SEQ ID NO: 97)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAGGTCAGGGCATTAGAAATGATTTAGTCTGGTATCAGCAG
AAACCAGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTGG
GGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCAG
CAGCCTGCAGCCTGAAGATTTTGCAACTTATTACTGTCTACAACATAATACTTACCC
ATTCACTTTCGGCCCTGGGACCAAAGTGGATATCAAA A8 HC (SEQ ID NO: 114)
CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCCTCGGAGACCCTGTC
CCTCACCTGCACTGTCTCTGGTGGCTCCATCAATAGTTTCTACTGGAGCTGGATCCGG
CAGCCCCCAGGGAAGGGACTGGAGTGGATTGGGTATATCTATTACAGTGGGAGCAC
CAACTACAATCCCTCCCTCAAGAGGCGAGTCACCATATCAGTAGACACGTCCAAGA
CCCAGTTCTCCCTGAAGCTGAGCTCTGTGACCGCTGCGGACACGGCCGTGTATTACT
GTGCGAGAGACAGTATAGCAGCCCCCTTTGACTACTGGGGCCAGGGAACCCTGGTC
ACCGTCTCCTCA A8 LC (SEQ ID NO: 113)
GACATCGTGATGACCCAGTCTCCAGACTCCCTGGCTGTGTCTCTGGGCGAGAGGGCC
ACCATCACCTGCAAGTCCAGCCAGAGTATTTTATACAGCTCCAACAATAAGAAGTAT
CTAGTTTGGTACCAGCAGAAACCAGGACAGCCTCCTAAGTTGATCATTTACTGGACA
TCTATGCGGGAATCCGGGGTCCCTGACCGATTCAGTGGCAGCGGGTCTGGGACAGA
TTTCACTCTCACCATCAGCAGCCTGCAGGCTGAAGATGTGGCAGTTTATTACTGTCA
GCAATATTATAGTACTCCGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA A9 HC (SEQ
ID NO: 130)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAG
ACTCTCCTGTGCAGCGTCTGGATTCACCTTCAGTAGTTACGGCATGCACTGGGTCCG
CCAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTA
ATAAATACCATGCAGACTCCGTGAAGGGCCGATTCACCATCTCCAGAGACAATTCC
AAGAACACGCTGTATCTGCAAGTGAACAGCCTGAGAGCCGAGGACACGGCTGTGTA
TTACTGTGTGAGAAGTCGGAACTGGAACTACGACAACTACTACTACGGTCTGGACGT
CTGGGGCCAAGGGACCACGGTCACCGTCTCCTCA A9 LC (SEQ ID NO: 129)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATAATTTAGGCTGGTATCAGCA
GAAACCAGGGAAAGCCCCTAAGCGCCTGATTTATGCTGCATCCAGTTTGCAAAGTG
GGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCA
GCAGCCTGCAGCCTGAAGATTTTACAACTTATTACTGTCTACAGCATAATAGTTACC
CGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA A10 HC (SEQ ID NO: 146)
GAGGTGCAGCTGGTGCAGTCTGGAGCAGAGGTGAAAAAGCCCGGGGAGTCTCTGAA
GATCTCCTGTCAGGGTTCTGGATACAGCTTTACCAGCTACTGGATCGGCTGGGTGCG
CCAGATGCCCGGGAAAGGCCTGGAGTGGATGGGGATCATCTATCCTGGTGACTCTG
ATACCAGATACAGCCCGTCCTTCCAAGGCCAGGTCACCATCTCAGCCGACAAGTCCA
TCAGCACCGCCTACCTGCAGTGGAGCAGCCTGAAGGCCTCGGACACCGCCATGTATT
ACTGTGCGAGACAAGGACTGGGGTTTGACTACTGGGGCCAGGGAACCCTGGTCACC GTCTCCTCA
A10 LC (SEQ ID NO: 145)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGC
ATCACCTGCTCTGGAGAAAAATGGGGAGAGAAATATGCTTGTTGGTATCAGCAGAA
GCCAGGCCAGTCCCCTGTGCTGGTCATCTATCAAGATACCAAGCGGCCCTCCGGGAT
CCCTGAGCGATTCTCTGGCTCCATTTCTGGGAACACAGCCACTCTGACCATCAGCGG
GACCCAGGCTATGGATGAGGCTGACTATTATTGTCAGGCGTGGGACAGGAGCACTG
TATTCGGCGGAGGGACCAAGCTGACCGTCCTA A11 HC (SEQ ID NO: 162)
CAGGTGCAGCTGCAGGAGTCGGGCCCAGGACTGGTGAAGCCTTCACAGACCCTGTC
CCTCACCTGCACTGTCTCTGGTGGCTCCATCAGCAGTGGTGGTTACTACTGGAGCTG
GATCCGCCAGCACCCAGGGAAGGGCCTGGAGTGGATTGGGTACATCTCTTACAGTG
GGAGCACCTACTACAACCCGTCCCTCAAGAGTCGAGTTACCATATCAGTTGACACGT
CTAAGAACCAGTTCTCCCTGAAGCTGAACTCTGTGACTGCCGCGGACACGGCCGTGT
ATTACTGTGCGCGCGCTTACGGTGACTATCGCGGCTGGTTCGACCCCTGGGGCCAGG
GAACCCTGGTCACCGTCTCCTCA A11 LC (SEQ ID NO: 161)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGC
ATCACCTGCTCTGGAGATAAATTGGGGGATAAATTTGCTTTCTGGTATCAGCTGAAG
CCAGGCCAGTCCCCTGTGCTGGTCATCTATCAAGATAACAAGCGGCCCTCAGGGATC
CCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGG
ACCCAGGCTATGGATGCGGCTGACTTTTACTGTCAGGCGTGGGACAGCAGCACTGTG
GTATTCGGCGGAGGGACCAAGCTGACCGTCCTA A12 HL (SEQ ID NO: 178)
CAGGTGCAGCTGGTGGAGTCTGGGGGAGGCGTGGTCCAGCCTGGGAGGTCCCTGAG
ACTCTCCTGTGTAGCGTCTGGATTCACCTTCAGTGCCTATGGCATGCACTGGGTCCGC
CAGGCTCCAGGCAAGGGGCTGGAGTGGGTGGCAGTTATATGGTATGATGGAAGTAA
TAAATACTATGCAGACTCCGTGAAGGGCCGATTCATCATCTCCAGAGACAATTCCAA
GAACACGCTGTATCTGCAAATGAACAGCCTGAGAGCCGAGGACACGGCTGTGTATT
ACTGTGCGAGAAGTCGGAACTGGAACTACGACTCCTACCAATACGGTTTGGACGTCT
GGGGCCAAGGGACCACGGTCACCGTCTCCTCA A12 LC (SEQ ID NO: 177)
GACATCCAGATGACCCAGTCTCCATCCTCCCTGTCTGCATCTGTAGGAGACAGAGTC
ACCATCACTTGCCGGGCAAGTCAGGGCATTAGAAATGATTTAGGCTGGTATCAGCA
GAAACCAGGGAAAGCCCCTAAGCGCCTGATCTATGCTGCATCCAGTTTGCAAAGTG
GGGTCCCATCAAGGTTCAGCGGCAGTGGATCTGGGACAGAATTCACTCTCACAATCA
GCAGCCTGCAGCCTGAAGATTGTGCAACTTATTATTGTCTACAGCATAATAGTTATA
CGTGGACGTTCGGCCAAGGGACCAAGGTGGAAATCAAA A13 HC (SEQ ID NO: 194)
CAGGTTCAGCTGGTGCAGTCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAA
GGTCTCCTGCAAGGCTTCTGGTTACACCTTTACCAGCTATGGTATCAGCTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGAGGATGGGATGGATCAGCGCTTACAATGGTA
ACACAAACTATGCACAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACACATCA
ACGACCACAGCCTACATGGAGCTGAGGAGCCTGAGATCTGACGACACGGCCGTGTA
TTACTGTGCGAGAGATCAAGATTACTATGATAGTAGTGGTTGGGGCCACTGGGGCCA
GGGAACCCTGGTCACCGTCTCCTCA A13 LC (SEQ ID NO: 193)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCAGC
ATCACCTGCTCTGGAGATAAATTGGGGGATAAATATGTTTGTTGGTATCAGCAGAAG
CCAGGCCAGTCCCCTGAACTGGTCATCTATCTAGATAACAAGCGGCCCTCAGGGATC
CCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGG
ACCCAGGCTATGGATGAGGCTGACTATTACTGTCAGGCGTGGGACAGCAGCACGGT
ATTCGGCGGAGGGACCAAACTGACCGTCCTG A14 HC (SEQ ID NO: 210)
CAGGTTCAGCTGGTGCAATCTGGAGCTGAGGTGAAGAAGCCTGGGGCCTCAGTGAA
GGTCTCCTGCAAGACTTCTGGTTACACCTTTACCAGCTATGGTATCAGCTGGGTGCG
ACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGATGGATCAGCCCTTACAATGGTA
ACACAAACTATGCACAGAAGTTCCAGGGCAGAGTCACCATGACCACAGACAAATCC
ACGAGCACAGCCTACATGGAGCTGAGGAGCCTGCGATCTGACGACACGGCCGTGTA
TTACTGTGCGAGAGATCAAGATTACTATGATAGTAGTGGTTGGGACCCCTGGGGCCA
GGGAACCCTGGTCACCGTCTCCTCG A14 LC (SEQ ID NO: 209)
TCCTATGAGCTGACTCAGCCACCCTCAGTGTCCGTGTCCCCAGGACAGACAGCCTCC
ATCACCTGCTCTGGAGATAAATTGGGGGATAAATATGCTTTCTGGTATCAGCAGAAG
CCAGGCCAGTCCCCTGTGCTGGTCTTCTATCATGATACCAAGCGGCCCTCAGGGATC
CCTGAGCGATTCTCTGGCTCCAACTCTGGGAACACAGCCACTCTGACCATCAGCGGG
ACCCAGGCTATGGATGAGGCTGACTATCACTGTCAGGCGTGGGACAGCAGCACGGT
CTTCGGCGGAGGGACCAAGCTGACCGTCCTAC Antibodies A1-A14 amino acid
sequences, light chain variable regions. CDR regions are shaded and
underlined; the intervening segments or regions are referred to as
framework (FR) herein. A1 (SEQ ID NO: 9)
SYEVTQAPSVSVSPGQTASITCSGDKLGDKYACWYQQKPGQSPVLVIYQDSKRPSGIPER
FSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGGTKLTVL A2 (SEQ ID NO: 25)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNNLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFTTYYCLQHNSYPWTFGQGTKVEIK A3 (SEQ ID NO: 41)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCRQQNTYPLTFGGGTKVEIK A4 (SEQ ID NO: 57)
DIVMTQSPLSLPVTPGEPASISCRSSQSLLHSTGYNYLDWYLQKPGQSPQLLIYLGSFRAS
GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQALQTPCSFGQGTKLEIK A5 (SEQ ID NO:
73) DIVMTQSPDSLAVSLGERATITCKSSQSILYSSNNKKYLVWYQQKPGQPPKLIIYWTSMR
ESGVPDRFSGSGSGTDFTLTINSLQAEDVAVYYCQQYYSTPWTFGQGTKVEIK A6 (SEQ ID
NO: 89)
DIQMTQSPSSLSASVGDRVTITCRASQSISNYLNWYQQRPGKAPKLLIYATSSLQSGVPSR
FSGSGSGTDFTLTISSLQPEDFVSYYCQQSYSISPTFGGGTKVENK A7 (SEQ ID NO: 105)
DIQMTQSPSSLSASVGDRVTITCRAGQGIRNDLVWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFATYYCLQHNTYPFTFGPGTKVDIK A8 (SEQ ID NO: 121)
DIVMTQSPDSLAVSLGERATITCKSSQSILYSSNNKKYLVWYQQKPGQPPKLIIYWTSMR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPWTFGQGTKVEIK A9 (SEQ ID
NO: 137)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNNLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDFTTYYCLQHNSYPWTFGQGTKVEIK A10 (SEQ ID NO:
153) SYELTQPPSVSVSPGQTASITCSGEKWGEKYACWYQQKPGQSPVLVIYQDTKRPSGIPER
FSGSISGNTATLTISGTQAMDEADYYCQAWDRSTVFGGGTKLTVL A11 (SEQ ID NO: 169)
SYELTQPPSVSVSPGQTASITCSGDKLGDKFAFWYQLKPGQSPVLVIYQDNKRPSGIPERF
SGSNSGNTATLTISGTQAMDAADFYCQAWDSSTVVFGGGTKLTVL A12 (SEQ ID NO: 185)
DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKRLIYAASSLQSGVPS
RFSGSGSGTEFTLTISSLQPEDCATYYCLQHNSYTWTFGQGTKVEIK A13 (SEQ ID NO:
201) SYELTQPPSVSVSPGQTASITCSGDKLGDKYVCWYQQKPGQSPELVIYLDNKRPSGIPER
FSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTVFGGGTKLTVL A14 (SEQ ID NO: 217)
SYELTQPPSVSVSPGQTASITCSGDKLGDKYAFWYQQKPGQSPVLVFYHDTKRPSGIPER
FSGSNSGNTATLTISGTQAMDEADYHCQAWDSSTVFGGGTKLTVL Antibodies A1-A14,
amino acid sequences of heavy chain variable regions. CDR regions
are shaded and underlined, the other regions are referred to as
framework (FR) herein. A1 (SEQ ID NO: 10)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGLSWVRQAPGQGLEWMGWIIPYNGN
TNSAQKLQGRVTMTTDTSTSTAYMELRSLRSDDTAVYFCARDRDYGVNYDAFDIWGQ GTMVTVSS
A2 (SEQ ID NO: 26)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSN
KYHADSVKGRFTISRDNSKNTLYLQVNSLRAEDTAVYYCVRSRNWNYDNYYYGLDVW
GQGTTVTVSS A3 (SEQ ID NO: 42)
EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYWMSWVRQAPGKGLECVANIKQDGSEE
YYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARGSSSWYYYNYGMDVWG QGTTVTVSS
A4 (SEQ ID NO: 58)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYIHWVRQAPGQGLEWMGWINPNSGG
TNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYFCARDSGYSSSWHFDYWGQG TLVTVSS
A5 (SEQ ID NO: 74)
QVQLQESGPGLVKPSETLSLTCTVSGGSINSFYWSWIRQPPGKGLEWIGYIYYSGSTNYN
PSLKSRVTISVDTSKTQFSLKLSSVTAADTAVYYCARDSIAAPFDYWGQGTLVTVSS A6 (SEQ
ID NO: 90)
QVQLQQWGAGLLKPSETLSLTCAVYGGSFSAYYWSWIRQPPGKGLEWIGEINHSGGTN
YNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARVQWLELAYFDYWGQGTLVT VSS A7
(SEQ ID NO: 106)
QVQLVDSGGGVVQPGRSLRLSCAASGFTFISYGMHWVRQAPGKGLEWVAVIWYDGST
EYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARERQWLYHYGMDVWGQ GTTVTVSS
A8 (SEQ ID NO: 122)
QVQLQESGPGLVKPSETLSLTCTVSGGSINSFYWSWIRQPPGKGLEWIGYIYYSGSTNYN
PSLKRRVTISVDTSKTQFSLKLSSVTAADTAVYYCARDSIAAPFDYWGQGTLVTVSS A9 (SEQ
ID NO: 138)
QVQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVIWYDGSN
KYHADSVKGRFTISRPNSKNTLYLQVNSLRAEDTAVYYCVRSRNWNYDNYYYGLDVW
GQGTTVTVSS A10 (SEQ ID NO: 154)
EVQLVQSGAEVKKPGESLKISCQGSGYSFTSYWIGWVRQMPGKGLEWMGIIYPGDSDT
RYSPSFQGQVTISADKSISTAYLQWSSLKASDTAMYYCARQGLGFDYWGQGTLVTVSS A11 (SEQ
ID NO: 170)
QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYISYSGSTY
YNPSLKSRVTISVDTSKNQFSLKLNSVTAADTAVYYCARAYGDYRGWFDPWGQGTLVT VSS A12
(SEQ ID NO: 186)
QVQLVESGGGVVQPGRSLRLSCVASGFTFSAYGMHWVRQAPGKGLEWVAVIWYDGSN
KYYADSVKGRFIISRDNSKNTLYLQMNSLRAEDTAVYYCARSRNWNYDSYQYGLDVW
GQGTTVTVSS A13 (SEQ ID NO: 202)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYGISWVRQAPGQGLERMGWISAYNGN
TNYAQKFQGRVTMTTDTSTTTAYMELRSLRSDDTAVYYCARDQDYYDSSGWGHWGQ GTLVTVSS
A14 (SEQ ID NO: 218)
QVQLVQSGAEVKKPGASVKVSCKTSGYTFTSYGISWVRQAPGQGLEWMGWISPYNGN
TNYAQKFQGRVTMTTDKSTSTAYMELRSLRSDDTAVYYCARDQDYYDSSGWDPWGQ
GTLVTVSS
CDR consensus sequences for Antibodies A1-A14.
TABLE-US-00002 Light Chain CDR1 Sequence L4 R S S Q S L L H S T G Y
N - Y L D (SEQ ID NO: 253) L5, L8 K S S Q S I L Y S S N N K K Y L V
(SEQ ID NO: 75) CONSENSUS: X.sub.1S S Q S X.sub.2 L X.sub.3 S
X.sub.4 X.sub.5 X.sub.6 X.sub.7 X.sub.8 Y L X.sub.9 (SEQ ID NO:
115) L2, L9 R A S Q G I R N N L G (SEQ ID NO: 27) L3, L12 R A S Q G
I R N D L G (SEQ ID NO: 43) L6 R A S Q S I S N Y L N (SEQ ID NO:
91) L7 R A G Q G I R N D L V (SEQ ID NO: 107) CONSENSUS: R A
X.sub.10 Q X.sub.11 I X.sub.12 N X.sub.13 L X.sub.14 (SEQ ID NO:
116) L1 S G D K L G D K Y A C (SEQ ID NO: 11) L10 S G E K W G E K Y
A C (SEQ ID NO: 155) L11 S G D K L G D K F A F (SEQ ID NO: 171) L13
S G D K L G D K Y V C (SEQ ID NO: 203) L14 S G D K L G D K Y A F
(SEQ ID NO: 219) CONSENSUS: S G X.sub.15 K X.sub.16 G X.sub.17
KX.sub.18 X.sub.19 X.sub.20 (SEQ ID NO: 123) X.sub.1 is an arginine
residue or a lysine residue, X.sub.2 is a leucine residue or a
isoleucine residue, X.sub.3 is a histidine residue or a tyrosine
residue, X.sub.4 is a threonine residue or a serine residue,
X.sub.5 is a glycine residue or an asparagine residue, X.sub.6 is a
tyrosine residue or an asparagine residue, X.sub.7 is an asparagine
residue or a lysine residue, X.sub.8 is a lysine residue or no
residue, X.sub.9 is an aspartate residue or a valine residue
X.sub.10 is a serine residue or a glycine residue, X.sub.11 is a
serine residue or a glycine residue, X.sub.12 is a serine residue
or an arginine residue, X.sub.13 is a tyrosine residue, an
aspartate residue, or an asparagine residue X.sub.14 is an
aspartate residue, a valine residue, or a glycine residue X.sub.15
is a glutamate residue or an aspartate residue, X.sub.16 is a
tryptophan residue or a leucine residue, X.sub.17 is a glutamate
residue or an aspartate residue, X.sub.18 is a tyrosine residue or
a phenylalanine residue, X.sub.19 is an alanine residue or a valine
residue, X.sub.20 is a cysteine residue or a phenylalanine
residue
TABLE-US-00003 Light Chain CDR2 Sequence L2 A T S S L Q S (SEQ ID
NO: 92) L3, L6, L7, L9, L12 A A S S L Q S (SEQ ID NO: 44) L5, L8 W
T S M R E S (SEQ ID NO: 76) L4 L G S F R A S (SEQ ID NO: 254)
CONSENSUS: X.sub.40X.sub.41SX.sub.42X.sub.43X.sub.44S (SEQ ID NO:
124) L10 Q D T K R P S (SEQ ID NO: 156) L11 Q D N K R P S (SEQ ID
NO: 172) L1 Q D S K R P S (SEQ ID NO: 12) L13 L D N K R P S (SEQ ID
NO: 204) L14 H D T K R P S (SEQ ID NO: 220) CONSENSUS: X.sub.45 D
X.sub.46 K R P S (SEQ ID NO: 128) X.sub.40 is an alanine residue, a
tryptophan residue, or a leucine residue, X.sub.41 is a threonine
residue, an alanine residue, or a glycine residue, X.sub.42 is a
serine residue, a methionine residue, or a phenylalanine residue,
X.sub.43 is a leucine residue or an arginine residue, X.sub.44 is a
glutamine residue, a glutamate residue, or an alanine residue
X.sub.45 is a glutamine residue, a leucine residue, or a histidine
residue, X.sub.46 is a threonine residue, an asparagine residue, or
a serine residue
TABLE-US-00004 Light Chain CDR3 Sequence L1 Q A W D S S T A V (SEQ
ID NO: 13) L10 Q A W D R S T - V (SEQ ID NO: 157) L11 Q A W D S S T
V V (SEQ ID NO: 173) L13, L14 Q A W D S S T V - (SEQ ID NO: 205) L2
L Q H N S Y P W T (SEQ ID NO: 29) L7 L Q H N T Y P F T (SEQ ID NO:
109) L9 L Q H N S Y P W T (SEQ ID NO: 141) L12 L Q H N S Y T W T
(SEQ ID NO: 189) CONSENSUS: L Q H N X.sub.81 Y X.sub.82 X.sub.83 T
(SEQ ID NO: 131) L3 R Q Q N T Y P L T (SEQ ID NO: 45) L4 M Q A L Q
T P C S (SEQ ID NO: 255) L5 Q Q Y Y S T P W T (SEQ ID NO: 77) L6 Q
Q S Y S I S P T (SEQ ID NO: 93) L8 Q Q Y Y S T P W T (SEQ ID NO:
125) CONSENSUS:
X.sub.73QX.sub.74X.sub.75X.sub.76X.sub.77X.sub.78X.sub.79X.sub.80
(SEQ ID NO: 132) X.sub.73 is a methionine residue, a glutamine
residue, or an arginine residue, X.sub.74 is an alanine residue, a
tyrosine residue, a glutamine residue, or a serine residue,
X.sub.75 is a leucine residue, a tyrosine residue, or an asparagine
residue, X.sub.76 is a glutamine residue, a serine residue, or a
threonine residue, X.sub.77 is a threonine residue, a tyrosine
residue, or an isoleucine residue, X.sub.78 is a proline residue or
a serine residue, X.sub.79 is a cysteine residue, a tryptophan
residue, a leucine residue, or a proline residue, X.sub.80 is a
serine residue or a threonine residue X.sub.81 is a threonine
residue or a serine residue, X.sub.82 is a proline residue or a
threonine residue, X.sub.83 is a phenylalanine residue or a
tryptophan residue
TABLE-US-00005 Heavy Chain CDR1 Sequence H5 G G S I N S - - F Y W S
(SEQ ID NO: 78) H6 G G S F S A - - Y Y W S (SEQ ID NO: 94) H8 G G S
I N S - - F Y W S (SEQ ID NO: 126) H11 G G S I S S G G Y Y W S (SEQ
ID NO: 174) CONSENSUS: G G
SX.sub.21X.sub.22X.sub.23X.sub.24X.sub.25X.sub.26YW S (SEQ ID NO:
252) H7 G F T F I S Y G M H (SEQ ID NO: 110) H4 G Y T F T G Y Y I H
(SEQ ID NO: 256) H2, H9 G F T F S S Y G M H (SEQ ID NO: 30) H10 G Y
S F T S Y W I G (SEQ ID NO: 158) CONSENSUS: G
X.sub.27X.sub.28FX.sub.29X.sub.30YX.sub.31X.sub.32X.sub.33 (SEQ ID
NO: 257) H13 G Y T F T S Y G L S (SEQ ID NO: 62) H12 G F T F S A Y
G M H (SEQ ID NO: 190) H3 G F T F S S Y W M S (SEQ ID NO: 46) H1,
H14 G Y T F T S Y G I S (SEQ ID NO: 206) CONSENSUS:
GX.sub.34TFX.sub.35X.sub.36YX.sub.37X.sub.38X.sub.39 (SEQ ID NO:
140) X.sub.21 is an isoleucine residue or a phenylalanine residue
X.sub.22 is an asparagine residue or a serine residue X.sub.23 is a
serine residue or an alanine residue X.sub.24 is a glycine residue
or no residue X.sub.25 is a glycine residue or no residue X.sub.26
is a phenylalanine residue or a tyrosine residue X.sub.27 is a
tyrosine residue or a phenylalanine residue, X.sub.28 is a
threonine residue or a serine residue, X.sub.29 is a threonine
residue,a serine residue, or an isoleucine residue, X.sub.30 is a
glycine residue or a serine residue, X.sub.31 is a tyrosine
residue, a glycine residue, or a tryptophan residue, X.sub.32 is an
isoleucine residue or a methionine residue, X.sub.33 is a histidine
residue or a glycine residue X.sub.34 is a tyrosine residue or a
phenylalanine residue, X.sub.35 is a threonine residue or a serine
residue, X.sub.36 is a serine residue or an alanine residue,
X.sub.37 is a glycine residue or a tryptophan residue, X.sub.38 is
a leucine residue, a methionine residue, or an isoleucine residue,
X.sub.39 is a serine residue or a histidine residue
TABLE-US-00006 Heavy Chain CDR2 Sequence H11 Y I S Y S G S T Y Y N
P S L K S (SEQ ID NO: 175) H5 Y I Y Y S G S T N Y N P S L K S (SEQ
ID NO: 79) H6 E I N H S G G T N Y N P S L K S (SEQ ID NO: 95) H8 Y
I Y Y S G S T N Y N P S L K R (SEQ ID NO: 127) CONSENSUS: X.sub.47
I X.sub.48 X.sub.49 S G X.sub.50 T X.sub.51 Y N P S L K X.sub.52
(SEQ ID NO: 142) H2, H9 V I W Y D G S N K Y H A D S V K G (SEQ ID
NO: 31) H12 V I W Y D G S N K Y Y A D S V K G (SEQ ID NO: 191) H3 N
I K Q D G S E E Y Y V D S V K G (SEQ ID NO: 47) H7 V I W Y D G S T
E Y Y A D S V K G (SEQ ID NO: 111) CONSENSUS: X.sub.53 I X.sub.54
X.sub.55 D G S X.sub.56 X.sub.57 Y X.sub.58 X.sub.59 D S V K G (SEQ
ID NO: 179) H4 W I N P N S G G T N Y A Q K F Q G (SEQ ID NO: 258)
H1 W I I P Y N G N T N S A Q K L Q G (SEQ ID NO: 63) H13 W I S A Y
N G N T N Y A Q K F Q G (SEQ ID NO: 207) H14 W I S P Y N G N T N Y
A Q K F Q G (SEQ ID NO: 259) H10 I I Y P G D S D T R Y S P S F Q G
(SEQ ID NO: 159) CONSENSUS: X.sub.60 I X.sub.61 X.sub.62 X.sub.63
X.sub.64 X.sub.65 X.sub.66 T X.sub.67 X.sub.68 X.sub.69 X.sub.70
X.sub.71 X.sub.72 Q G (SEQ ID NO: 180) X.sub.47 is a tyrosine
residue or a glutamate residue, X.sub.48 is a serine residue, a
tyrosine residue, or an asparagine residue, X.sub.49 is a tyrosine
residue or a histidine residue X.sub.50 is a serine residue or a
glycine residue, X.sub.51 is a tyrosine residue or an asparagine
residue, X.sub.52 is a serine residue or an arginine residue
X.sub.53 is an asparagine residue or a valine residue, X.sub.54 is
a tryptophan residue or a lysine residue, X.sub.55 is a tyrosine
residue or a glutamine residue, X.sub.56 is an asparagine residue,
a glutamate residue, or a serine residue, X.sub.57 is a lysine
residue or a glutamate residue, X.sub.58 is a histidine residue or
a tyrosine residue, X.sub.59 is an alanine residue or a valine
residue X.sub.60 is a tryptophan residue or an isoleucine residue,
X.sub.61 is an asparagine residue, an isoleucine residue, a serine
residue, or a tyrosine residue, X.sub.62 is a proline residue or an
alanine residue, X.sub.63 is an asparagine residue, a tyrosine
residue, or a glycine residue, X.sub.64 is a serine residue, an
asparagine residue, or an aspartate residue, X.sub.65 is a glycine
residue or a serine residue, X.sub.66 is a glycine residue, an
asparagine residue, or an aspartate residue, X.sub.67 is an
asparagine residue or an arginine residue, X.sub.68 is a tyrosine
residue or a serine residue, X.sub.69 is an alanine residue or a
serine residue X.sub.70 is a glutamine residue or a proline
residue, X.sub.71 is a lysine residue or a serine residue, X.sub.72
is a phenylalanine residue or a leucine residue
TABLE-US-00007 Heavy Chain CDR3 Sequence H5, H8 - - D S I A A P F D
Y (SEQ ID NO: 80) H6 V Q W L E L A Y F D Y (SEQ ID NO: 96) H10 - -
- - Q G L G F D Y (SEQ ID NO: 160) CONSENSUS:
X.sub.87X.sub.88X.sub.89X.sub.90X.sub.91X.sub.92X.sub.93X.sub.9-
4FDY (SEQ ID NO: 187) H13 D Q D Y Y D S S G W - G H (SEQ ID NO:
208) H14 D Q D Y Y D S S G W - D P (SEQ ID NO: 224) H11 - - A Y G D
Y R G W F D P (SEQ ID NO: 176) CONSENSUS: X.sub.95 X.sub.96
X.sub.97 Y X.sub.98 D X.sub.99 X.sub.100 G W X.sub.101 X.sub.102
X.sub.103 (SEQ ID NO: 188) H4 - - - D S G Y S S S W H F D Y - (SEQ
ID NO: 260) H1 - - - D R D Y G V N Y D A F D I (SEQ ID NO: 64) H2 -
S R N W N Y D N Y Y Y G L D V (SEQ ID NO: 32) H12 - S R N W N Y D S
Y Q Y G L D V (SEQ ID NO: 192) H9 - S R N W N Y D N Y Y Y G L D V
(SEQ ID NO: 144) H3 G S S S W Y Y - Y N G M D V - (SEQ ID NO: 261)
H7 - E R Q W L Y - - H Y G M D V (SEQ ID NO: 112) CONSENSUS:
X.sub.104X.sub.105X.sub.106X.sub.107X.sub.108X.sub.109YX.sub.11-
0X.sub.111X.sub.112X.sub.113
X.sub.114X.sub.115X.sub.116X.sub.117X.sub.118 (SEQ ID NO: 249))
X.sub.87 is a valine residue or no residue, X.sub.88 is a glutamine
residue or no residue, X.sub.89 is an aspartate residue, a
tryptophan residue, or no residue, X.sub.90 is a serine residue, a
leucine residue, or no residue, X.sub.91 is an isoleucine residue,
a glutamate residue, or a glutamine residue, X.sub.92 is an alanine
residue, a leucine residue, or a glycine residue, X.sub.93 is an
alanine residue or a leucine residue, X.sub.94 is a proline
residue, a tyrosine residue, or a glycine residue X.sub.95 is an
aspartate residue or no residue, X.sub.96 is a glutamine residue or
no residue, X.sub.97 is an aspartate residue or an alanine residue,
X.sub.98 is a tyrosine residue or a glycine residue, X.sub.99 is a
serine residue or a tyrosine residue, X.sub.100 is a serine residue
or an arginine residue, X.sub.101 is a phenylalanine residue or no
residue, X.sub.102 is a glycine residue or an aspartate residue,
X.sub.103 is a histidine residue or a proline residue X.sub.104 is
a glycine residue or no residue X.sub.105 is a serine residue, a
glutamate residue, or no residue X.sub.106 is an arginine residue,
a serine residue, or no residue, X.sub.107 is an aspartate residue,
an asparagine residue, a serine residue, or a glutamine resiude
X.sub.108 is a serine residue, an arginine residue, or a tryptophan
residue, X.sub.109 is a glycine residue, an aspartate residue, an
asparagine residue, a tyrosine residue, or a leucine residue,
X.sub.110 is a serine residue, a glycine residue, an aspartate
residue, or no residue, X.sub.111 is a serine residue, a valine
residue, an asparagine residue, or a tyrosine residue, X.sub.112 is
a serine residue, an asparagine residue, a tyrosine residue, or a
histidine residue X.sub.113 is a tryptophan residue, a tyrosine
residue, or a glutamine residue, X.sub.114 is a histidine residue,
an aspartate residue, a tyrosine residue, or no residue, X.sub.115
is a phenylalanine residue, an alanine residue, or a glycine
residue, X.sub.116 an aspartate residue, a phenylalanine residue, a
leucine residue, or a methionine residue X.sub.117 a tyrosine
residue, or an aspartate residue, X.sub.118 is an isoleucine
residue, a valine residue, or no residue
[0105] In one embodiment, the present invention provides an antigen
binding protein comprising a light chain variable domain comprising
a sequence of amino acids that differs from the sequence of a light
chain variable domain selected from the group consisting of L1
through L14 only at 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2,
or 1 residues, wherein each such sequence difference is
independently either a deletion, insertion, or substitution of one
amino acid residue. In another embodiment, the light-chain variable
domain comprises a sequence of amino acids that is at least 70%,
75%, 80%, 85%, 90%, 95%, 97%, or 99% identical to the sequence of a
light chain variable domain selected from the group consisting of
L1-L14. In another embodiment, the light chain variable domain
comprises a sequence of amino acids that is encoded by a nucleotide
sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99%
identical to a nucleotide sequence that encodes a light chain
variable domain selected from the group consisting of L1-L14 (which
includes L1, L2, L3, L4, L5, L6, L7, L8, L9, L10, L11, L12, L13,
and L14). In another embodiment, the light chain variable domain
comprises a sequence of amino acids that is encoded by a
polynucleotide that hybridizes under moderately stringent
conditions to the complement of a polynucleotide that encodes a
light chain variable domain selected from the group consisting of
L1-L14. In another embodiment, the light chain variable domain
comprises a sequence of amino acids that is encoded by a
polynucleotide that hybridizes under moderately stringent
conditions to the complement of a polynucleotide that encodes a
light chain variable domain selected from the group consisting of
L1-L14. In another embodiment, the light chain variable domain
comprises a sequence of amino acids that is encoded by a
polynucleotide that hybridizes under moderately stringent
conditions to a complement of a light chain polynucleotide of
L1-L14.
[0106] In another embodiment, the present invention provides an
antigen binding protein comprising a heavy chain variable domain
comprising a sequence of amino acids that differs from the sequence
of a heavy chain variable domain selected from the group consisting
of H1-H14 only at 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2,
or 1 residue(s), wherein each such sequence difference is
independently either a deletion, insertion, or substitution of one
amino acid residue. In another embodiment, the heavy chain variable
domain comprises a sequence of amino acids that is at least 70%,
75%, 80%, 85%, 90%, 95%, 97%, or 99% identical to the sequence of a
heavy chain variable domain selected from the group consisting of
H1-H14. In another embodiment, the heavy chain variable domain
comprises a sequence of amino acids that is encoded by a nucleotide
sequence that is at least 70%, 75%, 80%, 85%, 90%, 95%, 97%, or 99%
identical to a nucleotide sequence that encodes a heavy chain
variable domain selected from the group consisting of H1-H14. In
another embodiment, the heavy chain variable domain comprises a
sequence of amino acids that is encoded by a polynucleotide that
hybridizes under moderately stringent conditions to the complement
of a polynucleotide that encodes a heavy chain variable domain
selected from the group consisting of H1-H14. In another
embodiment, the heavy chain variable domain comprises a sequence of
amino acids that is encoded by a polynucleotide that hybridizes
under moderately stringent conditions to the complement of a
polynucleotide that encodes a heavy chain variable domain selected
from the group consisting of H1-H14. In another embodiment, the
heavy chain variable domain comprises a sequence of amino acids
that is encoded by a polynucleotide that hybridizes under
moderately stringent conditions to a complement of a heavy chain
polynucleotide selected from SEQ ID NO:10, 26, 42, 58, 74, 90, 106,
122, 136, 154, 170, 186, 202, and 218.
