U.S. patent application number 14/454044 was filed with the patent office on 2015-02-19 for combinatorial dna library for producing modified n-glycans in lower eukaryotes.
The applicant listed for this patent is GlycoFi, Inc.. Invention is credited to Piotr Bobrowicz, Byung-kwon Choi, Robert C. Davidson, Tillman U. Gerngross, Stephen R. Hamilton, Juergen Hermann Nett, Stefan Wildt.
Application Number | 20150051381 14/454044 |
Document ID | / |
Family ID | 32907683 |
Filed Date | 2015-02-19 |
United States Patent
Application |
20150051381 |
Kind Code |
A1 |
Gerngross; Tillman U. ; et
al. |
February 19, 2015 |
COMBINATORIAL DNA LIBRARY FOR PRODUCING MODIFIED N-GLYCANS IN LOWER
EUKARYOTES
Abstract
The present invention relates to eukaryotic host cells having
modified oligosaccharides which may be modified further by
heterologous expression of a set of glycosyltransferases, sugar
transporters and mannosidases to become host-strains for the
production of mammalian, e.g., human therapeutic glycoproteins. The
invention provides nucleic acid molecules and combinatorial
libraries which can be used to successfully target and express
mammalian enzymatic activities such as those involved in
glycosylation to intracellular compartments in a eukaryotic host
cell. The process provides an engineered host cell which can be
used to express and target any desirable gene(s) involved in
glycosylation. Host cells with modified oligosaccharides are
created or selected. N-glycans made in the engineered host cells
have a Man.sub.5GlcNAc.sub.2 core structure which may then be
modified further by heterologous expression of one or more enzymes,
e.g., glycosyltransferases, sugar transporters and mannosidases, to
yield human-like glycoproteins. For the production of therapeutic
proteins, this method may be adapted to engineer cell lines in
which any desired glycosylation structure may be obtained.
Inventors: |
Gerngross; Tillman U.;
(Hanover, NH) ; Wildt; Stefan; (Somerville,
MA) ; Choi; Byung-kwon; (Hanover, NH) ; Nett;
Juergen Hermann; (Grantham, NH) ; Bobrowicz;
Piotr; (Hanover, NH) ; Hamilton; Stephen R.;
(Lebanon, NH) ; Davidson; Robert C.; (Hanover,
NH) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
GlycoFi, Inc. |
Lebanon |
NH |
US |
|
|
Family ID: |
32907683 |
Appl. No.: |
14/454044 |
Filed: |
August 7, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13156804 |
Jun 9, 2011 |
8883483 |
|
|
14454044 |
|
|
|
|
12291373 |
Nov 7, 2008 |
8067551 |
|
|
13156804 |
|
|
|
|
10371877 |
Feb 20, 2003 |
7449308 |
|
|
12291373 |
|
|
|
|
09892591 |
Jun 27, 2001 |
7029872 |
|
|
10371877 |
|
|
|
|
60279997 |
Mar 30, 2001 |
|
|
|
Current U.S.
Class: |
530/395 ;
435/366; 435/68.1; 506/16 |
Current CPC
Class: |
C12N 15/1082 20130101;
C12N 15/79 20130101; C07K 14/47 20130101; C12P 21/005 20130101;
C12N 9/1051 20130101 |
Class at
Publication: |
530/395 ;
435/68.1; 506/16; 435/366 |
International
Class: |
C12P 21/00 20060101
C12P021/00; C07K 14/47 20060101 C07K014/47 |
Goverment Interests
STATEMENT AS TO FEDERALLY SPONSORED RESEARCH
[0002] This invention was funded, at least in part, with a
government grant from the National Institutes of Health (NHI Phase
I Grant No. 1R43GM66690-1) and a grant from the Department of
Commerce, NIST-ATP Cooperative Agreement Number 70NANB2H3046. The
United States Government may therefore have certain rights in this
invention.
Claims
1. A method for producing a human-like glycoprotein in a non-human
eukaryotic host cell that does not display a 1,6
mannosyltransferase activity with respect to the N-glycan on a
glycoprotein, the method comprising the step of introducing into
the host cell one or more enzymes for production of a
Man.sub.5GlcNAc.sub.2 carbohydrate structure, wherein
Man.sub.5GlcNAc.sub.2 is produced within the host cell at a yield
of at least 30 mole percent.
2.-4. (canceled)
5. The method of claim 1, wherein at least one of the enzymes is
targeted to a subcellular location in the host cell where the
enzyme will have optimal activity.
6. The method of claim 5, wherein the enzyme is targeted by means
of a chimeric protein comprising a cellular targeting signal
peptide not normally associated with the enzyme.
7. (canceled)
8. The method of claim 1, wherein at least one of the enzymes is
selected from the group consisting of mannosidases,
glycosyltransferases and glycosidases.
9. The method of claim 6, wherein the enzyme is a mannosidase
predominantly localized in the Golgi apparatus or the endoplasmic
reticulum.
10.-11. (canceled)
12. The method of claim 1, wherein the glycoprotein comprises one
or more sugars selected from the group consisting of GlcNAc,
galactose, sialic acid, and fucose.
13. The method of claim 1, wherein the glycoprotein comprises at
least one oligosaccharide branch comprising the structure
NeuNAc-Gal-GlcNAc-Man.
14. (canceled)
15. The method of claim 1, wherein the host is a lower eukaryotic
cell.
16. The method of claim 15, wherein the host cell is selected from
the group consisting of Pichia pastoris, Pichia finlandica, Pichia
trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia
opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia
guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica,
Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula
polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida
albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus
oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium
sp., Fusarium gramineum, Fusarium venenatum and Neurospora
crassa.
17. The method of claim 1, wherein the host is deficient in the
activity of one or more enzymes selected from the group consisting
of mannosyltransferases and phosphomannosyltransferases.
18. The method of claim 17, wherein the host does not express an
enzyme selected from the group consisting of 1,6
mannosyltransferase; 1,3 mannosyltransferase; and 1,2
mannosyltransferase.
19. The method of claim 1, wherein the host is an och1 mutant of P.
pastoris.
20. The method of claim 1, wherein the host expresses GnTI and
UDP-GlcNAc transporter activities.
21. The method of claim 1, wherein the host expresses a UDP- or
GDP-specific diphosphatase activity.
22. The method of claim 1, further comprising the step of isolating
the glycoprotein from the host.
23.-24. (canceled)
25. The method of claim 1, further comprising the step of
introducing into the host a nucleic acid molecule encoding one or
more mannosidase activities involved in the production of
Man.sub.5GlcNAc.sub.2 from Man.sub.8GlcNAc.sub.2 or
Man.sub.9GlcNAc.sub.2.
26. The method of claim 25, wherein at least one of the encoded
mannosidase activities has a pH optimum within about 1.4 pH units
of the average pH optimum of other representative enzymes in the
organelle in which the mannosidase activity is localized, or has
optimal activity at a pH of between about 5.1 and about 8.0.
27. The method of claim 26, wherein the mannosidase has optimal
activity at a pH of between about 5.5 and about 7.5.
28. The method of claim 26, wherein the mannosidase activity is an
.alpha.-1,2-mannosidase derived from mouse, human, Lepidoptera,
Aspergillus nidulans, or Bacillus sp., C. elegans, D. melanogaster,
P. citrinum or X. laevis.
29.-36. (canceled)
37. A nucleic acid library comprising at least two different
genetic constructs, wherein at least one genetic construct
comprises a nucleic acid fragment encoding a glycosylation enzyme
ligated in-frame with a nucleic acid fragment encoding a cellular
targeting signal peptide which it is not normally associated
with.
38. A DNA library of fusion constructs comprising: (a) at least two
nucleotide sequences encoding a cellular targeting signal peptide
and at least one nucleotide sequence encoding a catalytic domain
region selected from the group consisting of mannosidases,
glycosyltransferases and glycosidases; or (b) at least one
nucleotide sequence encoding a cellular targeting signal peptide
and at least two nucleotide sequences encoding a catalytic domain
region selected from the group consisting of mannosidases,
glycosyltransferases and glycosidases; wherein at least one
nucleotide sequence encoding a catalytic domain region is ligated
in-frame to a nucleotide sequence encoding a cellular targeting
signal peptide.
39.-62. (canceled)
63. A host cell produced by the method of claim 1, 24 or 55.
64. A human-like glycoprotein produced by the method of claim 1, 24
or 55.
65.-76. (canceled)
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation application of U.S.
application Ser. No. 13/156,804, filed Jun. 9, 2011, now pending,
which is a continuation of U.S. Ser. No. 12/291,373, filed Nov. 7,
2008, now U.S. Pat. No. 8,607,551, which is a continuation of U.S.
application Ser. No. 10/371,877, filed Feb. 20, 2003, now U.S. Pat.
No. 7,449,308, which is a continuation-in-part of U.S. application
Ser. No. 09/892,591, filed Jun. 27, 2001, now issued as U.S. Pat.
No. 7,029,872, which claims benefit of U.S. Provisional Application
Ser. No. 60/214,358, filed Jun. 28, 2000, U.S. Provisional
Application No. 60/215,638, filed Jun. 30, 2000, and U.S.
Provisional Application No. 60/279,997, filed Mar. 30, 2001; each
of which is incorporated herein by reference in its entirety.
REFERENCE TO SEQUENCE LISTING SUBMITTED ELECTRONICALLY
[0003] The sequence listing of the present application is submitted
electronically via EFS-Web as an ASCII formatted sequence listing
with a file name "GF0021YIACB_US_CNT.sub.--2_SEQ LIST.txt",
creation date of Aug. 1, 2014, and a size of 41 KB. This sequence
listing submitted via EFS-Web is part of the specification and is
herein incorporated by reference in its entirety.
FIELD OF THE INVENTION
[0004] The present invention is directed to methods and
compositions by which non-human eukaryotic host cells, such as
fungi or other eukaryotic cells, can be genetically modified to
produce glycosylated proteins (glycoproteins) having patterns of
glycosylation similar to those of glycoproteins produced by animal
cells, especially human cells, which are useful as human or animal
therapeutic agents.
BACKGROUND OF THE INVENTION
Glycosylation Pathways in Humans and Lower Eukaryotes
[0005] After DNA is transcribed and translated into a protein,
further post-translational processing involves the attachment of
sugar residues, a process known as glycosylation. Different
organisms produce different glycosylation enzymes
(glycosyltransferases and glycosidases), and have different
substrates (nucleotide sugars) available, so that the glycosylation
patterns as well as composition of the individual oligosaccharides,
even of the same protein, will be different depending on the host
system in which the particular protein is being expressed. Bacteria
typically do not glycosylate proteins, and if so only in a very
unspecific manner (Moens and Vanderleyden, 1997 Arch Microbiol.
168(3):169-175). Lower eukaryotes such as filamentous fungi and
yeast add primarily mannose and mannosylphosphate sugars. The
resulting glycan is known as a "high-mannose" type glycan or a
mannan. Plant cells and insect cells (such as Sf9 cells)
glycosylate proteins in yet another way. By contrast, in higher
eukaryotes such as humans, the nascent oligosaccharide side chain
may be trimmed to remove several mannose residues and elongated
with additional sugar residues that typically are not found in the
N-glycans of lower eukaryotes. See, e.g., R. K. Bretthauer, et al.
Biotechnology and Applied Biochemistry, 1999, 30, 193-200; W.
Martinet, et al. Biotechnology Letters, 1998, 20, 1171-1177; S.
Weikert, et al. Nature Biotechnology, 1999, 17, 1116-1121; M.
Malissard, et al. Biochemical and Biophysical Research
Communications, 2000, 267, 169-173; Jarvis, et al., Current Opinion
in Biotechnology, 1998, 9:528-533; and M. Takeuchi, 1 Trends in
Glycoscience and Glycotechnology, 1997, 9, S29-S35.
[0006] Synthesis of a mammalian-type oligosaccharide structure
begins with a set of sequential reactions in the course of which
sugar residues are added and removed while the protein moves along
the secretory pathway in the host organism. The enzymes which
reside along the glycosylation pathway of the host organism or cell
determine the resulting glycosylation patterns of secreted
proteins. Thus, the resulting glycosylation pattern of proteins
expressed in lower eukaryotic host cells differs substantially from
the glycosylation pattern of proteins expressed in higher
eukaryotes such as humans and other mammals (Bretthauer, 1999). The
structure of a typical fungal N-glycan is shown in FIG. 1A.
[0007] The early steps of human glycosylation can be divided into
at least two different phases: (i) lipid-linked
Glc.sub.3Man.sub.9GlcNAc.sub.2 oligosaccharides are assembled by a
sequential set of reactions at the membrane of the endoplasmic
reticulum (ER) and (ii) the transfer of this oligosaccharide from
the lipid anchor dolichyl pyrophosphate onto de novo synthesized
protein. The site of the specific transfer is defined by an
asparagine (Asn) residue in the sequence Asn-Xaa-Ser/Thr where Xaa
can be any amino acid except proline (Gavel, 1990). Further
processing by glucosidases and mannosidases occurs in the ER before
the nascent glycoprotein is transferred to the early Golgi
apparatus, where additional mannose residues are removed by Golgi
specific alpha (a)-1,2-mannosidases. Processing continues as the
protein proceeds through the Golgi. In the medial Golgi, a number
of modifying enzymes, including N-acetylglucosaminyl Transferases
(GnTI, GnTII, GnTIII, GnTIV and GnTV), mannosidase II and
fucosyltransferases, add and remove specific sugar residues.
Finally, in the trans-Golgi, galactosyltranferases (GalT) and
sialyltransferases (ST) produce a glycoprotein structure that is
released from the Golgi. It is this structure, characterized by
bi-, tri- and tetra-antennary structures, containing galactose,
fucose, N-acetylglucosamine and a high degree of terminal sialic
acid, that gives glycoproteins their human characteristics. The
structure of a typical human N-glycan is shown in FIG. 1B.
[0008] In nearly all eukaryotes, glycoproteins are derived from a
common lipid-linked oligosaccharide precursor
Glc.sub.3Man.sub.9GlcNAc.sub.2-dolichol-pyrophosphate. Within the
endoplasmic reticulum, synthesis and processing of dolichol
pyrophosphate bound oligosaccharides are identical between all
known eukaryotes. However, further processing of the core
oligosaccharide by fungal cells, e.g., yeast, once it has been
transferred to a peptide leaving the ER and entering the Golgi,
differs significantly from humans as it moves along the secretory
pathway and involves the addition of several mannose sugars.
[0009] In yeast, these steps are catalyzed by Golgi residing
mannosyl-transferases, like Och1p, Mnt1p and Mnn1p, which
sequentially add mannose sugars to the core oligosaccharide. The
resulting structure is undesirable for the production of human-like
proteins and it is thus desirable to reduce or eliminate
mannosyltransferase activity. Mutants of S. cerevisiae, deficient
in mannosyl-transferase activity (for example och1 or mnn9 mutants)
have been shown to be non-lethal and display reduced mannose
content in the oligosaccharide of yeast glycoproteins. Other
oligosaccharide processing enzymes, such as mannosylphosphate
transferase, may also have to be eliminated depending on the host's
particular endogenous glycosylation pattern.
Sugar Nucleotide Precursors
[0010] The N-glycans of animal glycoproteins typically include
galactose, fucose, and terminal sialic acid. These sugars are not
found on glycoproteins produced in yeast and filamentous fungi. In
humans, the full range of nucleotide sugar precursors (e.g.
UDP-N-acetylglucosamine, UDP-N-acetylgalactosamine,
CMP-N-acetylneuraminic acid, UDP-galactose, GDP-fucose, etc.) are
synthesized in the cytosol and transported into the Golgi, where
they are attached to the core oligosaccharide by
glycosyltransferases. (Sommers and Hirschberg, 1981 J. Cell Biol.
91(2): A406-A406; Sommers and Hirschberg 1982 J. Biol. Chem.
257(18): 811-817; Perez and Hirschberg 1987 Methods in Enzymology
138: 709-715).
[0011] Glycosyl transfer reactions typically yield a side product
which is a nucleoside diphosphate or monophosphate. While
monophosphates can be directly exported in exchange for nucleoside
triphosphate sugars by an antiport mechanism, diphosphonucleosides
(e.g. GDP) have to be cleaved by phosphatases (e.g. GDPase) to
yield nucleoside monophosphates and inorganic phosphate prior to
being exported. This reaction is important for efficient
glycosylation; for example, GDPase from Saccharomyces cerevisiae
(S. cerevisiae) has been found to be necessary for mannosylation.
However that GDPase has 90% reduced activity toward UDP (Berninsone
et al., 1994 J. Biol. Chem. 269(1):207-211). Lower eukaryotes
typically lack UDP-specific diphosphatase activity in the Golgi
since they do not utilize UDP-sugar precursors for Golgi-based
glycoprotein synthesis. Schizosaccharomyces pombe, a yeast found to
add galactose residues to cell wall polysaccharides (from
UDP-galactose) has been found to have specific UDPase activity,
indicating the potential requirement for such an enzyme (Berninsone
et al., 1994). UDP is known to be a potent inhibitor of
glycosyltransferases and the removal of this glycosylation side
product may be important to prevent glycosyl-transferase inhibition
in the lumen of the Golgi (Khatara et al., 1974). See Berninsone,
P., et al. 1995. J. Biol. Chem. 270(24): 14564-14567; Beaudet, L.,
et al. 1998 Abc Transporters: Biochemical, Cellular, and Molecular
Aspects. 292: 397-413.
Sequential Processing of N-Glycans by Compartmentalized Enzyme
Activities
[0012] Sugar transferases and glycosidases (e.g., mannosidases)
line the inner (luminal) surface of the ER and Golgi apparatus and
thereby provide a "catalytic" surface that allows for the
sequential processing of glycoproteins as they proceed through the
ER and Golgi network. The multiple compartments of the cis, medial,
and trans Golgi and the trans-Golgi Network (TGN), provide the
different localities in which the ordered sequence of glycosylation
reactions can take place. As a glycoprotein proceeds from synthesis
in the ER to full maturation in the late Golgi or TGN, it is
sequentially exposed to different glycosidases, mannosidases and
glycosyltransferases such that a specific carbohydrate structure
may be synthesized. Much work has been dedicated to revealing the
exact mechanism by which these enzymes are retained and anchored to
their respective organelle. The evolving picture is complex but
evidence suggests that stem region, membrane spanning region and
cytoplasmic tail, individually or in concert, direct enzymes to the
membrane of individual organelles and thereby localize the
associated catalytic domain to that locus (see, e.g., Glceson, P.
A. (1998) Histochem. Cell Biol. 109, 517-532).
[0013] In some cases, these specific interactions were found to
function across species. For example, the membrane spanning domain
of .alpha.2,6-ST from rats, an enzyme known to localize in the
trans-Golgi of the animal, was shown to also localize a reporter
gene (invertase) in the yeast Golgi (Schwientek, 1995). However,
the very same membrane spanning domain as part of a full-length
.alpha.2,6-ST was retained in the ER and not further transported to
the Golgi of yeast (Krezdorn, 1994). A full length GalT from humans
was not even synthesized in yeast, despite demonstrably high
transcription levels. In contrast, the transmembrane region of the
same human GalT fused to an invertase reporter was able to direct
localization to the yeast Golgi, albeit it at low production
levels. Schwientek and co-workers have shown that fusing 28 amino
acids of a yeast mannosyltransferase (MNT1), a region containing a
cytoplasmic tail, a transmembrane region and eight amino acids of
the stem region, to the catalytic domain of human GalT are
sufficient for Golgi localization of an active GalT. Other
galactosyltransferases appear to rely on interactions with enzymes
resident in particular organelles because, after removal of their
transmembrane region, they are still able to localize properly.