[0107] Particular embodiments of antigen binding proteins of the
present invention comprise one or more amino acid sequences that
are identical to the amino acid sequences of one or more of the
CDRs and/or FRs referenced herein for example, one or more CDR or
FR from one or more of SEQ ID Nos: 9-16, 22, 25-32, 36,
41-48-57-62, 64, 73-80, 89-91, 93-96, 105-107, 109-112, 115, 116,
121-128, 131, 132, 134, 137-142, 144, 153-160, 169-176, 179, 180,
185-192, 201-208, 217-220, and 223. In one embodiment, the antigen
binding protein comprises a light chain CDR1 sequence illustrated
above. In another embodiment, the antigen binding protein comprises
a light chain CDR2 sequence illustrated above. In another
embodiment, the antigen binding protein comprises a light chain
CDR3 sequence illustrated above. In another embodiment, the antigen
binding protein comprises a heavy chain CDR1 sequence illustrated
above. In another embodiment, the antigen binding protein comprises
a heavy chain CDR2 sequence illustrated above. In another
embodiment, the antigen binding protein comprises a heavy chain
CDR3 sequence illustrated above. In another embodiment, the antigen
binding protein comprises a light chain FR1 sequence illustrated
above. In another embodiment, the antigen binding protein comprises
a light chain FR2 sequence illustrated above. In another
embodiment, the antigen binding protein comprises a light chain FR3
sequence illustrated above. In another embodiment, the antigen
binding protein comprises a light chain FR4 sequence illustrated
above. In another embodiment, the antigen binding protein comprises
a heavy chain FR1 sequence illustrated above. In another
embodiment, the antigen binding protein comprises a heavy chain FR2
sequence illustrated above. In another embodiment, the antigen
binding protein comprises a heavy chain FR3 sequence illustrated
above. In another embodiment, the antigen binding protein comprises
a heavy chain FR4 sequence illustrated above.
[0108] In one embodiment, the present invention provides an antigen
binding protein that comprises one or more CDR sequences that
differ from a CDR sequence shown above by no more than 5, 4, 3, 2,
or 1 amino acid residues.
[0109] In another embodiment, at least one of the antigen binding
protein's CDR3 sequences is a CDR3 sequence from A1-A14, as shown
in Table 1 or Table 2. In another embodiment, the antigen binding
protein's light chain CDR3 sequence is a light chain CDR3 sequence
from A1-A14 as shown Table 1 and the antigen binding protein's
heavy chain CDR3 sequence is a heavy chain sequence from A1-A14 as
shown in Table 2. In another embodiment, the antigen binding
protein comprises 1, 2, 3, 4, or 5 CDR sequence(s) that each
independently differs by 6, 5, 4, 3, 2, 1, or 0 single amino acid
additions, substitutions, and/or deletions from a CDR sequence of
A1-A14, and the antigen binding protein further comprises 1, 2, 3,
4, or 5 CDR sequence(s) that each independently differs by 6, 5, 4,
3, 2, 1, or 0 single amino acid additions, substitutions, and/or
deletions from a CDR sequence.
[0110] The light chain CDR's of antibodies A1-A14 are shown below
in Table 1, and the heavy chain CDR's of antibodies A1-A14 are
shown below in Table 2.
TABLE-US-00008 TABLE 1 Light Chain Antibody CDR1 CDR2 CDR3 A1
SGDKLGDKYAC QDSKRPS QAWDSSTAV (SEQ ID NO: 11) (SEQ ID (SEQ ID NO:
12) NO: 13) A2 RASQGIRNNLG AASSLQS LQHNSYPWT (SEQ ID NO: 27) (SEQ
ID (SEQ ID NO: 28) NO: 29) A3 RASQGIRNDLG AASSLQS RQQNTYPLT (SEQ ID
NO: 43) (SEQ ID (SEQ ID NO: 44) NO: 45) A4 RSSQSLLHSTGYNYLD LGSFRAS
MQALQTPCS (SEQ ID NO: 253) (SEQ ID (SEQ ID NO: 254) NO: 255) A5
KSSQSILYSSNNKKYLV WTSMRES QQYYSTPWT (SEQ ID NO: 75) (SEQ ID (SEQ ID
NO: 76) NO: 77) A6 RASQSISNYLN ATSSLQS QQSYSISPT (SEQ ID NO: 91)
(SEQ ID (SEQ ID NO: 92) NO: 93) A7 RAGQGIRNDLV AASSLQS LQHNTYPFT
(SEQ ID NO: 107) (SEQ ID (SEQ ID NO: 44) NO: 109) A8
KSSQSILYSSNNKKYLV WTSMRES QQYYSTPWT (SEQ ID NO: 75) (SEQ ID (SEQ ID
NO: 76) NO: 125) A9 RASQGIRNNLG AASSLQS LQHNSYPWT (SEQ ID NO: 27)
(SEQ ID (SEQ ID NO: 44) NO: 141) A10 SGEKWGEKYAC QDTKRPS QAWDRSTV
(SEQ ID NO: 155) (SEQ ID (SEQ ID NO: 156) NO: 157) A11 SGDKLGDKFAF
QDNKRPS QAWDSSTVV (SEQ ID NO: 171) (SEQ ID (SEQ ID NO: 172) NO:
173) A12 RASQGIRNDLG AASSLQS LQHNSYTWT (SEQ ID NO: 43) (SEQ ID (SEQ
ID NO: 44) NO: 189) A13 SGDKLGDKYVC LDNKRPS QAWDSSTV (SEQ ID NO:
203) (SEQ ID (SEQ ID NO: 204) NO: 205) A14 SGDKLGDKYAF HDTKRPS
QAWDSSTV (SEQ ID NO: 219) (SEQ ID (SEQ ID NO: 220) NO: 205)
TABLE-US-00009 TABLE 2 Heavy Chain Anti- body CDR1 CDR2 CDR3 A1
GYTFTSYGLS WIIPYNGNTNSAQKLQ DRDYGVNYDAFDI (SEQ ID G (SEQ ID NO: 62)
(SEQ ID NO: 63) NO: 64) A2 GFTFSSYGMH VIWYDGSNKYHADSV SRNWNYDNYYYGL
(SEQ ID KG DV NO: 30) (SEQ ID NO: 31) (SEQ ID NO: 32) A3 GFTFSSYWMS
NIKQDGSEEYYVDSVK GSSSWYYYNYGMD (SEQ ID G V NO: 46) (SEQ ID NO: 47)
(SEQ ID NO: 48) A4 GYTFTGYYIH WINPNSGGTNYAQKF DSGYSSSWHFDY (SEQ ID
QG (SEQ ID NO: 256) (SEQ ID NO: 258) NO: 260) A5 GGSINSFYWS
YIYYSGSTNYNPSLKS DSIAAPFDY (SEQ ID (SEQ ID NO: 79) (SEQ ID NO: 78)
NO: 80) A6 GGSFSAYYWS EINHSGGTNYNPSLKS VQWLELAYFDY (SEQ ID (SEQ ID
NO: 95) (SEQ ID NO: 94) NO: 96) A7 GFTFISYGMH VIWYDGSTEYYADSV
ERQWLYHYGMDV (SEQ ID KG (SEQ ID NO: 110) (SEQ ID NO: 111) NO: 112)
A8 GGSINSFYWS YIYYSGSTNYNPSLKR DSIAAPFDY (SEQ ID (SEQ ID NO: 127)
(SEQ ID NO: 126) NO: 80) A9 GFTFSSYGMH VIWYDGSNKYHADSV
SRNWNYDNYYYGL (SEQ ID KG DV NO: 30) (SEQ ID NO: 31) (SEQ ID NO:
144) A10 GYSFTSYWIG IIYPGDSDTRYSPSFQG QGLGFDY (SEQ ID (SEQ ID NO:
159) (SEQ ID NO: 158) NO: 160) A11 GGSISSGGYYWS YISYSGSTYYNPSLKS
AYGDYRGWFDP (SEQ ID (SEQ ID NO: 175) (SEQ ID NO: 174) NO: 176) A12
GFTFSAYGMH VIWYDGSNKYYADSV SRNWNYDSYQYGL (SEQ ID KG DV NO: 190)
(SEQ ID NO: 191) (SEQ ID NO: 192) A13 GYTFTSYGIS WISAYNGNTNYAQKF
DQDYYDSSGWGH (SEQ ID QG (SEQ ID NO: 206) (SEQ ID NO: 207) NO: 208)
A14 GYTFTSYGIS WISPYNGNTNYAQKF DQDYYDSSGWDP (SEQ ID QG (SEQ ID NO:
206) (SEQ ID NO: 259) NO: 224)
[0111] The nucleotide sequences of A1-A14, or the amino acid
sequences of A1-A14, can be altered, for example, by random
mutagenesis or by site-directed mutagenesis (e.g.,
oligonucleotide-directed site-specific mutagenesis) to create an
altered polynucleotide comprising one or more particular nucleotide
substitutions, deletions, or insertions as compared to the
non-mutated polynucleotide. Examples of techniques for making such
alterations are described in Walder et al., 1986, Gene 42:133;
Bauer et al. 1985, Gene 37:73; Craik, BioTechniques, January 1985,
12-19; Smith et al., 1981, Genetic Engineering: Principles and
Methods, Plenum Press; and U.S. Pat. Nos. 4,518,584 and 4,737,462.
These and other methods can be used to make, for example,
derivatives of anti-activin A antibodies that have a desired
property, for example, increased affinity, avidity, or specificity
for activin A, increased activity or stability in vivo or in vitro,
or reduced in vivo side-effects as compared to the underivatized
antibody.
[0112] Other derivatives of anti-activin A antibodies within the
scope of this invention include covalent or aggregative conjugates
of anti-activin A antibodies, or fragments thereof, with other
proteins or polypeptides, such as by expression of recombinant
fusion proteins comprising heterologous polypeptides fused to the
N-terminus or C-terminus of an anti-activin A antibody polypeptide.
For example, the conjugated peptide may be a heterologous signal
(or leader) polypeptide, e.g., the yeast alpha-factor leader, or a
peptide such as an epitope tag. Antigen binding protein-containing
fusion proteins can comprise peptides added to facilitate
purification or identification of antigen binding protein (e.g.,
poly-His). An antigen binding protein also can be linked to the
FLAG peptide Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys (DYKDDDDK) (SEQ ID
NO:226) as described in Hopp et al., Bio/Technology 6:1204, 1988,
and U.S. Pat. No. 5,011,912. The FLAG peptide is highly antigenic
and provides an epitope reversibly bound by a specific monoclonal
antibody (mAb), enabling rapid assay and facile purification of
expressed recombinant protein. Reagents useful for preparing fusion
proteins in which the FLAG peptide is fused to a given polypeptide
are commercially available (Sigma, St. Louis, Mo.).
[0113] Oligomers that contain one or more antigen binding proteins
may be employed as activin A antagonists. Oligomers may be in the
form of covalently-linked or non-covalently-linked dimers, trimers,
or higher oligomers. Oligomers comprising two or more antigen
binding protein are contemplated for use, with one example being a
homodimer. Other oligomers include heterodimers, homotrimers,
heterotrimers, homotetramers, heterotetramers, etc.
[0114] One embodiment is directed to oligomers comprising multiple
antigen binding proteins joined via covalent or non-covalent
interactions between peptide moieties fused to the antigen binding
proteins. Such peptides may be peptide linkers (spacers), or
peptides that have the property of promoting oligomerization.
Leucine zippers and certain polypeptides derived from antibodies
are among the peptides that can promote oligomerization of antigen
binding proteins attached thereto, as described in more detail
below.
[0115] In particular embodiments, the oligomers comprise from two
to four antigen binding proteins. The antigen binding proteins of
the oligomer may be in any form, such as any of the forms described
above, e.g., variants or fragments. Preferably, the oligomers
comprise antigen binding proteins that have activin A binding
activity.
[0116] In one embodiment, an oligomer is prepared using
polypeptides derived from immunoglobulins. Preparation of fusion
proteins comprising certain heterologous polypeptides fused to
various portions of antibody-derived polypeptides (including the Fc
domain) has been described, e.g., by Ashkenazi et al., 1991, PNAS
USA 88:10535; Byrn et al., 1990, Nature 344:677; and Hollenbaugh et
al., 1992 Curr. Prots. in Immunol., Suppl. 4, pages
10.19.1-10.19.11.
[0117] One embodiment of the present invention is directed to a
dimer comprising two fusion proteins created by fusing an activin A
binding fragment of an anti-activin A antibody to the Fc region of
an antibody. The dimer can be made by, for example, inserting a
gene fusion encoding the fusion protein into an appropriate
expression vector, expressing the gene fusion in host cells
transformed with the recombinant expression vector, and allowing
the expressed fusion protein to assemble much like antibody
molecules, whereupon interchain disulfide bonds form between the Fc
moieties to yield the dimer.
[0118] The term "Fc polypeptide" as used herein includes native and
mutein forms of polypeptides derived from the Fc region of an
antibody. Truncated forms of such polypeptides containing the hinge
region that promotes dimerization also are included. Fusion
proteins comprising Fc moieties (and oligomers formed therefrom)
offer the advantage of facile purification by affinity
chromatography over Protein A or Protein G columns.
[0119] One suitable Fc polypeptide, described in PCT application WO
93/10151 (hereby incorporated by reference), is a single chain
polypeptide extending from the N-terminal hinge region to the
native C-terminus of the Fc region of a human IgG1 antibody.
Another useful Fc polypeptide is the Fc mutein described in U.S.
Pat. No. 5,457,035 and in Baum et al., 1994, EMBO J. 13:3992-4001.
The amino acid sequence of this mutein is identical to that of the
native Fc sequence presented in WO 93/10151, except that amino acid
19 has been changed from Leu to Ala, amino acid 20 has been changed
from Leu to Glu, and amino acid 22 has been changed from Gly to
Ala. The mutein exhibits reduced affinity for Fc receptors.
[0120] In other embodiments, the variable portion of the heavy
and/or light chains of an anti-activin A antibody may be
substituted for the variable portion of an antibody heavy and/or
light chain.
[0121] Alternatively, the oligomer is a fusion protein comprising
multiple antigen binding proteins, with or without peptide linkers
(spacer peptides). Among the suitable peptide linkers are those
described in U.S. Pat. Nos. 4,751,180 and 4,935,233.
[0122] Another method for preparing oligomeric antigen binding
proteins involves use of a leucine zipper. Leucine zipper domains
are peptides that promote oligomerization of the proteins in which
they are found. Leucine zippers were originally identified in
several DNA-binding proteins (Landschulz et al., 1988, Science
240:1759), and have since been found in a variety of different
proteins. Among the known leucine zippers are naturally occurring
peptides and derivatives thereof that dimerize or trimerize.
Examples of leucine zipper domains suitable for producing soluble
oligomeric proteins are described in PCT application WO 94/10308,
and the leucine zipper derived from lung surfactant protein D (SPD)
described in Hoppe et al., 1994, FEBS Letters 344:191, hereby
incorporated by reference. The use of a modified leucine zipper
that allows for stable trimerization of a heterologous protein
fused thereto is described in Fanslow et al., 1994, Semin. Immunol.
6:267-78. In one approach, recombinant fusion proteins comprising
an anti-activin A antibody fragment or derivative fused to a
leucine zipper peptide are expressed in suitable host cells, and
the soluble oligomeric anti-activin A antibody fragments or
derivatives that form are recovered from the culture
supernatant.
[0123] In one aspect, the present invention provides antigen
binding proteins that interfere with the binding of activin A to an
activin A receptor. Such antigen binding proteins can be made
against activin A, or a fragment, variant or derivative thereof,
and screened in conventional assays for the ability to interfere
with binding of activin A to activin A receptor. Examples of
suitable assays are assays that test the antigen binding proteins
for the ability to inhibit binding of activin A to cells expressing
activin A receptor, or that test antigen binding proteins for the
ability to reduce a biological or cellular response that results
from the binding of activin A to cell surface activin A receptors.
For example, as set forth in FIG. 10, as well as the Examples
below, antibodies can be screened according to their ability to
bind to immobilized antibody surfaces (activin A and/or activin
B).
[0124] Antigen-binding fragments of antigen binding proteins of the
invention may be produced by conventional techniques. Examples of
such fragments include, but are not limited to, Fab and
F(ab').sub.2 fragments. Antibody fragments and derivatives produced
by genetic engineering techniques also are contemplated.
[0125] Additional embodiments include chimeric antibodies, e.g.,
humanized versions of non-human (e.g., murine) monoclonal
antibodies. Such humanized antibodies may be prepared by known
techniques, and offer the advantage of reduced immunogenicity when
the antibodies are administered to humans. In one embodiment, a
humanized monoclonal antibody comprises the variable domain of a
murine antibody (or all or part of the antigen binding site
thereof) and a constant domain derived from a human antibody.
Alternatively, a humanized antibody fragment may comprise the
antigen binding site of a murine monoclonal antibody and a variable
domain fragment (lacking the antigen-binding site) derived from a
human antibody. Procedures for the production of chimeric and
further engineered monoclonal antibodies include those described in
Riechmann et al., 1988, Nature 332:323, Liu et al., 1987, Proc.
Nat. Acad. Sci. USA 84:3439, Larrick et al., 1989, Bio/Technology
7:934, and Winter et al., 1993, TIPS 14:139. In one embodiment, the
chimeric antibody is a CDR grafted antibody. Techniques for
humanizing antibodies are discussed in, e.g., U.S. Pat. Nos.
5,869,619, 5,225,539, 5,821,337, 5,859,205, 6,881,557, Padlan et
al., 1995, FASEB J. 9:133-39, and Tamura et al., 2000, J. Immunol.
164:1432-41.
[0126] Procedures have been developed for generating human or
partially human antibodies in non-human animals. For example, mice
in which one or more endogenous immunoglobulin genes have been
inactivated by various means have been prepared. Human
immunoglobulin genes have been introduced into the mice to replace
the inactivated mouse genes. Antibodies produced in the animal
incorporate human immunoglobulin polypeptide chains encoded by the
human genetic material introduced into the animal. In one
embodiment, a non-human animal, such as a transgenic mouse, is
immunized with an activin A polypeptide, such that antibodies
directed against the activin A polypeptide are generated in the
animal.
[0127] One example of a suitable immunogen is a soluble human
activin A, such as a polypeptide comprising the extracellular
domain of the protein of SEQ ID NO:225, or other immunogenic
fragment of the protein of SEQ ID NO:225. Examples of techniques
for production and use of transgenic animals for the production of
human or partially human antibodies are described in U.S. Pat. Nos.
5,814,318, 5,569,825, and 5,545,806, Davis et al., 2003, Production
of human antibodies from transgenic mice in Lo, ed. Antibody
Engineering: Methods and Protocols, Humana Press, N.J.: 191-200,
Kellermann et al., 2002, Curr Opin Biotechnol. 13:593-97, Russel et
al., 2000, Infect Immun. 68:1820-26, Gallo et al., 2000, Eur J
Immun. 30:534-40, Davis et al., 1999, Cancer Metastasis Rev.
18:421-25, Green, 1999, J Immunol Methods. 231:11-23, Jakobovits,
1998, Advanced Drug Delivery Reviews 31:33-42, Green et al., 1998,
J Exp Med. 188:483-95, Jakobovits A, 1998, Exp. Opin. Invest.
Drugs. 7:607-14, Tsuda et al., 1997, Genomics. 42:413-21, Mendez et
al., 1997, Nat Genet. 15:146-56, Jakobovits, 1994, Curr Biol.
4:761-63, Arbones et al., 1994, Immunity. 1:247-60, Green et al.,
1994, Nat Genet. 7:13-21, Jakobovits et al., 1993, Nature.
362:255-58, Jakobovits et al., 1993, Proc Natl Acad Sci USA.
90:2551-55. Chen, J., M. Trounstine, F. W. Alt, F. Young, C.
Kurahara, J. Loring, D. Huszar. Inter'l Immunol. 5 (1993): 647-656,
Choi et al., 1993, Nature Genetics 4: 117-23, Fishwild et al.,
1996, Nature Biotech. 14: 845-51, Harding et al., 1995, Annals of
the New York Academy of Sciences, Lonberg et al., 1994, Nature 368:
856-59, Lonberg, 1994, Transgenic Approaches to Human Monoclonal
Antibodies in Handbook of Experimental Pharmacology 113: 49-101,
Lonberg et al., 1995, Internal Review of Immunology 13: 65-93,
Neuberger, 1996, Nature Biotechnology 14: 826, Taylor et al., 1992,
Nucleic Acids Res. 20: 6287-95, Taylor et al., 1994, Inter'l
Immunol. 6: 579-91, Tomizuka et al., 1997, Nature Genetics 16:
133-43, Tomizuka et al., 2000, Pro. Nat'l Acad. Sci. USA 97:
722-27, Tuaillon et al., 1993, Pro. Nat'l Acad. Sci. USA 90:
3720-24, and Tuaillon et al., 1994, J. Immunol. 152: 2912-20.
[0128] In another aspect, the present invention provides monoclonal
antibodies that bind to activin A. Monoclonal antibodies may be
produced using any technique known in the art, e.g., by
immortalizing spleen cells harvested from the transgenic animal
after completion of the immunization schedule. The spleen cells can
be immortalized using any technique known in the art, e.g., by
fusing them with myeloma cells to produce hybridomas. Myeloma cells
for use in hybridoma-producing fusion procedures preferably are
non-antibody-producing, have high fusion efficiency, and enzyme
deficiencies that render them incapable of growing in certain
selective media which support the growth of only the desired fused
cells (hybridomas). Examples of suitable cell lines for use in
mouse fusions include Sp-20, P3-X63/Ag8, P3-X63-Ag8.653, NS1/1.Ag
41, Sp210-Ag14, FO, NSO/U, MPC-11, MPC11-X45-GTG 1.7 and S194/5XX0
Bul; examples of cell lines used in rat fusions include R210.RCY3,
Y3-Ag 1.2.3, IR983F and 4B210. Other cell lines useful for cell
fusions are U-266, GM1500-GRG2, LICR-LON-HMy2 and UC729-6.
[0129] In one embodiment, a hybridoma cell line is produced by
immunizing an animal (e.g., a transgenic animal having human
immunoglobulin sequences) with an activin A immunogen; harvesting
spleen cells from the immunized animal; fusing the harvested spleen
cells to a myeloma cell line, thereby generating hybridoma cells;
establishing hybridoma cell lines from the hybridoma cells, and
identifying a hybridoma cell line that produces an antibody that
binds an activin A polypeptide. Such hybridoma cell lines, and
anti-activin A monoclonal antibodies produced by them, are
encompassed by the present invention.
[0130] Monoclonal antibodies secreted by a hybridoma cell line can
be purified using any technique known in the art. Hybridomas or
mAbs may be further screened to identify mAbs with particular
properties, such as the ability to block an activin A-induced
activity. Examples of such screens are provided in the examples
below.
[0131] Molecular evolution of the complementarity determining
regions (CDRs) in the center of the antibody binding site also has
been used to isolate antibodies with increased affinity, for
example, antibodies having increased affinity for c-erbB-2, as
described by Schier et al., 1996, J. Mol. Biol. 263:551.
Accordingly, such techniques are useful in preparing antibodies to
activin A.
[0132] Antigen binding proteins directed against an activin A can
be used, for example, in assays to detect the presence of activin A
polypeptides, either in vitro or in vivo. The antigen binding
proteins also may be employed in purifying activin A proteins by
immunoaffinity chromatography. Those antigen binding proteins that
additionally can block binding of activin A may be used to inhibit
a biological activity that results from such binding. Blocking
antigen binding proteins can be used in the methods of the present
invention. Such antigen binding proteins that function as activin A
antagonists may be employed in treating any activin A-related
condition, including but not limited to cachexia. In one
embodiment, a human anti-activin A monoclonal antibody generated by
procedures involving immunization of transgenic mice is employed in
treating such conditions.
[0133] Although human, partially human, or humanized antibodies
will be suitable for many applications, particularly those
involving administration of the antibody to a human subject, other
types of antigen binding proteins will be suitable for certain
applications. The non-human antibodies of the invention can be, for
example, derived from any antibody-producing animal, such as mouse,
rat, rabbit, goat, donkey, or non-human primate (such as monkey
(e.g., cynomologous or rhesus monkey) or ape (e.g., chimpanzee)).
Non-human antibodies of the invention can be used, for example, in
in vitro and cell-culture based applications, or any other
application where an immune response to the antibody of the
invention does not occur, is insignificant, can be prevented, is
not a concern, or is desired. In one embodiment, a non-human
antibody of the invention is administered to a non-human subject.
In another embodiment, the non-human antibody does not elicit an
immune response in the non-human subject. In another embodiment,
the non-human antibody is from the same species as the non-human
subject, e.g., a mouse antibody of the invention is administered to
a mouse. An antibody from a particular species can be made by, for
example, immunizing an animal of that species with the desired
immunogen (e.g., a soluble activin A polypeptide) or using an
artificial system for generating antibodies of that species (e.g.,
a bacterial or phage display-based system for generating antibodies
of a particular species), or by converting an antibody from one
species into an antibody from another species by replacing, e.g.,
the constant region of the antibody with a constant region from the
other species, or by replacing one or more amino acid residues of
the antibody so that it more closely resembles the sequence of an
antibody from the other species. In one embodiment, the antibody is
a chimeric antibody comprising amino acid sequences derived from
antibodies from two or more different species.
[0134] Antigen binding proteins may be prepared by any of a number
of conventional techniques. For example, they may be purified from
cells that naturally express them (e.g., an antibody can be
purified from a hybridoma that produces it), or produced in
recombinant expression systems, using any technique known in the
art. See, for example, Monoclonal Antibodies, Hybridomas: A New
Dimension in Biological Analyses, Kennet et al. (eds.), Plenum
Press, New York (1980); and Antibodies: A Laboratory Manual, Harlow
and Land (eds.), Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y., (1988).
[0135] Any expression system known in the art can be used to make
the recombinant polypeptides of the invention. In general, host
cells are transformed with a recombinant expression vector that
comprises DNA encoding a desired polypeptide. Among the host cells
that may be employed are prokaryotes, yeast or higher eukaryotic
cells. Prokaryotes include gram negative or gram positive
organisms, for example E. coli or Bacilli. Higher eukaryotic cells
include insect cells and established cell lines of mammalian
origin. Examples of suitable mammalian host cell lines include the
COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al.,
1981, Cell 23:175), L cells, 293 cells, C127 cells, 3T3 cells (ATCC
CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, BHK (ATCC
CRL 10) cell lines, and the CVI/EBNA cell line derived from the
African green monkey kidney cell line CVI (ATCC CCL 70) as
described by McMahan et al., 1991, EMBO J. 10: 2821. Appropriate
cloning and expression vectors for use with bacterial, fungal,
yeast, and mammalian cellular hosts are described by Pouwels et al.
(Cloning Vectors: A Laboratory Manual, Elsevier, New York,
1985).
[0136] The transformed cells can be cultured under conditions that
promote expression of the polypeptide, and the polypeptide
recovered by conventional protein purification procedures. One such
purification procedure includes the use of affinity chromatography,
e.g., over a matrix having all or a portion (e.g., the
extracellular domain) of activin A bound thereto. Polypeptides
contemplated for use herein include substantially homogeneous
recombinant mammalian anti-activin A antibody polypeptides
substantially free of contaminating endogenous materials.
[0137] Antigen binding proteins may be prepared, and screened for
desired properties, by any of a number of known techniques. Certain
of the techniques involve isolating a nucleic acid encoding a
polypeptide chain (or portion thereof) of an antigen binding
protein of interest (e.g., an anti-activin A antibody), and
manipulating the nucleic acid through recombinant DNA technology.
The nucleic acid may be fused to another nucleic acid of interest,
or altered (e.g., by mutagenesis or other conventional techniques)
to add, delete, or substitute one or more amino acid residues, for
example.
[0138] In one aspect, the present invention provides
antigen-binding fragments of an anti-activin A antibody of the
invention. Such fragments can consist entirely of antibody-derived
sequences or can comprise additional sequences. Examples of
antigen-binding fragments include Fab, F(ab')2, single chain
antibodies, diabodies, triabodies, tetrabodies, and domain
antibodies. Other examples are provided in Lunde et al., 2002,
Biochem. Soc. Trans. 30:500-06.
[0139] Single chain antibodies may be formed by linking heavy and
light chain variable domain (Fv region) fragments via an amino acid
bridge (short peptide linker), resulting in a single polypeptide
chain. Such single-chain Fvs (scFvs) have been prepared by fusing
DNA encoding a peptide linker between DNAs encoding the two
variable domain polypeptides (V.sub.L and V.sub.H). The resulting
polypeptides can fold back on themselves to form antigen-binding
monomers, or they can form multimers (e.g., dimers, trimers, or
tetramers), depending on the length of a flexible linker between
the two variable domains (Kortt et al., 1997, Prot. Eng. 10:423;
Kortt et al., 2001, Biomol. Eng. 18:95-108). By combining different
V.sub.L and V.sub.H-comprising polypeptides, one can form
multimeric scFvs that bind to different epitopes (Kriangkum et al.,
2001, Biomol. Eng. 18:31-40). Techniques developed for the
production of single chain antibodies include those described in
U.S. Pat. No. 4,946,778; Bird, 1988, Science 242:423; Huston et
al., 1988, Proc. Natl. Acad. Sci. USA 85:5879; Ward et al., 1989,
Nature 334:544, de Graaf et al., 2002, Methods Mol Biol.
178:379-87. Single chain antibodies derived from antibodies
provided herein include, but are not limited to, scFvs comprising
the variable domain combinations L1H1, L2H2, L3H3, L4H4, L5H5,
L6H6, L7H7, L8H8, L9H9, L10H10, L11H11, L12H12, L13H13, and L14H14
are encompassed by the present invention.
[0140] Antigen binding proteins (e.g., antibodies, antibody
fragments, and antibody derivatives) of the invention can comprise
any constant region known in the art. The light chain constant
region can be, for example, a kappa- or lambda-type light chain
constant region, e.g., a human kappa- or lambda-type light chain
constant region. The heavy chain constant region can be, for
example, an alpha-, delta-, epsilon-, gamma-, or mu-type heavy
chain constant regions, e.g., a human alpha-, delta-, epsilon-,
gamma-, or mu-type heavy chain constant region. In one embodiment,
the light or heavy chain constant region is a fragment, derivative,
variant, or mutein of a naturally occurring constant region.
[0141] Techniques are known for deriving an antibody of a different
subclass or isotype from an antibody of interest, i.e., subclass
switching. Thus, IgG antibodies may be derived from an IgM
antibody, for example, and vice versa. Such techniques allow the
preparation of new antibodies that possess the antigen-binding
properties of a given antibody (the parent antibody), but also
exhibit biological properties associated with an antibody isotype
or subclass different from that of the parent antibody. Recombinant
DNA techniques may be employed. Cloned DNA encoding particular
antibody polypeptides may be employed in such procedures, e.g., DNA
encoding the constant domain of an antibody of the desired isotype.
See also Lantto et al., 2002, Methods Mol. Biol. 178:303-16.
[0142] In one embodiment, an antigen binding protein of the
invention comprises the IgG1 heavy chain domain of any of A1-A14
(H1-H14) or a fragment of the IgG1 heavy chain domain of any of
A1-A14 (H1-H14). In another embodiment, an antigen binding protein
of the invention comprises the kappa light chain constant chain
region of A1-A14 (L1-L14), or a fragment of the kappa light chain
constant region of A1-A14 (L1-L14). In another embodiment, an
antigen binding protein of the invention comprises both the IgG1
heavy chain domain, or a fragment thereof, of A1-A14 (L1-L14) and
the kappa light chain domain, or a fragment thereof, of A1-A14
(L1-L14).
[0143] Accordingly, the antigen binding proteins of the present
invention include those comprising, for example, the variable
domain combinations L1H1, L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8,
L9H9, L10H10, L11H11, L12H12, L13H13, and L14H14, having a desired
isotype (for example, IgA, IgG1, IgG2, IgG3, IgG4, IgM, IgE, and
IgD) as well as Fab or F(ab').sub.2 fragments thereof. Moreover, if
an IgG4 is desired, it may also be desired to introduce a point
mutation (CPSCP->CPPCP) in the hinge region as described in
Bloom et al., 1997, Protein Science 6:407, incorporated by
reference herein) to alleviate a tendency to form intra-H chain
disulfide bonds that can lead to heterogeneity in the IgG4
antibodies.
[0144] In one embodiment, the antigen binding protein has a
K.sub.off of 1.times.10.sup.-4 s.sup.-1 or lower. In another
embodiment, the K.sub.off is 5.times.10.sup.-5 s.sup.-1 or lower.
In another embodiment, the K.sub.off is substantially the same as
an antibody having a combination of light chain and heavy chain
variable domain sequences selected from the group of combinations
consisting of L1H1, L2H2, L3H3, L4H4, L5H5, L6H6, L7H7, L8H8, L9H9,
L10H10, L11H11, L12H12, L13H13, and L14H14. In another embodiment,
the antigen binding protein binds to activin A with substantially
the same K.sub.off as an antibody that comprises one or more CDRs
from an antibody having a combination of light chain and heavy
chain variable domain sequences selected from the group of
combinations consisting of L1H1, L2H2, L3H3, L4H4, L5H5, L6H6,
L7H7, L8H8, L9H9, L10H10, L11H11, L12H12, L13H13, and L14H14. In
another embodiment, the antigen binding protein binds to activin A
with substantially the same K.sub.off as an antibody that comprises
one of the amino acid sequences illustrated above. In another
embodiment, the antigen binding protein binds to activin A with
substantially the same K.sub.off as an antibody that comprises one
or more CDRs from an antibody that comprises one of the amino acid
sequences illustrated above.
[0145] As used herein, the term human activin A is intended to
include the protein of SEQ ID NO:1 and allelic variants thereof.
Activin A can be purified from host cells that have been
transfected by a gene encoding activin A by elution of filtered
supernatant of host cell culture fluid using a Heparin HP column,
using a salt gradient.
[0146] The term "antibody" refers to an intact antibody, or a
binding fragment thereof. An antibody may comprise a complete
antibody molecule (including polyclonal, monoclonal, chimeric,
humanized, or human versions having full length heavy and/or light
chains), or comprise an antigen binding fragment thereof. Antibody
fragments include F(ab').sub.2, Fab, Fab', Fv, Fc, and Fd
fragments, and can be incorporated into single domain antibodies,
single-chain antibodies, maxibodies, minibodies, intrabodies,
diabodies, triabodies, tetrabodies, v-NAR and bis-scFv (See e.g.,
Hollinger and Hudson, 2005, Nature Biotech., 23, 9, 1126-1136).
Antibody polypeptides are also disclosed in U.S. Pat. No.
6,703,199, including fibronectin polypeptide monobodies. Other
antibody polypeptides are disclosed in U.S. Patent Publication
2005/0238646, which are single-chain polypeptides.
[0147] Antigen binding fragments derived from an antibody can be
obtained, for example, by proteolytic hydrolysis of the antibody,
for example, pepsin or papain digestion of whole antibodies
according to conventional methods. By way of example, antibody
fragments can be produced by enzymatic cleavage of antibodies with
pepsin to provide a 5S fragment termed F(ab').sub.2. This fragment
can be further cleaved using a thiol reducing agent to produce 3.5S
Fab' monovalent fragments. Optionally, the cleavage reaction can be
performed using a blocking group for the sulfhydryl groups that
result from cleavage of disulfide linkages. As an alternative, an
enzymatic cleavage using papain produces two monovalent Fab
fragments and an Fc fragment directly. These methods are described,
for example, by Goldenberg, U.S. Pat. No. 4,331,647, Nisonoff et
al., Arch. Biochem. Biophys. 89:230, 1960; Porter, Biochem. J.
73:119, 1959; Edelman et al., in Methods in Enzymology 1:422
(Academic Press 1967); and by Andrews, S. M. and Titus, J. A. in
Current Protocols in Immunology (Coligan J. E., et al., eds), John
Wiley & Sons, New York (2003), pages 2.8.1-2.8.10 and
2.10A.1-2.10A.5. Other methods for cleaving antibodies, such as
separating heavy chains to form monovalent light-heavy chain
fragments (Fd), further cleaving of fragments, or other enzymatic,
chemical, or genetic techniques may also be used, so long as the
fragments bind to the antigen that is recognized by the intact
antibody.
[0148] An antibody fragment may also be any synthetic or
genetically engineered protein. For example, antibody fragments
include isolated fragments consisting of the light chain variable
region, "Fv" fragments consisting of the variable regions of the
heavy and light chains, recombinant single chain polypeptide
molecules in which light and heavy variable regions are connected
by a peptide linker (scFv proteins).
[0149] Another form of an antibody fragment is a peptide comprising
one or more complementarity determining regions (CDRs) of an
antibody. CDRs (also termed "minimal recognition units", or
"hypervariable region") can be obtained by constructing
polynucleotides that encode the CDR of interest. Such
polynucleotides are prepared, for example, by using the polymerase
chain reaction to synthesize the variable region using mRNA of
antibody-producing cells as a template (see, for example, Larrick
et al., Methods: A Companion to Methods in Enzymology 2:106, 1991;
Courtenay-Luck, "Genetic Manipulation of Monoclonal Antibodies," in
Monoclonal Antibodies: Production, Engineering and Clinical
Application, Ritter et al. (eds.), page 166 (Cambridge University
Press 1995); and Ward et al., "Genetic Manipulation and Expression
of Antibodies," in Monoclonal Antibodies: Principles and
Applications, Birch et al., (eds.), page 137 (Wiley-Liss, Inc.
1995)).
[0150] Thus, in one embodiment, the binding agent comprises at
least one CDR as described herein. The binding agent may comprise
at least two, three, four, five or six CDR's as described herein.
The binding agent further may comprise at least one variable region
domain of an antibody described herein. The variable region domain
may be of any size or amino acid composition and will generally
comprise at least one CDR sequence responsible for binding to human
activin A, for example CDR-H1, CDR-H2, CDR-H3 and/or the light
chain CDRs specifically described herein and which is adjacent to
or in frame with one or more framework sequences. In general terms,
the variable (V) region domain may be any suitable arrangement of
immunoglobulin heavy (V.sub.H) and/or light (V.sub.L) chain
variable domains. Thus, for example, the V region domain may be
monomeric and be a V.sub.H or V.sub.L domain, which is capable of
independently binding human activin A with an affinity at least
equal to 1.times.10.sup.-7M or less as described below.
Alternatively, the V region domain may be dimeric and contain
V.sub.H-V.sub.H, V.sub.H-V.sub.L, or V.sub.L-V.sub.L, dimers. The V
region dimer comprises at least one V.sub.H and at least one
V.sub.L chain that may be non-covalently associated (hereinafter
referred to as F.sub.V). If desired, the chains may be covalently
coupled either directly, for example via a disulfide bond between
the two variable domains, or through a linker, for example a
peptide linker, to form a single chain Fv (scF.sub.V).
[0151] The variable region domain may be any naturally occurring
variable domain or an engineered version thereof. By engineered
version is meant a variable region domain that has been created
using recombinant DNA engineering techniques. Such engineered
versions include those created, for example, from a specific
antibody variable region by insertions, deletions, or changes in or
to the amino acid sequences of the specific antibody. Particular
examples include engineered variable region domains containing at
least one CDR and optionally one or more framework amino acids from
a first antibody and the remainder of the variable region domain
from a second antibody.
[0152] The variable region domain may be covalently attached at a
C-terminal amino acid to at least one other antibody domain or a
fragment thereof. Thus, for example, a VH domain that is present in
the variable region domain may be linked to an immunoglobulin CH1
domain, or a fragment thereof. Similarly a V.sub.L domain may be
linked to a C.sub.K domain or a fragment thereof. In this way, for
example, the antibody may be a Fab fragment wherein the antigen
binding domain contains associated V.sub.H and V.sub.L domains
covalently linked at their C-termini to a CH1 and C.sub.K domain,
respectively. The CH1 domain may be extended with further amino
acids, for example to provide a hinge region or a portion of a
hinge region domain as found in a Fab' fragment, or to provide
further domains, such as antibody CH2 and CH3 domains.
[0153] As described herein, antibodies comprise at least one of
these CDRs. For example, one or more CDR may be incorporated into
known antibody framework regions (IgG1, IgG2, etc.), or conjugated
to a suitable vehicle to enhance the half-life thereof. Suitable
vehicles include, but are not limited to Fc, polyethylene glycol
(PEG), albumin, transferrin, and the like. These and other suitable
vehicles are known in the art. Such conjugated CDR peptides may be
in monomeric, dimeric, tetrameric, or other form. In one
embodiment, one or more water-soluble polymer is bonded at one or
more specific position, for example at the amino terminus, of a
binding agent.
[0154] In certain preferred embodiments, an antibody comprises one
or more water soluble polymer attachments, including, but not
limited to, polyethylene glycol, polyoxyethylene glycol, or
polypropylene glycol. See, e.g., U.S. Pat. Nos. 4,640,835,
4,496,689, 4,301,144, 4,670,417, 4,791,192 and 4,179,337. In
certain embodiments, a derivative binding agent comprises one or
more of monomethoxy-polyethylene glycol, dextran, cellulose, or
other carbohydrate based polymers, poly-(N-vinyl
pyrrolidone)-polyethylene glycol, propylene glycol homopolymers, a
polypropylene oxide/ethylene oxide co-polymer, polyoxyethylated
polyols (e.g., glycerol) and polyvinyl alcohol, as well as mixtures
of such polymers. In certain embodiments, one or more water-soluble
polymer is randomly attached to one or more side chains. In certain
embodiments, PEG can act to improve the therapeutic capacity for a
binding agent, such as an antibody. Certain such methods are
discussed, for example, in U.S. Pat. No. 6,133,426, which is hereby
incorporated by reference for any purpose.
[0155] It will be appreciated that an antibody of the present
invention may have at least one amino acid substitution, providing
that the antibody retains binding specificity. Therefore,
modifications to the antibody structures are encompassed within the
scope of the invention. These may include amino acid substitutions,
which may be conservative or non-conservative, that do not destroy
the activin A binding capability of an antibody. Conservative amino
acid substitutions may encompass non-naturally occurring amino acid
residues, which are typically incorporated by chemical peptide
synthesis rather than by synthesis in biological systems. These
include peptidomimetics and other reversed or inverted forms of
amino acid moieties. A conservative amino acid substitution may
also involve a substitution of a native amino acid residue with a
normative residue such that there is little or no effect on the
polarity or charge of the amino acid residue at that position.
[0156] Non-conservative substitutions may involve the exchange of a
member of one class of amino acids or amino acid mimetics for a
member from another class with different physical properties (e.g.,
size, polarity, hydrophobicity, charge). Such substituted residues
may be introduced into regions of the human antibody that are
homologous with non-human antibodies, or into the non-homologous
regions of the molecule.
[0157] Moreover, one skilled in the art may generate test variants
containing a single amino acid substitution at each desired amino
acid residue. The variants can then be screened using activity
assays known to those skilled in the art. Such variants could be
used to gather information about suitable variants. For example, if
one discovered that a change to a particular amino acid residue
resulted in destroyed, undesirably reduced, or unsuitable activity,
variants with such a change may be avoided. In other words, based
on information gathered from such routine experiments, one skilled
in the art can readily determine the amino acids where further
substitutions should be avoided either alone or in combination with
other mutations.
[0158] A skilled artisan will be able to determine suitable
variants of the polypeptide as set forth herein using well-known
techniques. In certain embodiments, one skilled in the art may
identify suitable areas of the molecule that may be changed without
destroying activity by targeting regions not believed to be
important for activity. In certain embodiments, one can identify
residues and portions of the molecules that are conserved among
similar polypeptides. In certain embodiments, even areas that may
be important for biological activity or for structure may be
subject to conservative amino acid substitutions without destroying
the biological activity or without adversely affecting the
polypeptide structure.
[0159] Additionally, one skilled in the art can review
structure-function studies identifying residues in similar
polypeptides that are important for activity or structure. In view
of such a comparison, one can predict the importance of amino acid
residues in a protein that correspond to amino acid residues which
are important for activity or structure in similar proteins. One
skilled in the art may opt for chemically similar amino acid
substitutions for such predicted important amino acid residues.
[0160] One skilled in the art can also analyze the
three-dimensional structure and amino acid sequence in relation to
that structure in similar polypeptides. In view of such
information, one skilled in the art may predict the alignment of
amino acid residues of an antibody with respect to its three
dimensional structure. In certain embodiments, one skilled in the
art may choose not to make radical changes to amino acid residues
predicted to be on the surface of the protein, since such residues
may be involved in important interactions with other molecules.
[0161] A number of scientific publications have been devoted to the
prediction of secondary structure. See Moult J., Curr. Op. in
Biotech., 7(4):422-427 (1996), Chou et al., Biochem., 13(2):222-245
(1974); Chou et al., Biochem., 113(2):211-222 (1974); Chou et al.,
Adv. Enzymol. Relat. Areas Mol. Biol., 47:45-148 (1978); Chou et
al., Ann. Rev. Biochem., 47:251-276 and Chou et al., Biophys. J.,
26:367-384 (1979). Moreover, computer programs are currently
available to assist with predicting secondary structure. One method
of predicting secondary structure is based upon homology modeling.
For example, two polypeptides or proteins which have a sequence
identity of greater than 30%, or similarity greater than 40% often
have similar structural topologies. The recent growth of the
protein structural database (PDB) has provided enhanced
predictability of secondary structure, including the potential
number of folds within a polypeptide's or protein's structure. See
Holm et al., Nucl. Acid. Res., 27(1):244-247 (1999). It has been
suggested (Brenner et al., Curr. Op. Struct. Biol., 7(3):369-376
(1997)) that there are a limited number of folds in a given
polypeptide or protein and that once a critical number of
structures have been resolved, structural prediction will become
dramatically more accurate.
[0162] Additional methods of predicting secondary structure include
"threading" (Jones, D., Curr. Opin. Struct. Biol., 7(3):377-87
(1997); Sippl et al., Structure, 4(1):15-19 (1996)), "profile
analysis" (Bowie et al., Science, 253:164-170 (1991); Gribskov et
al., Meth. Enzym., 183:146-159 (1990); Gribskov et al., Proc. Nat.
Acad. Sci., 84(13):4355-4358 (1987)), and "evolutionary linkage"
(See Holm, supra (1999), and Brenner, supra (1997)).
[0163] In certain embodiments, variants of antibodies include
glycosylation variants wherein the number and/or type of
glycosylation site has been altered compared to the amino acid
sequences of a parent polypeptide. In certain embodiments, variants
comprise a greater or a lesser number of N-linked glycosylation
sites than the native protein. An N-linked glycosylation site is
characterized by the sequence: Asn-X-Ser or Asn-X-Thr, wherein the
amino acid residue designated as X may be any amino acid residue
except proline. The substitution of amino acid residues to create
this sequence provides a potential new site for the addition of an
N-linked carbohydrate chain. Alternatively, substitutions which
eliminate this sequence will remove an existing N-linked
carbohydrate chain. Also provided is a rearrangement of N-linked
carbohydrate chains wherein one or more N-linked glycosylation
sites (typically those that are naturally occurring) are eliminated
and one or more new N-linked sites are created. Additional
preferred antibody variants include cysteine variants wherein one
or more cysteine residues are deleted from or substituted for
another amino acid (e.g., serine) as compared to the parent amino
acid sequence. Cysteine variants may be useful when antibodies must
be refolded into a biologically active conformation such as after
the isolation of insoluble inclusion bodies. Cysteine variants
generally have fewer cysteine residues than the native protein, and
typically have an even number to minimize interactions resulting
from unpaired cysteines.
[0164] Desired amino acid substitutions (whether conservative or
non-conservative) can be determined by those skilled in the art at
the time such substitutions are desired. In certain embodiments,
amino acid substitutions can be used to identify important residues
of antibodies to activin A, or to increase or decrease the affinity
of the antibodies to activin A described herein.
[0165] According to certain embodiments, preferred amino acid
substitutions are those which: (1) reduce susceptibility to
proteolysis, (2) reduce susceptibility to oxidation, (3) alter
binding affinity for forming protein complexes, (4) alter binding
affinities, and/or (4) confer or modify other physiochemical or
functional properties on such polypeptides. According to certain
embodiments, single or multiple amino acid substitutions (in
certain embodiments, conservative amino acid substitutions) may be
made in the naturally-occurring sequence (in certain embodiments,
in the portion of the polypeptide outside the domain(s) forming
intermolecular contacts). In certain embodiments, a conservative
amino acid substitution typically may not substantially change the
structural characteristics of the parent sequence (e.g., a
replacement amino acid should not tend to break a helix that occurs
in the parent sequence, or disrupt other types of secondary
structure that characterizes the parent sequence). Examples of
art-recognized polypeptide secondary and tertiary structures are
described in Proteins, Structures and Molecular Principles
(Creighton, Ed., W. H. Freeman and Company, New York (1984));
Introduction to Protein Structure (C. Branden and J. Tooze, eds.,
Garland Publishing, New York, N.Y. (1991)); and Thornton et al.
Nature 354:105 (1991), which are each incorporated herein by
reference.
[0166] In certain embodiments, antibodies of the invention may be
chemically bonded with polymers, lipids, or other moieties.
[0167] The binding agents may comprise at least one of the CDRs
described herein incorporated into a biocompatible framework
structure. In one example, the biocompatible framework structure
comprises a polypeptide or portion thereof that is sufficient to
form a conformationally stable structural support, or framework, or
scaffold, which is able to display one or more sequences of amino
acids that bind to an antigen (e.g., CDRs, a variable region, etc.)
in a localized surface region. Such structures can be a naturally
occurring polypeptide or polypeptide "fold" (a structural motif),
or can have one or more modifications, such as additions, deletions
or substitutions of amino acids, relative to a naturally occurring
polypeptide or fold. These scaffolds can be derived from a
polypeptide of any species (or of more than one species), such as a
human, other mammal, other vertebrate, invertebrate, plant,
bacteria or virus.
[0168] Typically the biocompatible framework structures are based
on protein scaffolds or skeletons other than immunoglobulin
domains. For example, those based on fibronectin, ankyrin,
lipocalin, neocarzinostain, cytochrome b, CP1 zinc finger, PST1,
coiled coil, LACI-D1, Z domain and tendamistat domains may be used
(See e.g., Nygren and Uhlen, 1997, Curr. Opin. in Struct. Biol., 7,
463-469).
[0169] It will be appreciated that the antibodies of the invention
include the humanized antibodies described herein. Humanized
antibodies such as those described herein can be produced using
techniques known to those skilled in the art (Zhang, W., et al.,
Molecular Immunology. 42(12):1445-1451, 2005; Hwang W. et al.,
Methods. 36(1):35-42, 2005; Dall'Acqua W F, et al., Methods
36(1):43-60, 2005; and Clark, M., Immunology Today. 21(8):397-402,
2000).
[0170] Additionally, one skilled in the art will recognize that
suitable binding agents include portions of these antibodies, such
as one or more of CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and CDR-L3
as specifically disclosed herein. At least one of the regions of
CDR-H1, CDR-H2, CDR-H3, CDR-L1, CDR-L2 and CDR-L3 may have at least
one amino acid substitution, provided that the antibody retains the
binding specificity of the non-substituted CDR. The non-CDR portion
of the antibody may be a non-protein molecule, wherein the binding
agent cross-blocks the binding of an antibody disclosed herein to
activin A and/or neutralizes activin A. The non-CDR portion of the
antibody may be a non-protein molecule in which the antibody
exhibits a similar binding pattern to human activin A peptides in a
competition binding assay as that exhibited by at least one of
antibodies A1-A14, and/or neutralizes activin A. The non-CDR
portion of the antibody may be composed of amino acids, wherein the
antibody is a recombinant binding protein or a synthetic peptide,
and the recombinant binding protein cross-blocks the binding of an
antibody disclosed herein to activin A and/or neutralizes activin
A. The non-CDR portion of the antibody may be composed of amino
acids, wherein the antibody is a recombinant antibody, and the
recombinant antibody exhibits a similar binding pattern to human
activin A peptides in the human activin A peptide epitope
competition binding assay (described hereinbelow) as that exhibited
by at least one of the antibodies A1-A14, and/or neutralizes
activin A.
[0171] Where an antibody comprises one or more of CDR-H1, CDR-H2,
CDR-H3, CDR-L1, CDR-L2 and CDR-L3 as described above, it may be
obtained by expression from a host cell containing DNA coding for
these sequences. A DNA coding for each CDR sequence may be
determined on the basis of the amino acid sequence of the CDR and
synthesized together with any desired antibody variable region
framework and constant region DNA sequences using oligonucleotide
synthesis techniques, site-directed mutagenesis and polymerase
chain reaction (PCR) techniques as appropriate. DNA coding for
variable region frameworks and constant regions is widely available
to those skilled in the art from genetic sequences databases such
as GenBank.RTM..
[0172] Once synthesized, the DNA encoding an antibody of the
invention or fragment thereof may be propagated and expressed
according to any of a variety of well-known procedures for nucleic
acid excision, ligation, transformation, and transfection using any
number of known expression vectors. Thus, in certain embodiments
expression of an antibody fragment may be preferred in a
prokaryotic host, such as Escherichia coli (see, e.g., Pluckthun et
al., 1989 Methods Enzymol. 178:497-515). In certain other
embodiments, expression of the antibody or a fragment thereof may
be preferred in a eukaryotic host cell, including yeast (e.g.,
Saccharomyces cerevisiae, Schizosaccharomyces pombe, and Pichia
pastoris), animal cells (including mammalian cells) or plant cells.
Examples of suitable animal cells include, but are not limited to,
myeloma (such as a mouse NSO line), COS, CHO, or hybridoma cells.
Examples of plant cells include tobacco, corn, soybean, and rice
cells.
[0173] One or more replicable expression vectors containing DNA
encoding an antibody variable and/or constant region may be
prepared and used to transform an appropriate cell line, for
example, a non-producing myeloma cell line, such as a mouse NSO
line or a bacteria, such as E. coli, in which production of the
antibody will occur. In order to obtain efficient transcription and
translation, the DNA sequence in each vector should include
appropriate regulatory sequences, particularly a promoter and
leader sequence operatively linked to the variable domain sequence.
Particular methods for producing antibodies in this way are
generally well-known and routinely used. For example, basic
molecular biology procedures are described by Maniatis et al.
(Molecular Cloning, A Laboratory Manual, 2nd ed., Cold Spring
Harbor Laboratory, New York, 1989; see also Maniatis et al, 3rd
ed., Cold Spring Harbor Laboratory, New York, (2001)). DNA
sequencing can be performed as described in Sanger et al. (PNAS
74:5463, (1977)) and the Amersham International plc sequencing
handbook, and site directed mutagenesis can be carried out
according to methods known in the art (Kramer et al., Nucleic Acids
Res. 12:9441, (1984); Kunkel Proc. Natl. Acad. Sci. USA 82:488-92
(1985); Kunkel et al., Methods in Enzymol. 154:367-82 (1987); the
Anglian Biotechnology Ltd. handbook). Additionally, numerous
publications describe techniques suitable for the preparation of
antibodies by manipulation of DNA, creation of expression vectors,
and transformation and culture of appropriate cells (Mountain A and
Adair, J R in Biotechnology and Genetic Engineering Reviews (ed.
Tombs, M P, 10, Chapter 1, 1992, Intercept, Andover, UK); "Current
Protocols in Molecular Biology", 1999, F. M. Ausubel (ed.), Wiley
Interscience, New York).
[0174] Where it is desired to improve the affinity of antibodies
according to the invention containing one or more of the
above-mentioned CDRs can be obtained by a number of affinity
maturation protocols including maintaining the CDRs (Yang et al.,
J. Mol. Biol., 254, 392-403, 1995), chain shuffling (Marks et al.,
Bio/Technology, 10, 779-783, 1992), use of mutation strains of E.
coli. (Low et al., J. Mol. Biol., 250, 350-368, 1996), DNA
shuffling (Patten et al., Curr. Opin. Biotechnol., 8, 724-733,
1997), phage display (Thompson et al., J. Mol. Biol., 256, 7-88,
1996) and sexual PCR (Crameri, et al., Nature, 391, 288-291, 1998).
All of these methods of affinity maturation are discussed by
Vaughan et al. (Nature Biotech., 16, 535-539, 1998).
[0175] Other antibodies according to the invention may be obtained
by conventional immunization and cell fusion procedures as
described herein and known in the art. Monoclonal antibodies of the
invention may be generated using a variety of known techniques. In
general, monoclonal antibodies that bind to specific antigens may
be obtained by methods known to those skilled in the art (see, for
example, Kohler et al., Nature 256:495, 1975; Coligan et al.
(eds.), Current Protocols in Immunology, 1:2.5.12.6.7 (John Wiley
& Sons 1991); U.S. Pat. Nos. RE 32,011, 4,902,614, 4,543,439,
and 4,411,993; Monoclonal Antibodies, Hybridomas: A New Dimension
in Biological Analyses, Plenum Press, Kennett, McKearn, and Bechtol
(eds.) (1980); and Antibodies: A Laboratory Manual, Harlow and Lane
(eds.), Cold Spring Harbor Laboratory Press (1988); Picksley et
al., "Production of monoclonal antibodies against proteins
expressed in E. coli," in DNA Cloning 2: Expression Systems, 2nd
Edition, Glover et al. (eds.), page 93 (Oxford University Press
1995)). Antibody fragments may be derived therefrom using any
suitable standard technique such as proteolytic digestion, or
optionally, by proteolytic digestion (for example, using papain or
pepsin) followed by mild reduction of disulfide bonds and
alkylation. Alternatively, such fragments may also be generated by
recombinant genetic engineering techniques as described herein.
[0176] Monoclonal antibodies can be obtained by injecting an
animal, for example, a rat, hamster, a rabbit, or preferably a
mouse, including for example a transgenic or a knock-out, as known
in the art, with an immunogen comprising human activin A of (SEQ ID
NO:225), or a fragment thereof, according to methods known in the
art and described herein. The presence of specific antibody
production may be monitored after the initial injection and/or
after a booster injection by obtaining a serum sample and detecting
the presence of an antibody that binds to human activin A or
peptide using any one of several immunodetection methods known in
the art and described herein. From animals producing the desired
antibodies, lymphoid cells, most commonly cells from the spleen or
lymph node, are removed to obtain B-lymphocytes. The B lymphocytes
are then fused with a drug-sensitized myeloma cell fusion partner,
preferably one that is syngeneic with the immunized animal and that
optionally has other desirable properties (e.g., inability to
express endogenous Ig gene products, e.g., P3X63-Ag 8.653 (ATCC No.
CRL 1580); NSO, SP20) to produce hybridomas, which are immortal
eukaryotic cell lines.
[0177] The lymphoid (e.g., spleen) cells and the myeloma cells may
be combined for a few minutes with a membrane fusion-promoting
agent, such as polyethylene glycol or a nonionic detergent, and
then plated at low density on a selective medium that supports the
growth of hybridoma cells but not unfused myeloma cells. A
preferred selection media is HAT (hypoxanthine, aminopterin,
thymidine). After a sufficient time, usually about one to two
weeks, colonies of cells are observed. Single colonies are
isolated, and antibodies produced by the cells may be tested for
binding activity to human activin A, using any one of a variety of
immunoassays known in the art and described herein. The hybridomas
are cloned (e.g., by limited dilution cloning or by soft agar
plaque isolation) and positive clones that produce an antibody
specific to activin A are selected and cultured. The monoclonal
antibodies from the hybridoma cultures may be isolated from the
supernatants of hybridoma cultures.
[0178] An alternative method for production of a murine monoclonal
antibody is to inject the hybridoma cells into the peritoneal
cavity of a syngeneic mouse, for example, a mouse that has been
treated (e.g., pristane-primed) to promote formation of ascites
fluid containing the monoclonal antibody. Monoclonal antibodies can
be isolated and purified by a variety of well-established
techniques. Such isolation techniques include affinity
chromatography with Protein-A Sepharose, size-exclusion
chromatography, and ion-exchange chromatography (see, for example,
Coligan at pages 2.7.1-2.7.12 and pages 2.9.1-2.9.3; Baines et al.,
"Purification of Immunoglobulin G (IgG)," in Methods in Molecular
Biology, Vol. 10, pages 79-104 (The Humana Press, Inc. 1992)).
Monoclonal antibodies may be purified by affinity chromatography
using an appropriate ligand selected based on particular properties
of the antibody (e.g., heavy or light chain isotype, binding
specificity, etc.). Examples of a suitable ligand, immobilized on a
solid support, include Protein A, Protein G, an anticonstant region
(light chain or heavy chain) antibody, an anti-idiotype antibody,
and a TGF-beta binding protein, or fragment or variant thereof.
[0179] An antibody of the present invention may also be a fully
human monoclonal antibody. An isolated fully human antibody is
provided that specifically binds to the cysteine knot region (amino
acids C11-S33 and/or amino acids C81-E111) of activin A, wherein
the antigen binding protein possesses at least one in vivo
biological activity of a human anti-activin A antibody. The
biological activity may be attenuation of cachexia, for example
cachexia in colon cancer, such as in a mouse model of colon cancer
described herein. The cachexia amenable to such treatment is
associated with loss of body weight, loss of muscle mass, and/or
loss of fat mass. The cachexia may be associated with rheumatoid
arthritis, such as in a collagen-induced animal model of rheumatoid
arthritis. Treatment with a fully human antibody described herein
ameliorates the loss of body weight, the loss of muscle mass,
and/or the loss of fat mass in vivo in a collagen-induced animal
model of rheumatoid arthritis. A fully human antibody described
herein ameliorates the loss of body weight in a AAV-activin A
transfected animal model. A fully human antibody described herein,
that specifically binds to the cysteine knot region (amino acids
C11-S33 and/or amino acids C81-E111) of activin A, inhibits the
binding of activin A to activin A receptor in vitro. A fully human
isolated antibody that specifically binds to the cysteine knot
region (amino acids C11-S33 and/or amino acids C81-E111) of activin
A, inhibits the binding of activin A to activin A receptor in
vivo.
[0180] Fully human monoclonal antibodies may be generated by any
number of techniques with which those having ordinary skill in the
art will be familiar. Such methods include, but are not limited to,
Epstein Barr Virus (EBV) transformation of human peripheral blood
cells (e.g., containing B lymphocytes), in vitro immunization of
human B-cells, fusion of spleen cells from immunized transgenic
mice carrying inserted human immunoglobulin genes, isolation from
human immunoglobulin V region phage libraries, or other procedures
as known in the art and based on the disclosure herein. For
example, fully human monoclonal antibodies may be obtained from
transgenic mice that have been engineered to produce specific human
antibodies in response to antigenic challenge. Methods for
obtaining fully human antibodies from transgenic mice are
described, for example, by Green et al., Nature Genet. 7:13, 1994;
Lonberg et al., Nature 368:856, 1994; Taylor et al., Int. Immun.
6:579, 1994; U.S. Pat. No. 5,877,397; Bruggemann et al., 1997 Curr.
Opin. Biotechnol. 8:455-58; Jakobovits et al., 1995 Ann. N.Y. Acad.
Sci. 764:525-35. In this technique, elements of the human heavy and
light chain locus are introduced into strains of mice derived from
embryonic stem cell lines that contain targeted disruptions of the
endogenous heavy chain and light chain loci (see also Bruggemann et
al., Curr. Opin. Biotechnol. 8:455-58 (1997)). For example, human
immunoglobulin transgenes may be mini-gene constructs, or transloci
on yeast artificial chromosomes, which undergo B-cell-specific DNA
rearrangement and hypermutation in the mouse lymphoid tissue. Fully
human monoclonal antibodies may be obtained by immunizing the
transgenic mice, which may then produce human antibodies specific
for activin A. Lymphoid cells of the immunized transgenic mice can
be used to produce human antibody-secreting hybridomas according to
the methods described herein. Polyclonal sera containing fully
human antibodies may also be obtained from the blood of the
immunized animals.
[0181] Another method for generating human antibodies of the
invention includes immortalizing human peripheral blood cells by
EBV transformation. See, e.g., U.S. Pat. No. 4,464,456. Such an
immortalized B-cell line (or lymphoblastoid cell line) producing a
monoclonal antibody that specifically binds to activin A can be
identified by immunodetection methods as provided herein, for
example, an ELISA, and then isolated by standard cloning
techniques. The stability of the lymphoblastoid cell line producing
an anti-activin A antibody may be improved by fusing the
transformed cell line with a murine myeloma to produce a
mouse-human hybrid cell line according to methods known in the art
(see, e.g., Glasky et al., Hybridoma 8:377-89 (1989)). Still
another method to generate human monoclonal antibodies is in vitro
immunization, which includes priming human splenic B-cells with
human activin A, followed by fusion of primed B-cells with a
heterohybrid fusion partner. See, e.g., Boerner et al., 1991 J.
Immunol. 147:86-95.
[0182] In certain embodiments, a B-cell that is producing an
anti-human activin A antibody is selected and the light chain and
heavy chain variable regions are cloned from the B-cell according
to molecular biology techniques known in the art (WO 92/02551; U.S.
Pat. No. 5,627,052; Babcook et al., Proc. Natl. Acad. Sci. USA
93:7843-48 (1996)) and described herein. B-cells from an immunized
animal may be isolated from the spleen, lymph node, or peripheral
blood sample by selecting a cell that is producing an antibody that
specifically binds to activin A. B-cells may also be isolated from
humans, for example, from a peripheral blood sample. Methods for
detecting single B-cells that are producing an antibody with the
desired specificity are well known in the art, for example, by
plaque formation, fluorescence-activated cell sorting, in vitro
stimulation followed by detection of specific antibody, and the
like. Methods for selection of specific antibody-producing B-cells
include, for example, preparing a single cell suspension of B-cells
in soft agar that contains human activin A. Binding of the specific
antibody produced by the B-cell to the antigen results in the
formation of a complex, which may be visible as an
immunoprecipitate. After the B-cells producing the desired antibody
are selected, the specific antibody genes may be cloned by
isolating and amplifying DNA or mRNA according to methods known in
the art and described herein.
[0183] An additional method for obtaining antibodies of the
invention is by phage display. See, e.g., Winter et al., 1994 Annu.
Rev. Immunol. 12:433-55; Burton et al., 1994 Adv. Immunol.
57:191-280. Human or murine immunoglobulin variable region gene
combinatorial libraries may be created in phage vectors that can be
screened to select Ig fragments (Fab, Fv, sFv, or multimers
thereof) that bind specifically to TGF-beta binding protein or
variant or fragment thereof. See, e.g., U.S. Pat. No. 5,223,409;
Huse et al., 1989 Science 246:1275-81; Sastry et al., Proc. Natl.
Acad. Sci. USA 86:5728-32 (1989); Alting-Mees et al., Strategies in
Molecular Biology 3:1-9 (1990); Kang et al., 1991 Proc. Natl. Acad.
Sci. USA 88:4363-66; Hoogenboom et al., 1992 J. Molec. Biol.
227:381-388; Schlebusch et al., 1997 Hybridoma 16:47-52 and
references cited therein. For example, a library containing a
plurality of polynucleotide sequences encoding Ig variable region
fragments may be inserted into the genome of a filamentous
bacteriophage, such as M13 or a variant thereof, in frame with the
sequence encoding a phage coat protein. A fusion protein may be a
fusion of the coat protein with the light chain variable region
domain and/or with the heavy chain variable region domain.
According to certain embodiments, immunoglobulin Fab fragments may
also be displayed on a phage particle (see, e.g., U.S. Pat. No.
5,698,426).
[0184] Heavy and light chain immunoglobulin cDNA expression
libraries may also be prepared in lambda phage, for example, using
.lamda.ImmunoZap.TM.(H) and .lamda.ImmunoZap.TM.(L) vectors
(Stratagene, La Jolla, Calif.). Briefly, mRNA is isolated from a
B-cell population, and used to create heavy and light chain
immunoglobulin cDNA expression libraries in the .lamda.ImmunoZap(H)
and .lamda.ImmunoZap(L) vectors. These vectors may be screened
individually or co-expressed to form Fab fragments or antibodies
(see Huse et al., supra; see also Sastry et al., supra). Positive
plaques may subsequently be converted to a non-lytic plasmid that
allows high level expression of monoclonal antibody fragments from
E. coli.
[0185] In one embodiment, in a hybridoma the variable regions of a
gene expressing a monoclonal antibody of interest are amplified
using nucleotide primers. These primers may be synthesized by one
of ordinary skill in the art, or may be purchased from commercially
available sources. (See, e.g., Stratagene (La Jolla, Calif.), which
sells primers for mouse and human variable regions including, among
others, primers for V.sub.Ha, V.sub.Hb, V.sub.Hc, V.sub.Hd,
C.sub.H1, V.sub.L and C.sub.L regions.) These primers may be used
to amplify heavy or light chain variable regions, which may then be
inserted into vectors such as ImmunoZAP.TM.H or ImmunoZAP.TM.L
(Stratagene), respectively. These vectors may then be introduced
into E. coli, yeast, or mammalian-based systems for expression.
Large amounts of a single-chain protein containing a fusion of the
V.sub.H and V.sub.L domains may be produced using these methods
(see Bird et al., Science 242:423-426, 1988).
[0186] Once cells producing antibodies according to the invention
have been obtained using any of the above-described immunization
and other techniques, the specific antibody genes may be cloned by
isolating and amplifying DNA or mRNA therefrom according to
standard procedures as described herein. The antibodies produced
therefrom may be sequenced and the CDRs identified and the DNA
coding for the CDRs may be manipulated as described previously to
generate other antibodies according to the invention.
[0187] Activin A binding agents of the present invention preferably
modulate activin A function in the cell-based assay described
herein and/or the in vivo assay described herein and/or bind to one
or more of the cysteine knot domains described herein and/or
cross-block the binding of one of the antibodies described in this
application and/or are cross-blocked from binding activin A by one
of the antibodies described in this application. Accordingly such
binding agents can be identified using the assays described
herein.
[0188] In certain embodiments, antibodies are generated by first
identifying antibodies that bind to one more of the cysteine knot
domains provided herein and/or neutralize in the cell-based and/or
in vivo assays described herein and/or cross-block the antibodies
described in this application and/or are cross-blocked from binding
activin A by one of the antibodies described in this application.
The CDR regions from these antibodies are then used to insert into
appropriate biocompatible frameworks to generate activin A binding
agents. The non-CDR portion of the binding agent may be composed of
amino acids, or may be a non-protein molecule. The assays described
herein allow the characterization of binding agents. Preferably the
binding agents of the present invention are antibodies as defined
herein.
[0189] It will be understood by one skilled in the art that some
proteins, such as antibodies, may undergo a variety of
posttranslational modifications. The type and extent of these
modifications often depends on the host cell line used to express
the protein as well as the culture conditions. Such modifications
may include variations in glycosylation, methionine oxidation,
diketopiperizine formation, aspartate isomerization and asparagine
deamidation. A frequent modification is the loss of a
carboxy-terminal basic residue (such as lysine or arginine) due to
the action of carboxypeptidases (as described in Harris, R. J.
Journal of Chromatography 705:129-134, 1995).
Nucleic Acids
[0190] In one aspect, the present invention provides isolated
nucleic acid molecules. The nucleic acids comprise, for example,
polynucleotides that encode all or part of an antigen binding
protein, for example, one or both chains of an antibody of the
invention, or a fragment, derivative, mutein, or variant thereof,
polynucleotides sufficient for use as hybridization probes, PCR
primers or sequencing primers for identifying, analyzing, mutating
or amplifying a polynucleotide encoding a polypeptide, anti-sense
nucleic acids for inhibiting expression of a polynucleotide, and
complementary sequences of the foregoing. The nucleic acids can be
any length. They can be, for example, 5, 10, 15, 20, 25, 30, 35,
40, 45, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450,
500, 750, 1,000, 1,500, 3,000, 5,000 or more nucleotides in length,
and/or can comprise one or more additional sequences, for example,
regulatory sequences, and/or be part of a larger nucleic acid, for
example, a vector. The nucleic acids can be single-stranded or
double-stranded and can comprise RNA and/or DNA nucleotides, and
artificial variants thereof (e.g., peptide nucleic acids).
[0191] Nucleic acids encoding antibody polypeptides (e.g., heavy or
light chain, variable domain only, or full length) may be isolated
from B-cells of mice that have been immunized with activin A. The
nucleic acid may be isolated by conventional procedures such as
polymerase chain reaction (PCR).