[0014] Improper localization of a glycosylation enzyme may prevent
proper functioning of the enzyme in the pathway. For example,
Aspergillus nidulans, which has numerous .alpha.-1,2-mannosidases
(Eades and Hintz, 2000 Gene 255(1):25-34), does not add GlcNAc to
Man.sub.5GlcNAc.sub.2 when transformed with the rabbit GnTI gene,
despite a high overall level of GnTI activity (Kalsner et al.,
1995). GnTI, although actively expressed, may be incorrectly
localized such that the enzyme is not in contact with both of its
substrates: UDP-GlcNAc and a productive Man.sub.5GlcNAc.sub.2
substrate (not all Man.sub.5GlcNAc.sub.2 structures are productive;
see below). Alternatively, the host organism may not provide an
adequate level of UDP-GlcNAc in the Golgi or the enzyme may be
properly localized but nevertheless inactive in its new
environment. In addition, Man.sub.5GlcNAc.sub.2 structures present
in the host cell may differ in structure from Man.sub.5GlcNAc.sub.2
found in mammals. Maras and coworkers found that about one third of
the N-glycans from cellobiohydrolase I (CBHI) obtained from T.
reesei can be trimmed to Man.sub.5GlcNAc.sub.2 by A. saitoi 1,2
mannosidase in vitro. Fewer than 1% of those N-glycans, however,
could serve as a productive substrate for GnTI. The mere presence
of Man.sub.5GlcNAc.sub.2, therefore, does not assure that further
processing to Man.sub.5GlcNAc.sub.2 can be achieved. It is
formation of a productive, GnTI-reactive Man.sub.5GlcNAc.sub.2
structure that is required. Although Man.sub.5GlcNAc.sub.2 could be
produced in the cell (about 27 mol %), only a small fraction could
be converted to Man.sub.5GlcNAc.sub.2 (less than about 5%, see
Chiba WO 01/14522).
[0015] To date, there is no reliable way of predicting whether a
particular heterologously expressed glycosyltransferase or
mannosidase in a lower eukaryote will be (1), sufficiently
translated (2), catalytically active or (3) located to the proper
organelle within the secretory pathway. Because all three of these
are necessary to affect glycosylation patterns in lower eukaryotes,
a systematic scheme to achieve the desired catalytic function and
proper retention of enzymes in the absence of predictive tools,
which are currently not available, would be desirable.
Production of Therapeutic Glycoproteins
[0016] A significant number of proteins isolated from humans or
animals are post-translationally modified, with glycosylation being
one of the most significant modifications. An estimated 70% of all
therapeutic proteins are glycosylated and thus currently rely on a
production system (i.e., host cell) that is able to glycosylate in
a manner similar to humans. Several studies have shown that
glycosylation plays an important role in determining the (1)
immunogenicity, (2) pharmacokinetic properties, (3) trafficking,
and (4) efficacy of therapeutic proteins. It is thus not surprising
that substantial efforts by the pharmaceutical industry have been
directed at developing processes to obtain glycoproteins that are
as "humanoid" or "human-like" as possible. To date, most
glycoproteins are made in a mammalian host system. This may involve
the genetic engineering of such mammalian cells to enhance the
degree of sialylation (i.e., terminal addition of sialic acid) of
proteins expressed by the cells, which is known to improve
pharmacokinetic properties of such proteins. Alternatively, one may
improve the degree of sialylation by in vitro addition of such
sugars using known glycosyltransferases and their respective
nucleotide sugars (e.g., 2,3-sialyltransferase and CMP-sialic
acid).
[0017] While most higher eukaryotes carry out glycosylation
reactions that are similar to those found in humans, recombinant
human proteins expressed in the above mentioned host systems
invariably differ from their "natural" human counterpart (Raju,
2000). Extensive development work has thus been directed at finding
ways to improve the "human character" of proteins made in these
expression systems. This includes the optimization of fermentation
conditions and the genetic modification of protein expression hosts
by introducing genes encoding enzymes involved in the formation of
human-like glycoforms (Werner, 1998; Weikert, 1999; Andersen, 1994;
Yang, 2000). Inherent problems associated with all mammalian
expression systems have not been solved.
[0018] Fermentation processes based on mammalian cell culture
(e.g., CHO, murine, or human cells), for example, tend to be very
slow (fermentation times in excess of one week are not uncommon),
often yield low product titers, require expensive nutrients and
cofactors (e.g., bovine fetal serum), are limited by programmed
cell death (apoptosis), and often do not enable expression of
particular therapeutically valuable proteins. More importantly,
mammalian cells are susceptible to viruses that have the potential
to be human pathogens and stringent quality controls are required
to assure product safety. This is of particular concern as many
such processes require the addition of complex and temperature
sensitive media components that are derived from animals (e.g.,
bovine calf serum), which may carry agents pathogenic to humans
such as bovine spongiform encephalopathy (BSE) prions or viruses.
Moreover, the production of therapeutic compounds is preferably
carried out in a well-controlled sterile environment. An animal
farm, no matter how cleanly kept, does not constitute such an
environment, thus constituting an additional problem in the use of
transgenic animals for manufacturing high volume therapeutic
proteins.
[0019] Most, if not all, currently produced therapeutic
glycoproteins are therefore expressed in mammalian cells and much
effort has been directed at improving (i.e., "humanizing") the
glycosylation pattern of these recombinant proteins. Changes in
medium composition as well as the co-expression of genes encoding
enzymes involved in human glycosylation have been successfully
employed (see, for example, Weikert, 1999).
Glycoprotein Production Using Eukaryotic Microorganisms
[0020] The lack of a suitable mammalian expression system is a
significant obstacle to the low-cost and safe production of
recombinant human glycoproteins for therapeutic applications. It
would be desirable to produce recombinant proteins similar to their
mammalian, e.g., human, counterparts in lower eukaryotes (fungi and
yeast). Production of glycoproteins via the fermentation of
microorganisms would offer numerous advantages over existing
systems. For example, fermentation-based processes may offer (a)
rapid production of high concentrations of protein; (b) the ability
to use sterile, well-controlled production conditions; (c) the
ability to use simple, chemically defined (and protein-free) growth
media; (d) ease of genetic manipulation; (e) the absence of
contaminating human or animal pathogens such as viruses; (f) the
ability to express a wide variety of proteins, including those
poorly expressed in cell culture owing to toxicity etc.; and (g)
ease of protein recovery (e.g. via secretion into the medium). In
addition, fermentation facilities for yeast and fungi are generally
far less costly to construct than cell culture facilities. Although
the core oligosaccharide structure transferred to a protein in the
endoplasmic reticulum is basically identical in mammals and lower
eukaryotes, substantial differences have been found in the
subsequent processing reactions which occur in the Golgi apparatus
of fungi and mammals. In fact, even amongst different lower
eukaryotes there exist a great variety of glycosylation structures.
This has historically prevented the use of lower eukaryotes as
hosts for the production of recombinant human glycoproteins despite
otherwise notable advantages over mammalian expression systems.
[0021] Therapeutic glycoproteins produced in a microorganism host
such as yeast utilizing the endogenous host glycosylation pathway
differ structurally from those produced in mammalian cells and
typically show greatly reduced therapeutic efficacy. Such
glycoproteins are typically immunogenic in humans and show a
reduced half-life (and thus bioactivity) in vivo after
administration (Takeuchi, 1997). Specific receptors in humans and
animals (i.e., macrophage mannose receptors) can recognize terminal
mannose residues and promote the rapid clearance of the foreign
glycoprotein from the bloodstream. Additional adverse effects may
include changes in protein folding, solubility, susceptibility to
proteases, trafficking, transport, compartmentalization, secretion,
recognition by other proteins or factors, antigenicity, or
allergenicity.
[0022] Yeast and filamentous fungi have both been successfully used
for the production of recombinant proteins, both intracellular and
secreted (Cereghino, J. L. and J. M. Cregg 2000 FEMS Microbiology
Reviews 24(1): 45-66; Harkki, A., et al. 1989 Bio-Technology 7(6):
596; Berka, R. M., et al. 1992 Abstr. Papers Amer. Chem. Soc. 203:
121-BIOT; Svetina, M., et al. 2000 J. Biotechnol. 76(2-3):
245-251). Various yeasts, such as K. lactis, Pichia pastoris,
Pichia methanolica, and Hansenula polymorpha, have played
particularly important roles as eukaryotic expression systems
because they are able to grow to high cell densities and secrete
large quantities of recombinant protein. Likewise, filamentous
fungi, such as Aspergillus niger, Fusarium sp, Neurospora crassa
and others, have been used to efficiently produce glycoproteins at
the industrial scale. However, as noted above, glycoproteins
expressed in any of these eukaryotic microorganisms differ
substantially in N-glycan structure from those in animals. This has
prevented the use of yeast or filamentous fungi as hosts for the
production of many therapeutic glycoproteins.
[0023] Although glycosylation in yeast and fungi is very different
than in humans, some common elements are shared. The first step,
the transfer of the core oligosaccharide structure to the nascent
protein, is highly conserved in all eukaryotes including yeast,
fungi, plants and humans (compare FIGS. 1A and 1B). Subsequent
processing of the core oligosaccharide, however, differs
significantly in yeast and involves the addition of several mannose
sugars. This step is catalyzed by mannosyltransferases residing in
the Golgi (e.g. OCH1, MNT1, MNN1, etc.), which sequentially add
mannose sugars to the core oligosaccharide. The resulting structure
is undesirable for the production of humanoid proteins and it is
thus desirable to reduce or eliminate mannosyltransferase activity.
Mutants of S. cerevisiae deficient in mannosyltransferase activity
(e.g. och1 or mnn9 mutants) have shown to be non-lethal and display
a reduced mannose content in the oligosaccharide of yeast
glycoproteins. Other oligosaccharide processing enzymes, such as
mannosylphosphate transferase, may also have to be eliminated
depending on the host's particular endogenous glycosylation
pattern. After reducing undesired endogenous glycosylation
reactions, the formation of complex N-glycans has to be engineered
into the host system. This requires the stable expression of
several enzymes and sugar-nucleotide transporters. Moreover, one
has to localize these enzymes so that a sequential processing of
the maturing glycosylation structure is ensured.
[0024] Several efforts have been made to modify the glycosylation
pathways of eukaryotic microorganisms to provide glycoproteins more
suitable for use as mammalian therapeutic agents. For example,
several glycosyltransferases have been separately cloned and
expressed in S. cerevisiae (GalT, GnTI), Aspergillus nidulans
(GnTI) and other fungi (Yoshida et al., 1999, Kalsner et al., 1995
Glycoconj. J. 12(3):360-370, Schwientek et al., 1995). However,
N-glycans resembling those made in human cells were not
obtained.
[0025] Yeasts produce a variety of mannosyltransferases (e.g.,
1,3-mannosyltransferases such as MNN1 in S. cerevisiae; Graham and
Emr, 1991 J. Cell. Biol. 114(2):207-218), 1,2-mannosyltransferases
(e.g. KTR/KRE family from S. cerevisiae), 1,6-mannosyltransferases
(e.g., OCH1 from S. cerevisiae), mannosylphosphate transferases and
their regulators (e.g., MNN4 and MNN6 from S. cerevisiae) and
additional enzymes that are involved in endogenous glycosylation
reactions. Many of these genes have been deleted individually
giving rise to viable organisms having altered glycosylation
profiles. Examples are shown in Table 1.
TABLE-US-00001 TABLE 1 Examples of yeast strains having altered
mannosylation Strain N-glycan (wild type) Mutation N-glycan
(mutant) Reference S. pombe Man.sub.>9GlcNAc.sub.2 OCH1
Man.sub.8GlcNAc.sub.2 Yoko-o et al., 2001 FEBS Lett. 489(1): 75-80
S. cerevisiae Man.sub.>9GlcNAc.sub.2 OCH1/MNN1
Man.sub.8GlcNAc.sub.2 Nakanishi-Shindo et al,. 1993 J. Biol. Chem.
268(35): 26338- 26345 S. cerevisiae Man.sub.>9GlcNAc.sub.2
OCH1/MNN1/MNN4 Man.sub.8GlcNAc.sub.2 Chiba et al., 1998 J. Biol.
Chem. 273, 26298-26304 P. pastoris Hyperglycosylated OCH1 (complete
Not Welfide, Japanese deletion) hyperglycosylated Application
Publication No. 8-336387 P. pastoris Man.sub.>8GlcNAc.sub.2 OCH1
(disruption) Man.sub.>8GlcNAc.sub.2 Contreras et al. WO 02/00856
A2
[0026] Japanese Patent Application Publication No. 8-336387
discloses the deletion of an OCH1 homolog in Pichia pastoris. In S.
cerevisiae, OCH1 encodes a 1,6-mannosyltransferase, which adds a
mannose to the glycan structure Man.sub.8GlcNAc.sub.2 to yield
Man.sub.9GlcNAc.sub.2. The Man.sub.9GlcNAc.sub.2 structure, which
contains three 1,6 mannose residues, is then a substrate for
further 1,2-, 1,6-, and 1,3-mannosyltransferases in vivo, leading
to the hypermannosylated glycoproteins that are characteristic for
S. cerevisiae and which typically may have 30-40 mannose residues
per N-glycan. Because the Och1p initiates the transfer of 1,6
mannose to the Man.sub.8GlcNAc.sub.2 core, it is often referred to
as the "initiating 1,6 mannosyltransferase" to distinguish it from
other 1,6 mannosyltransferases acting later in the Golgi. In an
och1 mnn1 mnn4 mutant strain of S. cerevisiae, proteins
glycosylated with Man.sub.8GlcNAc.sub.2 accumulate and
hypermannosylation does not occur. However, Man.sub.8GlcNAc.sub.2
is not a substrate for mammalian glycosyltransferases, such as
human UDP-GlcNAc transferase I, and accordingly, the use of that
mutant strain, in itself, is not useful for producing
mammalian-like proteins, i.e., with complex or hybrid glycosylation
patterns.
[0027] Although Japanese Patent Application Publication No.
8-336387 discloses methods to obtain an och1 mutant of P. pastoris
displaying a reduced mannosylation phenotype, it provides no data
on whether the initiating 1,6 mannosyltransferase activity presumed
to be encoded by OCH1 is reduced or eliminated. It is
well-established in the field of fungal genetics that homologs of
genes often do not play the same role in their respective host
organism. For example, the Neurospora rca-1 gene complements an
Aspergillus flbD sporulation mutant but has no identifiable role in
Neurospora sporulation. Shen, W. C. et al., Genetics 1998;
148(3):1031-41. More recently, Contreras (WO 02/00856 A2) shows
that, in an och1 mutant of P. pastoris, at least 50% of the cell
wall glycans cannot be trimmed to Man.sub.5GlcNAc.sub.2 with a
Trichoderma reesei .alpha.-1,2-mannosidase (see FIG. 11 of WO
02/00856 A2). As the wild-type displays a very similar
glycosylation pattern (FIG. 10, Panel 2 of WO 02/00856 A2), it
appears that the OCH1 gene of P. pastoris may not encode the
initiating 1,6-mannosyltransferase activity and is thus different
from its genetic homolog in S. cerevisiae. Thus, to date, there is
no evidence that initiating .alpha.-1,6-mannosyltransferase
activity is eliminated in och1 mutants of P. pastoris, which
further supports the notion that the glycosylation pathways of S.
cerevisiae and P. pastoris are significantly different.
[0028] Martinet et al. (Biotechnol. Lett. 1998, 20(12), 1171-1177)
reported the expression of .alpha.-1,2-mannosidase from T. reesei
in P. pastoris. Some mannose trimming from the N-glycans of a model
protein was observed. However, the model protein had no N-glycans
with the structure Man.sub.5GlcNAc.sub.2, which would be necessary
as an intermediate for the generation of complex N-glycans.
Accordingly, that system is not useful for producing proteins with
complex or hybrid glycosylation patterns.
[0029] Similarly, Chiba et al. (1998) expressed
.alpha.-1,2-mannosidase from Aspergillus saitoi in the yeast
Saccharomyces cerevisiae. A signal peptide sequence
(His-Asp-Glu-Leu) (SEQ ID NO:5) was engineered into the exogenous
mannosidase to promote its retention in the endoplasmic reticulum.
In addition, the yeast host was a mutant lacking enzyme activities
associated with hypermannosylation of proteins:
1,6-mannosyltransferase (och1); 1,3-mannosyltransferase (mnn1); and
a regulator of mannosylphosphate transferase (mnn4). The N-glycans
of the triple mutant host consisted primarily of the structure
Man.sub.8GlcNAc.sub.2, rather than the high mannose forms found in
wild-type S. cerevisiae. In the presence of the engineered
mannosidase, the N-glycans of a model protein (carboxypeptidase Y)
were trimmed to give a mixture consisting of 27 mole %
Man.sub.5GlcNAc.sub.2, 22 mole % Man.sub.6GlcNAc.sub.2, 22 mole %
Man.sub.7GlcNAc.sub.2, and 29 mole % Man.sub.8GlcNAc.sub.2.
Trimming of cell wall glycoproteins was less efficient, with only
10 mole % of the N-glycans having the desired Man.sub.5GlcNAc.sub.2
structure.
[0030] Even if all the Man.sub.5GlcNAc.sub.2 glycans were the
correct Man.sub.5GlcNAc.sub.2 form that can be converted to
GlcNAcMan.sub.5GlcNAc.sub.2 by GnTI, the above system would not be
efficient for the production of proteins having human-like
glycosylation patterns. If several glycosylation sites are present
in a desired protein, the probability (P) of obtaining such a
protein in a correct form follows the relationship P=(F).sup.n,
where n equals the number of glycosylation sites, and F equals the
fraction of desired glycoforms. A glycoprotein with three
glycosylation sites would have a 0.1% chance of providing the
appropriate precursors for complex and hybrid N-glycan processing
on all of its glycosylation sites. Thus, using the system of Chiba
to make a glycoprotein having a single N-glycosylation site, at
least 73 mole % would have an incorrect structure. For a
glycoprotein having two or three N-glycosylation sites, at least 93
or 98 mole % would have an incorrect structure, respectively. Such
low efficiencies of conversion are unsatisfactory for the
production of therapeutic agents, particularly as the separation of
proteins having different glycoforms is typically costly and
difficult.
[0031] Chiba et al. (WO 01/14522) have shown high levels of
Man.sub.5GlcNAc.sub.2 structures on recombinant fibroblast growth
factor (FGF), a secreted soluble glycoprotein produced in S.
cerevisiae. It is not clear, however, that the detected
Man.sub.5GlcNAc.sub.2 was produced inside the host cell (i.e. in
vivo) because the .alpha.-1,2 mannosidase was targeted by fusion
with an HDEL (SEQ ID NO:5) localization tag, a mechanism, which is
known to be leaky (Pelham H. R. (1998) EMBO J. 7, 913-918). It is
more likely that FGF was secreted into the medium, where it was
then processed by .alpha.-1,2 mannosidase which had escaped the
HDEL (SEQ ID NO:5) retrieval mechanism and leaked into the medium.
As mentioned above, an intracellular protein (CPY), expressed in
the same strain, contained mostly glycans (more than 73%) that were
Man.sub.6GlcNAc.sub.2 and larger. The majority of the
Man.sub.5GlcNAc.sub.2 structures on FGF are, thus, likely to have
been produced ex vivo. It is further unclear whether the
Man.sub.5GlcNAc.sub.2 structures that were produced were productive
substrates for GnTI.
[0032] As the above work demonstrates, one can trim
Man.sub.8GlcNAc.sub.2 structures to a Man.sub.5GlcNAc.sub.2 isomer
in S. cerevisiae, although high efficiency trimming greater than
50% in vivo has yet to be determined, by engineering a fungal
mannosidase from A. saitoi into the endoplasmic reticulum (ER). The
shortcomings of this approach are two-fold: (1) it is not clear
whether the Man.sub.5GlcNAc.sub.2 structures formed are in fact
formed in vivo (rather than having been secreted and further
modified by mannosidases outside the cell); and (2) it is not clear
whether any Man.sub.5GlcNAc.sub.2 structures formed, if in fact
formed in vivo, are the correct isoform to be a productive
substrate for subsequent N-glycan modification by GlcNAc
transferase I (Maras et al., 1997, Eur. J. Biochem. 249,
701-707).