[0192] Nucleic acid sequences encoding the variable regions of the
heavy and light chain variable regions are shown above. The skilled
artisan will appreciate that, due to the degeneracy of the genetic
code, each of the polypeptide sequences disclosed herein is encoded
by a large number of other nucleic acid sequences. The present
invention provides each degenerate nucleotide sequence encoding
each antigen binding protein of the invention.
[0193] The invention further provides nucleic acids that hybridize
to other nucleic acids (e.g., nucleic acids comprising a nucleotide
sequence of any of A1-A14) under particular hybridization
conditions. Methods for hybridizing nucleic acids are well-known in
the art. See, e.g., Curr. Prot. in Mol. Biol., John Wiley &
Sons, N.Y. (1989), 6.3.1-6.3.6. As defined herein, a moderately
stringent hybridization condition uses a prewashing solution
containing 5.times. sodium chloride/sodium citrate (SSC), 0.5% SDS,
1.0 mM EDTA (pH 8.0), hybridization buffer of about 50% formamide,
6.times.SSC, and a hybridization temperature of 55.degree. C. (or
other similar hybridization solutions, such as one containing about
50% formamide, with a hybridization temperature of 42.degree. C.),
and washing conditions of 60.degree. C., in 0.5.times.SSC, 0.1%
SDS. A stringent hybridization condition hybridizes in 6.times.SSC
at 45.degree. C., followed by one or more washes in 0.1.times.SSC,
0.2% SDS at 68.degree. C. Furthermore, one of skill in the art can
manipulate the hybridization and/or washing conditions to increase
or decrease the stringency of hybridization such that nucleic acids
comprising nucleotide sequences that are at least 65, 70, 75, 80,
85, 90, 95, 98 or 99% identical to each other typically remain
hybridized to each other. The basic parameters affecting the choice
of hybridization conditions and guidance for devising suitable
conditions are set forth by, for example, Sambrook, Fritsch, and
Maniatis (1989, Molecular Cloning: A Laboratory Manual, Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and
11; and Curr. Prot. in Mol. Biol. 1995, Ausubel et al., eds., John
Wiley & Sons, Inc., sections 2.10 and 6.3-6.4), and can be
readily determined by those having ordinary skill in the art based
on, for example, the length and/or base composition of the DNA.
[0194] Changes can be introduced by mutation into a nucleic acid,
thereby leading to changes in the amino acid sequence of a
polypeptide (e.g., an antigen binding protein) that it encodes.
Mutations can be introduced using any technique known in the art.
In one embodiment, one or more particular amino acid residues are
changed using, for example, a site-directed mutagenesis protocol.
In another embodiment, one or more randomly selected residues is
changed using, for example, a random mutagenesis protocol. However
it is made, a mutant polypeptide can be expressed and screened for
a desired property (e.g., binding to activin A).
[0195] Mutations can be introduced into a nucleic acid without
significantly altering the biological activity of a polypeptide
that it encodes. For example, one can make nucleotide substitutions
leading to amino acid substitutions at non-essential amino acid
residues. In one embodiment, a nucleotide sequence provided herein
for A1-A14, or a desired fragment, variant, or derivative thereof,
is mutated such that it encodes an amino acid sequence comprising
one or more deletions or substitutions of amino acid residues that
are shown herein for A1-A14 to be residues where two or more
sequences differ. As described herein inter alia, A1-A14 refers to
14 sequences, A1, and A14, as well as the 12 intervening amino acid
residues. In another embodiment, the mutagenesis inserts an amino
acid adjacent to one or more amino acid residues shown herein for
A1-A14 to be residues where two or more sequences differ.
Alternatively, one or more mutations can be introduced into a
nucleic acid that selectively change the biological activity (e.g.,
binding of activin A) of a polypeptide that it encodes. For
example, the mutation can quantitatively or qualitatively change
the biological activity. Examples of quantitative changes include
increasing, reducing or eliminating the activity. Examples of
qualitative changes include changing the antigen specificity of an
antigen binding protein.
[0196] In another aspect, the present invention provides nucleic
acid molecules that are suitable for use as primers or
hybridization probes for the detection of nucleic acid sequences of
the invention. A nucleic acid molecule of the invention can
comprise only a portion of a nucleic acid sequence encoding a
full-length polypeptide of the invention, for example, a fragment
that can be used as a probe or primer or a fragment encoding an
active portion (e.g., an activin A binding portion) of a
polypeptide of the invention.
[0197] Probes based on the sequence of a nucleic acid of the
invention can be used to detect the nucleic acid or similar nucleic
acids, for example, transcripts encoding a polypeptide of the
invention. The probe can comprise a label group, e.g., a
radioisotope, a fluorescent compound, an enzyme, or an enzyme
co-factor. Such probes can be used to identify a cell that
expresses the polypeptide.
[0198] In another aspect, the present invention provides vectors
comprising a nucleic acid encoding a polypeptide of the invention
or a portion thereof. Examples of vectors include, but are not
limited to, plasmids, viral vectors, non-episomal mammalian vectors
and expression vectors, for example, recombinant expression
vectors.
[0199] The recombinant expression vectors of the invention can
comprise a nucleic acid of the invention in a form suitable for
expression of the nucleic acid in a host cell. The recombinant
expression vectors include one or more regulatory sequences,
selected on the basis of the host cells to be used for expression,
which is operably linked to the nucleic acid sequence to be
expressed. Regulatory sequences include those that direct
constitutive expression of a nucleotide sequence in many types of
host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus
promoter and cytomegalovirus promoter), those that direct
expression of the nucleotide sequence only in certain host cells
(e.g., tissue-specific regulatory sequences, see Voss et al., 1986,
Trends Biochem. Sci. 11:287, Maniatis et al., 1987, Science
236:1237, incorporated by reference herein in their entireties),
and those that direct inducible expression of a nucleotide sequence
in response to particular treatment or condition (e.g., the
metallothionin promoter in mammalian cells and the tet-responsive
and/or streptomycin responsive promoter in both prokaryotic and
eukaryotic systems (see id.). It will be appreciated by those
skilled in the art that the design of the expression vector can
depend on such factors as the choice of the host cell to be
transformed, the level of expression of protein desired, etc. The
expression vectors of the invention can be introduced into host
cells to thereby produce proteins or peptides, including fusion
proteins or peptides, encoded by nucleic acids as described
herein.
[0200] In another aspect, the present invention provides host cells
into which a recombinant expression vector of the invention has
been introduced. A host cell can be any prokaryotic cell (for
example, E. coli) or eukaryotic cell (for example, yeast, insect,
or mammalian cells (e.g., CHO cells)). Vector DNA can be introduced
into prokaryotic or eukaryotic cells via conventional
transformation or transfection techniques. For stable transfection
of mammalian cells, it is known that, depending upon the expression
vector and transfection technique used, only a small fraction of
cells may integrate the foreign DNA into their genome. In order to
identify and select these integrants, a gene that encodes a
selectable marker (e.g., for resistance to antibiotics) is
generally introduced into the host cells along with the gene of
interest. Preferred selectable markers include those which confer
resistance to drugs, such as G418, hygromycin and methotrexate.
Cells stably transfected with the introduced nucleic acid can be
identified by drug selection (e.g., cells that have incorporated
the selectable marker gene will survive, while the other cells
die), among other methods.
Indications
[0201] In one aspect, the present invention provides methods of
treating a subject. The method can, for example, have a generally
beneficial effect on the subject's health, e.g., it can increase
the subject's expected longevity. Alternatively, the method can,
for example, treat, prevent, cure, relieve, or ameliorate ("treat")
a disease, disorder, condition, or illness ("a condition"). Among
the conditions to be treated in accordance with the present
invention are conditions characterized by inappropriate expression
or activity of activin A. In some such conditions, the expression
or activity level is too high, and the treatment comprises
administering an activin A antagonist as described herein.
[0202] One example of a type of condition that can be treated using
the methods and compositions of the present invention is a
condition that involves cell growth, for example, a cancerous
condition which is accompanied by cachexia. Thus, in one
embodiment, the present invention provides compositions and methods
for treating a cancerous condition. In particular, the cancerous
condition is a gonadal cancer, including tumors of the ovary and
testis. (Fujii, Y. et al., Am. J. Phys. Endocrin. Metab.,
286:E927-E931, 2004; Reis, F. M. et al., J. Clin. Endocrin.
87:2277-2282, 2005.) Activin A is known for its action in
stimulating FSH biosynthesis and secretion in the pituitary gland,
and has a physiological role in the regulation of gonadal function.
Activin A has been associated with many types of human cancers and
in particular with tumors of the reproductive system. Specifically,
overexpression or deregulation of activin A has been implicated in
ovarian cancer, (Menon U, et al., BJOG: An International Journal of
Obstetrics & Gynaecology; 107(9):1069-74, 2000. Choi K C, et
al., Molecular & Cellular Endocrinology. 174(1-2):99-110, 2001;
Zheng W, et al., American Journal of Reproductive Immunology.
44(2):104-13, 2000; Lambert-Messerlian G M, et al., Gynecologic
Oncology. 74(1):93-7, 1999; Steller M D, et al., Molecular Cancer
Research: MCR. 3(1):50-61, 2005; Corbellis L., et al., Journal of
the Society for Gynecologic Investigation. 11(4):203-6, 2004; Welt
C K, et al., Journal of Clinical Endocrinology & Metabolism.
82(11):3720-7, 1997; and Harada K., et al., Journal of Clinical
Endocrinology & Metabolism. 81(6):2125-30, 1996, endometrial
adenocarcinoma Otani, T, et a., Gynecologic Oncology. 83(1):31-8,
2001; Tanaka T, et al., International Journal of Oncology.
23(3):657-63, 2003 and prostate cancer (Thomas T Z, et al., Journal
of Clinical Endocrinology & Metabolism. 82(11):3851-8, 1997;
Zhang, Z, et al., Biochemical & Biophysical Research
Communications. 234(2):362-5, 1997; and Risbridger G P, et al.,
Molecular & Cellular Endocrinology. 180(1-2):149-53, 2001
[0203] The cancerous condition can be any cancerous condition that
can be treated using the compositions comprised herein, for
example, activin A antigen binding proteins such as anti-activin A
antibodies, antibody fragments, or antibody derivatives. Examples
of cancerous conditions include, for example, acute lymphoblastic
leukemia, adrenocortical carcinoma, AIDS-related cancers,
AIDS-related lymphoma, anal cancer, childhood cerebellar
astrocytoma, childhood cerebral astrocytoma, basal cell carcinoma,
extrahepatic bile duct cancer, bladder cancer,
osteosarcoma/malignant fibrous histiocytoma bone cancer, brain
tumors (e.g., brain stem glioma, cerebellar astrocytoma, cerebral
astrocytoma/malignant glioma, ependymoma, medulloblastoma,
supratentorial primitive neuroectodermal tumors, visual pathway and
hypothalamic glioma), breast cancer, bronchial adenomas/carcinoids,
Burkitt's Lymphoma, carcinoid tumor, gastrointestinal carcinoid
tumor, carcinoma of unknown primary, primary central nervous
system, cerebellar astrocytoma, cerebral astrocytoma/malignant
glioma, cervical cancer, childhood cancers, chronic lymphocytic
leukemia, chronic myelogenous leukemia, chronic myeloproliferative
disorders, colon cancer, colorectal cancer, cutaneous t-cell
lymphoma, endometrial cancer, ependymoma, esophageal cancer,
ewing's family of tumors, extracranial germ cell tumor,
extragonadal germ cell tumor, extrahepatic bile duct cancer,
intraocular melanoma eye cancer, retinoblastoma eye cancer,
gallbladder cancer, gastric (stomach) cancer, gastrointestinal
carcinoid tumor, germ cell tumors (e.g., extracranial,
extragonadal, and ovarian), gestational trophoblastic tumor, glioma
(e.g., adult, childhood brain stem, childhood cerebral astrocytoma,
childhood visual pathway and hypothalamic), hairy cell leukemia,
head and neck cancer, hepatocellular (liver) cancer, Hodgkin's
lymphoma, hypopharyngeal cancer, hypothalamic and visual pathway
glioma, intraocular melanoma, islet cell carcinoma (endocrine
pancreas), Kaposi's Sarcoma, kidney (renal cell) cancer, laryngeal
cancer, leukemia (e.g., acute lymphoblastic, acute myeloid, chronic
lymphocytic, chronic myelogenous, and hairy cell), lip and oral
cavity cancer, liver cancer, non-small cell lung cancer, small cell
lung cancer, lymphoma (e.g., AIDS-related, Burkitt's, cutaneous
t-cell, Hodgkin's, non-Hodgkin's, and primary central nervous
system), Waldenstrom's Macroglobulinemia, malignant fibrous
histiocytoma of bone/osteosarcoma, medulloblastoma, melanoma,
intraocular (eye) melanoma, Merkel cell carcinoma, mesothelioma,
metastatic squamous neck cancer with occult primary, multiple
endocrine neoplasia syndrome, multiple myeloma/plasma cell
neoplasm, mycosis fungoides, myelodysplastic syndromes,
myelodysplastic/myeloproliferative diseases, myelogenous leukemia,
chronic myeloid leukemia, multiple myeloma, chronic
myeloproliferative disorders, nasal cavity and paranasal sinus
cancer, nasopharyngeal cancer, neuroblastoma, oral cancer,
oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma
of bone, ovarian cancer, ovarian epithelial cancer, ovarian germ
cell tumor, ovarian low malignant potential tumor, pancreatic
cancer, islet cell pancreatic cancer, paranasal sinus and nasal
cavity cancer, parathyroid cancer, penile cancer, pheochromocytoma,
pineoblastoma, pituitary tumor, plasma cell neoplasm/multiple
myeloma, pleuropulmonary blastoma, primary central nervous system
lymphoma, prostate cancer, rectal cancer, renal cell (kidney)
cancer, renal pelvis and ureter transitional cell cancer,
retinoblastoma, rhabdomyosarcoma, salivary gland cancer, soft
tissue sarcoma, uterine sarcoma, Sezary syndrome, non-melanoma skin
cancer, merkel cell skin carcinoma, small intestine cancer, soft
tissue sarcoma, squamous cell carcinoma, cutaneous t-cell lymphoma,
testicular cancer, thymoma, thymic carcinoma, thyroid cancer,
gestational trophoblastic tumor, carcinoma of unknown primary site,
cancer of unknown primary site, urethral cancer, endometrial
uterine cancer, uterine sarcoma, vaginal cancer, visual pathway and
hypothalamic glioma, vulvar cancer, Waldenstrom's
Macroglobulinemia, and Wilms' Tumor.
[0204] An oligopeptide or polypeptide is within the scope of the
invention if it has an amino acid sequence that is at least 75%,
76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%,
89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical
to least one of the CDR's of antibodies A1-A14; and/or to a CDR of
a activin A binding agent that cross-blocks the binding of at least
one of antibodies A1-A14 to activin A, and/or is cross-blocked from
binding to activin A by at least one of antibodies A1-A14; and/or
to a CDR of a activin A binding agent wherein the binding agent can
block the binding of activin A to activin A receptor.
[0205] Activin A binding agent polypeptides and antibodies are
within the scope of the invention if they have amino acid sequences
that are at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%,
95%, 96%, 97%, 98% or 99% identical to a variable region of at
least one of antibodies A1-A14, and cross-block the binding of at
least one of antibodies A1-A14 to activin A, and/or are
cross-blocked from binding to activin A by at least one of
antibodies A1-A14; and/or can block the inhibitory effect of
activin A on an activin A receptor.
[0206] Therapeutic antibodies may be used that specifically bind to
intact activin A, in which sequences in the region of approximately
C11-S33 (first loop) and approximately C81-E111 (second loop)
retain the conformation of native activin A. Such mapping and
binding is described in Example 6, below.
[0207] Antibodies according to the invention may have a binding
affinity for human activin A of less than or equal to
1.times.10.sup.-7M, less than or equal to 1.times.10.sup.-8M, less
than or equal to 1.times.10.sup.-9M, less than or equal to
1.times.10.sup.-10 less than or equal to 1.times.10.sup.-11 M, or
less than or equal to 1.times.10.sup.-12 M.
[0208] The affinity of an antibody or binding partner, as well as
the extent to which an antibody inhibits binding, can be determined
by one of ordinary skill in the art using conventional techniques,
for example those described by Scatchard et al. (Ann. N.Y. Acad.
Sci. 51:660-672 (1949)) or by surface plasmon resonance (SPR;
BIAcore, Biosensor, Piscataway, N.J.). For surface plasmon
resonance, target molecules are immobilized on a solid phase and
exposed to ligands in a mobile phase running along a flow cell. If
ligand binding to the immobilized target occurs, the local
refractive index changes, leading to a change in SPR angle, which
can be monitored in real time by detecting changes in the intensity
of the reflected light. The rates of change of the SPR signal can
be analyzed to yield apparent rate constants for the association
and dissociation phases of the binding reaction. The ratio of these
values gives the apparent equilibrium constant (affinity) (see,
e.g., Wolff et al., Cancer Res. 53:2560-65 (1993)).
[0209] An antibody according to the present invention may belong to
any immunoglobin class, for example IgG, IgE, IgM, IgD, or IgA. It
may be obtained from or derived from an animal, for example, fowl
(e.g., chicken) and mammals, which includes but is not limited to a
mouse, rat, hamster, rabbit, or other rodent, cow, horse, sheep,
goat, camel, human, or other primate. The antibody may be an
internalizing antibody. Production of antibodies is disclosed
generally in U.S. Patent Publication No. 2004/0146888 A1.
Characterization Assays
[0210] In the methods described above to generate antibodies
according to the invention, including the manipulation of the
specific A1-A14 CDRs into new frameworks and/or constant regions,
appropriate assays are available to select the desired antibodies
(i.e. assays for determining binding affinity to activin A;
cross-blocking assays; Biacore-based competition binding assay;" in
vivo assays).
Therapeutic Methods and Administration of Antigen Binding
Proteins
[0211] Certain methods provided herein comprise administering an
activin A binding antigen binding protein to a subject, thereby
reducing an activin A-induced biological response that plays a role
in a particular condition. In particular embodiments, methods of
the invention involve contacting endogenous activin A with an
activin A binding antigen binding protein, e.g., via administration
to a subject or in an ex vivo procedure.
[0212] The term "treatment" encompasses alleviation or prevention
of at least one symptom or other aspect of a disorder, or reduction
of disease severity, and the like. In addition, "treatment" further
relates to administering a therapeutic agent described herein for
preventing or alleviating at least one symptom or other aspect of a
disorder in a subject in need thereof. An antigen binding protein
need not effect a complete cure, or eradicate every symptom or
manifestation of a disease, to constitute a viable therapeutic
agent. As is recognized in the pertinent field, drugs employed as
therapeutic agents may reduce the severity of a given disease
state, but need not abolish every manifestation of the disease to
be regarded as useful therapeutic agents. Similarly, a
prophylactically administered treatment need not be completely
effective in preventing the onset of a condition in order to
constitute a viable prophylactic agent. Simply reducing the impact
of a disease (for example, by reducing the number or severity of
its symptoms, or by increasing the effectiveness of another
treatment, or by producing another beneficial effect), or reducing
the likelihood that the disease will occur or worsen in a subject,
is sufficient. One embodiment of the invention is directed to a
method comprising administering to a patient an activin A
antagonist in an amount and for a time sufficient to induce a
sustained improvement over baseline of an indicator that reflects
the severity of the particular disorder.
[0213] As is understood in the pertinent field, pharmaceutical
compositions comprising the molecules of the invention are
administered to a subject in need thereof in a manner appropriate
to the indication. Pharmaceutical compositions may be administered
by any suitable technique, including but not limited to
parenterally, topically, or by inhalation. If injected, the
pharmaceutical composition can be administered, for example, via
intra-articular, intravenous, intramuscular, intralesional,
intraperitoneal or subcutaneous routes, by bolus injection, or
continuous infusion. Localized administration, e.g., at a site of
disease or injury is contemplated, as are transdermal delivery and
sustained release from implants. Delivery by inhalation includes,
for example, nasal or oral inhalation, use of a nebulizer,
inhalation of the antagonist in aerosol form, and the like. Other
alternatives include eyedrops; oral preparations including pills,
syrups, lozenges or chewing gum; and topical preparations such as
lotions, gels, sprays, and ointments.
[0214] Use of antigen binding proteins in ex vivo procedures also
is contemplated. For example, a patient's blood or other bodily
fluid may be contacted with an antigen binding protein that binds
full-length activin A, one or more activin A isoform, or other
partial length activin A ex vivo. The antigen binding protein may
be bound to a suitable insoluble matrix or solid support
material.
[0215] Advantageously, antigen binding proteins are administered in
the form of a composition comprising one or more additional
components such as a physiologically acceptable carrier, excipient
or diluent. Optionally, the composition additionally comprises one
or more physiologically active agents, for example, a second
activin A receptor-inhibiting substance, an anti-angiogenic
substance, a chemotherapeutic substance, an analgesic substance,
etc., non-exclusive examples of which are provided herein. In
various particular embodiments, the composition comprises one, two,
three, four, five, or six physiologically active agents in addition
to an activin A-binding antigen binding protein.
[0216] In one embodiment, the pharmaceutical composition comprise
an antigen binding protein of the invention together with one or
more substances selected from the group consisting of a buffer, an
antioxidant such as ascorbic acid, a low molecular weight
polypeptide (such as those having fewer than 10 amino acids), a
protein, an amino acid, a carbohydrate such as glucose, sucrose or
dextrins, a chelating agent such as EDTA, glutathione, a
stabilizer, and an excipient. Neutral buffered saline or saline
mixed with conspecific serum albumin are examples of appropriate
diluents. In accordance with appropriate industry standards,
preservatives such as benzyl alcohol may also be added. The
composition may be formulated as a lyophilizate using appropriate
excipient solutions (e.g., sucrose) as diluents. Suitable
components are nontoxic to recipients at the dosages and
concentrations employed. Further examples of components that may be
employed in pharmaceutical formulations are presented in
Remington's Pharmaceutical Sciences, 16.sup.th Ed. (1980) and
20.sup.th Ed. (2000), Mack Publishing Company, Easton, Pa.
[0217] Kits for use by medical practitioners include an antigen
binding protein of the invention and a label or other instructions
for use in treating any of the conditions discussed herein. In one
embodiment, the kit includes a sterile preparation of one or more
antigen binding proteins, which may be in the form of a composition
as disclosed above, and may be in one or more vials.
[0218] Dosages and the frequency of administration may vary
according to such factors as the route of administration, the
particular antigen binding proteins employed, the nature and
severity of the disease to be treated, whether the condition is
acute or chronic, and the size and general condition of the
subject. Appropriate dosages can be determined by procedures known
in the pertinent art, e.g., in clinical trials that may involve
dose escalation studies.
[0219] An antigen binding protein of the invention may be
administered, for example, once or more than once, e.g., at regular
intervals over a period of time. In particular embodiments, an
antigen binding protein is administered over a period of at least a
month or more, e.g., for one, two, or three months or even
indefinitely. For treating chronic conditions, long-term treatment
is generally most effective. However, for treating acute
conditions, administration for shorter periods, e.g. from one to
six weeks, may be sufficient. In general, the antigen binding
protein is administered until the patient manifests a medically
relevant degree of improvement over baseline for the chosen
indicator or indicators.
[0220] Particular embodiments of the present invention involve
administering an antigen binding protein at a dosage of from about
1 ng of antigen binding protein per kg of subject's weight per day
("1 ng/kg/day") to about 10 mg/kg/day, more preferably from about
500 ng/kg/day to about 5 mg/kg/day, and most preferably from about
5 .mu.g/kg/day to about 2 mg/kg/day, to a subject. In additional
embodiments, an antigen binding protein is administered to adults
one time per week, two times per week, or three or more times per
week, to treat an activin A mediated disease, condition or
disorder, e.g., a medical disorder disclosed herein. If injected,
the effective amount of antigen binding protein per adult dose may
range from 1-20 mg/m.sup.2, and preferably is about 5-12
mg/m.sup.2. Alternatively, a flat dose may be administered; the
amount may range from 5-100 mg/dose. One range for a flat dose is
about 20-30 mg per dose. In one embodiment of the invention, a flat
dose of 25 mg/dose is repeatedly administered by injection. If a
route of administration other than injection is used, the dose is
appropriately adjusted in accordance with standard medical
practices. One example of a therapeutic regimen involves injecting
a dose of about 20-30 mg of antigen binding protein one to three
times per week over a period of at least three weeks, though
treatment for longer periods may be necessary to induce the desired
degree of improvement. For pediatric subjects (age 4-17), one
exemplary suitable regimen involves the subcutaneous injection of
0.4 mg/kg, up to a maximum dose of 25 mg of antigen binding protein
administered two or three times per week.
[0221] Particular embodiments of the methods provided herein
involve subcutaneous injection of from 0.5 mg to 10 mg, preferably
from 3 to 5 mg, of an antigen binding protein, once or twice per
week. Another embodiment is directed to pulmonary administration
(e.g., by nebulizer) of 3 or more mg of antigen binding protein
once a week.
[0222] Examples of therapeutic regimens provided herein comprise
subcutaneous injection of an antigen binding protein once a week,
at a dose of 1.5 to 3 mg, to treat a condition in which activin A
signaling plays a role. Examples of such conditions are provided
herein and include, for example, cachexia, cancer, rheumatoid
arthritis, and all conditions in which loss of body weight, body
mass, body fat, or inability to maintain body weight, body mass,
body fat, play a role. Weekly administration of antigen binding
protein is continued until a desired result is achieved, e.g., the
subject's symptoms subside. Treatment may resume as needed, or,
alternatively, maintenance doses may be administered.
[0223] Other examples of therapeutic regimens provided herein
comprise subcutaneous or intravenous administration of a dose of 1,
3, 5, 6, 7, 8, 9, 10, 11, 12, 15, or 20 milligrams of an activin A
inhibitor of the present invention per kilogram body mass of the
subject (mg/kg). The dose can be administered once to the subject,
or more than once at a certain interval, for example, once a day,
three times a week, twice a week, once a week, three times a month,
twice a month, once a month, once every two months, once every
three months, once every six months, or once a year. The duration
of the treatment, and any changes to the dose and/or frequency of
treatment, can be altered or varied during the course of treatment
in order to meet the particular needs of the subject.
[0224] In another embodiment, an antigen binding protein is
administered to the subject in an amount and for a time sufficient
to induce an improvement, preferably a sustained improvement, in at
least one indicator that reflects the severity of the disorder that
is being treated. Various indicators that reflect the extent of the
subject's illness, disease or condition may be assessed for
determining whether the amount and time of the treatment is
sufficient. Such indicators include, for example, clinically
recognized indicators of disease severity, symptoms, or
manifestations of the disorder in question. In one embodiment, an
improvement is considered to be sustained if the subject exhibits
the improvement on at least two occasions separated by two to four
weeks. The degree of improvement generally is determined by a
physician, who may make this determination based on signs,
symptoms, biopsies, or other test results, and who may also employ
questionnaires that are administered to the subject, such as
quality-of-life questionnaires developed for a given disease.
[0225] A subject's levels of activin A may be monitored before,
during and/or after treatment with an antigen binding protein, to
detect changes, if any, in their levels. For some disorders, the
incidence of elevated activin A levels may vary according to such
factors as the stage of the disease or the particular form of the
disease. Known techniques may be employed for measuring activin A
levels, e.g., in a subject's serum. Activin A levels in blood
samples may be measured using any suitable technique, for example,
ELISA.
[0226] Particular embodiments of methods and compositions of the
invention involve the use of an antigen binding protein and one or
more additional activin A antagonists, for example, two or more
antigen binding proteins of the invention, or an antigen binding
protein of the invention and one or more other activin A
antagonists. In further embodiments, antigen binding protein are
administered alone or in combination with other agents useful for
treating the condition with which the patient is afflicted.
Examples of such agents include both proteinaceous and
non-proteinaceous drugs. When multiple therapeutics are
co-administered, dosages may be adjusted accordingly, as is
recognized in the pertinent art. "Co-administration" and
combination therapy are not limited to simultaneous administration,
but also include treatment regimens in which an antigen binding
protein is administered at least once during a course of treatment
that involves administering at least one other therapeutic agent to
the patient.
[0227] Examples of other agents that may be co-administered with an
antigen binding protein are other antigen binding proteins or
therapeutic polypeptides that are chosen according to the
particular condition to be treated. Alternatively,
non-proteinaceous drugs that are useful in treating one of the
particular conditions discussed above may be co-administered with
an activin A antagonist.
Combination Therapy
[0228] In another aspect, the present invention provides a method
of treating a subject with an activin A inhibiting antigen binding
protein and one or more other treatments. In one embodiment, such a
combination therapy achieves synergy or an additive effect by, for
example, attacking multiple sites or molecular targets in a tumor.
Types of combination therapies that can be used in connection with
the present invention include inhibiting or activating (as
appropriate) multiple nodes in a single disease-related pathway,
multiple pathways in a target cell, and multiple cell types within
a target tissue (e.g., within a tumor). For example, an activin A
inhibitor of the present invention can be combined with a treatment
that promotes apoptosis or inhibits angiogenesis. In another
embodiment, a targeted agent, that, when used by itself, fails to
elicit a therapeutically desired effect, could be used to, for
example, sensitize cancer cells or augment treatment effect of
other agents. In another embodiment, an activin A inhibitor
according to the invention is used in combination with a cytotoxic
drug or other targeted agent that induces apoptosis. In another
embodiment, an activin A inhibitor is used in combination with one
or more agents that inhibit different targets that are involved in
cell survival (e.g., PKB, mTOR), different receptor tyrosine
kinases (e.g., ErbB1, ErbB2, c-Met, c-kit), or different cell types
(e.g., KDR inhibitors, c-fms). In another embodiment, an activin A
inhibitor of the invention is added to the existing standard of
care for a particular condition. Examples of therapeutic agents
include, but are not limited to, gemcitabine, taxol, taxotere, and
CPT-11.
[0229] In another embodiment, the method comprises administering
one or more of the activin A antagonists described herein and one
or more other treatments (e.g., a therapeutic or palliative
treatment), for example, anti-cancer treatments (such as surgery,
ultrasound, radiotherapy, chemotherapy, or treatment with another
anti-cancer agent). Where a method comprises administering more
than one treatment to a subject, it is to be understood that the
order, timing, number, concentration, and volume of the
administrations is limited only by the medical requirements and
limitations of the treatment, i.e., two treatments can be
administered to the subject, e.g., simultaneously, consecutively,
alternately, or according to any other regimen. Examples of agents
that can be administered in combination with the activin A
antagonists described herein include, but are not limited to,
neutrophil-boosting agents, irinothecan, SN-38, gemcitabine,
herstatin, or an activin A-binding herstatin derivative (as
described, for example, in U.S. patent application Ser. No.
05/027,2637), AVASTIN.RTM. (Genentech, South San Francisco,
Calif.), HERCEPTIN.RTM. (Genentech), RITUXAN.RTM. (Genentech),
ARIMIDEX.RTM. (AstraZeneca, Wilmington, Del.), IRESSA.RTM.
(AstraZeneca), BEXXAR.RTM. (Corixa, Seattle, Wash.), ZEVALIN.RTM.
(Biogen Idec, Cambridge, Mass.), ERBITUX.RTM. (Imclone Systems
Inc., New York, N.Y.), GEMZAR.RTM. (Eli Lilly and Co.,
Indianapolis, Ind.), CAMPTOSAR.RTM. (Pfizer, New York, N.Y.),
GLEEVEC.RTM. (Novartis), SU-11248 (Pfizer), BMS-354825
(Bristol-Myers Squibb), panitumumab (Abgenix, Fremont, Calif./Amgen
Inc., Thousand Oaks, Calif.), and denosumab (Amgen Inc., Thousand
Oaks, Calif.).
[0230] The development of suitable dosing and treatment regimens
for using the particular compositions described herein in a variety
of treatment regimens, including e.g., subcutaneous, oral,
parenteral, intravenous, intranasal, and intramuscular
administration and formulation, is well known in the art, some of
which are briefly discussed below for general purposes of
illustration.
[0231] In certain applications, the pharmaceutical compositions
disclosed herein may be delivered via oral administration to an
animal. As such, these compositions may be formulated with an inert
diluent or with an assimilable edible carrier, or they may be
enclosed in hard- or soft-shell gelatin capsule, or they may be
compressed into tablets, or they may be incorporated directly with
the food of the diet.
[0232] In certain circumstances it will be desirable to deliver the
pharmaceutical compositions disclosed herein subcutaneously,
parenterally, intravenously, intramuscularly, or even
intraperitoneally. Such approaches are well known to the skilled
artisan, some of which are further described, for example, in U.S.
Pat. No. 5,543,158; U.S. Pat. No. 5,641,515 and U.S. Pat. No.
5,399,363. In certain embodiments, solutions of the active
compounds as free base or pharmacologically acceptable salts may be
prepared in water suitably mixed with a surfactant, such as
hydroxypropylcellulose. Dispersions may also be prepared in
glycerol, liquid polyethylene glycols, and mixtures thereof and in
oils. Under ordinary conditions of storage and use, these
preparations generally will contain a preservative to prevent the
growth of microorganisms.
[0233] Illustrative pharmaceutical forms suitable for injectable
use include sterile aqueous solutions or dispersions and sterile
powders for the extemporaneous preparation of sterile injectable
solutions or dispersions (for example, see U.S. Pat. No.
5,466,468). In all cases the form must be sterile and must be fluid
to the extent that easy syringability exists. It must be stable
under the conditions of manufacture and storage and must be
preserved against the contaminating action of microorganisms, such
as bacteria and fungi. The carrier can be a solvent or dispersion
medium containing, for example, water, ethanol, polyol (e.g.,
glycerol, propylene glycol, and liquid polyethylene glycol, and the
like), suitable mixtures thereof, and/or vegetable oils. Proper
fluidity may be maintained, for example, by the use of a coating,
such as lecithin, by the maintenance of the required particle size
in the case of dispersion and/or by the use of surfactants. The
prevention of the action of microorganisms can be facilitated by
various antibacterial and antifungal agents, for example, parabens,
chlorobutanol, phenol, sorbic acid, thimerosal, and the like. In
many cases, it will be preferable to include isotonic agents, for
example, sugars or sodium chloride. Prolonged absorption of the
injectable compositions can be brought about by the use in the
compositions of agents delaying absorption, for example, aluminum
monostearate and gelatin.
[0234] In one embodiment, for parenteral administration in an
aqueous solution, the solution should be suitably buffered if
necessary and the liquid diluent first rendered isotonic with
sufficient saline or glucose. These particular aqueous solutions
are especially suitable for intravenous, intramuscular,
subcutaneous and intraperitoneal administration. In this
connection, a sterile aqueous medium that can be employed will be
known to those of skill in the art in light of the present
disclosure. For example, one dosage may be dissolved in 1 ml of
isotonic NaCl solution and either added to 1000 ml of
hypodermoclysis fluid or injected at the proposed site of infusion,
(see for example, Remington's Pharmaceutical Sciences, 15th ed.,
pp. 1035-1038 and 1570-1580). Some variation in dosage will
necessarily occur depending on the condition of the subject being
treated. Moreover, for human administration, preparations will of
course preferably meet sterility, pyrogenicity, and the general
safety and purity standards as required by FDA Office of Biologics
standards.
[0235] In another embodiment of the invention, the compositions
disclosed herein may be formulated in a neutral or salt form.
Illustrative pharmaceutically-acceptable salts include the acid
addition salts (formed with the free amino groups of the protein)
and which are formed with inorganic acids such as, for example,
hydrochloric or phosphoric acids, or such organic acids as acetic,
oxalic, tartaric, mandelic, and the like. Salts formed with the
free carboxyl groups can also be derived from inorganic bases such
as, for example, sodium, potassium, ammonium, calcium, or ferric
hydroxides, and such organic bases as isopropylamine,
trimethylamine, histidine, procaine and the like. Upon formulation,
solutions will be administered in a manner compatible with the
dosage formulation and in such amount as is therapeutically
effective.
[0236] The carriers can further comprise any and all solvents,
dispersion media, vehicles, coatings, diluents, antibacterial and
antifungal agents, isotonic and absorption delaying agents,
buffers, carrier solutions, suspensions, colloids, and the like.
The use of such media and agents for pharmaceutical active
substances is well known in the art. Except insofar as any
conventional media or agent is incompatible with the active
ingredient, its use in the therapeutic compositions is
contemplated. Supplementary active ingredients can also be
incorporated into the compositions. The phrase
"pharmaceutically-acceptable" refers to molecular entities and
compositions that do not produce an allergic or similar untoward
reaction when administered to a human.
[0237] In certain embodiments, liposomes, nanocapsules,
microparticles, lipid particles, vesicles, and the like, are used
for the introduction of the compositions of the present invention
into suitable host cells/organisms. In particular, the compositions
of the present invention may be formulated for delivery either
encapsulated in a lipid particle, a liposome, a vesicle, a
nanosphere, or a nanoparticle or the like. Alternatively,
compositions of the present invention can be bound, either
covalently or non-covalently, to the surface of such carrier
vehicles.
[0238] The formation and use of liposome and liposome-like
preparations as potential drug carriers is generally known to those
of skill in the art (see for example, Lasic, Trends Biotechnol.
16(7):307-21, 1998; Takakura, Nippon Rinsho 56(3):691-95, 1998;
Chandran et al., Indian J. Exp. Biol. 35(8):801-09, 1997; Margalit,
Crit. Rev. Ther. Drug Carrier Syst. 12(2-3):233-61, 1995; U.S. Pat.
No. 5,567,434; U.S. Pat. No. 5,552,157; U.S. Pat. No. 5,565,213;
U.S. Pat. No. 5,738,868 and U.S. Pat. No. 5,795,587, each
specifically incorporated herein by reference in its entirety). The
use of liposomes does not appear to be associated with autoimmune
responses or unacceptable toxicity after systemic delivery. In
certain embodiments, liposomes are formed from phospholipids that
are dispersed in an aqueous medium and spontaneously form
multilamellar concentric bilayer vesicles (also termed
multilamellar vesicles (MLVs)).
[0239] Alternatively, in other embodiments, the invention provides
for pharmaceutically-acceptable nanocapsule formulations of the
compositions of the present invention. Nanocapsules can generally
entrap compounds in a stable and reproducible way (see, for
example, Quintanar-Guerrero et al., Drug Dev. Ind. Pharm.
24(12):1113-28, 1998). To avoid side effects due to intracellular
polymeric overloading, such ultrafine particles (sized around 0.1
.mu.m) may be designed using polymers able to be degraded in vivo.
Such particles can be made as described, for example, by Couvreur
et al., Crit. Rev. Ther. Drug Carrier Syst. 5(1):1-20, 1988; zur
Muhlen et al., Eur. J. Pharm. Biopharm. 45(2):149-55, 1998; Zambaux
et al., J. Controlled Release 50(1-3):31-40, 1998; and U.S. Pat.
No. 5,145,684.
[0240] In addition, pharmaceutical compositions of the present
invention may be placed within containers, along with packaging
material that provides instructions regarding the use of such
pharmaceutical compositions. Generally, such instructions will
include a tangible expression describing the reagent concentration,
as well as within certain embodiments, relative amounts of
excipient ingredients or diluents (e.g., water, saline or PBS) that
may be necessary to reconstitute the pharmaceutical
composition.
[0241] The dose administered may range from 0.01 mg/kg to 100 mg/kg
of body weight. As will be evident to one of skill in the art, the
amount and frequency of administration will depend, of course, on
such factors as the nature and severity of the indication being
treated, the desired response, the condition of the patient, and so
forth. Typically, the compositions may be administered by a variety
of techniques, as noted above.
[0242] The invention also provides a diagnostic kit comprising at
least one anti-activin A binding agent according to the present
invention. The binding agent may be an antibody. In addition, such
a kit may optionally comprise one or more of the following: [0243]
(1) instructions for using the one or more binding agent(s) for
screening, diagnosis, prognosis, therapeutic monitoring or any
combination of these applications; [0244] (2) a labeled binding
partner to the anti-activin A binding agent(s); [0245] (3) a solid
phase (such as a reagent strip) upon which the anti-activin A
binding agent(s) is immobilized; and [0246] (4) a label or insert
indicating regulatory approval for screening, diagnostic,
prognostic or therapeutic use or any combination thereof. If no
labeled binding partner to the binding agent(s) is provided, the
binding agent(s) itself can be labeled with one or more of a
detectable marker(s), e.g. a chemiluminescent, enzymatic,
fluorescent, or radioactive moiety.
[0247] The following examples are offered by way of illustration,
and not by way of limitation.
EXAMPLES
Example 1
Recombinant Expression of Activin A
[0248] Ultra Filtration and Diafiltration (UF/DF) of Conditioned
Media.
[0249] R-HuActivinA was expressed in chinese hamster ovary (CHO)
cells. A series of steps was developed to generate active, purified
material. The purification process began by concentrating
(diafiltration) the conditioned media (C.M.) between 15 to 20 fold
using an Amicon S10Y10 spiral cartridge. The media was then buffer
exchanged (diafiltered) using 5 volumes of 10 mM tris buffer Ph
7.0, filtered and stored.
[0250] Cation Exchange Chromatography.
[0251] The r-HuActivin A was applied at 5 ml/minute at 4-80 C to a
2.6.times.7 cm (Pharmacia) S-Sepharose Fast Flow column
equilibrated in 10 mM Tris buffer Ph 7.0. The column was washed
with the equilibration buffer. The r-HuActivin A was eluted from
the column with a gradient of increasing sodium chloride
concentration to 0.4M over 20 column volumes buffered with 10 Mm
Tris Ph 7.0. The appropriate fractions were pooled and stored 4-80
C.
[0252] Reverse Phase HPLC C4 Chromatography.
[0253] The S-Sepharose column pool pH was adjusted to 2.0 with
trifluroacetic acid (TFA). The pool was then applied to a
1.times.25 cm Vydac C4 column at room temperature equilibrated with
75% A buffer (0.1% TFA in water), and 25% B buffer (90%
acetonitrile, 0.1% TFA, 9.9% water). The column was then washed
with the equilibration buffer. R-HuActivin A was eluted with a
gradient of 25% B buffer to 50% B buffer over 50 minutes at a flow
rate of 5 ml/minute. The appropriate fractions were pooled, and
lyophylized.
[0254] High Performance Cation Exchange Chromatography.
[0255] A 5 ml S Sepharose High Performance column was equilibrated
with 8M urea, 10 mM sodium phosphate, Ph 7.0 (A buffer) at room
temperature. The lyophylized C4 pool was resuspended in A buffer
and applied at 5 ml/minute, and washed with A buffer. The
r-HuActivin A was eluted from the column with a gradient of
increasing sodium chloride concentration to 0.15M over 30 column
volumes buffered with 8M urea, 10 mM sodium phosphate, pH 7.0. The
appropriate fractions were pooled and stored 4-80.degree. C.
[0256] Reverse Phase HPLC C4 Chromatography.
[0257] The S-Sepharose column pool pH was adjusted to 2.0 with
Trifluroacetic Acid (TFA). The pool was then applied to a
1.times.25 cm Vydac C4 column at room temperature equilibrated with
75% A buffer (0.1% TFA in water), and 25% B buffer (90%
acetonitrile, 0.1% TFA, 9.9% water). The column was then washed
extensively to remove urea and salts with the equilibration buffer.
R-HuActivin A was eluted with a gradient of 25% B buffer to 50% B
buffer over 50 minutes at a flow rate of 5 ml/minute. The
appropriate fractions were pooled, and the final purified
r-HuActivin A was lyophylized and stored in aliquots -80.degree. C.
SEQ ID NO:225 provides the amino acid sequence for activin A.
Example 2
Generation of Anti-Activin A Hybridomas
[0258] Antibodies to activin A were raised in XenoMouse.RTM. mice
(Abgenix, Fremont, Calif.), which are mice containing human
immunoglobulin genes. The XenoMouse.RTM. strain XMG2 was used to
produce fully human IgG2 Kappa antibodies. A second strain was used
to produce fully human IgG4 Kappa antibodies. Mice were immunized
with activin A.
[0259] The mice were injected with antigen (activin A) according to
standard protocols (US 2005/0118643; WO 2005/694879) in the hind
footpads (5 .mu.g per footpad). Initial injections contained the
adjuvant TiterMax.RTM. Gold (Sigma, Cat # T2684). In subsequent
injections, each mouse was injected with a total of 5 .mu.g of
antigen in the adjuvant alum gel (aluminum phosphate gel adjuvant;
Superfos Biosector a/s, distributed by E. M. Sargent Pulp and
Chemical Co., Clifton N.J., cat #1452-250). The final injection
contained a total of 10 .mu.g of antigen per mouse and did not
contain an adjuvant.
[0260] Each mouse was bled two days after the sixth injection.
Blood samples from those bleeds were assayed by ELISA to determine
the titer of antibodies to activin A. Four days after the final
injection, the mice were sacrificed and their draining lymph nodes
were harvested and the lymphocytes were recovered. Lymphocytes from
the mice of each of the three groups were separately pooled. To
enrich the lymphocyte samples for B-cells, T-cells were depleted by
adding anti-CD90 magnetic beads (Miltenyi Biotech cat. #491-01) and
then passing the lymphocytes through an LS.sup.+ column (Miltenyi
Biotech cat. #424-01).
[0261] Each of the samples of B-cell enriched lymphocytes was then
fused with P3 myeloma cells using an electrocell fusion device
(Genetronic, Inc., Model ECM 2001) to create hybridomas. The three
groups of fused hybridoma lines were then plated in 96-well plates
hybridoma media as described (WO 2005/094879) although other
suitable media known in the art can be used. The hybridoma lines
were cultured for 14 days at 37.degree. C., in 15% CO.sub.2.
[0262] After 14 days, culture supernatants were assayed by ELISA to
detect the presence of human IgG antibodies to activin A. Culture
supernatants that tested positive in that ELISA were tested for the
presence of human kappa chain in a second ELISA. In that second
ELISA, the conditions were identical to the first ELISA, except
that the secondary antibody was a goat anti-human kappa chain
antibody conjugated to horseradish peroxidase. Hybridomas that
tested positive in both ELISA assays were further expanded to
produce 5 ml of supernatant for subsequent testing.
[0263] A total of 160 anti-activin A hybridoma samples derived from
the xeno mice were screened using a cell-based functional assay and
BIAcore binding analysis as described in the Examples below.
Twenty-three hybridomas were further characterized for their
properties related to expression, purification, cell-based assay,
binding analysis, sequence analysis, MS, and SEC. From these, three
potent Mabs, A1, A2, and A3, were identified for further testing as
described below. The amino acid sequences for these antibodies are
as follows: A1: SEQ ID NO:9 (light chain variable); SEQ ID NO:84
(light chain constant); SEQ ID NO:10 (heavy chain variable); and
SEQ ID NO:214 (heavy chain constant). A2: SEQ ID NO:25 (light chain
variable); SEQ ID NO:100 (light chain constant); SEQ ID NO:26
(heavy chain variable); and SEQ ID NO:215 (heavy chain constant).
A3: SEQ ID NO:41 (light chain variable); SEQ ID NO:108 (light chain
constant); SEQ ID NO:42 (heavy chain variable); and SEQ ID NO:221
(heavy chain constant).
Example 3
Expression and Purification of Human Anti-huActivin A Antibodies in
Cho Cells
[0264] CS-9 cells used for transfection of the anti-huActivin A
expression plasmids were a serum-free suspension CHO cell line. The
CS-9 clone was selected as the host cell line for expression of
recombinant proteins and banked in serum-free medium. The bank was
tested for adventious agents and sterility and found to be free of
viral, mycoplasma and microbial agents.
[0265] Anti-hu Activin A expressing cell lines were scaled up using
a typical fed-batch process. Cells were inoculated into a Wave
bioreactor upon expansion. Culture was fed three times on
approximately day 3, day 5 and day 9 with bolus feeds and harvested
on day 11. Cells were spun down and conditioned media was filtered
through a ten inch 0.45/0.2 micron pre filter, followed by a
filtration through a six inch 0.2 micron filter.
Purification of Mab's from Hybridoma Conditioned Media (C.M.):
[0266] To between 7 to 10 ml of C.M.'s was added 100 .mu.l of a 1:2
slurry of Mab Select resin equilibrated in PBS. The tubes were
placed on rotators at 4-8.degree. C. overnight. The tubes were
centrifuged at 1,000.times.g for 5 minutes and the non-bound
fraction was decanted. The resin was washed with 5 ml of PBS, and
centrifuged and decanted as above. The resin was then transferred
to a SPIN-X, 0.45 um, 2 ml tube. The resin was washed an additional
two times with 0.5 ml of PBS and centrifuged. The Mab's were eluted
with 0.2 ml of 0.1M acetic acid by incubating at room temperature
with occasional mixing for 10 minutes. The tubes were centrifuged,
and 30 ul of 1M Tris buffer Ph 8.0 is added to the eluate. Purified
Mab's were stored 4-8.degree. C.
Example 4
C2C12 Cell Based Activin Activity Assay
[0267] This assay demonstrates the activin A neutralizing
capability of the antibody being tested by measuring the extent
that binding of activin A to its receptor is inhibited. An
activin-responsive reporter cell line was generated by transfection
of C2C12 myoblast cells (ATCC No: CRL-1772) with a pMARE-luc
construct. The pMARE-luc construct was made by cloning twelve
repeats of the CAGA sequence, representing the activin response
elements (Dennler et al. EMBO 17: 3091-3100 (1998)) into a pLuc-MCS
reporter vector (Stratagene cat #219087) upstream of the TATA box.
The myoblast C2C12 cells naturally express activin IIB receptors
(actRIIB) on the cell surface. When activin binds the cell
receptors, the Smad pathway is activated, and phosphorylated Smad
binds to the response element (Macias-Silva et al. Cell 87:1215
(1996)), resulting in the expression of the luciferase gene.
Luciferase activity is then measured using a commercial luciferase
reporter assay kit (cat # E4550, Promega, Madison, Wis.) according
to manufacturer's protocol.
[0268] A stable line of C2C12 cells that had been transfected with
pMARE-luc (C2C12/pMARE clone #44) was used to measure activin
activity according to the following procedure.
[0269] Equal numbers of the reporter cells (C2C12/pMARE clone #44)
were plated into 96 well cultures. A first round screening using
two dilutions of condition medium which contains antibodies was
performed with the activin A concentration fixed at 4 nM.
Recombinant mature activin A was pre-incubated for 1 hour at room
temperature with condition medium at 2.times. and 5.times.
dilutions respectively. The reporter cell culture was treated with
activin with or without antibodies for six hours. Activin A
activity was measured by determining the luciferase activity in the
treated cultures. This assay was used to initially identify
antibodies that inhibited the activin A signaling activity in the
reporter assay. Subsequently, a nine point titration curve was
generated with the activin A concentration fixed at 4 nM. The
activin A was preincubated with each of the following nine
concentrations of purified antibodies: 0.004 nM, 0.04 nM, 0.4 nM, 4
nM, 20 nM, 40 nM, 200 nM, 400 nM and 2 .mu.M for one hour before
adding the mixture to the reporter cell culture. The IC.sub.50
values were for a number of antibodies A1, A2 and A3 are provided
in Table 3.
TABLE-US-00010 TABLE 3 MAb Cell IC.sub.50 (nM) A1 <3 A2 <3 A3
<3
Example 5
Biacore.RTM. Assay
[0270] An affinity analysis of activin A antibodies A1, A2 and A3
was performed on a BIAcore.RTM.3000 (Biacore, Inc., Piscataway,
N.J.), apparatus using sensor chip CM5, and 0.005 percent P20
surfactant (Biacore, Inc.) as running buffer. Recombinant mature
activin A protein was immobilized to a research grade CM5 sensor
chip (Biacore, Inc.) via primary amine groups using the Amine
Coupling Kit (Biacore, Inc.) according to the manufacturer's
suggested protocol.
[0271] Direct binding assays were used to screen antibodies in
order of their ability to bind to immobilized activin A. Binding
assays were carried by injection of two concentrations (40 and 400
nM) of each candidate antibody to the immobilized activin A surface
at a flow rate of 50 .mu.l/min for 3 minutes. After a dissociation
time of 3 minutes, the surface was regenerated. Binding curves were
compared qualitatively for binding signal intensity, as well as for
dissociation rates. Antibody binding kinetic parameters including
ka (association rate constant), kd (dissociation rate constant) and
KD (dissociation equilibrium constant) were determined using the
BIA evaluation 3.1 computer program (Biacore, Inc.). The lower the
dissociation equilibrium constants (expressed in nM), the greater
the affinity of the antibody for activin A.
Example 6
Activin A Binding Region Mapping for Monoclonal Antibodies
[0272] Antibody binding regions on activin A were determined using
multiple biochemical methods, including western under reducing or
non-reducing conditions, limited protease digestion using LysC,
peptide analysis by MS, and peptide competition using BIAcore.
[0273] Cys-knots are key structural characteristics for TGF-.beta.
family members. Breaking S-S with reducing agent deteriorated
activin A structure and decreased activin A binding to the
neutralizing antibodies, including A-1. This data demonstrated that
Cys-knots are important for activin A binding with these
neutralizing antibodies that bind specifically to activin A
compared to activin B. Cys-knots make two distant loops of
sequences structurally adjacent to each other. These two regions
are a sequence in the region of approximately C11-S33 (first loop)
and approximately C81-E111 (second loop) activin A (FIG. 7). A
limited LysC digestion revealed that these two regions were
protected by antibody A-1, indicating they interact with the
neutralizing antibodies directly. The neutralizing antibodies are
sensitive to conformational changes of activin A, suggesting they
bind to non-linear epitopes of the antigen. Further peptide
analysis indicated that fragments G-1 to K7 and S57-F74 in activin
A are not required for its binding with the neutralizing antibodies
directly. A comparison of the sequence of activin A compared to
activin B shows that some of the sequence differences occur in this
region.
Example 7
Selectivity Assays
[0274] These assays were performed using BIAcore.RTM. technology,
to determine the selectivity of binding of antibodies A1, A2 and A3
to various activins and other TGF-.beta. family members, including
activin A, activin B, activin AB, inhibin A, GDF-8, GDF-11,
TGF-.beta.-1, TGF-.beta.-3, and BMP4 (all from R & D Systems).
ActRIIB/Fc was covalently coupled to research grade sensor chips
according to manufacturer's suggested protocol. Because BIAcore
assays detect changes in the refractive index, the difference
between the response detected with injection over the immobilized
receptor surfaces compared with the response detected with
injection over the control surface in the absence of any antibody
represents the actual binding of the various ligands to the
receptor. With pre-incubation of antibodies and activin and
TGF-.beta. molecules, a change (increase or decrease) in binding
response indicates antibody binding to the TGF.beta. family of
molecules. The antibodies all bound to activin A but not to activin
B, GDF-8, GDF-11, TGF-.beta.-1, TGF-.beta.-3, and BMP4, thus
indicating specificity for activin A.
Example 8
KinEx A.TM. Equilibrium Assays
[0275] Solution-based equilibrium-binding assays using KinExA.TM.
technology (Sapidyne Instruments, Inc.) were used to determine the
dissociation equilibrium (KD) of activin A binding to antibody
molecules. This solution-based assay is considered to be more
sensitive than the BIAcore assay in some instances. Reacti-Gel.TM.
6.times. was pre-coated with about 50 .mu.g/ml activin A overnight,
and then blocked with BSA. 30 pM and 100 pM of antibody samples
were incubated with various concentrations (0.5 pM to 5 nM) of
activin A in sample buffer at room temperature for 8 hours before
being run through the activin A-coated beads. The amount of the
bead-bound antibody was quantified by fluorescent (Cy5) labeled
goat anti-human-Fc antibody at 1 mg/ml in superblock. The binding
signal was proportional to the concentration of free antibody at
equilibrium with a given activin A concentration. KD was obtained
from the nonlinear regression of the competition curves using a
dual-curve one-site homogeneous binding model provided in the KinEx
ATM software (Sapidyne Instruments, Inc.). The results are shown in
FIG. 8. A1 shows the strongest binding affinity for activin A
(K.sub.D.about.3 pM). A2 and A3 bound to activin A at .about.15 pM
and .about.8 pM, respectively.
Example 9
Protective Effects of Anti-Activin on Body Weight and Muscle Mass
Loss in Collagen-Induced Arthritis Model
[0276] This example was designed to test if activin inhibitors can
rescue muscle wasting condition observed in collagen-induced
arthritis. Collagen-induced arthritis (CIA) is a widely used mouse
model sharing several clinical and pathological features with
rheumatoid arthritis (RA). The precise mechanisms for CIA is not
known, however, there is considerable evidence to suggest that CIA
is a Th-1 mediated inflammatory disease. Rheumatoid arthritis is a
common autoimmune disease that leads to joint inflammation, and
progressive cartilage/bone erosion. Even if the RA progression is
under control, loss of BCM is not corrected without additional,
direct intervention.
[0277] The collagen-induced arthritis model was prepared as
follows. DBA/1J male mice (The Jackson Laboratory, Bar Harbor,
Me.), 8 weeks of age (20-23 g), were used. Immunization was carried
out on day 1 and day 21 by injecting 1000 g Bovine Collagen II
(Chondrex, Redmond, Wash.) emulsified in 100 .mu.l of CFA or ICFA,
intradermally at the base of the tail. Three groups of ten mice
each were used. Group 1 (control) received vehicle only. Group 2
(experimental, collagen injection) received vehicle only as
treatment. Group 3 was injected with collagen and treated with
anti-Activin A antibody A1.
[0278] The arthritic clinical index used was:
[0279] 0=normal joint no signs of arthritis
[0280] 1=swelling and/or redness of one digit
[0281] 2=two joints involved
[0282] 3=more than two joints
[0283] 4=severe arthritis of the entire paw and digits
[0284] The treatment consisted of activin antibody injection (s.c.)
beginning on Day 8, 5 mg/kg, s.c. twice a week. The endpoints
measured were body weight, muscle/fat mass, food intake and
inflammatory cytokines.
[0285] Body weight. Untreated CIA animals lost twenty-five percent
of their body weight and muscle mass compared to normal animals,
which provided the evidence of rheumatoid cachexia. Anti-activin A
(A-1) treatments significantly increased (p<0.05) body weight
compared to that of CIA control but not to the normal control
animals.
[0286] Muscle mass. Treatment with monoclonal antibody A1
significantly increased muscle mass (p<0.05) in CIA animals,
compared to that of untreated CIA animals. In the CIA controls, the
muscle mass at 95 days was 1.5 g; whereas in the antibody-treated
CIA animals, the muscle mass at 95 days was 2.5 g. The results are
shown in FIG. 1.
[0287] Fat mass. Anti-activin A antibody did not reverse the fat
loss in CIA animals. The results are shown in FIG. 2.
[0288] The preservation of body weight and muscle mass in the
treated animals provides support for activin A antibodies as a
therapeutic for improving quality of life and lowering mortality in
rheumatoid arthritis sufferers.
Example 10
Intramuscular CHO/Activin Xenograft in Young Adult Nude Mice
[0289] CHO cells stably transfected with activin A (CHO/Activin)
were implanted into young adult CD1 nu/nu mice via intramuscular
injection at various doses, 1.times.10.sup.6, 5.times.10.sup.6, and
10.times.10.sup.6. The same doses of non-transfected CHO cells were
injected into separate groups of mice as controls. CHO/Activin
implantation induced a rapid and drastic body weight loss compared
to controls.
[0290] At day 12, the CHO/control group for 1.times.10.sup.6 cells
had a loss of 10% of body weight, whereas the CHO/anti-activin A
group had a 10% gain in body weight. The 5.times.10.sup.6 and
10.times.10.sup.6 cell anti-activin A groups also showed body
weight increases of about 10%, whereas the control 5.times.10.sup.6
and 10.times.10.sup.6 cell groups lost 25-30% of the body
weight.
[0291] Serum activin A levels in mice were measured on day 12 post
xenograft implantation. The levels of serum activin A in parental
CHO implanted control mice were <2 ng/ml. In contrast, the mice
bearing CHO/Activin xenograft showed dramatically elevated serum
activin A. There was a significant correlation between the serum
activin A level and the severity of body weight loss as indicated
by the statistical analysis, indicating that activin A
overexpression is responsible for the body weight loss seen in
CHO/Activin xenograft mice.
[0292] Mice (n=14 per group) were implanted with CHO/Activin
xenograft and subsequently injected with either vehicle or each of
the three anti-activin A monoclonal antibody, A1, A2 and A3. Twelve
out of fourteen of the mice in the vehicle group died by day 25
post CHO/Activin implantation, while only one of forty-two
CHO/Activin implanted mice in the anti-activin A Mab treatment
groups died at the time. By day 38, the majority of mice in the Mab
treatment groups continued to survive well, with survival rates as
follows: thirteen out of fourteen for A1 group and ten out of
fourteen for either A2 or A3 group.
[0293] Body weight data show that treatment with anti-activin A
Mab, A1 or A2, completely prevented the body weight loss in
CHO/Activin xenograft-bearing mice, indicating that the
anti-activin A Mabs were effective in neutralizing activin A
activity in vivo. As shown in FIG. 3, NMR data revealed that
treatment with anti-activin A Mab, A1 prevented the progressive
loss of lean body mass seen in CHO/Activin-bearing mice. Treatment
with this antibody also caused an increase in food intake.
[0294] Necropsy data indicate that treatment with anti-activin A
Mab, A1 and A2, prevented the severe reduction in lean carcass
weights seen in CHO/Activin-bearing mice (Table 5). Terminal
necropsy data indicate that treatment with anti-activin A Mab, A1
and A2, prevented the severe reduction in fat mass seen in
CHO/Activin-xenograft bearing mice (Table 5).
[0295] The percentage of animals bearing a visible tumor at the
xenograft site was analyzed during terminal necropsy on day 12 post
CHO/Activin implantation. As shown in Table 5, data revealed that
80% of the mice in the vehicle group developed visually
identifiable xenograft tumors at the injection site. A
significantly decreased rate of visible tumor formation in the
anti-activin A Mab treatment groups was observed.
[0296] Upon necropsy, all the visually identifiable tumors at the
CHO/Activin xenograft sites were dissected from the animals and
weighed. A significant decrease in tumor mass was observed in the
activin A Mab treatment group compared to vehicle group (Table
5).
TABLE-US-00011 TABLE 5 Tumor xenograft Periuterine fat development,
Lean carcass mass tissue (g) on percent of Tumor weight (g)
Treatment (g) on day 12 day 12 animals, on day 12 on day 12 Nude
mice 9 .+-. 0.25 0.18 .+-. 0.02 Not applicable Not applicable plus
vehicle CHO/Activin 7.5 .+-. 0.25 0.10 .+-. 0.02 80% 0.11 .+-. .01
plus vehicle CHO/Activin 9.2 .+-. 0.25 0.17 .+-. 0.04 20% 0.01 .+-.
0.005 plus A-1 antibody CHO/Activin 8.9 .+-. 0.25 0.16 .+-. 0.03
50% 0.01 .+-. 0.005 plus A-2 antibody
[0297] The foregoing experiments on xenograft tumor development led
to several conclusions regarding the use of anti-activin A
antibodies to improve survival from cancer. Activin A played a
causal role in the development of cachexia syndrome in nude mice
bearing CHO/Activin xenograft. The loss of body weight correlated
well with the increase in serum activin level in this model.
Anti-activin A Mabs prevented the body weight loss and cachexia
syndrome seen in CHO/Activin xenograft tumor-bearing mice.
Anti-activin A Mabs suppressed xenograft growth, thereby
significantly reducing the percentage of mice bearing visible
xenograft tumors as well as decreasing the xenograft tumor sizes.
Anti-activin A Mabs prevented the death resulting from CHO/Activin
exograft, markedly promoting animal survival.
Example 11
Anti-Activin Monoclonal Antibody A1 in AAV-Activin Mice
[0298] Postnatal overexpression of activin A led to severe
cachexia-like wasting syndrome in C57Bl/6 mice. The body weight
decreased over day 1, 4, 9 and 11, going from 16 grams to 14, 12.5,
and finally 10.5 grams at day 11. There was also a loss of fat
weight, lean carcass weight, and gastrocnemeus muscle weight.
[0299] To determine whether antibody directed to activin A could
alleviate or prevent the effects of activin A, the following
experiments were performed. AAV-Activin or empty AAV vector
(control) were injected at 1.times.10.sup.13 pfu/mouse into 8 week
old male C57Bl/6 mice (n=10-12) via the tail veins. FIG. 5 shows
the effect of anti-Activin A monoclonal antibody A1 on body weight
change in the transduced mice at days 1, 5, 8 and 12. The antibody
prevented the body weight change observed in the control mice.
Antibody treatment improved food intake in this animal model.
Example 12
Protective Effect of Anti-Activin-A Mab A1 Against Body Weight and
Lean Mass Losses in Colon-26 Cancer Cachexia Model
[0300] This example demonstrates the muscle preserving effect of
the anti-Activin-A monoclonal antibody A-1 in a murine cancer
cachexia model. The model of cancer cachexia was established by
using the syngenic murine colon 26 adenocarcinoma cells inoculation
in 8.5 weeks old male CDF1 mice (0.5.times.10.sup.6 cells/mouse) on
day 0. The anti-Activin-A MAb A-1 treatment (10 mg/kg, sc) was
initiated on day 4 and was given 3 times weekly for 18 days. Sodium
acetate buffer (10 nm sodium acetate, 5% sucrose, pH 5.0) as
vehicle was used in the tumor-bearing control group mice. One group
of age and weight matched normal CDF1 mice without tumors was used
as parallel baseline control. Body weight and food intake were
monitored three times weekly. Tumor size was measured three times
per week by digital calipers. Body composition was measured using
NMR at the beginning and the end of the study to monitor changes in
lean and fat mass. At the end of the experiment, the mice were
euthanized in a CO.sub.2 chamber. Terminal block samples were
collected and serum Activin-A levels were analyzed by ELISA. The
lean carcass were weighed and recorded, and the gastrocnemius
muscles and tumors were weighed and properly saved.
[0301] All results were expressed as mean.+-.standard error of the
mean (SEM). Non-paired T-test was performed to determine
statistical difference between groups by using the Graph Pad Prizm
software. Statistical significance from vehicle was represented by
p values less than 0.05.
[0302] The data show that A-1 treated mice had significantly higher
body weight than vehicle treated mice (21.30.+-.0.54 g vs.
19.21.+-.0.38 g, P<0.05, Day 15 and 19.66.+-.0.22 g vs.
18.11.+-.0.19 g, P<0.05, day 18). There was a significant body
weight loss in tumor-bearing mice treated with vehicle compared to
age-matched non-tumor-bearing mice (25.48.+-.0.35 g vs.
18.11.+-.0.19 g, p<0.005). Thus, the activin A antibody
treatment helped to maintain body weight.
[0303] Tumor growth was monitored with a digitized calipers
measurement and tumor size was calculated with the equation of:
Tumor dimension (mm.sup.3=L (mm)*W (mm)*W (mm)*0.5. The tumor size
was not different between the antibody A1 treated and vehicle
treated two groups.
[0304] After C-26 tumor cell inoculation, the mice in vehicle
treated group had a dramatic body weight loss compared to non
tumor-bearing mice (25.48.+-.0.35 g vs. 18.11.+-.0.19 g,
p<0.01). However, A-1 treatment attenuated the average weight
loss (19.66.+-.0.22 g vs. 18.11.+-.0.19 g, P<0.05).
[0305] A-1 treatment resulted in a significant preservation of the
skeletal muscle mass. A-1 treated mice had greater weight of the
gastrocnemius muscle mass (0.099.+-.0.002 g vs. 0.093.+-.0.001,
p<0.05) than that in the C26 vehicle treated group.
[0306] At the end of the experiment, the terminal tissue dissection
was performed. The control C-26 tumor-bearing mice had
significantly lower lean carcass weight (6.75.+-.0.11 g) than that
of the antibody A1 treated mice (7.20.+-.0.16 g, p<0.05 vs.
C-26+vehicle group).
[0307] The lean body mass was markedly lost in C-26 vehicle treated
group (-1.85.+-.0.24 g compared to their initial body lean mass).
Treatment with A-1 in C-26 tumor-bearing mice significantly
attenuated the loss of lean body mass (-0.60.+-.0.26 g, p<0.05
vs. C26-vehicle group).
[0308] Anti-Activin A monoclonal antibody A1 treatment is effective
in attenuation of cancer cachexia induced whole body weight lose.
The protective effect of antibody A1 is associated with preserving
skeletal muscle mass, lean carcass mass and total lean body mass in
a well-established murine cancer cachexia animal model.
[0309] The present study provides preclinical evidence that
neutralization of active A using monoclonal antibody A1
significantly attenuated body weight loss and preserved skeletal
muscle and lean body mass.
Example 13
Activin A ELISA
[0310] Antibodies to activin A can be used to assay and quantitate
activin A in samples, such as biological samples. Recombinant human
activin A (100 ng/ml, cat #10-85106) and assay diluting buffer (0
mg/ml, cat #10-85101) were purchased from DSLabs (Webster, Tex.)
and stored at 4.degree. C. Standards were prepared fresh before the
experiment by diluting into assay buffer.
[0311] Human sera were obtained from Bioreclamation Inc.
(Hicksville, N.Y.). Sera for activin A measurement were aliquoted
in 110 .mu.l to minimize variation due to freeze-thaw. The samples
were diluted 1/3 with assay buffer and measured in the ELISA.
[0312] Activin A ELISA (one-step ELISA) is performed using the
following steps:
[0313] Corning Costar 3590 96-well plats were coated with 100 .mu.l
of 4 .mu.g/mL anti-activin A Mab (A2) overnight at room temperature
while gently shaking at 500-600 rpm. The wells (400 .mu.l/well)
were washed three times with PBS containing 0.02% (v/v) Tween 20.
The wells were blocked in 300 .mu.l of I-blocking buffer for two
hours at room temperature, then blocking buffer was removed.
[0314] 100 .mu.l of standard activin A/or 100 .mu.l of diluted
samples were added, and 25 .mu.l of 0.5 .mu.g/mL anti-activin A
mAb-HRP labelled (A1/HRP) was added in assay buffer. For free
activin A measurements, sera were diluted in 1/3 with assay buffer.
For total activin A measurements, sera were (1) acidified (pH 4-5)
with 20% HCL (2 .mu.l per 110 .mu.l sera), (2) incubated for 15
minutes at room temperature, (3) neutralized by adding 2 .mu.l of 5
N NaOH (2 .mu.l per 110 .mu.l sera), and (4) diluted in 1/3 with
assay buffer.
[0315] Incubation was carried out for 2 hours at room temperature
while shaking at 600-700 rpm. The wells (400 .mu.l/well) were
washed three times with PBS containing 0.02% (v/v) Tween-20. 100
.mu.l of TMB (R&D System, Minneapolis, Minn.) was added,
followed by an incubation for twenty minutes at room temperature.
50 .mu.l of stop solution (R&D System, Minneapolis, Minn.) was
added. OD measurement was performed using 450 nm in Molecular
Device SpectraMax M5.
[0316] A standard curve was generated by plotting absorbance at 450
nm vs. the log of the rh-activin concentration, by using a log-log
(or a five-parameter logistic) curve-fitting program of Molecular
Device. Values for sample concentrations were obtained by
interpolation of their absorbance from the standard.
[0317] The Capturing Antibody was A-3 anti-activin A mAb, 20.78
mg/ml. The Detection Antibody was A-1 anti-activin A mAb-HRP, 0.65
HRP/Ab, 12.05 mg/ml. The Blocking Buffer was I-blocking buffer. The
wash buffer was PBS/0.1% Tween-20. The assay buffer (Reagent
Diluent) was 0 mg/ml activin A buffer.
Example 14
Activin A Protease Protection Analysis
[0318] Protease protection assays were conducted in order to
identify epitope binding of activin A antibodies. Recombinant human
activin A degraded preparation was analyzed by three methods. The
first method examined an activin A preparation that had been
degraded during purification. The second method included
proteolysis of the activin A preparation with Lysine C,
chymotrypsin, pepsin and thermolysin. The third method included
chemical degradation of the preparation using cyanogen bromide.