[0033] With the objective of providing a more human-like
glycoprotein derived from a fungal host, U.S. Pat. No. 5,834,251
discloses a method for producing a hybrid glycoprotein derived from
Trichoderma reseei. A hybrid N-glycan has only mannose residues on
the Man.alpha.1-6 arm of the core mannose structure and one or two
complex antennae on the Man.alpha.1-3 arm. While this structure has
utility, the method has the disadvantage that numerous enzymatic
steps must be performed in vitro, which is costly and
time-consuming Isolated enzymes are expensive to prepare and need
costly substrates (e.g. UDP-GlcNAc). The method also does not allow
for the production of complex glycans on a desired protein.
Intracellular Mannosidase Activity Involved in N-glycan
Trimming
[0034] Alpha-1,2-mannosidase activity is required for the trimming
of Man.sub.8GlcNAc.sub.2 to form Man.sub.5GlcNAc.sub.2, which is a
major intermediate for complex N-glycan formation in mammals.
Previous work has shown that truncated murine, fungal and human
.alpha.-1,2-mannosidase can be expressed in the methylotropic yeast
P. pastoris and display Man.sub.8GlcNAc.sub.2 to
Man.sub.5GlcNAc.sub.2 trimming activity (Lal et al., Glycobiology
1998 October; 8(10):981-95; Tremblay et al., Glycobiology 1998
June; 8(6):585-95, Callewaert et al., 2001). However, to date, no
reports exist that show the high level in vivo trimming of
Man.sub.8GlcNAc.sub.2 to Man.sub.5GlcNAc.sub.2 on a secreted
glycoprotein from P. pastoris.
[0035] While it is useful to engineer strains that are able to
produce Man.sub.5GlcNAc.sub.2 as the primary N-glycan structure,
any attempt to further modify these high mannose precursor
structures to more closely resemble human glycans requires
additional in vivo or in vitro steps. Methods to further humanize
glycans from fungal and yeast sources in vitro are described in
U.S. Pat. No. 5,834,251 (supra). As discussed above, however, if
Man.sub.5GlcNAc.sub.2 is to be further humanized in vivo, one has
to ensure that the generated Man.sub.5GlcNAc.sub.2 structures are,
in fact, generated intracellularly and not the product of
mannosidase activity in the medium. Complex N-glycan formation in
yeast or fungi will require high levels of Man.sub.5GlcNAc.sub.2 to
be generated within the cell because only intracellular
Man.sub.5GlcNAc.sub.2 glycans can be further processed to hybrid
and complex N-glycans in vivo. In addition, one has to demonstrate
that the majority of Man.sub.5GlcNAc.sub.2 structures generated are
in fact a substrate for GnTI and thus allow the formation of hybrid
and complex N-glycans.
[0036] Moreover, the mere presence of an .alpha.-1,2-mannosidase in
the cell does not, by itself, ensure proper intracellular trimming
of Man.sub.8GlcNAc.sub.2 to Man.sub.5GlcNAc.sub.2. (See, e.g.,
Contreras et al. WO 02/00856 A2, in which an HDEL (SEQ ID NO:5)
tagged mannosidase of T. reesei is localized primarily in the ER
and co-expressed with an influenza haemagglutinin (HA) reporter
protein on which virtually no Man.sub.5GlcNAc.sub.2 could be
detected. See also Chiba et al., 1998 (supra), in which a chimeric
.alpha.-1,2-mannosidase/Och1p transmembrane domain fusion localized
in the ER, early Golgi and cytosol of S. cerevisiae, had no
mannosidase trimming activity). Accordingly, mere localization of a
mannosidase in the ER or Golgi is insufficient to ensure activity
of the respective enzyme in that targeted organelle. (See also,
Martinet et al. (1998), supra, showing that .alpha.-1,2-mannosidase
from T. reesei, while localizing intracellularly, increased rather
than decreased the extent of mannosylation). To date, there is no
report that demonstrates the intracellular localization of an
active heterologous .alpha.-1,2-mannosidase in either yeast or
fungi using a transmembrane localization sequence.
[0037] Accordingly, the need exists for methods to produce
glycoproteins characterized by a high intracellular
Man.sub.5GlcNAc.sub.2 content which can be further processed into
human-like glycoprotein structures in non-human eukaryotic host
cells, and particularly in yeast and filamentous fungi.
SUMMARY OF THE INVENTION
[0038] Host cells and cell lines having genetically modified
glycosylation pathways that allow them to carry out a sequence of
enzymatic reactions which mimic the processing of glycoproteins in
mammals, especially in humans, have been developed. Recombinant
proteins expressed in these engineered hosts yield glycoproteins
more similar, if not substantially identical, to their mammalian,
e.g., human counterparts. Host cells of the invention, e.g., lower
eukaryotic micro-organisms and other non-human, eukaryotic host
cells grown in culture, are modified to produce N-glycans such as
Man.sub.5GlcNAc.sub.2 or other structures produced along human
glycosylation pathways. This is achieved using a combination of
engineering and/or selection of strains which: do not express
certain enzymes which create the undesirable structures
characteristic of the fungal glycoproteins; which express
heterologous enzymes selected either to have optimal activity under
the conditions present in the host cell where activity is to be
achieved; or combinations thereof; wherein the genetically
engineered eukaryote expresses at least one heterologous enzyme
activity required to produce a "human-like" glycoprotein. Host
cells of the invention may be modified further by heterologous
expression of one or more activities such as glycosyltransferases,
sugar transporters and mannosidases, to become strains for the
production of mammalian, e.g., human therapeutic glycoproteins.
[0039] The present invention thus provides a glycoprotein
production method using (1) a lower eukaryotic host such as a
unicellular or filamentous fungus, or (2) any non-human eukaryotic
organism that has a different glycosylation pattern from humans, to
modify the glycosylation composition and structures of the proteins
made in a host organism ("host cell") so that they resemble more
closely carbohydrate structures found in mammalian, e.g., human
proteins. The process allows one to obtain an engineered host cell
which can be used to express and target any desirable gene(s),
e.g., one involved in glycosylation, by methods that are
well-established in the scientific literature and generally known
to the artisan in the field of protein expression. Host cells with
modified oligosaccharides are created or selected. N-glycans made
in the engineered host cells have a Man.sub.5GlcNAc.sub.2 core
structure which may then be modified further by heterologous
expression of one or more enzymes, e.g., glycosyltransferases,
glycosidases, sugar transporters and mannosidases, to yield
human-like glycoproteins. For the production of therapeutic
proteins, this method may be adapted to engineer cell lines in
which any desired glycosylation structure may be obtained.
[0040] Accordingly, in one embodiment, the invention provides a
method for producing a human-like glycoprotein in a non-human
eukaryotic host cell. The host cell of the invention is selected or
engineered to be depleted in 1,6-mannosyl-transferase activities
which would otherwise add mannose residues onto the N-glycan on a
glycoprotein. One or more enzymes (enzymatic activities) are
introduced into the host cell which enable the production of a
Man.sub.5GlcNAc.sub.2 carbohydrate structure at a high yield, e.g.,
at least 30 mole percent. In a more preferred embodiment, at least
10% of the Man.sub.5GlcNAc.sub.2 produced within the host cell is a
productive substrate for GnTI and thus for further glycosylation
reactions in vivo and/or in vitro that produce a finished N-glycan
that is similar or identical to that formed in mammals, especially
humans.
[0041] In another embodiment, a nucleic acid molecule encoding one
or more enzymes for production of a Man.sub.5GlcNAc.sub.2
carbohydrate structure is introduced into a host cell selected or
engineered to be depleted in 1,6-mannosyltransferase activities. In
one preferred embodiment, at least one enzyme introduced into the
host cell is selected to have optimal activity at the pH of the
subcellular location where the carbohydrate structure is produced.
In another preferred embodiment, at least one enzyme is targeted to
a host subcellular organelle where the enzyme will have optimal
activity, e.g., by means of a chimeric protein comprising a
cellular targeting signal peptide not normally associated with the
enzyme.
[0042] The invention further provides isolated nucleic acid
molecules and vectors comprising such molecules which encode an
initiating .alpha.1,6-mannosyl-transferase activity isolated from
P. pastoris or from K. lactis. These nucleic acid molecules
comprise sequences that are homologous to the OCH1 gene in S.
cerevisiae. These and homologous sequences are useful for
constructing host cells which will not hypermannosylate the
N-glycan of a glycoprotein.
[0043] In another embodiment, the host cell is engineered to
express a heterologous glycosidase, e.g., by introducing into the
host one or more nucleic acid molecules encoding the glycosidase.
Preferably, a nucleic acid molecule encodes one or more mannosidase
activities involved in the production of Man.sub.5GlcNAc.sub.2 from
Man.sub.8GlcNAc.sub.2 or Man.sub.9GlcNAc.sub.2. In a preferred
embodiment, at least one of the encoded mannosidase activities has
a pH optimum within 1.4 pH units of the average pH optimum of other
representative enzymes in the organelle in which the mannosidase
activity is localized, or has optimal activity at a pH of between
about 5.1 and about 8.0, preferably between about 5.5 and about
7.5. Preferably, the heterologous enzyme is targeted to the
endoplasmic reticulum, the Golgi apparatus or the transport
vesicles between ER and Golgi of the host organism, where it trims
N-glycans such as Man.sub.8GlcNAc.sub.2 to yield high levels of
Man.sub.5GlcNAc.sub.2. In one embodiment, the enzyme is targeted by
forming a fusion protein between a catalytic domain of the enzyme
and a cellular targeting signal peptide, e.g., by the in-frame
ligation of a DNA fragment encoding a cellular targeting signal
peptide with a DNA fragment encoding a glycosylation enzyme or
catalytically active fragment thereof.
[0044] In yet another embodiment, the glycosylation pathway of a
host is modified to express a sugar nucleotide transporter. In a
preferred embodiment, a nucleotide diphosphatase enzyme is also
expressed. The transporter and diphosphatase improve the efficiency
of engineered glycosylation steps, by providing the appropriate
substrates for the glycosylation enzymes in the appropriate
compartments, reducing competitive product inhibition, and
promoting the removal of nucleoside diphosphates.
[0045] The present invention also provides a combinatorial nucleic
acid library useful for making fusion constructs which can target a
desired protein or polypeptide fragment, e.g., an enzyme involved
in glycosylation or a catalytic domain thereof, to a selected
subcellular region of a host cell. In one preferred embodiment, the
combinatorial nucleic acid library comprises (a) nucleic acid
sequences encoding different cellular targeting signal peptides and
(b) nucleic acid sequences encoding different polypeptides to be
targeted. Nucleic acid sequences of or derived from (a) and (b) are
ligated together to produce fusion constructs, at least one of
which encodes a functional protein domain (e.g., a catalytic domain
of an enzyme) ligated in-frame to a heterologous cellular targeting
signal peptide, i.e., one which it normally does not associate
with.
[0046] The invention also provides a method for modifying the
glycosylation pathway of a host cell (e.g., any eukaryotic host
cell, including a human host cell) using enzymes involved in
modifying N-glycans including glycosidases and
glycosyltransferases; by transforming the host cell with a nucleic
acid (e.g., a combinatorial) library of the invention to produce a
genetically mixed cell population expressing at least one and
preferably two or more distinct chimeric glycosylation enzymes
having a catalytic domain ligated in-frame to a cellular targeting
signal peptide which it normally does not associate with. A host
cell having a desired glycosylation phenotype may optionally be
selected from the population. Host cells modified using the library
and associated methods of the invention are useful, e.g., for
producing glycoproteins having a glycosylation pattern similar or
identical to those produced in mammals, especially humans.
[0047] In another aspect, the combinatorial library of the present
invention enables production of one or a combination of
catalytically active glycosylation enzymes, which successfully
localize to intracellular compartments in which they function
efficiently in the glycosylation/secretory pathway. Preferred
enzymes convert Man.sub.5(.alpha.-1,2-Man).sub.3-9GlcNAc.sub.2 to
Man.sub.5GlcNAc.sub.2 at high efficiency in vivo. In addition, the
invention provides eukaryotic host strains, and in particular,
yeasts, fungal, insect, plant, plant cells, algae and insect cell
hosts, capable of producing glycoprotein intermediates or products
with Man.sub.5GlcNAc.sub.2 and/or GlcNAcMan.sub.5GlcNAc.sub.2 as
the predominant N-glycan.
[0048] The present invention also provides recombinant molecules
derived from a combinatorial nucleic acid library; vectors,
including expression vectors, comprising such recombinant
molecules; proteins encoded by the recombinant molecules and
vectors; host cells transformed with the recombinant molecules or
vectors; glycoproteins produced from such transformed hosts; and
methods for producing, in vivo, glycoprotein intermdiates or
products with predominantly Man.sub.5GlcNAc.sub.2 or
GlcNAcMan.sub.5GlcNAc.sub.2 N-glycans covalently attached to
appropriate glycosylation sites using the combinatorial
library.
[0049] Further aspects of this invention include methods,
compositions and kits for diagnostic and therapeutic uses in which
presence or absence of Man.sub.5GlcNAc.sub.2 and/or
GlcNAcMan.sub.5GlcNAc.sub.2 on a glycoprotein may be detected.
BRIEF DESCRIPTION OF THE DRAWINGS
[0050] FIG. 1A is a schematic diagram of a typical fungal
N-glycosylation pathway.
[0051] FIG. 1B is a schematic diagram of a typical human
N-glycosylation pathway.
[0052] FIG. 2 depicts construction of a combinatorial DNA library
of fusion constructs. Panel A diagrams the insertion of a targeting
peptide fragment into pCR2.1-TOPO (Invitrogen, Carlsbad, Calif.).
Panel B shows the generated targeting peptide sub-library having
restriction sites NotI-AscI. Panel C diagrams the insertion of a
catalytic domain region into pJN347, a modified pUC19 vector. Panel
D shows the generated catalytic domain sub-library having
restriction sites NotI, AscI and PacI. Panel E depicts one
particular fusion construct generated from the targeting peptide
sub-library and the catalytic domain sub-library.
[0053] FIGS. 3A and 3B (SEQ ID NOS 45-46 respectively, in order of
appearance) illustrate the M. musculus .alpha.-1,2-mannosidase IA
open reading frame. The sequences of the PCR primers used to
generate N-terminal truncations are underlined.
[0054] FIGS. 4A-4F illustrate engineering of vectors with multiple
auxotrophic markers and genetic integration of target proteins in
the P. pastoris OCH1 locus.
[0055] FIG. 5 shows MALDI-TOF analysis demonstrating production of
kringle 3 domain of human plasminogen (K3) glycoproteins having
Man.sub.5GlcNAc.sub.2 as the predominant N-glycan structure in P.
pastoris. FIG. 5A depicts the standard Man.sub.5GlcNAc.sub.2 [a]
glycan (Glyko, Novato, Calif.) and
Man.sub.5GlcNAc.sub.2+Na.sup.+[b]. FIG. 5B shows PNGase-released
glycans from K3 wild type. The N-glycans shown are as follows:
Man.sub.9GlcNAc.sub.2 [d]; Man.sub.10GlcNAc.sub.2 [e];
Man.sub.11GlcNAc.sub.2 Man.sub.12GlcNAc.sub.2 [g]. FIG. 5C depicts
the och1 deletion resulting in the production of
Man.sub.8GlcNAc.sub.2 [c] as the predominant N-glycan. FIGS. 5D and
5E show the production of Man.sub.5GlcNAc.sub.2 [b] after in vivo
trimming of Man.sub.8GlcNAc.sub.2 with a chimeric
.alpha.-1,2-mannosidase. The predominant N-glycan is indicated by a
peak with a mass (m/z) of 1253 consistent with its identification
as Man.sub.5GlcNAc.sub.2 [b].
[0056] FIG. 6 shows MALDI-TOF analysis demonstrating production of
IFN-.beta. glycoproteins having Man.sub.5GlcNAc.sub.2 as the
predominant N-glycan structure in P. pastoris. FIG. 6A shows the
standard Man.sub.5GlcNAc.sub.2 [a] and
Man.sub.5GlcNAc.sub.2+Na.sup.+[b] as the standard (Glyko, Novato,
Calif.). FIG. 6B shows PNGase-released glycans from IFN-.beta.
wildtype. FIG. 6C depicts the och1 knock-out producing
Man.sub.8GlcNAc.sub.2 [c]; Man.sub.9GlcNAc.sub.2 [d];
Man.sub.10GlcNAc.sub.2 [e]; Man.sub.11GlcNAc.sub.2 [f];
Man.sub.12GlcNAc.sub.2 [g]; and no production of
Man.sub.5GlcNAc.sub.2 [b]. FIG. 6D shows relatively small amount of
Man.sub.5GlcNAc.sub.2 [b] among other intermediate N-glycans
Man.sub.8GlcNAc.sub.2 [c] to Man.sub.12GlcNAc.sub.2 [g]. FIG. 6E
shows a significant amount of Man.sub.5GlcNAc.sub.2 [b] relative to
the other glycans Man.sub.8GlcNAc.sub.2 [c] and
Man.sub.9GlcNAc.sub.2 [d] produced by pGC5 (Saccharomyces
MNS1(m)/mouse mannosidase IB .DELTA.99). FIG. 6F shows predominant
production of Man.sub.5GlcNAc.sub.2 [b] on the secreted
glycoprotein IFN-.beta. by pFB8 (Saccharomyces SEC12 (m)/mouse
mannosidase IA .DELTA.187). The N-glycan is indicated by a peak
with a mass (m/z) of 1254 consistent with its identification as
Man.sub.5GlcNAc.sub.2 [b].
[0057] FIG. 7 shows a high performance liquid chromatogram for: (A)
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB (negative
control); (B) supernatant of medium P. pastoris, .DELTA.och1
transformed with pFB8 mannosidase, which demonstrates a lack of
extracellular mannosidase activity in the supernatant; and (C)
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB after exposure to
T. reesei mannosidase (positive control). FIG. 7A shows a high
performance liquid chromatogram for Man.sub.9GlcNAc.sub.2 standard
labeled with 2-AB (negative control). FIG. 7B shows a high
performance liquid chromatogram for supernatant of medium P.
pastoris, .DELTA.och1 transformed with pFB8 mannosidase, which
demonstrates a lack of extracellular mannosidase activity in the
supernatant. FIG. 7C shows a high performance liquid chromatogram
for Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB after exposure
to T. reesei mannosidase (positive control).
[0058] FIG. 8 shows a high performance liquid chromatogram for: (A)
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB (negative
control); (B) supernatant of medium P. pastoris, .DELTA.och1
transformed with pGC5 mannosidase, which demonstrates a lack of
extracellular mannosidase activity in the supernatant; and (C)
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB after exposure to
T. reesei mannosidase (positive control). FIG. 8A shows a high
performance liquid chromatogram for Man.sub.9GlcNAc.sub.2 standard
labeled with 2-AB (negative control). FIG. 8B shows a high
performance liquid chromatogram for supernatant of medium P.
pastoris, .DELTA.och1 transformed with pGC5 mannosidase, which
demonstrates a lack of extracellular mannosidase activity in the
supernatant. FIG. 8C shows a high performance liquid chromatogram
for Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB after exposure
to T. reesei mannosidase (positive control).
[0059] FIG. 9 shows a high performance liquid chromatogram for: (A)
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB (negative
control); (B) supernatant of medium P. pastoris, .DELTA.och1
transformed with pBC18-5 mannosidase, which demonstrates lack of
extracellular mannosidase activity in the supernatant; and (C)
supernatant of medium P. pastoris, .DELTA.och1 transformed with
pDD28-3, which demonstrates activity in the supernatant (positive
control). FIG. 9A shows a high performance liquid chromatogram for
Man.sub.9GlcNAc.sub.2 standard labeled with 2-AB (negative
control). FIG. 9B shows a high performance liquid chromatogram for
supernatant of medium P. pastoris, .DELTA.och1 transformed with
pBC18-5 mannosidase, which demonstrates a lack of extracellular
mannosidase activity in the supernatant. FIG. 9C shows a high
performance liquid chromatogram for supernatant of medium P.
pastoris, .DELTA.och1 transformed with pDD28-3, which demonstrates
activity in the supernatant (positive control).
[0060] FIG. 10 demonstrates the activity of an UDP-GlcNAc
transporter in the production of GlcNAcMan.sub.5GlcNAc.sub.2 in P.
pastoris. FIG. 10A depicts a P. pastoris strain (YSH-3) with a
human GnTI but without the UDP-GlcNAc transporter resulting in some
production of GlcNAcMan.sub.5GlcNAc.sub.2 [b] but a predominant
production of Man.sub.5GlcNAc.sub.2 [a]. FIG. 10B depicts the
addition of UDP-GlcNAc transporter from K. lactis in a strain
(PBP-3) with the human GnTI, which resulted in the predominant
production of GlcNAcMan.sub.5GlcNAc.sub.2 [b]. The single prominent
peak of mass (m/z) at 1457 is consistent with its identification as
GlcNAcMan.sub.5GlcNAc.sub.2 [b] as shown in FIG. 10B.
[0061] FIG. 11 shows a pH optimum of a heterologous mannosidase
enzyme encoded by pBB27-2 (Saccharomyces MNN10 (s)/C. elegans
mannosidase IB .DELTA.31) expressed in P. pastoris.
[0062] FIG. 12 shows MALDI-TOF analysis of N-glycans released from
a cell free extract of K. lactis. FIG. 12A shows the N-glycans
released from wild-type cells, which includes high-mannose type
N-glycans. FIG. 12B shows the N-glycans released from och1 mnn1
deleted cells, revealing a distinct peak of mass (m/z) at 1908
consistent with its identification as Man.sub.9GlcNAc.sub.2 [d].
FIG. 12C shows the N-glycans released from och1 mnn1 deleted cells
after in vitro .alpha.-1,2-mannosidase digest corresponding to a
peak consistent with Man.sub.5GlcNAc.sub.2.
[0063] FIG. 13 represents T-DNA cassettes with catalytic domain(s)
of glycosylation enzymes fused in-frame to different leader
sequences. The ends of the T-DNA are marked by the right (rb) and
left borders (lb). Various promoters and terminators may also be
used. The plant selectable marker can also be varied. The right and
left borders are required only for agrobacterium-mediated
transformation and not for particle bombardment or
electroporation.
DETAILED DESCRIPTION OF THE INVENTION
[0064] Unless otherwise defined herein, scientific and technical
terms used in connection with the present invention shall have the
meanings that are commonly understood by those of ordinary skill in
the art. Further, unless otherwise required by context, singular
terms shall include pluralities and plural terms shall include the
singular. The methods and techniques of the present invention are
generally performed according to conventional methods well known in
the art. Generally, nomenclatures used in connection with, and
techniques of biochemistry, enzymology, molecular and cellular
biology, microbiology, genetics and protein and nucleic acid
chemistry and hybridization described herein are those well-known
and commonly used in the art.
[0065] The methods and techniques of the present invention are
generally performed according to conventional methods well-known in
the art and as described in various general and more specific
references that are cited and discussed throughout the present
specification unless otherwise indicated. See, e.g., Sambrook et
al. Molecular Cloning: A Laboratory Manual, 2d ed., Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989); Ausubel
et al., Current Protocols in Molecular Biology, Greene Publishing
Associates (1992, and Supplements to 2002); Harlow and Lane
Antibodies: A Laboratory Manual Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y. (1990); Introduction to
Glycobiology, Maureen E. Taylor, Kurt Drickamer, Oxford Univ. Press
(2003); Worthington Enzyme Manual, Worthington Biochemical Corp.
Freehold, N.J.; Handbook of Biochemistry: Section A Proteins Vol I
1976 CRC Press; Handbook of Biochemistry: Section A Proteins Vol II
1976 CRC Press; Essentials of Glycobiology, Cold Spring Harbor
Laboratory Press (1999). The nomenclatures used in connection with,
and the laboratory procedures and techniques of, molecular and
cellular biology, protein biochemistry, enzymology and medicinal
and pharmaceutical chemistry described herein are those well known
and commonly used in the art.
[0066] All publications, patents and other references mentioned
herein are incorporated by reference.
[0067] The following terms, unless otherwise indicated, shall be
understood to have the following meanings:
[0068] As used herein, the term "N-glycan" refers to an N-linked
oligosaccharide, e.g., one that is attached by an
asparagine-N-acetylglucosamine linkage to an asparagine residue of
a polypeptide. N-glycans have a common pentasaccharide core of
Man.sub.3GlcNAc.sub.2 ("Man" refers to mannose; "Glc" refers to
glucose; and "NAc" refers to N-acetyl; GlcNAc refers to
N-acetylglucosamine). The term "trimannose core" used with respect
to the N-glycan also refers to the structure Man.sub.3GlcNAc.sub.2
("Man.sub.3"). N-glycans differ with respect to the number of
branches (antennae) comprising peripheral sugars (e.g., fucose and
sialic acid) that are added to the Man.sub.3 core structure.
N-glycans are classified according to their branched constituents
(e.g., high mannose, complex or hybrid).
[0069] A "high mannose" type N-glycan has five or more mannose
residues. A "complex" type N-glycan typically has at least one
GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc
attached to the 1,6 mannose arm of the trimannose core. Complex
N-glycans may also have galactose ("Gal") residues that are
optionally modified with sialic acid or derivatives ("NeuAc", where
"Neu" refers to neuraminic acid and "Ac" refers to acetyl). A
complex N-glycan typically has at least one branch that terminates
in an oligosaccharide such as, for example: NeuNAc-;
NeuAca2-6GalNAca1-; NeuAca2-3Galb1-3GalNAca1-;
NeuAca2-3/6Galb1-4GlcNAcb1-; GlcNAca1-4Galb1-(mucins only);
Fucal-2Galb1-(blood group H). Sulfate esters can occur on
galactose, GalNAc, and GlcNAc residues, and phosphate esters can
occur on mannose residues. NeuAc (Neu: neuraminic acid; Ac:acetyl)
can be 0-acetylated or replaced by NeuGl (N-glycolylneuraminic
acid). Complex N-glycans may also have intrachain substitutions
comprising "bisecting" GlcNAc and core fucose ("Fuc"). A "hybrid"
N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose
arm of the trimannose core and zero or more mannoses on the 1,6
mannose arm of the trimannose core.
[0070] The term "predominant" or "predominantly" used with respect
to the production of N-glycans refers to a structure which
represents the major peak detected by matrix assisted laser
desorption ionization time of flight mass spectrometry (MALDI-TOF)
analysis.
[0071] Abbreviations used herein are of common usage in the art,
see, e.g., abbreviations of sugars, above. Other common
abbreviations include "PNGase", which refers to peptide
N-glycosidase F (EC 3.2.2.18); "GlcNAc Tr" or "GnT," which refers
to N-acetylglucosaminyl Transferase enzymes; "NANA" refers to
N-acetylneuraminic acid.
[0072] As used herein, a "humanized glycoprotein" or a "human-like
glycoprotein" refers alternatively to a protein having attached
thereto N-glycans having less than four mannose residues, and
synthetic glycoprotein intermediates (which are also useful and can
be manipulated further in vitro or in vivo) having at least five
mannose residues. Preferably, glycoproteins produced according to
the invention contain at least 30 mole %, preferably at least 40
mole % and more preferably 50-100 mole % of the
Man.sub.5GlcNAc.sub.2 intermediate, at least transiently. This may
be achieved, e.g., by engineering a host cell of the invention to
express a "better", i.e., a more efficient glycosylation enzyme.
For example, a mannosidase is selected such that it will have
optimal activity under the conditions present at the site in the
host cell where proteins are glycosylated and is introduced into
the host cell preferably by targeting the enzyme to a host cell
organelle where activity is desired.
[0073] The term "enzyme", when used herein in connection with
altering host cell glycosylation, refers to a molecule having at
least one enzymatic activity, and includes full-length enzymes,
catalytically active fragments, chimerics, complexes, and the like.
A "catalytically active fragment" of an enzyme refers to a
polypeptide having a detectable level of functional (enzymatic)
activity.
[0074] A lower eukaryotic host cell, when used herein in connection
with glycosylation profiles, refers to any eukaryotic cell which
ordinarily produces high mannose containing N-glycans, and thus is
meant to include some animal or plant cells and most typical lower
eukaryotic cells, including uni- and multicellular fungal and algal
cells.
[0075] As used herein, the term "secretion pathway" refers to the
assembly line of various glycosylation enzymes to which a
lipid-linked oligosaccharide precursor and an N-glycan substrate
are sequentially exposed, following the molecular flow of a nascent
polypeptide chain from the cytoplasm to the endoplasmic reticulum
(ER) and the compartments of the Golgi apparatus. Enzymes are said
to be localized along this pathway. An enzyme X that acts on a
lipid-linked glycan or an N-glycan before enzyme Y is said to be or
to act "upstream" to enzyme Y; similarly, enzyme Y is or acts
"downstream" from enzyme X.
[0076] The term "targeting peptide" as used herein refers to
nucleotide or amino acid sequences encoding a cellular targeting
signal peptide which mediates the localization (or retention) of an
associated sequence to sub-cellular locations, e.g.,
organelles.
[0077] The term "polynucleotide" or "nucleic acid molecule" refers
to a polymeric form of nucleotides of at least 10 bases in length.
The term includes DNA molecules (e.g., cDNA or genomic or synthetic
DNA) and RNA molecules (e.g., mRNA or synthetic RNA), as well as
analogs of DNA or RNA containing non-natural nucleotide analogs,
non-native internucleoside bonds, or both. The nucleic acid can be
in any topological conformation. For instance, the nucleic acid can
be single-stranded, double-stranded, triple-stranded, quadruplexed,
partially double-stranded, branched, hairpinned, circular, or in a
padlocked conformation. The term includes single and double
stranded forms of DNA. A nucleic acid molecule of this invention
may include both sense and antisense strands of RNA, cDNA, genomic
DNA, and synthetic forms and mixed polymers of the above. They may
be modified chemically or biochemically or may contain non-natural
or derivatized nucleotide bases, as will be readily appreciated by
those of skill in the art. Such modifications include, for example,
labels, methylation, substitution of one or more of the naturally
occurring nucleotides with an analog, internucleotide modifications
such as uncharged linkages (e.g., methyl phosphonates,
phosphotriesters, phosphoramidates, carbamates, etc.), charged
linkages (e.g., phosphorothioates, phosphorodithioates, etc.),
pendent moieties (e.g., polypeptides), intercalators (e.g.,
acridine, psoralen, etc.), chelators, alkylators, and modified
linkages (e.g., alpha anomeric nucleic acids, etc.) Also included
are synthetic molecules that mimic polynucleotides in their ability
to bind to a designated sequence via hydrogen bonding and other
chemical interactions. Such molecules are known in the art and
include, for example, those in which peptide linkages substitute
for phosphate linkages in the backbone of the molecule.
[0078] Unless otherwise indicated, a "nucleic acid comprising SEQ
ID NO:X" refers to a nucleic acid, at least a portion of which has
either (i) the sequence of SEQ ID NO:X, or (ii) a sequence
complementary to SEQ ID NO:X. The choice between the two is
dictated by the context. For instance, if the nucleic acid is used
as a probe, the choice between the two is dictated by the
requirement that the probe be complementary to the desired
target.
[0079] An "isolated" or "substantially pure" nucleic acid or
polynucleotide (e.g., an RNA, DNA or a mixed polymer) is one which
is substantially separated from other cellular components that
naturally accompany the native polynucleotide in its natural host
cell, e.g., ribosomes, polymerases, and genomic sequences with
which it is naturally associated. The term embraces a nucleic acid
or polynucleotide that (1) has been removed from its naturally
occurring environment, (2) is not associated with all or a portion
of a polynucleotide in which the "isolated polynucleotide" is found
in nature, (3) is operatively linked to a polynucleotide which it
is not linked to in nature, or (4) does not occur in nature. The
term "isolated" or "substantially pure" also can be used in
reference to recombinant or cloned DNA isolates, chemically
synthesized polynucleotide analogs, or polynucleotide analogs that
are biologically synthesized by heterologous systems.
[0080] However, "isolated" does not necessarily require that the
nucleic acid or polynucleotide so described has itself been
physically removed from its native environment. For instance, an
endogenous nucleic acid sequence in the genome of an organism is
deemed "isolated" herein if a heterologous sequence (i.e., a
sequence that is not naturally adjacent to this endogenous nucleic
acid sequence) is placed adjacent to the endogenous nucleic acid
sequence, such that the expression of this endogenous nucleic acid
sequence is altered. By way of example, a non-native promoter
sequence can be substituted (e.g., by homologous recombination) for
the native promoter of a gene in the genome of a human cell, such
that this gene has an altered expression pattern. This gene would
now become "isolated" because it is separated from at least some of
the sequences that naturally flank it.
[0081] A nucleic acid is also considered "isolated" if it contains
any modifications that do not naturally occur to the corresponding
nucleic acid in a genome. For instance, an endogenous coding
sequence is considered "isolated" if it contains an insertion,
deletion or a point mutation introduced artificially, e.g., by
human intervention. An "isolated nucleic acid" also includes a
nucleic acid integrated into a host cell chromosome at a
heterologous site, a nucleic acid construct present as an episome.
Moreover, an "isolated nucleic acid" can be substantially free of
other cellular material, or substantially free of culture medium
when produced by recombinant techniques, or substantially free of
chemical precursors or other chemicals when chemically
synthesized.
[0082] As used herein, the phrase "degenerate variant" of a
reference nucleic acid sequence encompasses nucleic acid sequences
that can be translated, according to the standard genetic code, to
provide an amino acid sequence identical to that translated from
the reference nucleic acid sequence.
[0083] The term "percent sequence identity" or "identical" in the
context of nucleic acid sequences refers to the residues in the two
sequences which are the same when aligned for maximum
correspondence. The length of sequence identity comparison may be
over a stretch of at least about nine nucleotides, usually at least
about 20 nucleotides, more usually at least about 24 nucleotides,
typically at least about 28 nucleotides, more typically at least
about 32 nucleotides, and preferably at least about 36 or more
nucleotides. There are a number of different algorithms known in
the art which can be used to measure nucleotide sequence identity.
For instance, polynucleotide sequences can be compared using FASTA,
Gap or Bestfit, which are programs in Wisconsin Package Version
10.0, Genetics Computer Group (GCG), Madison, Wis. FASTA provides
alignments and percent sequence identity of the regions of the best
overlap between the query and search sequences (Pearson, 1990,
herein incorporated by reference). For instance, percent sequence
identity between nucleic acid sequences can be determined using
FASTA with its default parameters (a word size of 6 and the NOPAM
factor for the scoring matrix) or using Gap with its default
parameters as provided in GCG Version 6.1, herein incorporated by
reference.
[0084] The term "substantial homology" or "substantial similarity,"
when referring to a nucleic acid or fragment thereof, indicates
that, when optimally aligned with appropriate nucleotide insertions
or deletions with another nucleic acid (or its complementary
strand), there is nucleotide sequence identity in at least about
50%, more preferably 60% of the nucleotide bases, usually at least
about 70%, more usually at least about 80%, preferably at least
about 90%, and more preferably at least about 95%, 96%, 97%, 98% or
99% of the nucleotide bases, as measured by any well-known
algorithm of sequence identity, such as FASTA, BLAST or Gap, as
discussed above.
[0085] Alternatively, substantial homology or similarity exists
when a nucleic acid or fragment thereof hybridizes to another
nucleic acid, to a strand of another nucleic acid, or to the
complementary strand thereof, under stringent hybridization
conditions. "Stringent hybridization conditions" and "stringent
wash conditions" in the context of nucleic acid hybridization
experiments depend upon a number of different physical parameters.
Nucleic acid hybridization will be affected by such conditions as
salt concentration, temperature, solvents, the base composition of
the hybridizing species, length of the complementary regions, and
the number of nucleotide base mismatches between the hybridizing
nucleic acids, as will be readily appreciated by those skilled in
the art. One having ordinary skill in the art knows how to vary
these parameters to achieve a particular stringency of
hybridization.
[0086] In general, "stringent hybridization" is performed at about
25.degree. C. below the thermal melting point (T.sub.m) for the
specific DNA hybrid under a particular set of conditions.
"Stringent washing" is performed at temperatures about 5.degree. C.
lower than the T.sub.m for the specific DNA hybrid under a
particular set of conditions. The T.sub.m is the temperature at
which 50% of the target sequence hybridizes to a perfectly matched
probe. See Sambrook et al., supra, page 9.51, hereby incorporated
by reference. For purposes herein, "high stringency conditions" are
defined for solution phase hybridization as aqueous hybridization
(i.e., free of formamide) in 6.times.SSC (where 20.times.SSC
contains 3.0 M NaCl and 0.3 M sodium citrate), 1% SDS at 65.degree.
C. for 8-12 hours, followed by two washes in 0.2.times.SSC, 0.1%
SDS at 65.degree. C. for 20 minutes. It will be appreciated by the
skilled artisan that hybridization at 65.degree. C. will occur at
different rates depending on a number of factors including the
length and percent identity of the sequences which are
hybridizing.
[0087] The term "mutated" when applied to nucleic acid sequences
means that nucleotides in a nucleic acid sequence may be inserted,
deleted or changed compared to a reference nucleic acid sequence. A
single alteration may be made at a locus (a point mutation) or
multiple nucleotides may be inserted, deleted or changed at a
single locus. In addition, one or more alterations may be made at
any number of loci within a nucleic acid sequence. A nucleic acid
sequence may be mutated by any method known in the art including
but not limited to mutagenesis techniques such as "error-prone PCR"
(a process for performing PCR under conditions where the copying
fidelity of the DNA polymerase is low, such that a high rate of
point mutations is obtained along the entire length of the PCR
product. See, e.g., Leung, D. W., et al., Technique, 1, pp. 11-15
(1989) and Caldwell, R. C. & Joyce G. F., PCR Methods Applic.,
2, pp. 28-33 (1992)); and "oligonucleotide-directed mutagenesis" (a
process which enables the generation of site-specific mutations in
any cloned DNA segment of interest. See, e.g., Reidhaar-Olson, J.
F. & Sauer, R. T., et al., Science, 241, pp. 53-57 (1988)).
[0088] The term "vector" as used herein is intended to refer to a
nucleic acid molecule capable of transporting another nucleic acid
to which it has been linked. One type of vector is a "plasmid",
which refers to a circular double stranded DNA loop into which
additional DNA segments may be ligated. Other vectors include
cosmids, bacterial artificial chromosomes (BAC) and yeast
artificial chromosomes (YAC). Another type of vector is a viral
vector, wherein additional DNA segments may be ligated into the
viral genome (discussed in more detail below). Certain vectors are
capable of autonomous replication in a host cell into which they
are introduced (e.g., vectors having an origin of replication which
functions in the host cell). Other vectors can be integrated into
the genome of a host cell upon introduction into the host cell, and
are thereby replicated along with the host genome. Moreover,
certain preferred vectors are capable of directing the expression
of genes to which they are operatively linked. Such vectors are
referred to herein as "recombinant expression vectors" (or simply,
"expression vectors").
[0089] "Operatively linked" expression control sequences refers to
a linkage in which the expression control sequence is contiguous
with the gene of interest to control the gene of interest, as well
as expression control sequences that act in trans or at a distance
to control the gene of interest.