[0319] Thus, for the proteolysis of human activin and antibody
complex, 5 micrograms of activin A and 90 micrograms of antibody
were mixed in 100 microliters of 0.1 M ammonium bicarbonate (pH
7.8) and kept at room temperature for approximately 20 minutes
before treatment with 2% by weight of the particular selected
protease. Digestion of the protein was allowed to proceed at 37
degrees Celsius for 90 minutes. Control samples containing activin
A alone or antibody alone were carried out in an identical fashion.
The samples were acidified prior to RP-HPLC analysis.
[0320] For the cyanogen bromide digestion of activin A, CNBr
fragments of activin A were generated by incubating 10 micrograms
of the protein with CNBr in 100 mincroliters of 90% TFA overnight
at room temperature. The sample was kept in the dark throughout the
incubation and was dried in a vacuum prior to RP-HPLC analysis.
[0321] The RP-HPLC was utilized to analyze the fragments generated
as described above. Briefly, the column was equilibrated with
solvent, the sample was injected and the column was washed with
solvent before a linear gradient was applied. Column effluent was
monitored by absorbance at 215 nm. The eluted samples were manually
collected and analyzed by Edman degradation and mass
spectrometry.
[0322] The preparation that had been degraded during purification
contained the following species:
1. Gly.sup.1-His.sup.59 (6,456.2 Da)
2. Ser.sup.60-Tyr.sup.94 (4,102.9 Da)
3. Asp.sup.95-Ser.sup.116 (2,452.8 Da)
4. Gly.sup.1-Tyr.sup.94 (10,541.1 Da)
[0323] The preparation that had been degraded by a
chymotryptic-like activity had the following species cleaved at the
locations indicated in SEQ ID NO: 225:
##STR00001##
[0324] The species set forth in FIG. 9 indicate the locations of
cleavage sites when the activin A preparation was degraded by
chymotrypsin, Lysine C (LysC), or Cyanogen Bromide (CNBr).
Example 15
Activin A Binding Assay
[0325] Monoclonal antibodies A1, A2, and A3 bind to activin A but
not activin B, according to the binding affinities listed in Table
6. Thus, an affinity analysis of activin A antibodies A1, A2, and
A3 was performed in order to determine the region or structure
needed for neutralizing antibody binding. Several activin A binding
proteins are known, including ActRII (A/B), ActRI (A/B)(Alt4),
follistatin, and follistatin related gene (FLRG).
[0326] Binding assays were conducted to screen antibodies in order
to assess their ability to bind to immobilized antibody surfaces
(activin A and/or activin B). Binding assays were performed
utilizing 2 nM rhActivin A and 20 nM of each antibody immobilized
on a surface. The following antibodies were immobilized on a
surface and tested: AKA1 (commercially available), AKA2
(commercially available), A1, and A3. Results of the antibody assay
are indicated in FIG. 10.
TABLE-US-00012 Anti- Activin A Ab A2 A3 A1 AKA1 AKA2 Activin
K.sub.D~25 pM K.sub.D~11 pM K.sub.D~3 pM K.sub.D~4 pM K.sub.D~4 pM
A Activin -- -- -- -- -- B
Example 16
Activin A Binding Assay Region Mapping (Biacore)
[0327] Blocking assays were conducted on immobilized recombinant
human activin RIB-Fc chimera surfaces, recombinant human activin
RIIB-Fc chimera surfaces, and recombinant human RIIA-Fc chimera
recombinant surfaces, as described in Example 5. Monoclonal
antibodies A1, A2, AKA1, and AKA2 on each chimera surface were
incubated with 1 nM activin A, and the relative binding response
(%) was measured. An increased binding response in the presence of
antibodies indicates that activin A is able to bind to the
immobilized receptor surfaces and the antibodies in solution
simultaneously, which is referred to as "carry on". Results are
indicated in Table 7 and FIG. 11, where EC50 means the effective
concentration that yields 50% binding.
TABLE-US-00013 TABLE 7 rhActivin RIB/Fc rhActivin RIIB/Fc rhActivin
FIIA/Fc EC50 (nM) Chimera Chimera Chimera AKA1 Partially block 0.30
0.35 AKA2 Partially block 0.36 0.37 A1 0.29 0.29 0.29 A2 0.18 Carry
on Carry on
Example 17
Activin A/B Chimeras
[0328] Activin A/B chimeras were generated in order to further
assess the epitope binding abilities of monoclonal antibodies A1,
A2, and A3, as described in Examples 5 and 16. As indicated in FIG.
12, two chimeras were tested: Activin A 13/39 B (containing amino
acids 1-116 of activin A except that amino acids at positions 13-39
of activin A are substituted with the corresponding amino acids at
positions 13-39 from activin B--SEQ ID NO: 243), and activin A
82/107 B (containing amino acids 1-116 of activin A except that
amino acids at positions 82-107 of activin A are substituted with
the corresponding amino acids at positions 82-107 from activin
B--SEQ ID NO: 244).
[0329] Briefly, a full length activin A clone was used as a
template for amplification by PCR using Pfu ultra polymerase
(Stratagene) and primers (SEQ ID NO: 245 and SEQ ID NO: 246) at the
start of the mature protein sequence. The resulting PCR product was
column purified (Qiagen), digested with SalI and XbaI restriction
enzymes (Roche) and gel isolated (Qiagen). The synthetic gene
cassettes containing the modified mature protein sequences were
designed by utilizing the amino acid sequences from full length
activin A and activin B and back translating into DNA sequences
codon optimized for expression in a mammalian host cell by using
the Gene Designer program (Version 1.0.4, DNA 2.0, Inc.) (BMC
Bioinformatics, 7: 285 (2006)). The sequences were digested with
XbaI and NotI and gel isolated. The activin A PCR product was
ligated under standard reaction conditions using T4 DNA ligase (New
England Biolabs, Inc.) with either the 13-39 synthetic gene
fragment (SEQ ID NO: 247) or the 82-107 synthetic gene fragment
(SEQ ID NO: 213) and a SalI/NotI digested expression vector
(pDRSalpha 24) to produce full length expression constructs. The
synthetic gene construct of activin A with amino acids 13-39
replaced with activin B sequence (SEQ ID NO: 247) and the synthetic
gene construct of acivin A with amino acids 82-107 replaced with
activin B sequence (SEQ ID NO: 248) were then utilized in the
epitope mapping experiments (results shown in FIG. 14).
[0330] From the foregoing, although specific embodiments of the
invention have been described herein for purposes of illustration,
various modifications may be made without deviating from the spirit
and scope of the invention. Accordingly, the invention is not
limited except as by the appended claims. All publications,
published patent applications, and patent documents disclosed
herein are hereby incorporated by reference.
Sequence CWU 1
1
2661318DNAHomo sapiens 1tcctatgagg tgactcaggc accctcagtg tccgtgtccc
caggacagac agccagcatc 60acctgctctg gagataaatt gggggataaa tatgcttgtt
ggtatcagca gaagccaggc 120cagtcccctg tgctggtcat ctatcaagat
agcaagcggc cctcagggat ccctgagcga 180ttctctggct ccaactctgg
aaacacagcc actctgacca tcagcgggac ccaggctatg 240gatgaggctg
actattactg tcaggcgtgg gacagcagca ctgcggtatt cggcggaggg
300accaagctga ccgtccta 3182366DNAHomo sapiens 2caggttcagc
tggtgcagtc tggagctgag gtgaagaagc ctggggcctc agtgaaggtc 60tcctgcaagg
cttctggtta cacctttacc agttatggtc tcagctgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatgg atcatccctt acaatggtaa
cacaaactct 180gcacagaaac tccagggcag agtcaccatg accacagaca
catccacgag cacagcctac 240atggagctga ggagcctgag atctgacgac
acggccgtgt atttctgtgc gagagacagg 300gactacggtg tcaattatga
tgcttttgat atctggggcc aagggacaat ggtcaccgtc 360tcttca 366333DNAHomo
sapiens 3tctggagata aattggggga taaatatgct tgt 33421DNAHomo sapiens
4caagatagca agcggccctc a 21527DNAHomo sapiens 5caggcgtggg
acagcagcac tgcggta 27630DNAHomo sapiens 6ggttacacct ttaccagtta
tggtctcagc 30751DNAHomo sapiens 7tggatcatcc cttacaatgg taacacaaac
tctgcacaga aactccaggg c 51839DNAHomo sapiens 8gacagggact acggtgtcaa
ttatgatgct tttgatatc 399106PRTHomo sapiens 9Ser Tyr Glu Val Thr Gln
Ala Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser Ile
Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala 20 25 30 Cys Trp
Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 35 40 45
Gln Asp Ser Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50
55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Ala
Met65 70 75 80 Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp Asp Ser Ser
Thr Ala Val 85 90 95 Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100
105 10122PRTHomo sapiens 10Gln Val Gln Leu Val Gln Ser Gly Ala Glu
Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala
Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30 Gly Leu Ser Trp Val Arg
Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly Trp Ile Ile
Pro Tyr Asn Gly Asn Thr Asn Ser Ala Gln Lys Leu 50 55 60 Gln Gly
Arg Val Thr Met Thr Thr Asp Thr Ser Thr Ser Thr Ala Tyr65 70 75 80
Met Glu Leu Arg Ser Leu Arg Ser Asp Asp Thr Ala Val Tyr Phe Cys 85
90 95 Ala Arg Asp Arg Asp Tyr Gly Val Asn Tyr Asp Ala Phe Asp Ile
Trp 100 105 110 Gly Gln Gly Thr Met Val Thr Val Ser Ser 115 120
1111PRTHomo sapiens 11Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala Cys1
5 10 127PRTHomo sapiens 12Gln Asp Ser Lys Arg Pro Ser1 5 139PRTHomo
sapiens 13Gln Ala Trp Asp Ser Ser Thr Ala Val1 5 1411PRTHomo
sapiens 14Arg Ala Ser Gln Gly Ile Arg Asn Asn Leu Gly1 5 10
157PRTHomo sapiens 15Ala Ala Ser Ser Leu Gln Ser1 5 169PRTHomo
sapiens 16Leu Gln His Asn Ser Tyr Pro Trp Thr1 5 17321DNAHomo
sapiens 17gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgcc gggcaagtca gggcattaga aataatttag gctggtatca
gcagaaacca 120gggaaagccc ctaagcgcct gatttatgct gcatccagtt
tgcaaagtgg ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa
ttcactctca caatcagcag tctgcagcct 240gaagatttta caacttatta
ctgtctacag cataatagtt acccgtggac gttcggccaa 300gggaccaagg
tggaaatcaa a 32118373DNAHomo sapiens 18caggtgcagc tggtggagtc
tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt
caccttcagt agttacggca tgcactgggt ccgccaggct 120ccaggcaagg
ggctggagtg ggtggcagtt atatggtatg atggaagtaa taaataccat
180gcagactccg tgaagggccg attcaccatc tccagagaca attccaagaa
cacgctgtat 240ctgcaagtga acagcctgag agccgaggac acggctgtgt
attactgtgt gagaagtcgg 300aactggaact acgacaacta ctactacggt
ctggacgtct ggggccaagg gaccacggtc 360accgtctcct cag 3731933DNAHomo
sapiens 19cgggcaagtc agggcattag aaataattta ggc 332021DNAHomo
sapiens 20gctgcatcca gtttgcaaag t 212127DNAHomo sapiens
21ctacagcata atagttaccc gtggacg 272230DNAHomo sapiens 22ggattcacct
tcagtagtta cggcatgcac 302351DNAHomo sapiens 23gttatatggt atgatggaag
taataaatac catgcagact ccgtgaaggg c 512445DNAHomo sapiens
24agtcggaact ggaactacga caactactac tacggtctgg acgtc 4525107PRTHomo
sapiens 25Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser
Val Gly1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly
Ile Arg Asn Asn 20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys
Ala Pro Lys Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser
Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu
Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Thr
Thr Tyr Tyr Cys Leu Gln His Asn Ser Tyr Pro Trp 85 90 95 Thr Phe
Gly Gln Gly Thr Lys Val Glu Ile Lys 100 105 26124PRTHomo sapiens
26Gln Val Gln Leu Val Glu Ser Gly Gly Gly Val Val Gln Pro Gly Arg1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr 20 25 30 Gly Met His Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Trp Val 35 40 45 Ala Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr
His Ala Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ser Lys Asn Thr Leu Tyr65 70 75 80 Leu Gln Val Asn Ser Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Val Arg Ser Arg Asn
Trp Asn Tyr Asp Asn Tyr Tyr Tyr Gly Leu Asp 100 105 110 Val Trp Gly
Gln Gly Thr Thr Val Thr Val Ser Ser 115 120 2711PRTHomo sapiens
27Arg Ala Ser Gln Gly Ile Arg Asn Asn Leu Gly1 5 10 287PRTHomo
sapiens 28Ala Ala Ser Ser Leu Gln Ser1 5 299PRTHomo sapiens 29Leu
Gln His Asn Ser Tyr Pro Trp Thr1 5 3010PRTHomo sapiens 30Gly Phe
Thr Phe Ser Ser Tyr Gly Met His1 5 10 3117PRTHomo sapiens 31Val Ile
Trp Tyr Asp Gly Ser Asn Lys Tyr His Ala Asp Ser Val Lys1 5 10 15
Gly3215PRTHomo sapiens 32Ser Arg Asn Trp Asn Tyr Asp Asn Tyr Tyr
Tyr Gly Leu Asp Val1 5 10 15 33321DNAHomo sapiens 33gacatccaga
tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc
gggcaagtca gggcattaga aatgatttag gctggtatca gcagaaacca
120gggaaagccc ctaagcgcct gatctatgct gcatccagtt tgcaaagtgg
ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa ttcactctca
caatcagcag cctgcagcct 240gaagattttg caacttatta ctgtcgacag
caaaatactt acccgctcac tttcggcgga 300gggaccaagg tggagatcaa a
32134369DNAHomo sapiens 34gaggtgcagt tggtggagtc tgggggaggc
ttggtccagc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt cacctttagt
agttattgga tgagctgggt ccgccaggct 120ccagggaagg ggctggagtg
cgtggccaac ataaagcaag atggaagtga ggaatactat 180gtggactctg
tgaagggccg attcaccatc tccagagaca acgccaagaa ttcactgtat
240ctgcaaatga acagcctgag agccgaggac acggctgtgt attactgtgc
gagaggtagc 300agcagctggt actactacaa ctacggtatg gacgtctggg
gccaagggac cacggtcacc 360gtctcctca 3693533DNAHomo sapiens
35cgggcaagtc agggcattag aaatgattta ggc 333621DNAHomo sapiens
36gctgcatcca gtttgcaaag t 213727DNAHomo sapiens 37cgacagcaaa
atacttaccc gctcact 273830DNAHomo sapiens 38ggattcacct ttagtagtta
ttggatgagc 303951DNAHomo sapiens 39aacataaagc aagatggaag tgaggaatac
tatgtggact ctgtgaaggg c 514042DNAHomo sapiens 40ggtagcagca
gctggtacta ctacaactac ggtatggacg tc 4241107PRTHomo sapiens 41Asp
Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10
15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asp
20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg
Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser
Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr
Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys
Arg Gln Gln Asn Thr Tyr Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr
Lys Val Glu Ile Lys 100 105 42123PRTHomo sapiens 42Glu Val Gln Leu
Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1 5 10 15 Ser Leu
Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30
Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Cys Val 35
40 45 Ala Asn Ile Lys Gln Asp Gly Ser Glu Glu Tyr Tyr Val Asp Ser
Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ala Lys Asn
Ser Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Ser Ser Ser Trp Tyr Tyr
Tyr Asn Tyr Gly Met Asp Val 100 105 110 Trp Gly Gln Gly Thr Thr Val
Thr Val Ser Ser 115 120 4311PRTHomo sapiens 43Arg Ala Ser Gln Gly
Ile Arg Asn Asp Leu Gly1 5 10 447PRTHomo sapiens 44Ala Ala Ser Ser
Leu Gln Ser1 5 459PRTHomo sapiens 45Arg Gln Gln Asn Thr Tyr Pro Leu
Thr1 5 4610PRTHomo sapiens 46Gly Phe Thr Phe Ser Ser Tyr Trp Met
Ser1 5 10 4717PRTHomo sapiens 47Asn Ile Lys Gln Asp Gly Ser Glu Glu
Tyr Tyr Val Asp Ser Val Lys1 5 10 15 Gly4814PRTHomo sapiens 48Gly
Ser Ser Ser Trp Tyr Tyr Tyr Asn Tyr Gly Met Asp Val1 5 10
49336DNAHomo sapiens 49gatattgtga tgactcagtc tccactctcc ctgcccgtca
cccctggaga gccggcctcc 60atctcctgca ggtctagtca gagcctcctg catagtactg
gatacaacta tttggattgg 120tacctgcaga agccagggca gtctccacag
ctcctgatct atttgggttc ttttcgggcc 180tccggggtcc ctgacaggtt
cagtggcagt gggtcaggca cagattttac actgaaaatc 240agcagagtgg
aggctgagga tgttggggtt tattactgca tgcaagctct ccaaactccg
300tgcagttttg gccaggggac caagctggag atcaag 33650363DNAHomo sapiens
50caggtgcagc tggtgcagtc tggggctgag gtgaagaagc ctggggcctc agtgaaggtc
60tcctgcaagg cttctggata caccttcacc ggctactata tccactgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatgg atcaacccta acagtggtgg
cacaaactat 180gcacagaagt ttcagggcag ggtcaccatg accagggaca
cgtccatcag cacagcctac 240atggagctga gcaggctgag atctgacgac
acggccgtgt atttctgtgc gagagattcg 300gggtatagca gcagctggca
ctttgactac tggggccagg gaaccctggt caccgtctcc 360tca 3635148DNAHomo
sapiens 51aggtctagtc agagcctcct gcatagtact ggatacaact atttggat
485221DNAHomo sapiens 52ttgggttctt ttcgggcctc c 215326DNAHomo
sapiens 53atgcaagctc tccaaactcc gtgcag 265430DNAHomo sapiens
54ggatacacct tcaccggcta ctatatccac 305551DNAHomo sapiens
55tggatcaacc ctaacagtgg tggcacaaac tatgcacaga agtttcaggg c
515636DNAHomo sapiens 56gattcggggt atagcagcag ctggcacttt gactac
3657112PRTHomo sapiens 57Asp Ile Val Met Thr Gln Ser Pro Leu Ser
Leu Pro Val Thr Pro Gly1 5 10 15 Glu Pro Ala Ser Ile Ser Cys Arg
Ser Ser Gln Ser Leu Leu His Ser 20 25 30 Thr Gly Tyr Asn Tyr Leu
Asp Trp Tyr Leu Gln Lys Pro Gly Gln Ser 35 40 45 Pro Gln Leu Leu
Ile Tyr Leu Gly Ser Phe Arg Ala Ser Gly Val Pro 50 55 60 Asp Arg
Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile65 70 75 80
Ser Arg Val Glu Ala Glu Asp Val Gly Val Tyr Tyr Cys Met Gln Ala 85
90 95 Leu Gln Thr Pro Cys Ser Phe Gly Gln Gly Thr Lys Leu Glu Ile
Lys 100 105 110 58121PRTHomo sapiens 58Gln Val Gln Leu Val Gln Ser
Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val Lys Val Ser
Cys Lys Ala Ser Gly Tyr Thr Phe Thr Gly Tyr 20 25 30 Tyr Ile His
Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35 40 45 Gly
Trp Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Ala Gln Lys Phe 50 55
60 Gln Gly Arg Val Thr Met Thr Arg Asp Thr Ser Ile Ser Thr Ala
Tyr65 70 75 80 Met Glu Leu Ser Arg Leu Arg Ser Asp Asp Thr Ala Val
Tyr Phe Cys 85 90 95 Ala Arg Asp Ser Gly Tyr Ser Ser Ser Trp His
Phe Asp Tyr Trp Gly 100 105 110 Gln Gly Thr Leu Val Thr Val Ser Ser
115 120 5911PRTHomo sapiens 59Ser Gly Asp Lys Leu Gly Asp Lys Tyr
Ala Cys1 5 10 607PRTHomo sapiens 60Gln Asp Ser Lys Arg Pro Ser1 5
619PRTHomo sapiens 61Gln Ala Trp Asp Ser Ser Thr Ala Val1 5
6210PRTHomo sapiens 62Gly Tyr Thr Phe Thr Ser Tyr Gly Leu Ser1 5 10
6317PRTHomo sapiens 63Trp Ile Ile Pro Tyr Asn Gly Asn Thr Asn Ser
Ala Gln Lys Leu Gln1 5 10 15 Gly6413PRTHomo sapiens 64Asp Arg Asp
Tyr Gly Val Asn Tyr Asp Ala Phe Asp Ile1 5 10 65339DNAHomo sapiens
65gacatcgtga tgacccagtc tccagactcc ctggctgtgt ctctgggcga gagggccacc
60atcacctgca agtccagcca gagtatttta tacagttcca acaataagaa gtatctagtt
120tggtaccagc agaaaccagg acagcctcct aagctgatca tttactggac
atctatgcgg 180gaatccgggg tccctgaccg attcagtggc agcgggtctg
ggacagattt cactctcacc 240atcaacagcc tgcaggctga agatgtggca
gtttattact gtcagcaata ttatagtact 300ccgtggacgt tcggccaagg
gaccaaggtg gaaatcaaa 33966488DNAHomo sapiens 66caggtgcagc
tgcaggagtc gggcccagga ctggtgaagc cttcggagac cctgtccctc 60acctgcactg
tctctggtgg ctccatcaat agtttctact ggagctggat ccggcagccc
120ccagggaagg gactggagtg gattgggtat atctattaca gtgggagcac
caactacaat 180ccctccctca agagtcgagt caccatatca gtagacacgt
ccaagaccca gttctccctg 240aagctgagct ctgtgaccgc tgcggacacg
gccgtgtatt actgtgcgag agacagtata 300gcagccccct ttgactactg
gggccaggga accctggtca ccgtctcctc agcttccacc 360aagggcccat
ccgtcttccc cctggcgccc tgctccagga gcacctccga gagcacagcc
420gccctgggct gcctggtcaa ggactacttc cccgaaccgg tgacggtgtc
gtggaactca 480tgcgccct 4886751DNAHomo sapiens 67aagtccagcc
agagtatttt atacagttcc aacaataaga agtatctagt t 516821DNAHomo sapiens
68tggacatcta tgcgggaatc c 216927DNAHomo sapiens 69cagcaatatt
atagtactcc gtggacg 277030DNAHomo sapiens 70ggtggctcca tcaatagttt
ctactggagc 307148DNAHomo sapiens 71tatatctatt acagtgggag caccaactac
aatccctccc tcaagagt 487227DNAHomo sapiens 72gacagtatag cagccccctt
tgactac 2773113PRTHomo sapiens 73Asp Ile Val Met Thr Gln Ser Pro
Asp Ser Leu Ala Val Ser Leu Gly1 5 10 15 Glu Arg Ala Thr Ile Thr
Cys Lys Ser Ser Gln Ser Ile Leu Tyr Ser 20 25 30
Ser Asn Asn Lys Lys Tyr Leu Val Trp Tyr Gln Gln Lys Pro Gly Gln 35
40 45 Pro Pro Lys Leu Ile Ile Tyr Trp Thr Ser Met Arg Glu Ser Gly
Val 50 55 60 Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe
Thr Leu Thr65 70 75 80 Ile Asn Ser Leu Gln Ala Glu Asp Val Ala Val
Tyr Tyr Cys Gln Gln 85 90 95 Tyr Tyr Ser Thr Pro Trp Thr Phe Gly
Gln Gly Thr Lys Val Glu Ile 100 105 110 Lys74117PRTHomo sapiens
74Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu1
5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Asn Ser
Phe 20 25 30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu
Glu Trp Ile 35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr
Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val Thr Ile Ser Val Asp Thr
Ser Lys Thr Gln Phe Ser Leu65 70 75 80 Lys Leu Ser Ser Val Thr Ala
Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Asp Ser Ile Ala
Ala Pro Phe Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val
Ser Ser 115 7517PRTHomo sapiens 75Lys Ser Ser Gln Ser Ile Leu Tyr
Ser Ser Asn Asn Lys Lys Tyr Leu1 5 10 15 Val767PRTHomo sapiens
76Trp Thr Ser Met Arg Glu Ser1 5 779PRTHomo sapiens 77Gln Gln Tyr
Tyr Ser Thr Pro Trp Thr1 5 7810PRTHomo sapiens 78Gly Gly Ser Ile
Asn Ser Phe Tyr Trp Ser1 5 10 7916PRTHomo sapiens 79Tyr Ile Tyr Tyr
Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 15 809PRTHomo
sapiens 80Asp Ser Ile Ala Ala Pro Phe Asp Tyr1 5 81321DNAHomo
sapiens 81gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgcc gggcaagtca gagcattagc aactatttaa attggtatca
gcagagacca 120gggaaagccc ctaagctcct gatctatgct acatccagtt
tgcaaagtgg ggtcccatca 180aggttcagtg gcagtggatc tgggacagat
ttcactctca ccatcagcag tctgcaacct 240gaagattttg taagttacta
ctgtcaacag agttacagta tttcgcccac tttcggcggc 300gggaccaagg
tggagaacaa a 32182357DNAHomo sapiens 82caggtgcagc tacagcagtg
gggcgcagga ctgttgaagc cttcggagac cctgtccctc 60acctgcgctg tctatggtgg
gtccttcagt gcttactact ggagctggat ccgccagccc 120ccagggaagg
gactggagtg gattggggaa atcaatcata gtggaggcac caactacaac
180ccgtccctca agagtcgagt caccatatca gtagacacgt ccaagaacca
gttctccctg 240aagctgagct ctgtgaccgc cgcggacacg gctgtgtatt
actgtgcgag agtacagtgg 300ctcgaactgg cctactttga ctactggggc
cagggaaccc tggtcaccgt ctcctca 3578333DNAHomo sapiens 83cgggcaagtc
agagcattag caactattta aat 3384106PRTHomo sapiens 84Gly Gln Pro Lys
Ala Ala Pro Ser Val Thr Leu Phe Pro Pro Ser Ser1 5 10 15 Glu Glu
Leu Gln Ala Asn Lys Ala Thr Leu Val Cys Leu Ile Ser Asp 20 25 30
Phe Tyr Pro Gly Ala Val Thr Val Ala Trp Lys Ala Asp Ser Ser Pro 35
40 45 Val Lys Ala Gly Val Glu Thr Thr Thr Pro Ser Lys Gln Ser Asn
Asn 50 55 60 Lys Tyr Ala Ala Ser Ser Tyr Leu Ser Leu Thr Pro Glu
Gln Trp Lys65 70 75 80 Ser His Arg Ser Tyr Ser Cys Gln Val Thr His
Glu Gly Ser Thr Val 85 90 95 Glu Lys Thr Val Ala Pro Thr Glu Cys
Ser 100 105 8527DNAHomo sapiens 85caacagagtt acagtatttc gcccact
278630DNAHomo sapiens 86ggtgggtcct tcagtgctta ctactggagc
308748DNAHomo sapiens 87gaaatcaatc atagtggagg caccaactac aacccgtccc
tcaagagt 488833DNAHomo sapiens 88gtacagtggc tcgaactggc ctactttgac
tac 3389107PRTHomo sapiens 89Asp Ile Gln Met Thr Gln Ser Pro Ser
Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr Ile Thr Cys
Arg Ala Ser Gln Ser Ile Ser Asn Tyr 20 25 30 Leu Asn Trp Tyr Gln
Gln Arg Pro Gly Lys Ala Pro Lys Leu Leu Ile 35 40 45 Tyr Ala Thr
Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser
Gly Ser Gly Thr Asp Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75
80 Glu Asp Phe Val Ser Tyr Tyr Cys Gln Gln Ser Tyr Ser Ile Ser Pro
85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Asn Lys 100 105
90119PRTHomo sapiens 90Gln Val Gln Leu Gln Gln Trp Gly Ala Gly Leu
Leu Lys Pro Ser Glu1 5 10 15 Thr Leu Ser Leu Thr Cys Ala Val Tyr
Gly Gly Ser Phe Ser Ala Tyr 20 25 30 Tyr Trp Ser Trp Ile Arg Gln
Pro Pro Gly Lys Gly Leu Glu Trp Ile 35 40 45 Gly Glu Ile Asn His
Ser Gly Gly Thr Asn Tyr Asn Pro Ser Leu Lys 50 55 60 Ser Arg Val
Thr Ile Ser Val Asp Thr Ser Lys Asn Gln Phe Ser Leu65 70 75 80 Lys
Leu Ser Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr Cys Ala 85 90
95 Arg Val Gln Trp Leu Glu Leu Ala Tyr Phe Asp Tyr Trp Gly Gln Gly
100 105 110 Thr Leu Val Thr Val Ser Ser 115 9111PRTHomo sapiens
91Arg Ala Ser Gln Ser Ile Ser Asn Tyr Leu Asn1 5 10 927PRTHomo
sapiens 92Ala Thr Ser Ser Leu Gln Ser1 5 939PRTHomo sapiens 93Gln
Gln Ser Tyr Ser Ile Ser Pro Thr1 5 9410PRTHomo sapiens 94Gly Gly
Ser Phe Ser Ala Tyr Tyr Trp Ser1 5 10 9516PRTHomo sapiens 95Glu Ile
Asn His Ser Gly Gly Thr Asn Tyr Asn Pro Ser Leu Lys Ser1 5 10 15
9611PRTHomo sapiens 96Val Gln Trp Leu Glu Leu Ala Tyr Phe Asp Tyr1
5 10 97321DNAHomo sapiens 97gacatccaga tgacccagtc tccatcctcc
ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggcaggtca gggcattaga
aatgatttag tctggtatca gcagaaacca 120gggaaagccc ctaagcgcct
gatctatgct gcatccagtt tgcaaagtgg ggtcccatca 180aggttcagcg
gcagtggatc tgggacagaa ttcactctca caatcagcag cctgcagcct
240gaagattttg caacttatta ctgtctacaa cataatactt acccattcac
tttcggccct 300gggaccaaag tggatatcaa a 32198363DNAHomo sapiens
98caggtgcagc tggtggactc tgggggaggc gtggtccagc ctgggaggtc cctgagactc
60tcctgtgcag cgtctggatt caccttcatt agctatggca tgcactgggt ccgccaggct
120ccaggcaagg ggctggagtg ggtggcagtt atctggtatg atggaagtac
tgaatactat 180gcagactccg tgaagggccg attcaccatc tccagagaca
attccaagaa cacgctgtat 240ctgcaaatga acagcctgag agccgaggac
acggctgtgt attactgtgc gagagagagg 300cagtggctct accactacgg
tatggacgtc tggggccaag ggaccacggt caccgtctcc 360tca 3639933DNAHomo
sapiens 99cgggcaggtc agggcattag aaatgattta gtc 33100107PRTHomo
sapiens 100Arg Thr Val Ala Ala Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu1 5 10 15 Gln Leu Lys Ser Gly Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe 20 25 30 Tyr Pro Arg Glu Ala Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln 35 40 45 Ser Gly Asn Ser Gln Glu Ser Val
Thr Glu Gln Asp Ser Lys Asp Ser 50 55 60 Thr Tyr Ser Leu Ser Ser
Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu65 70 75 80 Lys His Lys Val
Tyr Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser 85 90 95 Pro Val
Thr Lys Ser Phe Asn Arg Gly Glu Cys 100 105 10127DNAHomo sapiens
101ctacaacata atacttaccc attcact 2710230DNAHomo sapiens
102ggattcacct tcattagcta tggcatgcac 3010351DNAHomo sapiens
103gttatctggt atgatggaag tactgaatac tatgcagact ccgtgaaggg c
5110436DNAHomo sapiens 104gagaggcagt ggctctacca ctacggtatg gacgtc
36105107PRTHomo sapiens 105Asp Ile Gln Met Thr Gln Ser Pro Ser Ser
Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr Ile Thr Cys Arg
Ala Gly Gln Gly Ile Arg Asn Asp 20 25 30 Leu Val Trp Tyr Gln Gln
Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile 35 40 45 Tyr Ala Ala Ser
Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55 60 Ser Gly
Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln Pro65 70 75 80
Glu Asp Phe Ala Thr Tyr Tyr Cys Leu Gln His Asn Thr Tyr Pro Phe 85
90 95 Thr Phe Gly Pro Gly Thr Lys Val Asp Ile Lys 100 105
106121PRTHomo sapiens 106Gln Val Gln Leu Val Asp Ser Gly Gly Gly
Val Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala
Ser Gly Phe Thr Phe Ile Ser Tyr 20 25 30 Gly Met His Trp Val Arg
Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile Trp
Tyr Asp Gly Ser Thr Glu Tyr Tyr Ala Asp Ser Val 50 55 60 Lys Gly
Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75 80
Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85
90 95 Ala Arg Glu Arg Gln Trp Leu Tyr His Tyr Gly Met Asp Val Trp
Gly 100 105 110 Gln Gly Thr Thr Val Thr Val Ser Ser 115 120
10711PRTHomo sapiens 107Arg Ala Gly Gln Gly Ile Arg Asn Asp Leu
Val1 5 10 108107PRTHomo sapiens 108Arg Thr Val Ala Ala Pro Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu1 5 10 15 Gln Leu Lys Ser Gly Thr
Ala Ser Val Val Cys Leu Leu Asn Asn Phe 20 25 30 Tyr Pro Arg Glu
Ala Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln 35 40 45 Ser Gly
Asn Ser Gln Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser 50 55 60
Thr Tyr Ser Leu Ser Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu65
70 75 80 Lys His Lys Val Tyr Ala Cys Glu Val Thr His Gln Gly Leu
Ser Ser 85 90 95 Pro Val Thr Lys Ser Phe Asn Arg Gly Glu Cys 100
105 1099PRTHomo sapiens 109Leu Gln His Asn Thr Tyr Pro Phe Thr1 5
11010PRTHomo sapiens 110Gly Phe Thr Phe Ile Ser Tyr Gly Met His1 5
10 11117PRTHomo sapiens 111Val Ile Trp Tyr Asp Gly Ser Thr Glu Tyr
Tyr Ala Asp Ser Val Lys1 5 10 15 Gly11212PRTHomo sapiens 112Glu Arg
Gln Trp Leu Tyr His Tyr Gly Met Asp Val1 5 10 113339DNAHomo sapiens
113gacatcgtga tgacccagtc tccagactcc ctggctgtgt ctctgggcga
gagggccacc 60atcacctgca agtccagcca gagtatttta tacagctcca acaataagaa
gtatctagtt 120tggtaccagc agaaaccagg acagcctcct aagttgatca
tttactggac atctatgcgg 180gaatccgggg tccctgaccg attcagtggc
agcgggtctg ggacagattt cactctcacc 240atcagcagcc tgcaggctga
agatgtggca gtttattact gtcagcaata ttatagtact 300ccgtggacgt
tcggccaagg gaccaaggtg gaaatcaaa 339114351DNAHomo sapiens
114caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cctcggagac
cctgtccctc 60acctgcactg tctctggtgg ctccatcaat agtttctact ggagctggat
ccggcagccc 120ccagggaagg gactggagtg gattgggtat atctattaca
gtgggagcac caactacaat 180ccctccctca agaggcgagt caccatatca
gtagacacgt ccaagaccca gttctccctg 240aagctgagct ctgtgaccgc
tgcggacacg gccgtgtatt actgtgcgag agacagtata 300gcagccccct
ttgactactg gggccaggga accctggtca ccgtctcctc a 35111517PRTHomo
sapiensVARIANT1Xaa = Arg OR Lys 115Xaa Ser Ser Gln Ser Xaa Leu Xaa
Ser Xaa Xaa Xaa Xaa Xaa Tyr Leu1 5 10 15 Xaa11611PRTHomo
sapiensVARIANT3Xaa = Ser OR Gly 116Arg Ala Xaa Gln Xaa Ile Xaa Asn
Xaa Leu Xaa1 5 10 11727DNAHomo sapiens 117cagcaatatt atagtactcc
gtggacg 2711830DNAHomo sapiens 118ggtggctcca tcaatagttt ctactggagc
3011948DNAHomo sapiens 119tatatctatt acagtgggag caccaactac
aatccctccc tcaagagg 4812027DNAHomo sapiens 120gacagtatag cagccccctt
tgactac 27121113PRTHomo sapiens 121Asp Ile Val Met Thr Gln Ser Pro
Asp Ser Leu Ala Val Ser Leu Gly1 5 10 15 Glu Arg Ala Thr Ile Thr
Cys Lys Ser Ser Gln Ser Ile Leu Tyr Ser 20 25 30 Ser Asn Asn Lys
Lys Tyr Leu Val Trp Tyr Gln Gln Lys Pro Gly Gln 35 40 45 Pro Pro
Lys Leu Ile Ile Tyr Trp Thr Ser Met Arg Glu Ser Gly Val 50 55 60
Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Thr65
70 75 80 Ile Ser Ser Leu Gln Ala Glu Asp Val Ala Val Tyr Tyr Cys
Gln Gln 85 90 95 Tyr Tyr Ser Thr Pro Trp Thr Phe Gly Gln Gly Thr
Lys Val Glu Ile 100 105 110 Lys122117PRTHomo sapiens 122Gln Val Gln
Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro Ser Glu1 5 10 15 Thr
Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser Ile Asn Ser Phe 20 25
30 Tyr Trp Ser Trp Ile Arg Gln Pro Pro Gly Lys Gly Leu Glu Trp Ile
35 40 45 Gly Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr Asn Pro Ser
Leu Lys 50 55 60 Arg Arg Val Thr Ile Ser Val Asp Thr Ser Lys Thr
Gln Phe Ser Leu65 70 75 80 Lys Leu Ser Ser Val Thr Ala Ala Asp Thr
Ala Val Tyr Tyr Cys Ala 85 90 95 Arg Asp Ser Ile Ala Ala Pro Phe
Asp Tyr Trp Gly Gln Gly Thr Leu 100 105 110 Val Thr Val Ser Ser 115
12311PRTHomo sapiensVARIANT3Xaa = Glu OR Asp 123Ser Gly Xaa Lys Xaa
Gly Xaa Lys Xaa Xaa Xaa1 5 10 1247PRTHomo sapiensVARIANT1Xaa = Ala
OR Trp OR Leu 124Xaa Xaa Ser Xaa Xaa Xaa Ser1 5 1259PRTHomo sapiens
125Gln Gln Tyr Tyr Ser Thr Pro Trp Thr1 5 12610PRTHomo sapiens
126Gly Gly Ser Ile Asn Ser Phe Tyr Trp Ser1 5 10 12716PRTHomo
sapiens 127Tyr Ile Tyr Tyr Ser Gly Ser Thr Asn Tyr Asn Pro Ser Leu
Lys Arg1 5 10 15 1287PRTHomo sapiensVARIANT1Xaa = Gln OR Leu OR His
128Xaa Asp Xaa Lys Arg Pro Ser1 5 129321DNAHomo sapiens
129gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgcc gggcaagtca gggcattaga aataatttag gctggtatca
gcagaaacca 120gggaaagccc ctaagcgcct gatttatgct gcatccagtt
tgcaaagtgg ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa
ttcactctca caatcagcag cctgcagcct 240gaagatttta caacttatta
ctgtctacag cataatagtt acccgtggac gttcggccaa 300gggaccaagg
tggaaatcaa a 321130372DNAHomo sapiens 130caggtgcagc tggtggagtc
tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt
caccttcagt agttacggca tgcactgggt ccgccaggct 120ccaggcaagg
ggctggagtg ggtggcagtt atatggtatg atggaagtaa taaataccat
180gcagactccg tgaagggccg attcaccatc tccagagaca attccaagaa
cacgctgtat 240ctgcaagtga acagcctgag agccgaggac acggctgtgt
attactgtgt gagaagtcgg 300aactggaact acgacaacta ctactacggt
ctggacgtct ggggccaagg gaccacggtc 360accgtctcct ca 3721319PRTHomo
sapiensVARIANT5Xaa = Thr OR Ser 131Leu Gln His Asn Xaa Tyr Xaa Xaa
Thr1 5 1329PRTHomo sapiensVARIANT1Xaa = Met OR Gln OR Arg 132Xaa
Gln Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5 13327DNAHomo sapiens
133ctacagcata atagttaccc gtggacg 2713411PRTHomo sapiensVARIANT4Xaa
= Ile OR Phe 134Gly Gly Ser Xaa
Xaa Xaa Xaa Xaa Xaa Tyr Trp1 5 10 13551DNAHomo sapiens
135gttatatggt atgatggaag taataaatac catgcagact ccgtgaaggg c
5113645DNAHomo sapiens 136agtcggaact ggaactacga caactactac
tacggtctgg acgtc 45137107PRTHomo sapiens 137Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asn 20 25 30 Leu Gly
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile 35 40 45
Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50
55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Phe Thr Thr Tyr Tyr Cys Leu Gln His Asn Ser
Tyr Pro Trp 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105 138124PRTHomo sapiens 138Gln Val Gln Leu Val Glu Ser Gly
Gly Gly Val Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys
Ala Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val
Ile Trp Tyr Asp Gly Ser Asn Lys Tyr His Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80 Leu Gln Val Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Val Arg Ser Arg Asn Trp Asn Tyr Asp Asn Tyr Tyr
Tyr Gly Leu Asp 100 105 110 Val Trp Gly Gln Gly Thr Thr Val Thr Val
Ser Ser 115 120 13910PRTHomo sapiensVARIANT2Xaa = Tyr OR Phe 139Gly
Xaa Xaa Phe Xaa Xaa Tyr Xaa Xaa Xaa1 5 10 14010PRTHomo
sapiensVARIANT2Xaa = Tyr OR Phe 140Gly Xaa Thr Phe Xaa Xaa Tyr Xaa
Xaa Xaa1 5 10 1419PRTHomo sapiens 141Leu Gln His Asn Ser Tyr Pro
Trp Thr1 5 14216PRTHomo sapiensVARIANT1Xaa = Tyr OR Glu 142Xaa Ile
Xaa Xaa Ser Gly Xaa Thr Xaa Tyr Asn Pro Ser Leu Lys Xaa1 5 10 15
14317PRTHomo sapiens 143Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr His
Ala Asp Ser Val Lys1 5 10 15 Gly14415PRTHomo sapiens 144Ser Arg Asn
Trp Asn Tyr Asp Asn Tyr Tyr Tyr Gly Leu Asp Val1 5 10 15
145315DNAHomo sapiens 145tcctatgagc tgactcagcc accctcagtg
tccgtgtccc caggacagac agccagcatc 60acctgctctg gagaaaaatg gggagagaaa
tatgcttgtt ggtatcagca gaagccaggc 120cagtcccctg tgctggtcat
ctatcaagat accaagcggc cctccgggat ccctgagcga 180ttctctggct
ccatttctgg gaacacagcc actctgacca tcagcgggac ccaggctatg
240gatgaggctg actattattg tcaggcgtgg gacaggagca ctgtattcgg
cggagggacc 300aagctgaccg tccta 315146348DNAHomo sapiens
146gaggtgcagc tggtgcagtc tggagcagag gtgaaaaagc ccggggagtc
tctgaagatc 60tcctgtcagg gttctggata cagctttacc agctactgga tcggctgggt
gcgccagatg 120cccgggaaag gcctggagtg gatggggatc atctatcctg
gtgactctga taccagatac 180agcccgtcct tccaaggcca ggtcaccatc
tcagccgaca agtccatcag caccgcctac 240ctgcagtgga gcagcctgaa
ggcctcggac accgccatgt attactgtgc gagacaagga 300ctggggtttg
actactgggg ccagggaacc ctggtcaccg tctcctca 34814733DNAHomo sapiens
147tctggagaaa aatggggaga gaaatatgct tgt 3314821DNAHomo sapiens
148caagatacca agcggccctc c 2114924DNAHomo sapiens 149caggcgtggg
acaggagcac tgta 2415030DNAHomo sapiens 150ggatacagct ttaccagcta
ctggatcggc 3015151DNAHomo sapiens 151atcatctatc ctggtgactc
tgataccaga tacagcccgt ccttccaagg c 5115221DNAHomo sapiens
152caaggactgg ggtttgacta c 21153105PRTHomo sapiens 153Ser Tyr Glu
Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15 Thr
Ala Ser Ile Thr Cys Ser Gly Glu Lys Trp Gly Glu Lys Tyr Ala 20 25
30 Cys Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr
35 40 45 Gln Asp Thr Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser
Gly Ser 50 55 60 Ile Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly
Thr Gln Ala Met65 70 75 80 Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp
Asp Arg Ser Thr Val Phe 85 90 95 Gly Gly Gly Thr Lys Leu Thr Val
Leu 100 105 154116PRTHomo sapiens 154Glu Val Gln Leu Val Gln Ser
Gly Ala Glu Val Lys Lys Pro Gly Glu1 5 10 15 Ser Leu Lys Ile Ser
Cys Gln Gly Ser Gly Tyr Ser Phe Thr Ser Tyr 20 25 30 Trp Ile Gly
Trp Val Arg Gln Met Pro Gly Lys Gly Leu Glu Trp Met 35 40 45 Gly
Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser Phe 50 55
60 Gln Gly Gln Val Thr Ile Ser Ala Asp Lys Ser Ile Ser Thr Ala
Tyr65 70 75 80 Leu Gln Trp Ser Ser Leu Lys Ala Ser Asp Thr Ala Met
Tyr Tyr Cys 85 90 95 Ala Arg Gln Gly Leu Gly Phe Asp Tyr Trp Gly
Gln Gly Thr Leu Val 100 105 110 Thr Val Ser Ser 115 15511PRTHomo
sapiens 155Ser Gly Glu Lys Trp Gly Glu Lys Tyr Ala Cys1 5 10
1567PRTHomo sapiens 156Gln Asp Thr Lys Arg Pro Ser1 5 1578PRTHomo
sapiens 157Gln Ala Trp Asp Arg Ser Thr Val1 5 15810PRTHomo sapiens
158Gly Tyr Ser Phe Thr Ser Tyr Trp Ile Gly1 5 10 15917PRTHomo
sapiens 159Ile Ile Tyr Pro Gly Asp Ser Asp Thr Arg Tyr Ser Pro Ser
Phe Gln1 5 10 15 Gly1607PRTHomo sapiens 160Gln Gly Leu Gly Phe Asp
Tyr1 5 161318DNAHomo sapiens 161tcctatgagc tgactcagcc accctcagtg
tccgtgtccc caggacagac agccagcatc 60acctgctctg gagataaatt gggggataaa
tttgctttct ggtatcagct gaagccaggc 120cagtcccctg tgctggtcat
ctatcaagat aacaagcggc cctcagggat ccctgagcga 180ttctctggct
ccaactctgg gaacacagcc actctgacca tcagcgggac ccaggctatg
240gatgcggctg acttttactg tcaggcgtgg gacagcagca ctgtggtatt
cggcggaggg 300accaagctga ccgtccta 318162363DNAHomo sapiens
162caggtgcagc tgcaggagtc gggcccagga ctggtgaagc cttcacagac
cctgtccctc 60acctgcactg tctctggtgg ctccatcagc agtggtggtt actactggag
ctggatccgc 120cagcacccag ggaagggcct ggagtggatt gggtacatct
cttacagtgg gagcacctac 180tacaacccgt ccctcaagag tcgagttacc
atatcagttg acacgtctaa gaaccagttc 240tccctgaagc tgaactctgt
gactgccgcg gacacggccg tgtattactg tgcgcgcgct 300tacggtgact
atcgcggctg gttcgacccc tggggccagg gaaccctggt caccgtctcc 360tca
36316333DNAHomo sapiens 163tctggagata aattggggga taaatttgct ttc
3316421DNAHomo sapiens 164caagataaca agcggccctc a 2116527DNAHomo
sapiens 165caggcgtggg acagcagcac tgtggta 2716636DNAHomo sapiens
166ggtggctcca tcagcagtgg tggttactac tggagc 3616748DNAHomo sapiens
167tacatctctt acagtgggag cacctactac aacccgtccc tcaagagt
4816833DNAHomo sapiens 168gcttacggtg actatcgcgg ctggttcgac ccc
33169106PRTHomo sapiens 169Ser Tyr Glu Leu Thr Gln Pro Pro Ser Val
Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser Ile Thr Cys Ser Gly
Asp Lys Leu Gly Asp Lys Phe Ala 20 25 30 Phe Trp Tyr Gln Leu Lys
Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 35 40 45 Gln Asp Asn Lys
Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60 Asn Ser
Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Ala Met65 70 75 80
Asp Ala Ala Asp Phe Tyr Cys Gln Ala Trp Asp Ser Ser Thr Val Val 85
90 95 Phe Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 170121PRTHomo
sapiens 170Gln Val Gln Leu Gln Glu Ser Gly Pro Gly Leu Val Lys Pro
Ser Gln1 5 10 15 Thr Leu Ser Leu Thr Cys Thr Val Ser Gly Gly Ser
Ile Ser Ser Gly 20 25 30 Gly Tyr Tyr Trp Ser Trp Ile Arg Gln His
Pro Gly Lys Gly Leu Glu 35 40 45 Trp Ile Gly Tyr Ile Ser Tyr Ser
Gly Ser Thr Tyr Tyr Asn Pro Ser 50 55 60 Leu Lys Ser Arg Val Thr
Ile Ser Val Asp Thr Ser Lys Asn Gln Phe65 70 75 80 Ser Leu Lys Leu
Asn Ser Val Thr Ala Ala Asp Thr Ala Val Tyr Tyr 85 90 95 Cys Ala
Arg Ala Tyr Gly Asp Tyr Arg Gly Trp Phe Asp Pro Trp Gly 100 105 110
Gln Gly Thr Leu Val Thr Val Ser Ser 115 120 17111PRTHomo sapiens
171Ser Gly Asp Lys Leu Gly Asp Lys Phe Ala Phe1 5 10 1727PRTHomo
sapiens 172Gln Asp Asn Lys Arg Pro Ser1 5 1739PRTHomo sapiens
173Gln Ala Trp Asp Ser Ser Thr Val Val1 5 17412PRTHomo sapiens
174Gly Gly Ser Ile Ser Ser Gly Gly Tyr Tyr Trp Ser1 5 10
17516PRTHomo sapiens 175Tyr Ile Ser Tyr Ser Gly Ser Thr Tyr Tyr Asn
Pro Ser Leu Lys Ser1 5 10 15 17611PRTHomo sapiens 176Ala Tyr Gly
Asp Tyr Arg Gly Trp Phe Asp Pro1 5 10 177321DNAHomo sapiens
177gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgcc gggcaagtca gggcattaga aatgatttag gctggtatca
gcagaaacca 120gggaaagccc ctaagcgcct gatctatgct gcatccagtt
tgcaaagtgg ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa
ttcactctca caatcagcag cctgcagcct 240gaagattgtg caacttatta
ttgtctacag cataatagtt atacgtggac gttcggccaa 300gggaccaagg
tggaaatcaa a 321178372DNAHomo sapiens 178caggtgcagc tggtggagtc
tgggggaggc gtggtccagc ctgggaggtc cctgagactc 60tcctgtgtag cgtctggatt
caccttcagt gcctatggca tgcactgggt ccgccaggct 120ccaggcaagg
ggctggagtg ggtggcagtt atatggtatg atggaagtaa taaatactat
180gcagactccg tgaagggccg attcatcatc tccagagaca attccaagaa
cacgctgtat 240ctgcaaatga acagcctgag agccgaggac acggctgtgt
attactgtgc gagaagtcgg 300aactggaact acgactccta ccaatacggt
ttggacgtct ggggccaagg gaccacggtc 360accgtctcct ca 37217917PRTHomo
sapiensVARIANT1Xaa = Asn OR Val 179Xaa Ile Xaa Xaa Asp Gly Ser Xaa
Xaa Tyr Xaa Xaa Asp Ser Val Lys1 5 10 15 Gly18017PRTHomo
sapiensVARIANT1Xaa = Trp OR Ile 180Xaa Ile Xaa Xaa Xaa Xaa Xaa Xaa
Thr Xaa Xaa Xaa Xaa Xaa Xaa Gln1 5 10 15 Gly18127DNAHomo sapiens
181ctacagcata atagttatac gtggacg 2718230DNAHomo sapiens
182ggattcacct tcagtgccta tggcatgcac 3018351DNAHomo sapiens
183gttatatggt atgatggaag taataaatac tatgcagact ccgtgaaggg c
5118445DNAHomo sapiens 184agtcggaact ggaactacga ctcctaccaa
tacggtttgg acgtc 45185107PRTHomo sapiens 185Asp Ile Gln Met Thr Gln
Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr
Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asp 20 25 30 Leu Gly
Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile 35 40 45
Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50
55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Cys Ala Thr Tyr Tyr Cys Leu Gln His Asn Ser
Tyr Thr Trp 85 90 95 Thr Phe Gly Gln Gly Thr Lys Val Glu Ile Lys
100 105 186124PRTHomo sapiens 186Gln Val Gln Leu Val Glu Ser Gly
Gly Gly Val Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys
Val Ala Ser Gly Phe Thr Phe Ser Ala Tyr 20 25 30 Gly Met His Trp
Val Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val
Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr Ala Asp Ser Val 50 55 60
Lys Gly Arg Phe Ile Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65
70 75 80 Leu Gln Met Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr
Tyr Cys 85 90 95 Ala Arg Ser Arg Asn Trp Asn Tyr Asp Ser Tyr Gln
Tyr Gly Leu Asp 100 105 110 Val Trp Gly Gln Gly Thr Thr Val Thr Val
Ser Ser 115 120 18711PRTHomo sapiensVARIANT1Xaa = Val OR -Xaa (Xaa
deleted) 187Xaa Xaa Xaa Xaa Xaa Xaa Xaa Xaa Phe Asp Tyr1 5 10
18813PRTHomo sapiensVARIANT1Xaa = Asp OR -Xaa (Xaa deleted) 188Xaa
Xaa Xaa Tyr Xaa Asp Xaa Xaa Gly Trp Xaa Xaa Xaa1 5 10 1899PRTHomo
sapiens 189Leu Gln His Asn Ser Tyr Thr Trp Thr1 5 19010PRTHomo
sapiens 190Gly Phe Thr Phe Ser Ala Tyr Gly Met His1 5 10
19117PRTHomo sapiens 191Val Ile Trp Tyr Asp Gly Ser Asn Lys Tyr Tyr
Ala Asp Ser Val Lys1 5 10 15 Gly19215PRTHomo sapiens 192Ser Arg Asn
Trp Asn Tyr Asp Ser Tyr Gln Tyr Gly Leu Asp Val1 5 10 15
193315DNAHomo sapiens 193tcctatgagc tgactcagcc accctcagtg
tccgtgtccc caggacagac agccagcatc 60acctgctctg gagataaatt gggggataaa
tatgtttgtt ggtatcagca gaagccaggc 120cagtcccctg aactggtcat
ctatctagat aacaagcggc cctcagggat ccctgagcga 180ttctctggct
ccaactctgg gaacacagcc actctgacca tcagcgggac ccaggctatg
240gatgaggctg actattactg tcaggcgtgg gacagcagca cggtattcgg
cggagggacc 300aaactgaccg tcctg 315194363DNAHomo sapiens
194caggttcagc tggtgcagtc tggagctgag gtgaagaagc ctggggcctc
agtgaaggtc 60tcctgcaagg cttctggtta cacctttacc agctatggta tcagctgggt
gcgacaggcc 120cctggacaag ggcttgagag gatgggatgg atcagcgctt
acaatggtaa cacaaactat 180gcacagaagt tccagggcag agtcaccatg
accacagaca catcaacgac cacagcctac 240atggagctga ggagcctgag
atctgacgac acggccgtgt attactgtgc gagagatcaa 300gattactatg
atagtagtgg ttggggccac tggggccagg gaaccctggt caccgtctcc 360tca
36319533DNAHomo sapiens 195tctggagata aattggggga taaatatgtt tgt
3319621DNAHomo sapiens 196ctagataaca agcggccctc a 2119724DNAHomo
sapiens 197caggcgtggg acagcagcac ggta 2419830DNAHomo sapiens
198ggttacacct ttaccagcta tggtatcagc 3019951DNAHomo sapiens
199tggatcagcg cttacaatgg taacacaaac tatgcacaga agttccaggg c
5120036DNAHomo sapiens 200gatcaagatt actatgatag tagtggttgg ggccac
36201105PRTHomo sapiens 201Ser Tyr Glu Leu Thr Gln Pro Pro Ser Val
Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser Ile Thr Cys Ser Gly
Asp Lys Leu Gly Asp Lys Tyr Val 20 25 30 Cys Trp Tyr Gln Gln Lys
Pro Gly Gln Ser Pro Glu Leu Val Ile Tyr 35 40 45 Leu Asp Asn Lys
Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser 50 55 60 Asn Ser
Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln Ala Met65 70 75 80
Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp Asp Ser Ser Thr Val Phe 85
90 95 Gly Gly Gly Thr Lys Leu Thr Val Leu 100 105 202121PRTHomo
sapiens 202Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro
Gly Ala1 5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr
Phe Thr Ser Tyr 20 25 30 Gly Ile Ser Trp Val Arg Gln Ala Pro Gly
Gln Gly Leu Glu Arg Met 35 40 45 Gly Trp Ile Ser Ala Tyr Asn Gly
Asn
Thr Asn Tyr Ala Gln Lys Phe 50 55 60 Gln Gly Arg Val Thr Met Thr
Thr Asp Thr Ser Thr Thr Thr Ala Tyr65 70 75 80 Met Glu Leu Arg Ser
Leu Arg Ser Asp Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asp
Gln Asp Tyr Tyr Asp Ser Ser Gly Trp Gly His Trp Gly 100 105 110 Gln
Gly Thr Leu Val Thr Val Ser Ser 115 120 20311PRTHomo sapiens 203Ser
Gly Asp Lys Leu Gly Asp Lys Tyr Val Cys1 5 10 2047PRTHomo sapiens
204Leu Asp Asn Lys Arg Pro Ser1 5 2058PRTHomo sapiens 205Gln Ala
Trp Asp Ser Ser Thr Val1 5 20610PRTHomo sapiens 206Gly Tyr Thr Phe
Thr Ser Tyr Gly Ile Ser1 5 10 20717PRTHomo sapiens 207Trp Ile Ser
Ala Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys Phe Gln1 5 10 15
Gly20812PRTHomo sapiens 208Asp Gln Asp Tyr Tyr Asp Ser Ser Gly Trp
Gly His1 5 10 209316DNAHomo sapiens 209tcctatgagc tgactcagcc
accctcagtg tccgtgtccc caggacagac agcctccatc 60acctgctctg gagataaatt
gggggataaa tatgctttct ggtatcagca gaagccaggc 120cagtcccctg
tgctggtctt ctatcatgat accaagcggc cctcagggat ccctgagcga
180ttctctggct ccaactctgg gaacacagcc actctgacca tcagcgggac
ccaggctatg 240gatgaggctg actatcactg tcaggcgtgg gacagcagca
cggtcttcgg cggagggacc 300aagctgaccg tcctac 316210363DNAHomo sapiens
210caggttcagc tggtgcaatc tggagctgag gtgaagaagc ctggggcctc
agtgaaggtc 60tcctgcaaga cttctggtta cacctttacc agctatggta tcagctgggt
gcgacaggcc 120cctggacaag ggcttgagtg gatgggatgg atcagccctt
acaatggtaa cacaaactat 180gcacagaagt tccagggcag agtcaccatg
accacagaca aatccacgag cacagcctac 240atggagctga ggagcctgcg
atctgacgac acggccgtgt attactgtgc gagagatcaa 300gattactatg
atagtagtgg ttgggacccc tggggccagg gaaccctggt caccgtctcc 360tcg
36321133DNAHomo sapiens 211tctggagata aattggggga taaatatgct ttc
3321221DNAHomo sapiens 212catgatacca agcggccctc a
21213360DNAArtificial SequenceActivin A/B Chimera 213ggtctagagt
gtgatggcaa ggtcaacatc tgctgtaaga aacagttctt tgtcagtttc 60aaggacatcg
gctggaatga ctggatcatt gctccctctg gctatcatgc caactactgc
120gagggtgagt gcccgagcca tatagcaggc acgtccgggt caagcttgtc
cttccactca 180acagtcatca accactaccg catgcggggc catagcccct
ttgccaacct caaatcatgc 240tgtattccca ccaagctgag caccatgtcc
atgttgtact ttgatgatga gtacaacatc 300gtcaaaaggg acgttccgaa
catgatcgtg gaggagtgtg ggtgctcatg agcggccgct 360214326PRTHomo
sapiens 214Ala Ser Thr Lys Gly Pro Ser Val Phe Pro Leu Ala Pro Cys
Ser Arg1 5 10 15 Ser Thr Ser Glu Ser Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro Val Thr Val Ser Trp Asn
Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val His Thr Phe Pro Ala Val
Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60 Leu Ser Ser Val Val Thr
Val Pro Ser Ser Asn Phe Gly Thr Gln Thr65 70 75 80 Tyr Thr Cys Asn
Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys 85 90 95 Thr Val
Glu Arg Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro 100 105 110
Pro Val Ala Gly Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp 115
120 125 Thr Leu Met Ile Ser Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp 130 135 140 Val Ser His Glu Asp Pro Glu Val Gln Phe Asn Trp Tyr
Val Asp Gly145 150 155 160 Val Glu Val His Asn Ala Lys Thr Lys Pro
Arg Glu Glu Gln Phe Asn 165 170 175 Ser Thr Phe Arg Val Val Ser Val
Leu Thr Val Val His Gln Asp Trp 180 185 190 Leu Asn Gly Lys Glu Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu Pro 195 200 205 Ala Pro Ile Glu
Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu 210 215 220 Pro Gln
Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn225 230 235
240 Gln Val Ser Leu Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile
245 250 255 Ala Val Glu Trp Glu Ser Asn Gly Gln Pro Glu Asn Asn Tyr
Lys Thr 260 265 270 Thr Pro Pro Met Leu Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys 275 280 285 Leu Thr Val Asp Lys Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys 290 295 300 Ser Val Met His Glu Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu305 310 315 320 Ser Leu Ser Pro Gly
Lys 325 215326PRTHomo sapiens 215Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15 Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro
Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60
Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr65
70 75 80 Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val
Asp Lys 85 90 95 Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro
Cys Pro Ala Pro 100 105 110 Pro Val Ala Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp 115 120 125 Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp 130 135 140 Val Ser His Glu Asp Pro
Glu Val Gln Phe Asn Trp Tyr Val Asp Gly145 150 155 160 Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170 175 Ser
Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp 180 185
190 Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro
195 200 205 Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro
Arg Glu 210 215 220 Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu
Met Thr Lys Asn225 230 235 240 Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile 245 250 255 Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260 265 270 Thr Pro Pro Met Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 275 280 285 Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295 300 Ser
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu305 310
315 320 Ser Leu Ser Pro Gly Lys 325 21636DNAHomo sapiens
216gatcaagatt actatgatag tagtggttgg gacccc 36217105PRTHomo sapiens
217Ser Tyr Glu Leu Thr Gln Pro Pro Ser Val Ser Val Ser Pro Gly Gln1
5 10 15 Thr Ala Ser Ile Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr
Ala 20 25 30 Phe Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu
Val Phe Tyr 35 40 45 His Asp Thr Lys Arg Pro Ser Gly Ile Pro Glu
Arg Phe Ser Gly Ser 50 55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr
Ile Ser Gly Thr Gln Ala Met65 70 75 80 Asp Glu Ala Asp Tyr His Cys
Gln Ala Trp Asp Ser Ser Thr Val Phe 85 90 95 Gly Gly Gly Thr Lys
Leu Thr Val Leu 100 105 218121PRTHomo sapiens 218Gln Val Gln Leu
Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1 5 10 15 Ser Val
Lys Val Ser Cys Lys Thr Ser Gly Tyr Thr Phe Thr Ser Tyr 20 25 30
Gly Ile Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu Glu Trp Met 35
40 45 Gly Trp Ile Ser Pro Tyr Asn Gly Asn Thr Asn Tyr Ala Gln Lys
Phe 50 55 60 Gln Gly Arg Val Thr Met Thr Thr Asp Lys Ser Thr Ser
Thr Ala Tyr65 70 75 80 Met Glu Leu Arg Ser Leu Arg Ser Asp Asp Thr
Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Asp Gln Asp Tyr Tyr Asp Ser
Ser Gly Trp Asp Pro Trp Gly 100 105 110 Gln Gly Thr Leu Val Thr Val
Ser Ser 115 120 21911PRTHomo sapiens 219Ser Gly Asp Lys Leu Gly Asp
Lys Tyr Ala Phe1 5 10 2207PRTHomo sapiens 220His Asp Thr Lys Arg
Pro Ser1 5 221326PRTHomo sapiens 221Ala Ser Thr Lys Gly Pro Ser Val
Phe Pro Leu Ala Pro Cys Ser Arg1 5 10 15 Ser Thr Ser Glu Ser Thr
Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr 20 25 30 Phe Pro Glu Pro
Val Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser 35 40 45 Gly Val
His Thr Phe Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser 50 55 60
Leu Ser Ser Val Val Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr65
70 75 80 Tyr Thr Cys Asn Val Asp His Lys Pro Ser Asn Thr Lys Val
Asp Lys 85 90 95 Thr Val Glu Arg Lys Cys Cys Val Glu Cys Pro Pro
Cys Pro Ala Pro 100 105 110 Pro Val Ala Gly Pro Ser Val Phe Leu Phe
Pro Pro Lys Pro Lys Asp 115 120 125 Thr Leu Met Ile Ser Arg Thr Pro
Glu Val Thr Cys Val Val Val Asp 130 135 140 Val Ser His Glu Asp Pro
Glu Val Gln Phe Asn Trp Tyr Val Asp Gly145 150 155 160 Val Glu Val
His Asn Ala Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn 165 170 175 Ser
Thr Phe Arg Val Val Ser Val Leu Thr Val Val His Gln Asp Trp 180 185
190 Leu Asn Gly Lys Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro
195 200 205 Ala Pro Ile Glu Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro
Arg Glu 210 215 220 Pro Gln Val Tyr Thr Leu Pro Pro Ser Arg Glu Glu
Met Thr Lys Asn225 230 235 240 Gln Val Ser Leu Thr Cys Leu Val Lys
Gly Phe Tyr Pro Ser Asp Ile 245 250 255 Ala Val Glu Trp Glu Ser Asn
Gly Gln Pro Glu Asn Asn Tyr Lys Thr 260 265 270 Thr Pro Pro Met Leu
Asp Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys 275 280 285 Leu Thr Val
Asp Lys Ser Arg Trp Gln Gln Gly Asn Val Phe Ser Cys 290 295 300 Ser
Val Met His Glu Ala Leu His Asn His Tyr Thr Gln Lys Ser Leu305 310
315 320 Ser Leu Ser Pro Gly Lys 325 222318DNAHomo sapiens
222ggtcagccca aggctgcccc ctcggtcact ctgttcccgc cctcctctga
ggagcttcaa 60gccaacaagg ccacactggt gtgtctcata agtgacttct acccgggagc
cgtgacagtg 120gcctggaagg cagatagcag ccccgtcaag gcgggagtgg
agaccaccac accctccaaa 180caaagcaaca acaagtacgc ggccagcagc
tatctgagcc tgacgcctga gcagtggaag 240tcccacagaa gctacagctg
ccaggtcacg catgaaggga gcaccgtgga gaagacagtg 300gcccctacag aatgttca
318223321DNAHomo sapiens 223cgaactgtgg ctgcaccatc tgtcttcatc
ttcccgccat ctgatgagca gttgaaatct 60ggaactgcct ctgttgtgtg cctgctgaat