[0090] The term "expression control sequence" as used herein refers
to polynucleotide sequences which are necessary to affect the
expression of coding sequences to which they are operatively
linked. Expression control sequences are sequences which control
the transcription, post-transcriptional events and translation of
nucleic acid sequences. Expression control sequences include
appropriate transcription initiation, termination, promoter and
enhancer sequences; efficient RNA processing signals such as
splicing and polyadenylation signals; sequences that stabilize
cytoplasmic mRNA; sequences that enhance translation efficiency
(e.g., ribosome binding sites); sequences that enhance protein
stability; and when desired, sequences that enhance protein
secretion. The nature of such control sequences differs depending
upon the host organism; in prokaryotes, such control sequences
generally include promoter, ribosomal binding site, and
transcription termination sequence. The term "control sequences" is
intended to include, at a minimum, all components whose presence is
essential for expression, and can also include additional
components whose presence is advantageous, for example, leader
sequences and fusion partner sequences.
[0091] The term "recombinant host cell" (or simply "host cell"), as
used herein, is intended to refer to a cell into which a nucleic
acid such as a recombinant vector has been introduced. It should be
understood that such terms are intended to refer not only to the
particular subject cell but to the progeny of such a cell. Because
certain modifications may occur in succeeding generations due to
either mutation or environmental influences, such progeny may not,
in fact, be identical to the parent cell, but are still included
within the scope of the term "host cell" as used herein. A
recombinant host cell may be an isolated cell or cell line grown in
culture or may be a cell which resides in a living tissue or
organism.
[0092] The term "peptide" as used herein refers to a short
polypeptide, e.g., one that is typically less than about 50 amino
acids long and more typically less than about 30 amino acids long.
The term as used herein encompasses analogs and mimetics that mimic
structural and thus biological function.
[0093] The term "polypeptide" as used herein encompasses both
naturally-occurring and non-naturally-occurring proteins, and
fragments, mutants, derivatives and analogs thereof. A polypeptide
may be monomeric or polymeric. Further, a polypeptide may comprise
a number of different domains each of which has one or more
distinct activities.
[0094] The term "isolated protein" or "isolated polypeptide" is a
protein or polypeptide that by virtue of its origin or source of
derivation (1) is not associated with naturally associated
components that accompany it in its native state, (2) when it
exists in a purity not found in nature, where purity can be
adjudged with respect to the presence of other cellular material
(e.g., is free of other proteins from the same species) (3) is
expressed by a cell from a different species, or (4) does not occur
in nature (e.g., it is a fragment of a polypeptide found in nature
or it includes amino acid analogs or derivatives not found in
nature or linkages other than standard peptide bonds). Thus, a
polypeptide that is chemically synthesized or synthesized in a
cellular system different from the cell from which it naturally
originates will be "isolated" from its naturally associated
components. A polypeptide or protein may also be rendered
substantially free of naturally associated components by isolation,
using protein purification techniques well-known in the art. As
thus defined, "isolated" does not necessarily require that the
protein, polypeptide, peptide or oligopeptide so described has been
physically removed from its native environment.
[0095] The term "polypeptide fragment" as used herein refers to a
polypeptide that has an amino-terminal and/or carboxy-terminal
deletion compared to a full-length polypeptide. In a preferred
embodiment, the polypeptide fragment is a contiguous sequence in
which the amino acid sequence of the fragment is identical to the
corresponding positions in the naturally-occurring sequence.
Fragments typically are at least 5, 6, 7, 8, 9 or 10 amino acids
long, preferably at least 12, 14, 16 or 18 amino acids long, more
preferably at least 20 amino acids long, more preferably at least
25, 30, 35, 40 or 45, amino acids, even more preferably at least 50
or 60 amino acids long, and even more preferably at least 70 amino
acids long.
[0096] A "modified derivative" refers to polypeptides or fragments
thereof that are substantially homologous in primary structural
sequence but which include, e.g., in vivo or in vitro chemical and
biochemical modifications or which incorporate amino acids that are
not found in the native polypeptide. Such modifications include,
for example, acetylation, carboxylation, phosphorylation,
glycosylation, ubiquitination, labeling, e.g., with radionuclides,
and various enzymatic modifications, as will be readily appreciated
by those well skilled in the art. A variety of methods for labeling
polypeptides and of substituents or labels useful for such purposes
are well-known in the art, and include radioactive isotopes such as
.sup.125I, .sup.32P, .sup.35S, and .sup.3H, ligands which bind to
labeled antiligands (e.g., antibodies), fluorophores,
chemiluminescent agents, enzymes, and antiligands which can serve
as specific binding pair members for a labeled ligand. The choice
of label depends on the sensitivity required, ease of conjugation
with the primer, stability requirements, and available
instrumentation. Methods for labeling polypeptides are well-known
in the art. See Ausubel et al., 1992, hereby incorporated by
reference.
[0097] A "polypeptide mutant" or "mutein" refers to a polypeptide
whose sequence contains an insertion, duplication, deletion,
rearrangement or substitution of one or more amino acids compared
to the amino acid sequence of a native or wild type protein. A
mutein may have one or more amino acid point substitutions, in
which a single amino acid at a position has been changed to another
amino acid, one or more insertions and/or deletions, in which one
or more amino acids are inserted or deleted, respectively, in the
sequence of the naturally-occurring protein, and/or truncations of
the amino acid sequence at either or both the amino or carboxy
termini. A mutein may have the same but preferably has a different
biological activity compared to the naturally-occurring protein.
For instance, a mutein may have an increased or decreased neuron or
NgR binding activity. In a preferred embodiment of the present
invention, a MAG derivative that is a mutein (e.g., in MAG Ig-like
domain 5) has decreased neuronal growth inhibitory activity
compared to endogenous or soluble wild-type MAG.
[0098] A mutein has at least 70% overall sequence homology to its
wild-type counterpart. Even more preferred are muteins having 80%,
85% or 90% overall sequence homology to the wild-type protein. In
an even more preferred embodiment, a mutein exhibits 95% sequence
identity, even more preferably 97%, even more preferably 98% and
even more preferably 99% overall sequence identity. Sequence
homology may be measured by any common sequence analysis algorithm,
such as Gap or Bestfit.
[0099] Preferred amino acid substitutions are those which: (1)
reduce susceptibility to proteolysis, (2) reduce susceptibility to
oxidation, (3) alter binding affinity for forming protein
complexes, (4) alter binding affinity or enzymatic activity, and
(5) confer or modify other physicochemical or functional properties
of such analogs.
[0100] As used herein, the twenty conventional amino acids and
their abbreviations follow conventional usage. See Immunology--A
Synthesis (2.sup.nd Edition, E. S. Golub and D. R. Gren, Eds.,
Sinauer Associates, Sunderland, Mass. (1991)), which is
incorporated herein by reference. Stereoisomers (e.g., D-amino
acids) of the twenty conventional amino acids, unnatural amino
acids such as .alpha.-, .alpha.-disubstituted amino acids, N-alkyl
amino acids, and other unconventional amino acids may also be
suitable components for polypeptides of the present invention.
Examples of unconventional amino acids include: 4-hydroxyproline,
.gamma.-carboxyglutamate, .epsilon.-N,N,N-trimethyllysine,
.epsilon.-N-acetyllysine, O-phosphoserine, N-acetylserine,
N-formylmethionine, 3-methylhistidine, 5-hydroxylysine,
s-N-methylarginine, and other similar amino acids and imino acids
(e.g., 4-hydroxyproline). In the polypeptide notation used herein,
the left-hand direction is the amino terminal direction and the
right hand direction is the carboxy-terminal direction, in
accordance with standard usage and convention.
[0101] A protein has "homology" or is "homologous" to a second
protein if the nucleic acid sequence that encodes the protein has a
similar sequence to the nucleic acid sequence that encodes the
second protein. Alternatively, a protein has homology to a second
protein if the two proteins have "similar" amino acid sequences.
(Thus, the term "homologous proteins" is defined to mean that the
two proteins have similar amino acid sequences). In a preferred
embodiment, a homologous protein is one that exhibits 60% sequence
homology to the wild type protein, more preferred is 70% sequence
homology. Even more preferred are homologous proteins that exhibit
80%, 85% or 90% sequence homology to the wild type protein. In a
yet more preferred embodiment, a homologous protein exhibits 95%,
97%, 98% or 99% sequence identity. As used herein, homology between
two regions of amino acid sequence (especially with respect to
predicted structural similarities) is interpreted as implying
similarity in function.
[0102] When "homologous" is used in reference to proteins or
peptides, it is recognized that residue positions that are not
identical often differ by conservative amino acid substitutions. A
"conservative amino acid substitution" is one in which an amino
acid residue is substituted by another amino acid residue having a
side chain (R group) with similar chemical properties (e.g., charge
or hydrophobicity). In general, a conservative amino acid
substitution will not substantially change the functional
properties of a protein. In cases where two or more amino acid
sequences differ from each other by conservative substitutions, the
percent sequence identity or degree of homology may be adjusted
upwards to correct for the conservative nature of the substitution.
Means for making this adjustment are well known to those of skill
in the art (see, e.g., Pearson et al., 1994, herein incorporated by
reference).
[0103] The following six groups each contain amino acids that are
conservative substitutions for one another: 1) Serine (S),
Threonine (T); 2) Aspartic Acid (D), Glutamic Acid (E); 3)
Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5)
Isoleucine (I), Leucine (L), Methionine (M), Alanine (A), Valine
(V), and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W).
[0104] Sequence homology for polypeptides, which is also referred
to as percent sequence identity, is typically measured using
sequence analysis software. See, e.g., the Sequence Analysis
Software Package of the Genetics Computer Group (GCG), University
of Wisconsin Biotechnology Center, 910 University Avenue, Madison,
Wis. 53705. Protein analysis software matches similar sequences
using measure of homology assigned to various substitutions,
deletions and other modifications, including conservative amino
acid substitutions. For instance, GCG contains programs such as
"Gap" and "Bestfit" which can be used with default parameters to
determine sequence homology or sequence identity between closely
related polypeptides, such as homologous polypeptides from
different species of organisms or between a wild type protein and a
mutein thereof. See, e.g., GCG Version 6.1.
[0105] A preferred algorithm when comparing a inhibitory molecule
sequence to a database containing a large number of sequences from
different organisms is the computer program BLAST (Altschul, S. F.
et al. (1990) J. Mol. Biol. 215:403-410; Gish and States (1993)
Nature Genet. 3:266-272; Madden, T. L. et al. (1996) Meth. Enzymol.
266:131-141; Altschul, S. F. et al. (1997) Nucleic Acids Res.
25:3389-3402; Zhang, J. and Madden, T. L. (1997) Genome Res.
7:649-656), especially blastp or tblastn (Altschul et al., 1997).
Preferred parameters for BLASTp are: Expectation value: 10
(default); Filter: seg (default); Cost to open a gap: 11 (default);
Cost to extend a gap: 1 (default); Max. alignments: 100 (default);
Word size: 11 (default); No. of descriptions: 100 (default);
Penalty Matrix: BLOWSUM62.
[0106] The length of polypeptide sequences compared for homology
will generally be at least about 16 amino acid residues, usually at
least about 20 residues, more usually at least about 24 residues,
typically at least about 28 residues, and preferably more than
about 35 residues. When searching a database containing sequences
from a large number of different organisms, it is preferable to
compare amino acid sequences. Database searching using amino acid
sequences can be measured by algorithms other than blastp known in
the art. For instance, polypeptide sequences can be compared using
FASTA, a program in GCG Version 6.1. FASTA provides alignments and
percent sequence identity of the regions of the best overlap
between the query and search sequences (Pearson, 1990, herein
incorporated by reference). For example, percent sequence identity
between amino acid sequences can be determined using FASTA with its
default parameters (a word size of 2 and the PAM250 scoring
matrix), as provided in GCG Version 6.1, herein incorporated by
reference.
[0107] The term "fusion protein" refers to a polypeptide comprising
a polypeptide or fragment coupled to heterologous amino acid
sequences. Fusion proteins are useful because they can be
constructed to contain two or more desired functional elements from
two or more different proteins. A fusion protein comprises at least
10 contiguous amino acids from a polypeptide of interest, more
preferably at least 20 or 30 amino acids, even more preferably at
least 40, 50 or 60 amino acids, yet more preferably at least 75,
100 or 125 amino acids. Fusion proteins can be produced
recombinantly by constructing a nucleic acid sequence which encodes
the polypeptide or a fragment thereof in-frame with a nucleic acid
sequence encoding a different protein or peptide and then
expressing the fusion protein. Alternatively, a fusion protein can
be produced chemically by crosslinking the polypeptide or a
fragment thereof to another protein.
[0108] The term "region" as used herein refers to a physically
contiguous portion of the primary structure of a biomolecule. In
the case of proteins, a region is defined by a contiguous portion
of the amino acid sequence of that protein.
[0109] The term "domain" as used herein refers to a structure of a
biomolecule that contributes to a known or suspected function of
the biomolecule. Domains may be co-extensive with regions or
portions thereof; domains may also include distinct, non-contiguous
regions of a biomolecule. Examples of protein domains include, but
are not limited to, an Ig domain, an extracellular domain, a
transmembrane domain, and a cytoplasmic domain.
[0110] As used herein, the term "molecule" means any compound,
including, but not limited to, a small molecule, peptide, protein,
sugar, nucleotide, nucleic acid, lipid, etc., and such a compound
can be natural or synthetic.
[0111] Unless otherwise defined, all technical and scientific terms
used herein have the same meaning as commonly understood by one of
ordinary skill in the art to which this invention pertains.
Exemplary methods and materials are described below, although
methods and materials similar or equivalent to those described
herein can also be used in the practice of the present invention
and will be apparent to those of skill in the art. All publications
and other references mentioned herein are incorporated by reference
in their entirety. In case of conflict, the present specification,
including definitions, will control. The materials, methods, and
examples are illustrative only and not intended to be limiting.
[0112] Throughout this specification and claims, the word
"comprise" or variations such as "comprises" or "comprising", will
be understood to imply the inclusion of a stated integer or group
of integers but not the exclusion of any other integer or group of
integers.
Methods for Producing Host Cells Having Man.sub.5GlcNAc.sub.2
Modified Oligosaccharides for the Generation of Human-Like
N-Glycans
[0113] The invention provides a method for producing a glycoprotein
having human-like glycosylation in a non-human eukaryotic host
cell. As described in more detail below, a eukaryotic host cell
that does not naturally express, or which is engineered not to
express, one or more enzymes involved in production of high mannose
structures is selected as a starting host cell. Such a selected
host cell is engineered to express one or more enzymes or other
factors required to produce human-like glycoproteins. A desired
host strain can be engineered one enzyme or more than one enzyme at
a time. In addition, a nucleic acid molecule encoding one or more
enzymes or activities may be used to engineer a host strain of the
invention. Preferably, a library of nucleic acid molecules encoding
potentially useful enzymes (e.g., chimeric enzymes comprising a
catalytically active enzyme fragment ligated in-frame to a
heterologous subcellular targeting sequence) is created (e.g., by
ligation of sub-libraries comprising enzymatic fragments and
subcellular targeting sequences), and a strain having one or more
enzymes with optimal activities or producing the most "human-like"
glycoproteins may be selected by transforming target host cells
with one or more members of the library.
[0114] In particular, the methods described herein enable one to
obtain, in vivo, Man.sub.5GlcNAc.sub.2 structures in high yield, at
least transiently, for the purpose of further modifying it to yield
complex N-glycans. A successful scheme to obtain suitable
Man.sub.5GlcNAc.sub.2 structures in appropriate yields in a host
cell, such as a lower eukaryotic organism, generally involves two
parallel approaches: (1) reducing high mannose structures made by
endogenous mannosyltransferase activities, if any, and (2) removing
1,2-.alpha.-mannose by mannosidases to yield high levels of
suitable Man.sub.5GlcNAc.sub.2 structures which may be further
reacted inside the host cell to form complex, human-like
glycoforms.
[0115] Accordingly, a first step involves the selection or creation
of a eukaryotic host cell, e.g., a lower eukaryote, capable of
producing a specific precursor structure of Man.sub.5GlcNAc.sub.2
that is able to accept in vivo GlcNAc by the action of a GlcNAc
transferase I ("GnTI"). In one embodiment, the method involves
making or using a non-human eukaryotic host cell depleted in a 1,6
mannosyltransferase activity with respect to the N-glycan on a
glycoprotein. Preferably, the host cell is depleted in an
initiating 1,6 mannosyltransferase activity (see below). Such a
host cell will lack one or more enzymes involved in the production
of high mannose structures which are undesirable for producing
human-like glycoproteins.
[0116] One or more enzyme activities are then introduced into such
a host cell to produce N-glycans within the host cell characterized
by having at least 30 mol % of the
Man.sub.5GlcNAc.sub.2("Man.sub.5") carbohydrate structures.
Man.sub.5GlcNAc.sub.2 structures are necessary for complex N-glycan
formation: Man.sub.5GlcNAc.sub.2 must be formed in vivo in a high
yield (e.g., in excess of 30%), at least transiently, as subsequent
mammalian- and human-like glycosylation reactions require
Man.sub.5GlcNAc.sub.2 or a derivative thereof.
[0117] This step also requires the formation of a particular
isomeric structure of Man.sub.5GlcNAc.sub.2 within the cell at a
high yield. While Man.sub.5GlcNAc.sub.2 structures are necessary
for complex N-glycan formation, their presence is by no means
sufficient. That is because Man.sub.5GlcNAc.sub.2 may occur in
different isomeric forms, which may or may not serve as a substrate
for GlcNAc transferase I. As most glycosylation reactions are not
complete, a particular glycosylated protein generally contains a
range of different carbohydrate structures (i.e. glycoforms) on its
surface. Thus, the mere presence of trace amounts (i.e., less than
5%) of a particular structure like Man.sub.5GlcNAc.sub.2 is of
little practical relevance for producing mammalian- or human-like
glycoproteins. It is the formation of a GlcNAc transferase
I-accepting Man.sub.5GlcNAc.sub.2 intermediate (FIG. 1B) in high
yield (i.e., above 30%), which is required. The formation of this
intermediate is necessary to enable subsequent in vivo synthesis of
complex N-glycans on glycosylated proteins of interest (target
proteins).
[0118] Accordingly, some or all of the Man.sub.5GlcNAc.sub.2
produced by the selected host cell must be a productive substrate
for enzyme activities along a mammalian glycosylation pathway,
e.g., can serve as a substrate for a GlcNAc transferase I activity
in vivo, thereby forming the human-like N-glycan intermediate
GlcNAcMan.sub.5GlcNAc.sub.2 in the host cell. In a preferred
embodiment, at least 10%, more preferably at least 30% and most
preferably 50% or more of the Man.sub.5GlcNAc.sub.2 intermediate
produced in the host cell of the invention is a productive
substrate for GnTI in vivo. It is understood that if, for example,
GlcNAcMan.sub.5GlcNAc.sub.2 is produced at 10% and
Man.sub.5GlcNAc.sub.2 is produced at 25% on a target protein, that
the total amount of transiently produced Man.sub.5GlcNAc.sub.2 is
35% because GlcNAcMan.sub.5GlcNAc.sub.2 is a product of
Man.sub.5GlcNAc.sub.2.
[0119] One of ordinary skill in the art can select host cells from
nature, e.g., existing fungi or other lower eukaryotes that produce
significant levels of Man.sub.5GlcNAc.sub.2 in vivo. As yet,
however, no lower eukaryote has been shown to provide such
structures in vivo in excess of 1.8% of the total N-glycans (see
e.g. Maras et al., 1997). Alternatively, such host cells may be
genetically engineered to produce the Man.sub.5GlcNAc.sub.2
structure in vivo. Methods such as those described in U.S. Pat. No.