aacttctatc ccagagaggc caaagtacag 120tggaaggtgg ataacgccct
ccaatcgggt aactcccagg agagtgtcac agagcaggac 180agcaaggaca
gcacctacag cctcagcagc accctgacgc tgagcaaagc agactacgag
240aaacacaaag tctacgcctg cgaagtcacc catcagggcc tgagctcgcc
cgtcacaaag 300agcttcaaca ggggagagtg t 32122412PRTHomo sapiens
224Asp Gln Asp Tyr Tyr Asp Ser Ser Gly Trp Asp Pro1 5 10
225116PRTHomo sapiens 225Gly Leu Glu Cys Asp Gly Lys Val Asn Ile
Cys Cys Lys Lys Gln Phe1 5 10 15 Phe Val Ser Phe Lys Asp Ile Gly
Trp Asn Asp Trp Ile Ile Ala Pro 20 25 30 Ser Gly Tyr His Ala Asn
Tyr Cys Glu Gly Glu Cys Pro Ser His Ile 35 40 45 Ala Gly Thr Ser
Gly Ser Ser Leu Ser Phe His Ser Thr Val Ile Asn 50 55 60 His Tyr
Arg Met Arg Gly His Ser Pro Phe Ala Asn Leu Lys Ser Cys65 70 75 80
Cys Val Pro Thr Lys Leu Arg Pro Met Ser Met Leu Tyr Tyr Asp Asp 85
90 95 Gly Gln Asn Ile Ile Lys Lys Asp Ile Gln Asn Met Ile Val Glu
Glu 100 105 110 Cys Gly Cys Ser 115 2268PRTHomo sapiens 226Asp Tyr
Lys Asp Asp Asp Asp Lys1 5 227636DNAHomo sapiens 227tcctatgagg
tgactcaggc accctcagtg tccgtgtccc caggacagac agccagcatc 60acctgctctg
gagataaatt gggggataaa tatgcttgtt ggtatcagca gaagccaggc
120cagtcccctg tgctggtcat ctatcaagat agcaagcggc cctcagggat
ccctgagcga 180ttctctggct ccaactctgg aaacacagcc actctgacca
tcagcgggac ccaggctatg 240gatgaggctg actattactg tcaggcgtgg
gacagcagca ctgcggtatt cggcggaggg 300accaagctga ccgtcctagg
tcagcccaag gctgccccct cggtcactct gttcccgccc 360tcctctgagg
agcttcaagc caacaaggcc acactggtgt gtctcataag tgacttctac
420ccgggagccg tgacagtggc ctggaaggca gatagcagcc ccgtcaaggc
gggagtggag 480accaccacac cctccaaaca aagcaacaac aagtacgcgg
ccagcagcta tctgagcctg 540acgcctgagc agtggaagtc ccacagaagc
tacagctgcc aggtcacgca tgaagggagc 600accgtggaga agacagtggc
ccctacagaa tgttca 6362281344DNAHomo sapiens 228caggttcagc
tggtgcagtc tggagctgag gtgaagaagc ctggggcctc agtgaaggtc 60tcctgcaagg
cttctggtta cacctttacc agttatggtc tcagctgggt gcgacaggcc
120cctggacaag ggcttgagtg gatgggatgg atcatccctt acaatggtaa
cacaaactct 180gcacagaaac tccagggcag agtcaccatg accacagaca
catccacgag cacagcctac 240atggagctga ggagcctgag atctgacgac
acggccgtgt atttctgtgc gagagacagg 300gactacggtg tcaattatga
tgcttttgat atctggggcc aagggacaat ggtcaccgtc 360tcttcagcct
ccaccaaggg cccatcggtc ttccccctgg cgccctgctc caggagcacc
420tccgagagca cagcggccct gggctgcctg gtcaaggact acttccccga
accggtgacg 480gtgtcgtgga actcaggcgc tctgaccagc ggcgtgcaca
ccttcccagc tgtcctacag 540tcctcaggac tctactccct cagcagcgtg
gtgaccgtgc cctccagcaa cttcggcacc 600cagacctaca cctgcaacgt
agatcacaag cccagcaaca ccaaggtgga caagacagtt 660gagcgcaaat
gttgtgtcga gtgcccaccg tgcccagcac cacctgtggc aggaccgtca
720gtcttcctct tccccccaaa acccaaggac accctcatga tctcccggac
ccctgaggtc 780acgtgcgtgg tggtggacgt gagccacgaa gaccccgagg
tccagttcaa ctggtacgtg 840gacggcgtgg aggtgcataa tgccaagaca
aagccacggg aggagcagtt caacagcacg 900ttccgtgtgg tcagcgtcct
caccgttgtg caccaggact ggctgaacgg caaggagtac 960aagtgcaagg
tctccaacaa aggcctccca gcccccatcg agaaaaccat ctccaaaacc
1020aaagggcagc cccgagaacc acaggtgtac accctgcccc catcccggga
ggagatgacc 1080aagaaccagg tcagcctgac ctgcctggtc aaaggcttct
accccagcga catcgccgtg 1140gagtgggaga gcaatgggca gccggagaac
aactacaaga ccacacctcc catgctggac 1200tccgacggct ccttcttcct
ctacagcaag ctcaccgtgg acaagagcag gtggcagcag 1260gggaacgtct
tctcatgctc cgtgatgcat gaggctctgc acaaccacta cacgcagaag
1320agcctctccc tgtctccggg taaa 1344229642DNAHomo sapiens
229gacatccaga tgacccagtc tccatcctcc ctgtctgcat ctgtaggaga
cagagtcacc 60atcacttgcc gggcaagtca gggcattaga aataatttag gctggtatca
gcagaaacca 120gggaaagccc ctaagcgcct gatttatgct gcatccagtt
tgcaaagtgg ggtcccatca 180aggttcagcg gcagtggatc tgggacagaa
ttcactctca caatcagcag tctgcagcct 240gaagatttta caacttatta
ctgtctacag cataatagtt acccgtggac gttcggccaa 300gggaccaagg
tggaaatcaa acgaactgtg gctgcaccat ctgtcttcat cttcccgcca
360tctgatgagc agttgaaatc tggaactgcc tctgttgtgt gcctgctgaa
taacttctat 420cccagagagg ccaaagtaca gtggaaggtg gataacgccc
tccaatcggg taactcccag 480gagagtgtca cagagcagga cagcaaggac
agcacctaca gcctcagcag caccctgacg 540ctgagcaaag cagactacga
gaaacacaaa gtctacgcct gcgaagtcac ccatcagggc 600ctgagctcgc
ccgtcacaaa gagcttcaac aggggagagt gt
6422301350DNAHomo sapiens 230caggtgcagc tggtggagtc tgggggaggc
gtggtccagc ctgggaggtc cctgagactc 60tcctgtgcag cgtctggatt caccttcagt
agttacggca tgcactgggt ccgccaggct 120ccaggcaagg ggctggagtg
ggtggcagtt atatggtatg atggaagtaa taaataccat 180gcagactccg
tgaagggccg attcaccatc tccagagaca attccaagaa cacgctgtat
240ctgcaagtga acagcctgag agccgaggac acggctgtgt attactgtgt
gagaagtcgg 300aactggaact acgacaacta ctactacggt ctggacgtct
ggggccaagg gaccacggtc 360accgtctcct cagcctccac caagggccca
tcggtcttcc ccctggcgcc ctgctccagg 420agcacctccg agagcacagc
ggccctgggc tgcctggtca aggactactt ccccgaaccg 480gtgacggtgt
cgtggaactc aggcgctctg accagcggcg tgcacacctt cccagctgtc
540ctacagtcct caggactcta ctccctcagc agcgtggtga ccgtgccctc
cagcaacttc 600ggcacccaga cctacacctg caacgtagat cacaagccca
gcaacaccaa ggtggacaag 660acagttgagc gcaaatgttg tgtcgagtgc
ccaccgtgcc cagcaccacc tgtggcagga 720ccgtcagtct tcctcttccc
cccaaaaccc aaggacaccc tcatgatctc ccggacccct 780gaggtcacgt
gcgtggtggt ggacgtgagc cacgaagacc ccgaggtcca gttcaactgg
840tacgtggacg gcgtggaggt gcataatgcc aagacaaagc cacgggagga
gcagttcaac 900agcacgttcc gtgtggtcag cgtcctcacc gttgtgcacc
aggactggct gaacggcaag 960gagtacaagt gcaaggtctc caacaaaggc
ctcccagccc ccatcgagaa aaccatctcc 1020aaaaccaaag ggcagccccg
agaaccacag gtgtacaccc tgcccccatc ccgggaggag 1080atgaccaaga
accaggtcag cctgacctgc ctggtcaaag gcttctaccc cagcgacatc
1140gccgtggagt gggagagcaa tgggcagccg gagaacaact acaagaccac
acctcccatg 1200ctggactccg acggctcctt cttcctctac agcaagctca
ccgtggacaa gagcaggtgg 1260cagcagggga acgtcttctc atgctccgtg
atgcatgagg ctctgcacaa ccactacacg 1320cagaagagcc tctccctgtc
tccgggtaaa 1350231642DNAHomo sapiens 231gacatccaga tgacccagtc
tccatcctcc ctgtctgcat ctgtaggaga cagagtcacc 60atcacttgcc gggcaagtca
gggcattaga aatgatttag gctggtatca gcagaaacca 120gggaaagccc
ctaagcgcct gatctatgct gcatccagtt tgcaaagtgg ggtcccatca
180aggttcagcg gcagtggatc tgggacagaa ttcactctca caatcagcag
cctgcagcct 240gaagattttg caacttatta ctgtcgacag caaaatactt
acccgctcac tttcggcgga 300gggaccaagg tggagatcaa acgaactgtg
gctgcaccat ctgtcttcat cttcccgcca 360tctgatgagc agttgaaatc
tggaactgcc tctgttgtgt gcctgctgaa taacttctat 420cccagagagg
ccaaagtaca gtggaaggtg gataacgccc tccaatcggg taactcccag
480gagagtgtca cagagcagga cagcaaggac agcacctaca gcctcagcag
caccctgacg 540ctgagcaaag cagactacga gaaacacaaa gtctacgcct
gcgaagtcac ccatcagggc 600ctgagctcgc ccgtcacaaa gagcttcaac
aggggagagt gt 6422321347DNAHomo sapiens 232gaggtgcagt tggtggagtc
tgggggaggc ttggtccagc ctggggggtc cctgagactc 60tcctgtgcag cctctggatt
cacctttagt agttattgga tgagctgggt ccgccaggct 120ccagggaagg
ggctggagtg cgtggccaac ataaagcaag atggaagtga ggaatactat
180gtggactctg tgaagggccg attcaccatc tccagagaca acgccaagaa
ttcactgtat 240ctgcaaatga acagcctgag agccgaggac acggctgtgt
attactgtgc gagaggtagc 300agcagctggt actactacaa ctacggtatg
gacgtctggg gccaagggac cacggtcacc 360gtctcctcag cctccaccaa
gggcccatcg gtcttccccc tggcgccctg ctccaggagc 420acctccgaga
gcacagcggc cctgggctgc ctggtcaagg actacttccc cgaaccggtg
480acggtgtcgt ggaactcagg cgctctgacc agcggcgtgc acaccttccc
agctgtccta 540cagtcctcag gactctactc cctcagcagc gtggtgaccg
tgccctccag caacttcggc 600acccagacct acacctgcaa cgtagatcac
aagcccagca acaccaaggt ggacaagaca 660gttgagcgca aatgttgtgt
cgagtgccca ccgtgcccag caccacctgt ggcaggaccg 720tcagtcttcc
tcttcccccc aaaacccaag gacaccctca tgatctcccg gacccctgag
780gtcacgtgcg tggtggtgga cgtgagccac gaagaccccg aggtccagtt
caactggtac 840gtggacggcg tggaggtgca taatgccaag acaaagccac
gggaggagca gttcaacagc 900acgttccgtg tggtcagcgt cctcaccgtt
gtgcaccagg actggctgaa cggcaaggag 960tacaagtgca aggtctccaa
caaaggcctc ccagccccca tcgagaaaac catctccaaa 1020accaaagggc
agccccgaga accacaggtg tacaccctgc ccccatcccg ggaggagatg
1080accaagaacc aggtcagcct gacctgcctg gtcaaaggct tctaccccag
cgacatcgcc 1140gtggagtggg agagcaatgg gcagccggag aacaactaca
agaccacacc tcccatgctg 1200gactccgacg gctccttctt cctctacagc
aagctcaccg tggacaagag caggtggcag 1260caggggaacg tcttctcatg
ctccgtgatg catgaggctc tgcacaacca ctacacgcag 1320aagagcctct
ccctgtctcc gggtaaa 1347233212PRTHomo sapiens 233Ser Tyr Glu Val Thr
Gln Ala Pro Ser Val Ser Val Ser Pro Gly Gln1 5 10 15 Thr Ala Ser
Ile Thr Cys Ser Gly Asp Lys Leu Gly Asp Lys Tyr Ala 20 25 30 Cys
Trp Tyr Gln Gln Lys Pro Gly Gln Ser Pro Val Leu Val Ile Tyr 35 40
45 Gln Asp Ser Lys Arg Pro Ser Gly Ile Pro Glu Arg Phe Ser Gly Ser
50 55 60 Asn Ser Gly Asn Thr Ala Thr Leu Thr Ile Ser Gly Thr Gln
Ala Met65 70 75 80 Asp Glu Ala Asp Tyr Tyr Cys Gln Ala Trp Asp Ser
Ser Thr Ala Val 85 90 95 Phe Gly Gly Gly Thr Lys Leu Thr Val Leu
Gly Gln Pro Lys Ala Ala 100 105 110 Pro Ser Val Thr Leu Phe Pro Pro
Ser Ser Glu Glu Leu Gln Ala Asn 115 120 125 Lys Ala Thr Leu Val Cys
Leu Ile Ser Asp Phe Tyr Pro Gly Ala Val 130 135 140 Thr Val Ala Trp
Lys Ala Asp Ser Ser Pro Val Lys Ala Gly Val Glu145 150 155 160 Thr
Thr Thr Pro Ser Lys Gln Ser Asn Asn Lys Tyr Ala Ala Ser Ser 165 170
175 Tyr Leu Ser Leu Thr Pro Glu Gln Trp Lys Ser His Arg Ser Tyr Ser
180 185 190 Cys Gln Val Thr His Glu Gly Ser Thr Val Glu Lys Thr Val
Ala Pro 195 200 205 Thr Glu Cys Ser 210 234448PRTHomo sapiens
234Gln Val Gln Leu Val Gln Ser Gly Ala Glu Val Lys Lys Pro Gly Ala1
5 10 15 Ser Val Lys Val Ser Cys Lys Ala Ser Gly Tyr Thr Phe Thr Ser
Tyr 20 25 30 Gly Leu Ser Trp Val Arg Gln Ala Pro Gly Gln Gly Leu
Glu Trp Met 35 40 45 Gly Trp Ile Ile Pro Tyr Asn Gly Asn Thr Asn
Ser Ala Gln Lys Leu 50 55 60 Gln Gly Arg Val Thr Met Thr Thr Asp
Thr Ser Thr Ser Thr Ala Tyr65 70 75 80 Met Glu Leu Arg Ser Leu Arg
Ser Asp Asp Thr Ala Val Tyr Phe Cys 85 90 95 Ala Arg Asp Arg Asp
Tyr Gly Val Asn Tyr Asp Ala Phe Asp Ile Trp 100 105 110 Gly Gln Gly
Thr Met Val Thr Val Ser Ser Ala Ser Thr Lys Gly Pro 115 120 125 Ser
Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser Thr 130 135
140 Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro Val
Thr145 150 155 160 Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly Val
His Thr Phe Pro 165 170 175 Ala Val Leu Gln Ser Ser Gly Leu Tyr Ser
Leu Ser Ser Val Val Thr 180 185 190 Val Pro Ser Ser Asn Phe Gly Thr
Gln Thr Tyr Thr Cys Asn Val Asp 195 200 205 His Lys Pro Ser Asn Thr
Lys Val Asp Lys Thr Val Glu Arg Lys Cys 210 215 220 Cys Val Glu Cys
Pro Pro Cys Pro Ala Pro Pro Val Ala Gly Pro Ser225 230 235 240 Val
Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr Leu Met Ile Ser Arg 245 250
255 Thr Pro Glu Val Thr Cys Val Val Val Asp Val Ser His Glu Asp Pro
260 265 270 Glu Val Gln Phe Asn Trp Tyr Val Asp Gly Val Glu Val His
Asn Ala 275 280 285 Lys Thr Lys Pro Arg Glu Glu Gln Phe Asn Ser Thr
Phe Arg Val Val 290 295 300 Ser Val Leu Thr Val Val His Gln Asp Trp
Leu Asn Gly Lys Glu Tyr305 310 315 320 Lys Cys Lys Val Ser Asn Lys
Gly Leu Pro Ala Pro Ile Glu Lys Thr 325 330 335 Ile Ser Lys Thr Lys
Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr Leu 340 345 350 Pro Pro Ser
Arg Glu Glu Met Thr Lys Asn Gln Val Ser Leu Thr Cys 355 360 365 Leu
Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala Val Glu Trp Glu Ser 370 375
380 Asn Gly Gln Pro Glu Asn Asn Tyr Lys Thr Thr Pro Pro Met Leu
Asp385 390 395 400 Ser Asp Gly Ser Phe Phe Leu Tyr Ser Lys Leu Thr
Val Asp Lys Ser 405 410 415 Arg Trp Gln Gln Gly Asn Val Phe Ser Cys
Ser Val Met His Glu Ala 420 425 430 Leu His Asn His Tyr Thr Gln Lys
Ser Leu Ser Leu Ser Pro Gly Lys 435 440 445 235214PRTHomo sapiens
235Asp Ile Gln Met Thr Gln Ser Pro Ser Ser Leu Ser Ala Ser Val Gly1
5 10 15 Asp Arg Val Thr Ile Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn
Asn 20 25 30 Leu Gly Trp Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys
Arg Leu Ile 35 40 45 Tyr Ala Ala Ser Ser Leu Gln Ser Gly Val Pro
Ser Arg Phe Ser Gly 50 55 60 Ser Gly Ser Gly Thr Glu Phe Thr Leu
Thr Ile Ser Ser Leu Gln Pro65 70 75 80 Glu Asp Phe Thr Thr Tyr Tyr
Cys Leu Gln His Asn Ser Tyr Pro Trp 85 90 95 Thr Phe Gly Gln Gly
Thr Lys Val Glu Ile Lys Arg Thr Val Ala Ala 100 105 110 Pro Ser Val
Phe Ile Phe Pro Pro Ser Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr
Ala Ser Val Val Cys Leu Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135
140 Lys Val Gln Trp Lys Val Asp Asn Ala Leu Gln Ser Gly Asn Ser
Gln145 150 155 160 Glu Ser Val Thr Glu Gln Asp Ser Lys Asp Ser Thr
Tyr Ser Leu Ser 165 170 175 Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr
Glu Lys His Lys Val Tyr 180 185 190 Ala Cys Glu Val Thr His Gln Gly
Leu Ser Ser Pro Val Thr Lys Ser 195 200 205 Phe Asn Arg Gly Glu Cys
210 236450PRTHomo sapiens 236Gln Val Gln Leu Val Glu Ser Gly Gly
Gly Val Val Gln Pro Gly Arg1 5 10 15 Ser Leu Arg Leu Ser Cys Ala
Ala Ser Gly Phe Thr Phe Ser Ser Tyr 20 25 30 Gly Met His Trp Val
Arg Gln Ala Pro Gly Lys Gly Leu Glu Trp Val 35 40 45 Ala Val Ile
Trp Tyr Asp Gly Ser Asn Lys Tyr His Ala Asp Ser Val 50 55 60 Lys
Gly Arg Phe Thr Ile Ser Arg Asp Asn Ser Lys Asn Thr Leu Tyr65 70 75
80 Leu Gln Val Asn Ser Leu Arg Ala Glu Asp Thr Ala Val Tyr Tyr Cys
85 90 95 Val Arg Ser Arg Asn Trp Asn Tyr Asp Asn Tyr Tyr Tyr Gly
Leu Asp 100 105 110 Val Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser
Ala Ser Thr Lys 115 120 125 Gly Pro Ser Val Phe Pro Leu Ala Pro Cys
Ser Arg Ser Thr Ser Glu 130 135 140 Ser Thr Ala Ala Leu Gly Cys Leu
Val Lys Asp Tyr Phe Pro Glu Pro145 150 155 160 Val Thr Val Ser Trp
Asn Ser Gly Ala Leu Thr Ser Gly Val His Thr 165 170 175 Phe Pro Ala
Val Leu Gln Ser Ser Gly Leu Tyr Ser Leu Ser Ser Val 180 185 190 Val
Thr Val Pro Ser Ser Asn Phe Gly Thr Gln Thr Tyr Thr Cys Asn 195 200
205 Val Asp His Lys Pro Ser Asn Thr Lys Val Asp Lys Thr Val Glu Arg
210 215 220 Lys Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val
Ala Gly225 230 235 240 Pro Ser Val Phe Leu Phe Pro Pro Lys Pro Lys
Asp Thr Leu Met Ile 245 250 255 Ser Arg Thr Pro Glu Val Thr Cys Val
Val Val Asp Val Ser His Glu 260 265 270 Asp Pro Glu Val Gln Phe Asn
Trp Tyr Val Asp Gly Val Glu Val His 275 280 285 Asn Ala Lys Thr Lys
Pro Arg Glu Glu Gln Phe Asn Ser Thr Phe Arg 290 295 300 Val Val Ser
Val Leu Thr Val Val His Gln Asp Trp Leu Asn Gly Lys305 310 315 320
Glu Tyr Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu 325
330 335 Lys Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val
Tyr 340 345 350 Thr Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln
Val Ser Leu 355 360 365 Thr Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp
Ile Ala Val Glu Trp 370 375 380 Glu Ser Asn Gly Gln Pro Glu Asn Asn
Tyr Lys Thr Thr Pro Pro Met385 390 395 400 Leu Asp Ser Asp Gly Ser
Phe Phe Leu Tyr Ser Lys Leu Thr Val Asp 405 410 415 Lys Ser Arg Trp
Gln Gln Gly Asn Val Phe Ser Cys Ser Val Met His 420 425 430 Glu Ala
Leu His Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro 435 440 445
Gly Lys 450 237214PRTHomo sapiens 237Asp Ile Gln Met Thr Gln Ser
Pro Ser Ser Leu Ser Ala Ser Val Gly1 5 10 15 Asp Arg Val Thr Ile
Thr Cys Arg Ala Ser Gln Gly Ile Arg Asn Asp 20 25 30 Leu Gly Trp
Tyr Gln Gln Lys Pro Gly Lys Ala Pro Lys Arg Leu Ile 35 40 45 Tyr
Ala Ala Ser Ser Leu Gln Ser Gly Val Pro Ser Arg Phe Ser Gly 50 55
60 Ser Gly Ser Gly Thr Glu Phe Thr Leu Thr Ile Ser Ser Leu Gln
Pro65 70 75 80 Glu Asp Phe Ala Thr Tyr Tyr Cys Arg Gln Gln Asn Thr
Tyr Pro Leu 85 90 95 Thr Phe Gly Gly Gly Thr Lys Val Glu Ile Lys
Arg Thr Val Ala Ala 100 105 110 Pro Ser Val Phe Ile Phe Pro Pro Ser
Asp Glu Gln Leu Lys Ser Gly 115 120 125 Thr Ala Ser Val Val Cys Leu
Leu Asn Asn Phe Tyr Pro Arg Glu Ala 130 135 140 Lys Val Gln Trp Lys
Val Asp Asn Ala Leu Gln Ser Gly Asn Ser Gln145 150 155 160 Glu Ser
Val Thr Glu Gln Asp Ser Lys Asp Ser Thr Tyr Ser Leu Ser 165 170 175
Ser Thr Leu Thr Leu Ser Lys Ala Asp Tyr Glu Lys His Lys Val Tyr 180
185 190 Ala Cys Glu Val Thr His Gln Gly Leu Ser Ser Pro Val Thr Lys
Ser 195 200 205 Phe Asn Arg Gly Glu Cys 210 238449PRTHomo sapiens
238Glu Val Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Gly1
5 10 15 Ser Leu Arg Leu Ser Cys Ala Ala Ser Gly Phe Thr Phe Ser Ser
Tyr 20 25 30 Trp Met Ser Trp Val Arg Gln Ala Pro Gly Lys Gly Leu
Glu Cys Val 35 40 45 Ala Asn Ile Lys Gln Asp Gly Ser Glu Glu Tyr
Tyr Val Asp Ser Val 50 55 60 Lys Gly Arg Phe Thr Ile Ser Arg Asp
Asn Ala Lys Asn Ser Leu Tyr65 70 75 80 Leu Gln Met Asn Ser Leu Arg
Ala Glu Asp Thr Ala Val Tyr Tyr Cys 85 90 95 Ala Arg Gly Ser Ser
Ser Trp Tyr Tyr Tyr Asn Tyr Gly Met Asp Val 100 105 110 Trp Gly Gln
Gly Thr Thr Val Thr Val Ser Ser Ala Ser Thr Lys Gly 115 120 125 Pro
Ser Val Phe Pro Leu Ala Pro Cys Ser Arg Ser Thr Ser Glu Ser 130 135
140 Thr Ala Ala Leu Gly Cys Leu Val Lys Asp Tyr Phe Pro Glu Pro
Val145 150 155 160 Thr Val Ser Trp Asn Ser Gly Ala Leu Thr Ser Gly
Val His Thr Phe 165 170 175 Pro Ala Val Leu Gln Ser Ser Gly Leu Tyr
Ser Leu Ser Ser Val Val 180 185 190 Thr Val Pro Ser Ser Asn Phe Gly
Thr Gln Thr Tyr Thr Cys Asn Val 195 200 205 Asp His Lys Pro Ser Asn
Thr Lys Val Asp Lys Thr Val Glu Arg Lys 210
215 220 Cys Cys Val Glu Cys Pro Pro Cys Pro Ala Pro Pro Val Ala Gly
Pro225 230 235 240 Ser Val Phe Leu Phe Pro Pro Lys Pro Lys Asp Thr
Leu Met Ile Ser 245 250 255 Arg Thr Pro Glu Val Thr Cys Val Val Val
Asp Val Ser His Glu Asp 260 265 270 Pro Glu Val Gln Phe Asn Trp Tyr
Val Asp Gly Val Glu Val His Asn 275 280 285 Ala Lys Thr Lys Pro Arg
Glu Glu Gln Phe Asn Ser Thr Phe Arg Val 290 295 300 Val Ser Val Leu
Thr Val Val His Gln Asp Trp Leu Asn Gly Lys Glu305 310 315 320 Tyr
Lys Cys Lys Val Ser Asn Lys Gly Leu Pro Ala Pro Ile Glu Lys 325 330
335 Thr Ile Ser Lys Thr Lys Gly Gln Pro Arg Glu Pro Gln Val Tyr Thr
340 345 350 Leu Pro Pro Ser Arg Glu Glu Met Thr Lys Asn Gln Val Ser
Leu Thr 355 360 365 Cys Leu Val Lys Gly Phe Tyr Pro Ser Asp Ile Ala
Val Glu Trp Glu 370 375 380 Ser Asn Gly Gln Pro Glu Asn Asn Tyr Lys
Thr Thr Pro Pro Met Leu385 390 395 400 Asp Ser Asp Gly Ser Phe Phe
Leu Tyr Ser Lys Leu Thr Val Asp Lys 405 410 415 Ser Arg Trp Gln Gln
Gly Asn Val Phe Ser Cys Ser Val Met His Glu 420 425 430 Ala Leu His
Asn His Tyr Thr Gln Lys Ser Leu Ser Leu Ser Pro Gly 435 440 445
Lys239321DNAHomo sapiens 239cgaactgtgg ctgcaccatc tgtcttcatc
ttcccgccat ctgatgagca gttgaaatct 60ggaactgcct ctgttgtgtg cctgctgaat
aacttctatc ccagagaggc caaagtacag 120tggaaggtgg ataacgccct
ccaatcgggt aactcccagg agagtgtcac agagcaggac 180agcaaggaca
gcacctacag cctcagcagc accctgacgc tgagcaaagc agactacgag
240aaacacaaag tctacgcctg cgaagtcacc catcagggcc tgagctcgcc
cgtcacaaag 300agcttcaaca ggggagagtg t 321240978DNAHomo sapiens
240gcctccacca agggcccatc ggtcttcccc ctggcgccct gctccaggag
cacctccgag 60agcacagcgg ccctgggctg cctggtcaag gactacttcc ccgaaccggt
gacggtgtcg 120tggaactcag gcgctctgac cagcggcgtg cacaccttcc
cagctgtcct acagtcctca 180ggactctact ccctcagcag cgtggtgacc
gtgccctcca gcaacttcgg cacccagacc 240tacacctgca acgtagatca
caagcccagc aacaccaagg tggacaagac agttgagcgc 300aaatgttgtg
tcgagtgccc accgtgccca gcaccacctg tggcaggacc gtcagtcttc
360ctcttccccc caaaacccaa ggacaccctc atgatctccc ggacccctga
ggtcacgtgc 420gtggtggtgg acgtgagcca cgaagacccc gaggtccagt
tcaactggta cgtggacggc 480gtggaggtgc ataatgccaa gacaaagcca
cgggaggagc agttcaacag cacgttccgt 540gtggtcagcg tcctcaccgt
tgtgcaccag gactggctga acggcaagga gtacaagtgc 600aaggtctcca
acaaaggcct cccagccccc atcgagaaaa ccatctccaa aaccaaaggg
660cagccccgag aaccacaggt gtacaccctg cccccatccc gggaggagat
gaccaagaac 720caggtcagcc tgacctgcct ggtcaaaggc ttctacccca
gcgacatcgc cgtggagtgg 780gagagcaatg ggcagccgga gaacaactac
aagaccacac ctcccatgct ggactccgac 840ggctccttct tcctctacag
caagctcacc gtggacaaga gcaggtggca gcaggggaac 900gtcttctcat
gctccgtgat gcatgaggct ctgcacaacc actacacgca gaagagcctc
960tccctgtctc cgggtaaa 978241978DNAHomo sapiens 241gcctccacca
agggcccatc ggtcttcccc ctggcgccct gctccaggag cacctccgag 60agcacagcgg
ccctgggctg cctggtcaag gactacttcc ccgaaccggt gacggtgtcg
120tggaactcag gcgctctgac cagcggcgtg cacaccttcc cagctgtcct
acagtcctca 180ggactctact ccctcagcag cgtggtgacc gtgccctcca
gcaacttcgg cacccagacc 240tacacctgca acgtagatca caagcccagc
aacaccaagg tggacaagac agttgagcgc 300aaatgttgtg tcgagtgccc
accgtgccca gcaccacctg tggcaggacc gtcagtcttc 360ctcttccccc
caaaacccaa ggacaccctc atgatctccc ggacccctga ggtcacgtgc
420gtggtggtgg acgtgagcca cgaagacccc gaggtccagt tcaactggta
cgtggacggc 480gtggaggtgc ataatgccaa gacaaagcca cgggaggagc
agttcaacag cacgttccgt 540gtggtcagcg tcctcaccgt tgtgcaccag
gactggctga acggcaagga gtacaagtgc 600aaggtctcca acaaaggcct
cccagccccc atcgagaaaa ccatctccaa aaccaaaggg 660cagccccgag
aaccacaggt gtacaccctg cccccatccc gggaggagat gaccaagaac
720caggtcagcc tgacctgcct ggtcaaaggc ttctacccca gcgacatcgc
cgtggagtgg 780gagagcaatg ggcagccgga gaacaactac aagaccacac
ctcccatgct ggactccgac 840ggctccttct tcctctacag caagctcacc
gtggacaaga gcaggtggca gcaggggaac 900gtcttctcat gctccgtgat
gcatgaggct ctgcacaacc actacacgca gaagagcctc 960tccctgtctc cgggtaaa
978242824DNAHomo sapiens 242gcctccacca agggcccatc ggtcttcccc
ctggcgccct gctccaggag cacctccgag 60agcacagcgg ccctgggctg cctggtcaag
gactacttcc ccgaaccggt gacggtgtcg 120tggaactcag gcgctctgac
cagcggcgtg cacaccttcc cagctgtcct acagtcctca 180ggactctact
ccctcagcag cgtggtgacc gtgccctcca gcaacttcgg cacccagacc
240tacacctgca acgtagatca caagcccagc aacaccaagg tggacaagac
agttgagcgc 300aaatgttgtg tcgagtgccc accgtgccca gcaccacctg
tggcaggacc gtcagtcttc 360ctcttccccc caaaacccaa ggacaccctc
atgatctccc ggacccctga ggtcacgtgc 420gtggtggtgg acgtgagcca
cgaagacccc gaggtccagt tcaactggta cgtggacggc 480gtggaggtgc
ataatgccaa gacaaagcca cgggaggagc agttcaacag cacgttccgt
540gtggtcagcg tcctcaccgt tgtgcaccag gactggctga acggcaagga
gtacaagtgc 600aaggtctcca acaaaggcct cccagccccc atcgagaaaa
ccatctccaa aaccaaaggg 660cagccccgag aaccacaggt gtacaccctg
cccccatccc gggaggagat gaccaagaac 720caggtcagcc tgacctgcct
ggtcaaaggc ttctacccca gcgacatcgc cgtggagtgg 780gagagcaatg
ggcagccgga gaacaactac aagaccacac ctcc 824243116PRTArtificial
SequenceActivin A/B Chimera 243Gly Leu Glu Cys Asp Gly Lys Val Asn
Ile Cys Cys Arg Gln Gln Phe1 5 10 15 Phe Ile Asp Phe Arg Leu Ile
Gly Trp Asn Asp Trp Ile Ile Ala Pro 20 25 30 Thr Gly Tyr Tyr Gly
Asn Tyr Cys Glu Gly Glu Cys Pro Ser His Ile 35 40 45 Ala Gly Thr
Ser Gly Ser Ser Leu Ser Phe His Ser Thr Val Ile Asn 50 55 60 His
Tyr Arg Met Arg Gly His Ser Pro Phe Ala Asn Leu Lys Ser Cys65 70 75
80 Cys Val Pro Thr Lys Leu Arg Pro Met Ser Met Leu Tyr Tyr Asp Asp
85 90 95 Gly Gln Asn Ile Ile Lys Lys Asp Ile Gln Asn Met Ile Val
Glu Glu 100 105 110 Cys Gly Cys Ser 115 244116PRTArtificial
SequenceActivin A/B Chimera 244Gly Leu Glu Cys Asp Gly Lys Val Asn
Ile Cys Cys Lys Lys Gln Phe1 5 10 15 Phe Val Ser Phe Lys Asp Ile
Gly Trp Asn Asp Trp Ile Ile Ala Pro 20 25 30 Ser Gly Tyr His Ala
Asn Tyr Cys Glu Gly Glu Cys Pro Ser His Ile 35 40 45 Ala Gly Thr
Ser Gly Ser Ser Leu Ser Phe His Ser Thr Val Ile Asn 50 55 60 His
Tyr Arg Met Arg Gly His Ser Pro Phe Ala Asn Leu Lys Ser Cys65 70 75
80 Cys Ile Pro Thr Lys Leu Ser Thr Met Ser Met Leu Tyr Phe Asp Asp
85 90 95 Glu Tyr Asn Ile Val Lys Arg Asp Val Pro Asn Met Ile Val
Glu Glu 100 105 110 Cys Gly Cys Ser 115 24531DNAArtificial
SequenceOligonucleotide 245ctcgaggtcg actagaccac catgcccttg c
3124628DNAArtificial SequenceOligonucleotide 246ccatcacact
ctagaccccg ccgacgcc 28247360DNAArtificial SequenceActivin A/B
Chimera 247ggtctagagt gtgatggcaa ggtcaacatc tgctgtaggc aacagttctt
tatcgatttc 60aggctcatcg gctggaatga ctggatcatt gctcccactg gctattatgg
caactactgc 120gagggtgagt gcccgagcca tatagcaggc acgtccgggt
caagcttgtc cttccactca 180acagtcatca accactaccg catgcggggc
catagcccct ttgccaacct caaatcatgc 240tgtgtgccca ccaagctgag
acccatgtcc atgttgtact atgatgatgg tcaaaacatc 300atcaaaaagg
acattcagaa catgatcgtg gaggagtgtg ggtgctcatg agcggccgct
3602489PRTArtificial SequenceAnti Activin A Antibody Peptide 248Gln
Ala Trp Asp Xaa Ser Thr Xaa Xaa1 5 24916PRTArtificial SequenceAnti
Activin A Antibody Peptide 249Xaa Xaa Xaa Xaa Xaa Xaa Tyr Xaa Xaa
Xaa Xaa Xaa Xaa Xaa Xaa Xaa1 5 10 15 25011PRTArtificial
SequenceAnti Activin A Antibody Peptide 250Arg Ala Xaa Gln Gly Ile
Xaa Asn Xaa Leu Xaa1 5 10 25112PRTArtificial SequenceAnti Activin A
Antibody Peptide 251Arg Ala Ser Gln Ser Ile Ser Asn Tyr Leu Asn
Thr1 5 10 25212PRTArtificial SequenceAnti Activin A Antibody
Peptide 252Gly Gly Ser Xaa Xaa Xaa Xaa Xaa Xaa Tyr Trp Ser1 5 10
25316PRTArtificial SequenceAnti Activin A Antibody Peptide 253Arg
Ser Ser Gln Ser Leu Leu His Ser Thr Gly Tyr Asn Tyr Leu Asp1 5 10
15 2547PRTArtificial SequenceAnti Activin A Antibody Peptide 254Leu
Gly Ser Phe Arg Ala Ser1 5 2559PRTArtificial SequenceAnti Activin A
Antibody Peptide 255Met Gln Ala Leu Gln Thr Pro Cys Ser1 5
25610PRTArtificial SequenceAnti Activin A Antibody Peptide 256Gly
Tyr Thr Phe Thr Gly Tyr Tyr Ile His1 5 10 25710PRTArtificial
SequenceAnti Activin A Antibody Peptide 257Gly Xaa Xaa Phe Xaa Xaa
Tyr Xaa Xaa Xaa1 5 10 25817PRTArtificial SequenceAnti Activin A
Antibody Peptide 258Trp Ile Asn Pro Asn Ser Gly Gly Thr Asn Tyr Ala
Gln Lys Phe Gln1 5 10 15 Gly25917PRTArtificial SequenceAnti Activin
A Antibody Peptide 259Trp Ile Ser Pro Tyr Asn Gly Asn Thr Asn Tyr
Ala Gln Lys Phe Gln1 5 10 15 Gly26012PRTArtificial SequenceAnti
Activin A Antibody Peptide 260Asp Ser Gly Tyr Ser Ser Ser Trp His
Phe Asp Tyr1 5 10 26113PRTArtificial SequenceAnti Activin A
Antibody Peptide 261Gly Ser Ser Ser Trp Tyr Tyr Tyr Asn Gly Met Asp
Val1 5 10 26230PRTArtificial SequenceAmino acid residues 1-30 of
Activin A 262Gly Leu Glu Cys Asp Gly Lys Val Asn Ile Cys Cys Lys
Lys Gln Phe1 5 10 15 Phe Val Ser Phe Lys Asp Ile Gly Trp Asn Asp
Trp Ile Ile 20 25 30 26330PRTArtificial SequenceAmino acid residues
31-60 of Activin A 263Ala Pro Ser Gly Tyr His Ala Asn Tyr Cys Glu
Gly Glu Cys Pro Ser1 5 10 15 His Ile Ala Gly Thr Ser Gly Ser Ser
Leu Ser Phe His Ser 20 25 30 26430PRTArtificial SequenceAmino acid
residues 61-90 of Activin A 264Thr Val Ile Asn His Tyr Arg Met Arg
Gly His Ser Pro Phe Ala Asn1 5 10 15 Leu Lys Ser Cys Cys Val Pro
Thr Lys Leu Arg Pro Met Ser 20 25 30 26526PRTArtificial
SequenceAmino acid residues 91-116 of Activin A 265Met Leu Tyr Tyr
Asp Asp Gly Gln Asn Ile Ile Lys Lys Asp Ile Gln1 5 10 15 Asn Met
Ile Val Glu Glu Cys Gly Cys Ser 20 25 266116PRTArtificial
SequenceActivin A 13/39 B 266Gly Leu Glu Cys Asp Gly Lys Val Asn
Ile Cys Cys Arg Gln Gln Phe1 5 10 15 Phe Ile Asp Phe Arg Leu Ile
Gly Trp Asn Asp Trp Ile Ile Ala Pro 20 25 30 Thr Gly Tyr Tyr Gly
Asn Tyr Cys Glu Gly Glu Cys Pro Ser His Ile 35 40 45 Ala Gly Thr
Ser Gly Ser Ser Leu Ser Phe His Ser Thr Val Ile Asn 50 55 60 His
Tyr Arg Met Arg Gly His Ser Pro Phe Ala Asn Leu Lys Ser Cys65 70 75
80 Cys Val Pro Thr Lys Leu Arg Pro Met Ser Met Leu Tyr Tyr Asp Asp
85 90 95 Gly Gln Asn Ile Ile Lys Lys Asp Ile Gln Asn Met Ile Val
Glu Glu 100 105 110 Cys Gly Cys Ser 115
* * * * *