5,595,900 may be used to identify the absence or presence of
particular glycosyltransferases, mannosidases and sugar nucleotide
transporters in a target host cell or organism of interest.
Inactivation of Undesirable Host Cell Glycosylation Enzymes
[0120] The methods of the invention are directed to making host
cells which produce glycoproteins having altered, and preferably
human-like, N-glycan structures. In a preferred embodiment, the
methods are directed to making host cells in which oligosaccharide
precursors are enriched in Man.sub.5GlcNAc.sub.2. Preferably, a
eukaryotic host cell is used that does not express one or more
enzymes involved in the production of high mannose structures. Such
a host cell may be found in nature or may be engineered, e.g.,
starting with or derived from one of many such mutants already
described in yeasts. Thus, depending on the selected host cell, one
or a number of genes that encode enzymes known to be characteristic
of non-human glycosylation reactions will have to be deleted. Such
genes and their corresponding proteins have been extensively
characterized in a number of lower eukaryotes (e.g., S. cerevisiae,
T. reesei, A. nidulans etc.), thereby providing a list of known
glycosyltransferases in lower eukaryotes, their activities and
their respective genetic sequence. These genes are likely to be
selected from the group of mannosyltransferases e.g. 1,3
mannosyltransferases (e.g. MNN1 in S. cerevisiae) (Graham, 1991),
1,2 mannosyltransferases (e.g. KTR/KRE family from S. cerevisiae),
1,6 mannosyltransferases (OCH1 from S. cerevisiae),
mannosylphosphate transferases and their regulators (MNN4 and MNN6
from S. cerevisiae) and additional enzymes that are involved in
aberrant, i.e. non human, glycosylation reactions. Many of these
genes have in fact been deleted individually giving rise to viable
phenotypes with altered glycosylation profiles. Examples are shown
in Table 1.
[0121] Preferred lower eukaryotic host cells of the invention, as
described herein to exemplify the required manipulation steps, are
hypermannosylation-minus (och1) mutants of Pichia pastoris or K.
lactis. Like other lower eukaryotes, P. pastoris processes
Man.sub.9GlcNAc.sub.2 structures in the ER with an
.alpha.-1,2-mannosidase to yield Man.sub.8GlcNAc.sub.2 (FIG. 1A).
Through the action of several mannosyltransferases, this structure
is then converted to hypermannosylated structures
(Man.sub.>9GlcNAc.sub.2), also known as mannans. In addition, it
has been found that P. pastoris is able to add non-terminal
phosphate groups, through the action of mannosylphosphate
transferases, to the carbohydrate structure. This differs from the
reactions performed in mammalian cells, which involve the removal
rather than addition of mannose sugars. It is of particular
importance to eliminate the ability of the eukaryotic host cell,
e.g., fungus, to hypermannosylate an existing Man.sub.8GlcNAc.sub.2
structure. This can be achieved by either selecting for a host cell
that does not hypermannosylate or by genetically engineering such a
cell.
[0122] Genes that are involved in the hypermannosylation process
have been identified, e.g., in Pichia pastoris, and by creating
mutations in these genes, one can reduce the production of
"undesirable" glycoforms. Such genes can be identified by homology
to existing mannosyltransferases or their regulators (e.g., OCH1,
MNN4, MNN6, MNN1) found in other lower eukaryotes such as C.
albicans, Pichia angusta or S. cerevisiae or by mutagenizing the
host strain and selecting for a glycosylation phenotype with
reduced mannosylation. Based on homologies amongst known
mannosyltransferases and mannosylphosphate transferases, one may
either design PCR primers (SEQ ID NOS 7, 8, 47, & 4 left to
right, respectively, in order of appearance)(examples of which are
shown in Table 2), or use genes or gene fragments encoding such
enzymes as probes to identify homologs in DNA libraries of the
target or a related organism. Alternatively, one may identify a
functional homolog having mannosyltransferase activity by its
ability to complement particular glycosylation phenotypes in
related organisms.
TABLE-US-00002 TABLE 2 PCR Primers Target Gene(s) PCR in PCR primer
A primer B P.pastoris Homologs ATGGCGAAGGC TTAGTCCTTCC 1,6- OCH1
AGATGGCAGT AACTTCCTTC mannosyl- S.cerevisiae, (SEQ ID (SEQ ID
transferase Pichia NO: 1) NO: 2) albicans TAYTGGMGNGTNG GCRTCNCCCC
1,2 KTR/KRE ARCYNGAYATHAA ANCKYTCRTA mannosyl- family, (SEQ ID (SEQ
ID trans- S.cerevisiae NO: 3) NO: 4) ferases Legend: M = A or C, R
= A or G, W = A or T, S = C or G, Y = C or T, K = G or T, V = A or
C or G, H = A or C or T, D = A or G or T, B = C or G or T, N = G or
A or T or C.
[0123] To obtain the gene or genes encoding 1,6-mannosyltransferase
activity in P. pastoris, for example, one would carry out the
following steps: OCH1 mutants of S. cerevisiae are temperature
sensitive and are slow growers at elevated temperatures. One can
thus identify functional homologs of OCH1 in P. pastoris by
complementing an OCH1 mutant of S. cerevisiae with a P. pastoris
DNA or cDNA library. Mutants of S. cerevisiae are available, e.g.,
from Stanford University and are commercially available from
ResGen, an Invitrogen Corp. (Carlsbad, Calif.). Mutants that
display a normal growth phenotype at elevated temperature, after
having been transformed with a P. pastoris DNA library, are likely
to carry an OCH1 homolog of P. pastoris. Such a library can be
created by partially digesting chromosomal DNA of P. pastoris with
a suitable restriction enzyme and, after inactivating the
restriction enzyme, ligating the digested DNA into a suitable
vector, which has been digested with a compatible restriction
enzyme.
[0124] Suitable vectors include, e.g., pRS314, a low copy
(CEN6/ARS4) plasmid based on pBluescript containing the Trpl marker
(Sikorski, R. S., and Hieter, P., 1989, Genetics 122, pg 19-27) and
pFL44S, a high copy (2.mu.) plasmid based on a modified pUC19
containing the URA3 marker (Bonneaud, N., et al., 1991, Yeast 7,
pg. 609-615). Such vectors are commonly used by academic
researchers and similar vectors are available from a number of
different vendors (e.g., Invitrogen (Carlsbad, Calif.); Pharmacia
(Piscataway, N.J.); New England Biolabs (Beverly, Mass.)). Further
examples include pYES/GS, 2.mu. origin of replication based yeast
expression plasmid from Invitrogen, or Yep24 cloning vehicle from
New England Biolabs.
[0125] After ligation of the chromosomal DNA and the vector, one
may transform the DNA library into a strain of S. cerevisiae with a
specific mutation and select for the correction of the
corresponding phenotype. After sub-cloning and sequencing the DNA
fragment that is able to restore the wild-type phenotype, one may
use this fragment to eliminate the activity of the gene product
encoded by OCH1 in P. pastoris using in vivo mutagenesis and/or
recombination techniques well-known to those skilled in the
art.
[0126] Alternatively, if the entire genomic sequence of a
particular host cell, e.g., fungus, of interest is known, one may
identify such genes simply by searching publicly available DNA
databases, which are available from several sources, such as NCBI,
Swissprot. For example, by searching a given genomic sequence or
database with sequences from a known 1,6 mannosyltransferase gene
(e.g., OCH1 from S. cerevisiae), one can identify genes of high
homology in such a host cell genome which may (but do not
necessarily) encode proteins that have 1,6-mannosyltransferase
activity. Nucleic acid sequence homology alone is not enough to
prove, however, that one has identified and isolated a homolog
encoding an enzyme having the same activity. To date, for example,
no data exist to show that an OCH1 deletion in P. pastoris
eliminates the crucial initiating 1,6-mannosyltransferase activity.
(Martinet et al. Biotech. Letters 20(12) (December 1998):
1171-1177; Contreras et al. WO 02/00856 A2). Thus, no data prove
that the P. pastoris OCH1 gene homolog actually encodes that
function. That demonstration is provided for the first time
herein.
[0127] Homologs to several S. cerevisiae mannosyltransferases have
been identified in P. pastoris using these approaches. Homologous
genes often have similar functions to genes involved in the
mannosylation of proteins in S. cerevisiae and thus their deletion
may be used to manipulate the glycosylation pattern in P. pastoris
or, by analogy, in any other host cell, e.g., fungus, plant, insect
or animal cells, with similar glycosylation pathways.
[0128] The creation of gene knock-outs, once a given target gene
sequence has been determined, is a well-established technique in
the art and can be carried out by one of ordinary skill in the art
(see, e.g., R. Rothstein, (1991) Methods in Enzymology, vol. 194,
p. 281). The choice of a host organism may be influenced by the
availability of good transformation and gene disruption
techniques.
[0129] If several mannosyltransferases are to be knocked out, the
method developed by Alani and Kleckner, (Genetics 116:541-545
(1987)), for example, enables the repeated use of a selectable
marker, e.g., the URA3 marker in yeast, to sequentially eliminate
all undesirable endogenous mannosyltransferase activity. This
technique has been refined by others but basically involves the use
of two repeated DNA sequences, flanking a counter selectable
marker. For example: URA3 may be used as a marker to ensure the
selection of a transformants that have integrated a construct. By
flanking the URA3 marker with direct repeats one may first select
for transformants that have integrated the construct and have thus
disrupted the target gene. After isolation of the transformants,
and their characterization, one may counter select in a second
round for those that are resistant to 5-fluoroorotic acid (5-FOA).
Colonies that are able to survive on plates containing 5-FOA have
lost the URA3 marker again through a crossover event involving the
repeats mentioned earlier. This approach thus allows for the
repeated use of the same marker and facilitates the disruption of
multiple genes without requiring additional markers. Similar
techniques for sequential elimination of genes adapted for use in
another eukaryotic host cells with other selectable and
counter-selectable markers may also be used.
[0130] Eliminating specific mannosyltransferases, such as 1,6
mannosyltransferase (OCH1) or mannosylphosphate transferases (MNN6,
or genes complementing lbd mutants) or regulators (MNN4) in P.
pastoris enables one to create engineered strains of this organism
which synthesize primarily Man.sub.8GlcNAc.sub.2 and which can be
used to further modify the glycosylation pattern to resemble more
complex glycoform structures, e.g., those produced in mammalian,
e.g., human cells. A preferred embodiment of this method utilizes
DNA sequences encoding biochemical glycosylation activities to
eliminate similar or identical biochemical functions in P. pastoris
to modify the glycosylation structure of glycoproteins produced in
the genetically altered P. pastoris strain.
[0131] Methods used to engineer the glycosylation pathway in yeasts
as exemplified herein can be used in filamentous fungi to produce a
preferred substrate for subsequent modification. Strategies for
modifying glycosylation pathways in A. niger and other filamentous
fungi, for example, can be developed using protocols analogous to
those described herein for engineering strains to produce
human-like glycoproteins in yeast. Undesired gene activities
involved in 1,2 mannosyltransferase activity, e.g., KTR/KRE
homologs, are modified or eliminated. A filamentous fungus, such as
Aspergillus, is a preferred host because it lacks the 1,6
mannosyltransferase activity and as such, one would not expect a
hypermannosylating gene activity, e.g. OCH1, in this host. By
contrast, other desired activities (e.g., .alpha.-1,2-mannosidase,
UDP-GlcNAc transporter, glycosyltransferase (GnT),
galactosyltransferase (GalT) and sialyltransferase (ST)) involved
in glycosylation are introduced into the host using the targeting
methods of the invention.
Engineering or Selecting Hosts Having Diminished Initiating
.alpha.-1,6 Mannosyltransferase Activity
[0132] In a preferred embodiment, the method of the invention
involves making or using a host cell which is diminished or
depleted in the activity of an initiating
.alpha.-1,6-mannosyltransferase, i.e., an initiation specific
enzyme that initiates outer chain mannosylation on the .alpha.-1,3
arm of the Man.sub.3GlcNAc.sub.2 core structure. In S. cerevisiae,
this enzyme is encoded by the OCH1 gene. Disruption of the OCH1
gene in S. cerevisiae results in a phenotype in which N-linked
sugars completely lack the poly-mannose outer chain. Previous
approaches for obtaining mammalian-type glycosylation in fungal
strains have required inactivation of OCH1 (see, e.g., Chiba,
1998). Disruption of the initiating .alpha.-1,6-mannosyltransferase
activity in a host cell of the invention may be optional, however
(depending on the selected host cell), as the Och1p enzyme requires
an intact Man.sub.8GlcNAc.sub.2 for efficient mannose outer chain
initiation. Thus, host cells selected or produced according to this
invention which accumulate oligosaccharides having seven or fewer
mannose residues may produce hypoglycosylated N-glycans that will
likely be poor substrates for Och1p (see, e.g., Nakayama,
1997).
[0133] The OCH1 gene was cloned from P. pastoris (Example 1) and K.
lactis (Example 16), as described. The nucleic acid and amino acid
sequences of the OCH1 gene from K. lactis are set forth in SEQ ID
NOS: 41 and 42. Using gene-specific primers, a construct was made
from each clone to delete the OCH1 gene from the genome of P.
pastoris and K. lactis (Examples 1 and 16, respectively). Host
cells depleted in initiating .alpha.-1,6-mannosyltransferase
activity and engineered to produce N-glycans having a
Man.sub.5GlcNAc.sub.2 carbohydrate structure were thereby obtained
(see, e.g., FIGS. 5 and 6; Examples 11 and 16).
[0134] Thus, in another embodiment, the invention provides an
isolated nucleic acid molecule having a nucleic acid sequence
comprising or consisting of at least forty-five, preferably at
least 50, more preferably at least 60 and most preferably 75 or
more nucleotide residues of the K. lactis OCH1 gene (SEQ ID NO:
41), and homologs, variants and derivatives thereof. The invention
also provides nucleic acid molecules that hybridize under stringent
conditions to the above-described nucleic acid molecules.
Similarly, isolated polypeptides (including muteins, allelic
variants, fragments, derivatives, and analogs) encoded by the
nucleic acid molecules of the invention are provided. Also provided
are vectors, including expression vectors, which comprise the above
nucleic acid molecules of the invention, as described further
herein. Similarly, host cells transformed with the nucleic acid
molecules or vectors of the invention are provided.
Host Cells of the Invention
[0135] A preferred host cell of the invention is a lower eukaryotic
cell, e.g., yeast, a unicellular and multicellular or filamentous
fungus. However, a wide variety of host cells are envisioned as
being useful in the methods of the invention. Plant cells or insect
cells, for instance, may be engineered to express a human-like
glycoprotein according to the invention (Examples 17 and 18).
Likewise, a variety of non-human, mammalian host cells may be
altered to express more human-like or otherwise altered
glycoproteins using the methods of the invention. As one of skill
in the art will appreciate, any eukaryotic host cell (including a
human cell) may be used in conjunction with a library of the
invention to express one or more chimeric proteins which is
targeted to a subcellular location, e.g., organelle, in the host
cell where the activity of the protein is modified, and preferably
is enhanced. Such a protein is preferably--but need not necessarily
be--an enzyme involved in protein glycosylation, as exemplified
herein. It is envisioned that any protein coding sequence may be
targeted and selected for modified activity in a eukaryotic host
cell using the methods described herein.
[0136] Lower eukaryotes that are able to produce glycoproteins
having the attached N-glycan Man.sub.5GlcNAc.sub.2 are particularly
useful because (a) lacking a high degree of mannosylation (e.g.
greater than 8 mannoses per N-glycan, or especially 30-40
mannoses), they show reduced immunogenicity in humans; and (b) the
N-glycan is a substrate for further glycosylation reactions to form
an even more human-like glycoform, e.g., by the action of GlcNAc
transferase I (FIG. 1B; .beta.1,2 GnTI) to form
GlcNAcMan.sub.5GlcNAc.sub.2. A yield is obtained of greater than 30
mole %, more preferably a yield of 50-100 mole %, glycoproteins
with N-glycans having a Man.sub.5GlcNAc.sub.2 structure. In a
preferred embodiment, more than 50% of the Man.sub.5GlcNAc.sub.2
structure is shown to be a substrate for a GnTI activity and can
serve as such a substrate in vivo.
[0137] Preferred lower eukaryotes of the invention include but are
not limited to: Pichia pastoris, Pichia finlandica, Pichia
trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia
opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia
guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica,
Pichia sp., Saccharomyces cerevisiae, Saccharomyces sp., Hansenula
polymorpha, Kluyveromyces sp., Kluyveromyces lactis, Candida
albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus
oryzae, Trichoderma reseei, Chrysosporium lucknowense, Fusarium sp.
Fusarium gramineum, Fusarium venenatum and Neurospora crassa.
[0138] In each above embodiment, the method is directed to making a
host cell in which the oligosaccharide precursors are enriched in
Man.sub.5GlcNAc.sub.2. These structures are desirable because they
may then be processed by treatment in vitro, for example, using the
method of Maras and Contreras, U.S. Pat. No. 5,834,251. In a
preferred embodiment, however, precursors enriched in
Man.sub.5GlcNAc.sub.2 are processed by at least one further
glycosylation reaction in vivo--with glycosidases (e.g.,
.alpha.-mannosidases) and glycosyltransferases (e.g., GnTI)--to
produce human-like N-glycans. Oligosaccharide precursors enriched
in Man.sub.5GlcNAc.sub.2, for example, are preferably processed to
those having GlcNAcMan.sub.xGlcNAc.sub.2 core structures, wherein X
is 3, 4 or 5, and is preferably 3. N-glycans having a
GlcNAcMan.sub.xGlcNAc.sub.2 core structure where X is greater than
3 may be converted to GlcNAcMan.sub.3GlcNAc.sub.2, e.g., by
treatment with an .alpha.-1,3 and/or .alpha.-1,6 mannosidase
activity, where applicable. Additional processing of
GlcNAcMan.sub.3GlcNAc.sub.2 by treatment with glycosyltransferases
(e.g., GnTII) produces GlcNAc.sub.2Man.sub.3GlcNAc.sub.2 core
structures which may then be modified, as desired, e.g., by ex vivo
treatment or by heterologous expression in the host cell of
additional glycosylation enzymes, including glycosyltransferases,
sugar transporters and mannosidases (see below), to become
human-like N-glycans.
[0139] Preferred human-like glycoproteins which may be produced
according to the invention include those which comprise N-glycans
having seven or fewer, or three or fewer, mannose residues; and
which comprise one or more sugars selected from the group
consisting of galactose, GlcNAc, sialic acid, and fucose.
Formation of Complex N-Glycans
[0140] Formation of complex N-glycan synthesis is a sequential
process by which specific sugar residues are removed and attached
to the core oligosaccharide structure. In higher eukaryotes, this
is achieved by having the substrate sequentially exposed to various
processing enzymes. These enzymes carry out specific reactions
depending on their particular location within the entire processing
cascade. This "assembly line" consists of ER, early, medial and
late Golgi, and the trans Golgi network all with their specific
processing environment. To re-create the processing of human
glycoproteins in the Golgi and ER of lower eukaryotes, numerous
enzymes (e.g. glycosyltransferases, glycosidases, phosphatases and
transporters) have to be expressed and specifically targeted to
these organelles, and preferably, in a location so that they
function most efficiently in relation to their environment as well
as to other enzymes in the pathway.
[0141] Because one goal of the methods described herein is to
achieve a robust protein production strain that is able to perform
well in an industrial fermentation process, the integration of
multiple genes into the host cell chromosome involves careful
planning. As described above, one or more genes which encode
enzymes known to be characteristic of non-human glycosylation
reactions are preferably deleted. The engineered cell strain is
transformed with a range of different genes encoding desired
activities, and these genes are transformed in a stable fashion,
thereby ensuring that the desired activity is maintained throughout
the fermentation process.
[0142] Any combination of the following enzyme activities may be
engineered singly or multiply into the host using methods of the
invention: sialyltransferases, mannosidases, fucosyltransferases,
galactosyltransferases, GlcNAc transferases, ER and Golgi specific
transporters (e.g. syn- and antiport transporters for UDP-galactose
and other precursors), other enzymes involved in the processing of
oligosaccharides, and enzymes involved in the synthesis of
activated oligosaccharide precursors such as UDP-galactose and
CMP-N-acetylneuraminic acid. Preferably, enzyme activities are
introduced on one or more nucleic acid molecules (see also below).
Nucleic acid molecules may be introduced singly or multiply, e.g.,
in the context of a nucleic acid library such as a combinatorial
library of the invention. It is to be understood, however, that
single or multiple enzymatic activities may be introduced into a
host cell in any fashion, including but not limited to protein
delivery methods and/or by use of one or more nucleic acid
molecules without necessarily using a nucleic acid library or
combinatorial library of the invention.
Expression Of Glycosyltransferases To Produce Complex
N-glycans:
[0143] With DNA sequence information, the skilled artisan can clone
DNA molecules encoding GnT activities (e.g., Examples 3 and 4).
Using standard techniques well-known to those of skill in the art,
nucleic acid molecules encoding GnTI, II, III, IV or V (or encoding
catalytically active fragments thereof) may be inserted into
appropriate expression vectors under the transcriptional control of
promoters and other expression control sequences capable of driving
transcription in a selected host cell of the invention, e.g., a
fungal host such as Pichia sp., Kluyveromyces sp. and Aspergillus
sp., as described herein, such that one or more of these mammalian
GnT enzymes may be actively expressed in a host cell of choice for
production of a human-like complex glycoprotein (e.g., Examples 15,
17 and 18).
[0144] Several individual glycosyltransferases have been cloned and
expressed in S. cerevisiae (GalT, GnTI), Aspergillus nidulans
(GnTI) and other fungi, without however demonstrating the desired
outcome of "humanization" on the glycosylation pattern of the
organisms (Yoshida, 1995; Schwientek, 1995; Kalsner, 1995). It was
speculated that the carbohydrate structure required to accept
sugars by the action of such glycosyltransferases was not present
in sufficient amounts, which most likely contributed to the lack of
complex N-glycan formation.
[0145] A preferred method of the invention provides the functional
expression of a GnT, such as GnTI, in the early or medial Golgi
apparatus as well as ensuring a sufficient supply of UDP-GlcNAc
(e.g., by expression of a UDP-GlcNAc transporter; see below).
Methods for Providing Sugar Nucleotide Precursors to the Golgi
Apparatus:
[0146] For a glycosyltransferase to function satisfactorily in the
Golgi, the enzyme requires a sufficient concentration of an
appropriate nucleotide sugar, which is the high-energy donor of the
sugar moiety added to a nascent glycoprotein. In humans, the full
range of nucleotide sugar precursors (e.g. UDP-N-acetylglucosamine,
UDP-N-acetylgalactosamine, CMP-N-acetylneuraminic acid,
UDP-galactose, etc.) are generally synthesized in the cytosol and
transported into the Golgi, where they are attached to the core
oligosaccharide by glycosyltransferases.
[0147] To replicate this process in non-human host cells such as
lower eukaryotes, sugar nucleoside specific transporters have to be
expressed in the Golgi to ensure adequate levels of nucleoside
sugar precursors (Sommers, 1981; Sommers, 1982; Perez, 1987).
Nucleotide sugars may be provided to the appropriate compartments,
e.g., by expressing in the host microorganism an exogenous gene
encoding a sugar nucleotide transporter. The choice of transporter
enzyme is influenced by the nature of the exogenous
glycosyltransferase being used. For example, a GlcNAc transferase
may require a UDP-GlcNAc transporter, a fucosyltransferase may
require a GDP-fucose transporter, a galactosyltransferase may
require a UDP-galactose transporter, and a sialyltransferase may
require a CMP-sialic acid transporter.
[0148] The added transporter protein conveys a nucleotide sugar
from the cytosol into the Golgi apparatus, where the nucleotide
sugar may be reacted by the glycosyltransferase, e.g. to elongate
an N-glycan. The reaction liberates a nucleoside diphosphate or
monophosphate, e.g. UDP, GDP, or CMP. Nucleoside monophosphates can
be directly exported from the Golgi in exchange for nucleoside
triphosphate sugars by an antiport mechanism. Accumulation of a
nucleoside diphosphate, however, inhibits the further activity of a
glycosyltransferase. As this reaction appears to be important for
efficient glycosylation, it is frequently desirable to provide an
expressed copy of a gene encoding a nucleotide diphosphatase. The
diphosphatase (specific for UDP or GDP as appropriate) hydrolyzes
the diphosphonucleoside to yield a nucleoside monosphosphate and
inorganic phosphate.
[0149] Suitable transporter enzymes, which are typically of
mammalian origin, are described below. Such enzymes may be
engineered into a selected host cell using the methods of the
invention (see also Examples 7-10).
[0150] In another example, a 2,3- or a 2,6-sialyltransferase caps
galactose residues with sialic acid in the trans-Golgi and TGN of
humans leading to a mature form of the glycoprotein (FIG. 1B). To
reengineer this processing step into a metabolically engineered
yeast or fungus will require (1) a 2,3- or a 2,6-sialyltransferase
activity and (2) a sufficient supply of CMP-N-acetyl neuraminic
acid, in the late Golgi of yeast (Example 6). To obtain sufficient
a 2,3-sialyltransferase activity in the late Golgi, for example,
the catalytic domain of a known sialyltransferase (e.g. from
humans) has to be directed to the late Golgi in fungi (see above).
Likewise, transporters have to be engineered to allow the transport
of CMP-N-acetyl neuraminic acid into the late Golgi. There is
currently no indication that fungi synthesize or can even transport
sufficient amounts of CMP-N-acetyl neuraminic acid into the Golgi.
Consequently, to ensure the adequate supply of substrate for the
corresponding glycosyltransferases, one has to metabolically
engineer the production of CMP-sialic acid into the fungus.
UDP-N-Acetylglucosamine
[0151] The cDNA of human UDP-N-acetylglucosamine transporter, which
was recognized through a homology search in the expressed sequence
tags database (dbEST), has been cloned (Ishida, 1999 J. Biochem.
126(1): 68-77). The mammalian Golgi membrane transporter for
UDP-N-acetylglucosamine was cloned by phenotypic correction with
cDNA from canine kidney cells (MDCK) of a recently characterized
Kluyveromyces lactis mutant deficient in Golgi transport of the
above nucleotide sugar (Guillen, 1998). Results demonstrate that
the mammalian Golgi UDP-GlcNAc transporter gene has all of the
necessary information for the protein to be expressed and targeted
functionally to the Golgi apparatus of yeast and that two proteins
with very different amino acid sequences may transport the same
solute within the same Golgi membrane (Guillen, 1998).
[0152] Accordingly, one may incorporate the expression of a
UDP-GlcNAc transporter in a host cell by means of a nucleic acid
construct which may contain, for example: (1) a region by which the
transformed construct is maintained in the cell (e.g. origin of
replication or a region that mediates chromosomal integration), (2)
a marker gene that allows for the selection of cells that have been
transformed, including counterselectable and recyclable markers
such as ura3 or T-urf13 (Soderholm, 2001) or other well
characterized selection-markers (e.g., his4, bla, Sh ble etc.), (3)
a gene or fragment thereof encoding a functional UDP-GlcNAc
transporter (e.g. from K. lactis, (Abeijon, (1996) Proc. Natl.
Acad. Sci. U.S.A. 93:5963-5968), or from H. sapiens (Ishida, 1996),
and (4) a promoter activating the expression of the above mentioned
localization/catalytic domain fusion construct library.
GDP-Fucose
[0153] The rat liver Golgi membrane GDP-fucose transporter has been
identified and purified by Puglielli, L. and C. B. Hirschberg
(Puglielli, 1999 J. Biol. Chem. 274(50):35596-35600). The
corresponding gene has not been identified, however, N-terminal
sequencing can be used for the design of oligonucleotide probes
specific for the corresponding gene. These oligonucleotides can be
used as probes to clone the gene encoding for GDP-fucose
transporter.
UDP-Galactose
[0154] Two heterologous genes, gmal2(+) encoding alpha
1,2-galactosyltransferase (alpha 1,2 GalT) from Schizosaccharomyces
pombe and (hUGT2) encoding human UDP-galactose (UDP-Gal)
transporter, have been functionally expressed in S. cerevisiae to
examine the intracellular conditions required for galactosylation.
Correlation between protein galactosylation and UDP-galactose
transport activity indicated that an exogenous supply of UDP-Gal
transporter, rather than alpha 1,2 GalT played a key role for
efficient galactosylation in S. cerevisiae (Kainuma, 1999
Glycobiology 9(2): 133-141). Likewise, an UDP-galactose transporter
from S. pombe was cloned (Aoki, 1999 J. Biochem. 126(5): 940-950;
Segawa, 1999 Febs Letters 451(3): 295-298).
CMP-N-acetylneuraminic acid (CMP-Sialic acid).
[0155] Human CMP-sialic acid transporter (hCST) has been cloned and
expressed in Lec 8 CHO cells (Aoki, 1999; Eckhardt, 1997). The
functional expression of the murine CMP-sialic acid transporter was
achieved in Saccharomyces cerevisiae (Berninsone, 1997). Sialic
acid has been found in some fungi, however it is not clear whether
the chosen host system will be able to supply sufficient levels of
CMP-Sialic acid. Sialic acid can be either supplied in the medium
or alternatively fungal pathways involved in sialic acid synthesis
can also be integrated into the host genome.
Expression of Diphosphatases:
[0156] When sugars are transferred onto a glycoprotein, either a
nucleoside diphosphate or monophosphate is released from the sugar
nucleotide precursors. While monophosphates can be directly
exported in exchange for nucleoside triphosphate sugars by an
antiport mechanism, diphosphonucleosides (e.g. GDP) have to be
cleaved by phosphatases (e.g. GDPase) to yield nucleoside
monophosphates and inorganic phosphate prior to being exported.
This reaction appears to be important for efficient glycosylation,
as GDPase from S. cerevisiae has been found to be necessary for
mannosylation. However, the enzyme only has 10% of the activity
towards UDP (Berninsone, 1994). Lower eukaryotes often do not have
UDP-specific diphosphatase activity in the Golgi as they do not
utilize UDP-sugar precursors for glycoprotein synthesis in the
Golgi. Schizosaccharomyces pombe, a yeast which adds galactose
residues to cell wall polysaccharides (from UDP-galactose), was
found to have specific UDPase activity, further suggesting the
requirement for such an enzyme (Berninsone, 1994). UDP is known to
be a potent inhibitor of glycosyltransferases and the removal of
this glycosylation side product is important to prevent
glycosyltransferase inhibition in the lumen of the Golgi (Khatara
et al. 1974).
Methods for Altering N-Glycans in a Host by Expressing a Targeted
Enzymatic Activity from a Nucleic Acid Molecule
[0157] The present invention further provides a method for
producing a human-like glycoprotein in a non-human host cell
comprising the step of introducing into the cell one or more
nucleic acid molecules which encode an enzyme or enzymes for
production of the Man.sub.5GlcNAc.sub.2 carbohydrate structure. In
one preferred embodiment, a nucleic acid molecule encoding one or
more mannosidase activities involved in the production of
Man.sub.5GlcNAc.sub.2 from Man.sub.8GlcNAc.sub.2 or
Man.sub.9GlcNAc.sub.2 is introduced into the host. The invention
additionally relates to methods for making altered glycoproteins in
a host cell comprising the step of introducing into the host cell a
nucleic acid molecule which encodes one or more glycosylation
enzymes or activities. Preferred enzyme activities are selected
from the group consisting of UDP-GlcNAc transferase,
UDP-galactosyltransferase, GDP-fucosyltransferase,
CMP-sialyltransferase, UDP-GlcNAc transporter, UDP-galactose
transporter, GDP-fucose transporter, CMP-sialic acid transporter,
and nucleotide diphosphatases. In a particularly preferred
embodiment, the host is selected or engineered to express two or
more enzymatic activities in which the product of one activity
increases substrate levels of another activity, e.g., a
glycosyltransferase and a corresponding sugar transporter, e.g.,
GnTI and UDP-GlcNAc transporter activities. In another preferred
embodiment, the host is selected or engineered to expresses an
activity to remove products which may inhibit subsequent
glycosylation reactions, e.g. a UDP- or GDP-specific diphosphatase
activity.
[0158] Preferred methods of the invention involve expressing one or
more enzymatic activities from a nucleic acid molecule in a host
cell and comprise the step of targeting at least one enzymatic
activity to a desired subcellular location (e.g., an organelle) by
forming a fusion protein comprising a catalytic domain of the
enzyme and a cellular targeting signal peptide, e.g., a
heterologous signal peptide which is not normally ligated to or
associated with the catalytic domain. The fusion protein is encoded
by at least one genetic construct ("fusion construct") comprising a
nucleic acid fragment encoding a cellular targeting signal peptide
ligated in the same translational reading frame ("in-frame") to a
nucleic acid fragment encoding an enzyme (e.g., glycosylation
enzyme), or catalytically active fragment thereof.
[0159] The targeting signal peptide component of the fusion
construct or protein is preferably derived from a member of the
group consisting of: membrane-bound proteins of the ER or Golgi,
retrieval signals, Type II membrane proteins, Type I membrane
proteins, membrane spanning nucleotide sugar transporters,
mannosidases, sialyltransferases, glucosidases,
mannosyltransferases and phosphomannosyltransferases.
[0160] The catalytic domain component of the fusion construct or
protein is preferably derived from a glycosidase, mannosidase or a
glycosyltransferase activity derived from a member of the group
consisting of GnTI, GnTII, GnTIII, GnTIV, GnTV, GnTVI, GalT,
Fucosyltransferase and Sialyltransferase. The catalytic domain
preferably has a pH optimum within 1.4 pH units of the average pH
optimum of other representative enzymes in the organelle in which
the enzyme is localized, or has optimal activity at a pH between
5.1 and 8.0. In a preferred embodiment, the catalytic domain
encodes a mannosidase selected from the group consisting of C.
elegans mannosidase IA, C. elegans mannosidase IB, D. melanogaster
mannosidase IA, H. sapiens mannosidase IB, P. citrinum mannosidase
I, mouse mannosidase IA, mouse mannosidase IB, A. nidulans
mannosidase IA, A. nidulans mannosidase IB, A. nidulans mannosidase
IC, mouse mannosidase II, C. elegans mannosidase II, H. sapiens
mannosidase II, and mannosidase III.
Selecting a Glycosylation Enzyme: pH Optima and Subcellular
Localization
[0161] In one embodiment of the invention, a human-like
glycoprotein is made efficiently in a non-human eukaryotic host
cell by introducing into a subcellular compartment of the cell a
glycosylation enzyme selected to have a pH optimum similar to the
pH optima of other enzymes in the targeted subcellular compartment.
For example, most enzymes that are active in the ER and Golgi
apparatus of S. cerevisiae have pH optima that are between about
6.5 and 7.5 (see Table 3). Because the glycosylation of proteins is
a highly evolved and efficient process, the internal pH of the ER
and the Golgi is likely also in the range of about 6-8. All
previous approaches to reduce mannosylation by the action of
recombinant mannosidases in fungal hosts, however, have introduced
enzymes that have a pH optimum of around pH 5.0 (Martinet et al.,
1998, and Chiba et al., 1998). At pH 7.0, the in vitro determined
activity of those mannosidases is reduced to less than 10%, which
is likely insufficient activity at their point of use, namely, the
ER and early Golgi, for the efficient in vivo production of
Man.sub.5GlcNAc.sub.2 on N-glycans.
[0162] Accordingly, a preferred embodiment of this invention
targets a selected glycosylation enzyme (or catalytic domain
thereof), e.g., an .alpha.-mannosidase, to a subcellular location
in the host cell (e.g., an organelle) where the pH optimum of the
enzyme or domain is within 1.4 pH units of the average pH optimum
of other representative marker enzymes localized in the same
organelle(s). The pH optimum of the enzyme to be targeted to a
specific organelle should be matched with the pH optimum of other
enzymes found in the same organelle to maximize the activity per
unit enzyme obtained. Table 3 summarizes the activity of
mannosidases from various sources and their respective pH optima.
Table 4 summarizes their typical subcellular locations.
TABLE-US-00003 TABLE 3 Mannosidases and their pH optimum. pH Source
Enzyme optimum Reference Aspergillus saitoi .alpha.-1,2-mannosidase
5.0 Ichishima et al., 1999 Biochem. J. 339(Pt 3): 589-597
Trichoderma reesei .alpha.-1,2-mannosidase 5.0 Maras et al., 2000
J. Biotechnol. 77(2-3): 255- 263 Penicillium .alpha.-D-1,2- 5.0
Yoshida et al., 1993 citrinum mannosidase Biochem. J. 290(Pt 2):
349-354 C. elegans .alpha.-1,2-mannosidase 5.5 FIG. 11 Aspergillus
.alpha.-1,2-mannosidase 6.0 Eades and Hintz, 2000 nidulans Homo
sapiens IA .alpha.-1,2-mannosidase 6.0 (Golgi) Homo sapiens IB
.alpha.-1,2-mannosidase 6.0 (Golgi) Lepidopteran Type I
.alpha.-1,2-Man.sub.6- 6.0 Ren et al., 1995 insect cells
mannosidase Biochem. 34(8): 2489- 2495 Homo sapiens
.alpha.-D-mannosidase 6.0 Chandrasekaran et al., 1984 Cancer Res.
44(9): 4059-68 Xanthomonas .alpha.-1,2,3-mannosidase 6.0 U.S. Pat.
No. 6,300,113 manihotis Mouse IB (Golgi) .alpha.-1,2-mannosidase
6.5 Schneikert and Herscovics, 1994 Glycobiology. 4(4): 445- 50
Bacillus sp. .alpha.-D-1,2- 7.0 Maruyama et al., 1994 (secreted)
mannosidase Carbohydrate Res. 251: 89-98
[0163] In a preferred embodiment, a particular enzyme or catalytic
domain is targeted to a subcellular location in the host cell by
means of a chimeric fusion construct encoding a protein comprising
a cellular targeting signal peptide not normally associated with
the enzymatic domain. Preferably, an enzyme or domain is targeted
to the ER, the early, medial or late Golgi of the trans Golgi
apparatus of the host cell.
[0164] In a more preferred embodiment, the targeted glycosylation
enzyme is a mannosidase, glycosyltransferase or a glycosidase. In
an especially preferred embodiment, mannosidase activity is
targeted to the ER or cis Golgi, where the early reactions of
glycosylation occur. While this method is useful for producing a
human-like glycoprotein in a non-human host cell, it will be
appreciated that the method is also useful more generally for
modifying carbohydrate profiles of a glycoprotein in any eukaryotic
host cell, including human host cells.
[0165] Targeting sequences which mediate retention of proteins in
certain organelles of the host cell secretory pathway are
well-known and described in the scientific literature and public
databases, as discussed in more detail below with respect to
libraries for selection of targeting sequences and targeted
enzymes. Such subcellular targeting sequences may be used alone or
in combination to target a selected glycosylation enzyme (or
catalytic domain thereof) to a particular subcellular location in a
host cell, i.e., especially to one where the enzyme will have
enhanced or optimal activity based on pH optima or the presence of
other stimulatory factors.
[0166] When one attempts to trim high mannose structures to yield
Man.sub.5GlcNAc.sub.2 in the ER or the Golgi apparatus of a host
cell such as S. cerevisiae, for example, one may choose any enzyme
or combination of enzymes that (1) has a sufficiently close pH
optimum (i.e. between pH 5.2 and pH 7.8), and (2) is known to
generate, alone or in concert, the specific isomeric
Man.sub.5GlcNAc.sub.2 structure required to accept subsequent
addition of GlcNAc by GnTI. Any enzyme or combination of enzymes
that is shown to generate a structure that can be converted to
GlcNAcMan.sub.5GlcNAc.sub.2 by GnTI in vitro would constitute an
appropriate choice. This knowledge may be obtained from the
scientific literature or experimentally.
[0167] For example, one may determine whether a potential
mannosidase can convert Man.sub.8GlcNAc.sub.2-2AB
(2-aminobenzamide) to Man.sub.5GlcNAc.sub.2-AB and then verify that
the obtained Man.sub.5GlcNAc.sub.2-2AB structure can serve a
substrate for GnTI and UDP-GlcNAc to give
GlcNAcMan.sub.5GlcNAc.sub.2 in vitro. Mannosidase IA from a human
or murine source, for example, would be an appropriate choice (see,
e.g., Example 11). Examples described herein utilize
2-aminobenzamide labeled N-linked oligomannose followed by HPLC
analysis to make this determination.
TABLE-US-00004 TABLE 4 Cellular location and pH optima of various
glycosylation- related enzymes of S. cerevisiae. Loca- pH op- Gene
Activity tion timum Reference(s) KTR1 .alpha.-1,2 Golgi 7.0 Romero
et al. mannosyltransferase 1997 Biochem. J. 321(Pt 2): 289- 295
MNS1 .alpha.-1,2-mannosidase ER 6.5 CWH41 glucosidase I ER 6.8 --
mannosyltransferase Golgi 7-8 Lehele and Tanner, (1974) Biochim.
Biophys. Acta 350(1): 225-235 KRE2 .alpha.-1,2 Golgi 6.5-9.0 Romero
et al., mannosyltransferase 1997
[0168] Accordingly, a glycosylation enzyme such as an
.alpha.-1,2-mannosidase enzyme used according to the invention has
an optimal activity at a pH of between 5.1 and 8.0. In a preferred
embodiment, the enzyme has an optimal activity at a pH of between
5.5 and 7.5. The C. elegans mannosidase enzyme, for example, works
well in the methods of the invention and has an apparent pH optimum
of about 5.5). Preferred mannosidases include those listed in Table
3 having appropriate pH optima, e.g. Aspergillus nidulans, Homo
sapiens IA (Golgi), Homo sapiens IB (Golgi), Lepidopteran insect
cells (IPLB-SF21AE), Homo sapiens, mouse IB (Golgi), Xanthomonas
manihotis, Drosophila melanogaster and C. elegans.
[0169] The experiment which illustrates the pH optimum for an
.alpha.-1,2-mannosidase enzyme is described in Example 14. A
chimeric fusion protein BB27-2 (Saccharomyces MNN10 (s)/C. elegans
mannosidase IB .DELTA.31), which leaks into the medium was
subjected to various pH ranges to determine the optimal activity of
the enzyme. The results of the experiment show that the
.alpha.-1,2-mannosidase has an optimal pH of about 5.5 for its
function (FIG. 11).
[0170] In a preferred embodiment, a single cloned mannosidase gene
is expressed in the host organism. However, in some cases it may be
desirable to express several different mannosidase genes, or
several copies of one particular gene, in order to achieve adequate
production of Man.sub.5GlcNAc.sub.2. In cases where multiple genes
are used, the encoded mannosidases preferably all have pH optima
within the preferred range of about 5.1 to about 8.0, or especially
between about 5.5 and about 7.5. Preferred mannosidase activities
include .alpha.-1,2-mannosidases derived from mouse, human,
Lepidoptera, Aspergillus nidulans, or Bacillus sp., C. elegans, D.
melanogaster, P. citrinum, X. laevis or A. nidulans.
In Vivo Alteration of Host Cell Glycosylation Using a Combinatorial
DNA Library
[0171] Certain methods of the invention are preferably (but need
not necessarily be) carried out using one or more nucleic acid
libraries. An exemplary feature of a combinatorial nucleic acid
library of the invention is that it comprises sequences encoding
cellular targeting signal peptides and sequences encoding proteins
to be targeted (e.g., enzymes or catalytic domains thereof,
including but not limited to those which mediate
glycosylation).
[0172] In one embodiment, a combinatorial nucleic acid library
comprises: (a) at least two nucleic acid sequences encoding
different cellular targeting signal peptides; and (b) at least one
nucleic acid sequence encoding a polypeptide to be targeted. In
another embodiment, a combinatorial nucleic acid library comprises:
(a) at least one nucleic acid sequence encoding a cellular
targeting signal peptide; and (b) at least two nucleic acid
sequences encoding a polypeptide to be targeted into a host cell.
As described further below, a nucleic acid sequence derived from
(a) and a nucleic acid sequence derived from (b) are ligated to
produce one or more fusion constructs encoding a cellular targeting
signal peptide functionally linked to a polypeptide domain of
interest. One example of a functional linkage is when the cellular
targeting signal peptide is ligated to the polypeptide domain of
interest in the same translational reading frame ("in-frame").
[0173] In a preferred embodiment, a combinatorial DNA library
expresses one or more fusion proteins comprising cellular targeting
signal peptides ligated in-frame to catalytic enzyme domains. The
encoded fusion protein preferably comprises a catalytic domain of
an enzyme involved in mammalian- or human-like modification of
N-glycans. In a more preferred embodiment, the catalytic domain is
derived from an enzyme selected from the group consisting of
mannosidases, glycosyltransferases and other glycosidases which is
ligated in-frame to one or more targeting signal peptides. The
enzyme domain may be exogenous and/or endogenous to the host cell.
A particularly preferred signal peptide is one normally associated
with a protein that undergoes ER to Golgi transport.
[0174] The combinatorial DNA library of the present invention may
be used for producing and localizing in vivo enzymes involved in
mammalian- or human-like N-glycan modification. The fusion
constructs of the combinatorial DNA library are engineered so that
the encoded enzymes are localized in the ER, Golgi or the
trans-Golgi network of the host cell where they are involved in
producing particular N-glycans on a glycoprotein of interest.
Localization of N-glycan modifying enzymes of the present invention
is achieved through an anchoring mechanism or through
protein-protein interaction where the localization peptide
constructed from the combinatorial DNA library localizes to a
desired organelle of the secretory pathway such as the ER, Golgi or
the trans Golgi network.
[0175] An example of a useful N-glycan, which is produced
efficiently and in sufficient quantities for further modification
by human-like (complex) glycosylation reactions is
Man.sub.5GlcNAc.sub.2. A sufficient amount of Man.sub.5GlcNAc.sub.2
is needed on a glycoprotein of interest for further human-like
processing in vivo (e.g., more than 30 mole %). The
Man.sub.5GlcNAc.sub.2 intermediate may be used as a substrate for
further N-glycan modification to produce
GlcNAcMan.sub.5GlcNAc.sub.2 (FIG. 1B; see above). Accordingly, the
combinatorial DNA library of the present invention may be used to
produce enzymes which subsequently produce
GlcNAcMan.sub.5GlcNAc.sub.2, or other desired complex N-glycans, in
a useful quantity.
[0176] A further aspect of the fusion constructs produced using the
combinatorial DNA library of the present invention is that they
enable sufficient and often near complete intracellular N-glycan
trimming activity in the engineered host cell. Preferred fusion
constructs produced by the combinatorial DNA library of the
invention encode a glycosylation enzyme, e.g., a mannosidase, which
is effectively localized to an intracellular host cell compartment
and thereby exhibits very little and preferably no extracellular
activity. The preferred fusion constructs of the present invention
that encode a mannosidase enzyme are shown to localize where the
N-glycans are modified, namely, the ER and the Golgi. The fusion
enzymes of the present invention are targeted to such particular
organelles in the secretory pathway where they localize and act
upon N-glycans such as Man.sub.8GlcNAc.sub.2 to produce
Man.sub.5GlcNAc.sub.2 on a glycoprotein of interest.
[0177] Enzymes produced by the combinatorial DNA library of the
present invention can modify N-glycans on a glycoprotein of
interest as shown for K3 or IFN-.beta. proteins expressed in P.
pastoris, as shown in FIG. 5 and FIG. 6, respectively (see also
Examples 2 and 11). It is, however, appreciated that other types of
glycoproteins, without limitation, including erythropoietin,
cytokines such as interferon-.alpha., interferon-.beta.,
interferon-.gamma., interferon-.omega., and granulocyte-CSF,
coagulation factors such as factor VIII, factor IX, and human
protein C, soluble IgE receptor .alpha.-chain, IgG, IgG fragments,
IgM, urokinase, chymase, and urea trypsin inhibitor, IGF-binding
protein, epidermal growth factor, growth hormone-releasing factor,
annexin V fusion protein, angiostatin, vascular endothelial growth
factor-2, myeloid progenitor inhibitory factor-1, osteoprotegerin,
.alpha.-1 antitrypsin, DNase II and .alpha.-feto proteins may be
glycosylated in this way.
Constructing a Combinatorial DNA Library of Fusion Constructs:
[0178] A combinatorial DNA library of fusion constructs features
one or more cellular targeting signal peptides ("targeting
peptides") generally derived from N-terminal domains of native
proteins (e.g., by making C-terminal deletions). Some targeting
peptides, however, are derived from the C-terminus of native
proteins (e.g. SEC12). Membrane-bound proteins of the ER or the
Golgi are preferably used as a source for targeting peptide
sequences. These proteins have sequences encoding a cytosolic tail
(ct), a transmembrane domain (tmd) and a stem region (sr) which are
varied in length. These regions are recognizable by protein
sequence alignments and comparisons with known homologs and/or
other localized proteins (e.g., comparing hydrophobicity
plots).
[0179] The targeting peptides are indicated herein as short (s),
medium (m) and long (1) relative to the parts of a type II
membrane. The targeting peptide sequence indicated as short (s)
corresponds to the transmembrane domain (tmd) of the membrane-bound
protein. The targeting peptide sequence indicated as long (1)
corresponds to the length of the transmembrane domain (tmd) and the
stem region (sr). The targeting peptide sequence indicated as
medium (m) corresponds to the transmembrane domain (tmd) and
approximately half the length of the stem region (sr). The
catalytic domain regions are indicated herein by the number of
nucleotide deletion with respect to its wild-type glycosylation
enzyme.
Sub-Libraries
[0180] In some cases a combinatorial nucleic acid library of the
invention may be assembled directly from existing or wild-type
genes. In a preferred embodiment, the DNA library is assembled from
the fusion of two or more sub-libraries. By the in-frame ligation
of the sub-libraries, it is possible to create a large number of
novel genetic constructs encoding useful targeted protein domains
such as those which have glycosylation activities.
Catalytic Domain Sub-Libraries Encoding Glycosylation
Activities
[0181] One useful sub-library includes DNA sequences encoding
enzymes such as glycosidases (e.g., mannosidases),
glycosyltransferases (e.g., fucosyl-transferases,
galactosyltransferases, glucosyltransferases), GlcNAc transferases
and sialyltransferases. Catalytic domains may be selected from the
host to be engineered, as well as from other related or unrelated
organisms. Mammalian, plant, insect, reptile, algal or fungal
enzymes are all useful and should be chosen to represent a broad
spectrum of biochemical properties with respect to temperature and
pH optima. In a preferred embodiment, genes are truncated to give
fragments some of which encode the catalytic domains of the
enzymes. By removing endogenous targeting sequences, the enzymes
may then be redirected and expressed in other cellular loci.
[0182] The choice of such catalytic domains may be guided by the
knowledge of the particular environment in which the catalytic
domain is subsequently to be active. For example, if a particular
glycosylation enzyme is to be active in the late Golgi, and all
known enzymes of the host organism in the late Golgi have a certain
pH optimum, or the late Golgi is known to have a particular pH,
then a catalytic domain is chosen which exhibits adequate, and
preferably maximum, activity at that pH, as discussed above.
Targeting Peptide Sequence Sub-Libraries
[0183] Another useful sub-library includes nucleic acid sequences
encoding targeting signal peptides that result in localization of a
protein to a particular location within the ER, Golgi, or trans
Golgi network. These targeting peptides may be selected from the
host organism to be engineered as well as from other related or
unrelated organisms. Generally such sequences fall into three
categories: (1) N-terminal sequences encoding a cytosolic tail
(ct), a transmembrane domain (tmd) and part or all of a stem region
(sr), which together or individually anchor proteins to the inner
(lumenal) membrane of the Golgi; (2) retrieval signals which are
generally found at the C-terminus such as the HDEL (SEQ ID NO:5) or
KDEL (SEQ ID NO:6) tetrapeptide; and (3) membrane spanning regions
from various proteins, e.g., nucleotide sugar transporters, which
are known to localize in the Golgi.
[0184] In the first case, where the targeting peptide consists of
various elements (ct, tmd and sr), the library is designed such
that the ct, the tmd and various parts of the stem region are
represented. Accordingly, a preferred embodiment of the sub-library
of targeting peptide sequences includes ct, tmd, and/or sr
sequences from membrane-bound proteins of the ER or Golgi. In some
cases it may be desirable to provide the sub-library with varying
lengths of sr sequence. This may be accomplished by PCR using
primers that bind to the 5' end of the DNA encoding the cytosolic
region and employing a series of opposing primers that bind to
various parts of the stem region.
[0185] Still other useful sources of targeting peptide sequences
include retrieval signal peptides, e.g. the tetrapeptides HDEL (SEQ
ID NO:5) or KDEL (SEQ ID NO:6), which are typically found at the
C-terminus of proteins that are transported retrograde into the ER
or Golgi. Still other sources of targeting peptide sequences
include (a) type II membrane proteins, (b) the enzymes listed in
Table 3, (c) membrane spanning nucleotide sugar transporters that
are localized in the Golgi, and (d) sequences referenced in Table 5
(The HDEL signal in column 1, cell 8 is shown in (SEQ ID NO:5).
TABLE-US-00005 TABLE 5 Sources of useful compartmental targeting
sequences Location Gene or of Gene Sequence Organism Function
Product MNSI A. nidulans .alpha.-1,2-mannosidase ER MNSI A. niger
.alpha.-1,2-mannosidase ER MNSI S. cerevisiae
.alpha.-1,2-mannosidase ER GLSI S. cerevisiae glucosidase ER GLSI
A. niger glucosidase ER GLSI A. nidulans glucosidase ER HDEL
Universal in retrieval signal ER at C- fungi terminus SEC12 S.
cerevisiae COPII vesicle protein ER/Golgi SEC12 A. niger COPII
vesicle protein ER/Golgi OCH1 S. cerevisiae 1,6-mannosyltransferase
Golgi (cis) OCH1 P. pastoris 1,6-mannosyltransferase Golgi (cis)
MNN9 S. cerevisiae 1,6-mannosyltransferase Golgi complex MNN9 A.
niger undetermined Golgi VAN1 S. cerevisiae undetermined Golgi VAN1
A. niger undetermined Golgi ANP1 S. cerevisiae undetermined Golgi
HOCI S. cerevisiae undetermined Golgi MNN10 S. cerevisiae
undetermined Golgi MNN10 A. niger undetermined Golgi MNN11 S.
cerevisiae undetermined Golgi (cis) MNN11 A. niger undetermined
Golgi (cis) MNT1 S. cerevisiae 1,2-mannosyltransferase Golgi (cis,
medial KTR1 P. pastoris undetermined Golgi (medial) KRE2 P.
pastoris undetermined Golgi (medial) KTR3 P. pastoris undetermined
Golgi (medial) MNN2 S. cerevisiae 1,2-mannosyltransferase Golgi
(medial) KTR1 S. cerevisiae undetermined Golgi (medial) KTR2 S.
cerevisiae undetermined Golgi (medial) MNN1 S. cerevisiae
1,3-mannosyltransferase Golgi (trans) MNN6 S. cerevisiae
Phosphomannosyltransferase Golgi (trans) 2,6 ST H. sapiens
2,6-sialyltransferase trans Golgi network UDP- S. pombe UDP-Gal
transporter Golgi Gal T
[0186] In any case, it is highly preferred that targeting peptide
sequences are selected which are appropriate for the particular
enzymatic activity or activities to function optimally within the
sequence of desired glycosylation reactions. For example, in
developing a modified microorganism capable of terminal sialylation
of nascent N-glycans, a process which occurs in the late Golgi in
humans, it is desirable to utilize a sub-library of targeting
peptide sequences derived from late Golgi proteins. Similarly, the
trimming of Man.sub.8GlcNAc.sub.2 by an .alpha.-1,2-mannosidase to
give Man.sub.5GlcNAc.sub.2 is an early step in complex N-glycan
formation in humans (FIG. 1B). It is therefore desirable to have
this reaction occur in the ER or early Golgi of an engineered host
microorganism. A sub-library encoding ER and early Golgi retention
signals is used.
[0187] A series of fusion protein constructs (i.e., a combinatorial
DNA library) is then constructed by functionally linking one or a
series of targeting peptide sequences to one or a series of
sequences encoding catalytic domains. In a preferred embodiment,
this is accomplished by the in-frame ligation of a sub-library
comprising DNA encoding targeting peptide sequences (above) with a
sub-library comprising DNA encoding glycosylation enzymes or
catalytically active fragments thereof (see below).
[0188] The resulting library comprises synthetic genes encoding
targeting peptide sequence-containing fusion proteins. In some
cases it is desirable to provide a targeting peptide sequence at
the N-terminus of a fusion protein, or in other cases at the
C-terminus. In some cases, targeting peptide sequences may be
inserted within the open reading frame of an enzyme, provided the
protein structure of individual folded domains is not disrupted.
Each type of fusion protein is constructed (in a step-wise directed
or semi-random fashion) and optimal constructs may be selected upon
transformation of host cells and characterization of glycosylation
patterns in transformed cells using methods of the invention.
Generating Additional Sequence Diversity
[0189] The method of this embodiment is most effective when a
nucleic acid, e.g., a DNA library transformed into the host
contains a large diversity of sequences, thereby increasing the
probability that at least one transformant will exhibit the desired
phenotype. Single amino acid mutations, for example, may
drastically alter the activity of glycoprotein processing enzymes
(Romero et al., 2000). Accordingly, prior to transformation, a DNA
library or a constituent sub-library may be subjected to one or
more techniques to generate additional sequence diversity. For
example, one or more rounds of gene shuffling, error prone PCR, in
vitro mutagenesis or other methods for generating sequence
diversity, may be performed to obtain a larger diversity of
sequences within the pool of fusion constructs.
Expression Control Sequences
[0190] In addition to the open reading frame sequences described
above, it is generally preferable to provide each library construct
with expression control sequences, such as promoters, transcription
terminators, enhancers, ribosome binding sites, and other
functional sequences as may be necessary to ensure effective
transcription and translation of the fusion proteins upon
transformation of fusion constructs into the host organism.
[0191] Suitable vector components, e.g., selectable markers,
expression control sequences (e.g., promoter, enhancers,
terminators and the like) and, optionally, sequences required for
autonomous replication in a host cell, are selected as a function
of which particular host cell is chosen. Selection criteria for
suitable vector components for use in a particular mammalian or a
lower eukaryotic host cell are routine. Preferred lower eukaryotic
host cells of the invention include Pichia pastoris, Pichia
finlandica, Pichia trehalophila, Pichia koclamae, Pichia
membranaefaciens, Pichia opuntiae, Pichia thermotolerans, Pichia
salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia
methanolica, Pichia sp., Saccharomyces cerevisiae, Saccharomyces
sp., Hansenula polymorpha, Kluyveromyces sp., Kluyveromyces lactis,
Candida albicans, Aspergillus nidulans, Aspergillus niger,
Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense,
Fusarium sp. Fusarium gramineum, Fusarium venenatum and Neurospora
crassa. Where the host is Pichia pastoris, suitable promoters
include, for example, the AOX1, AOX2, GAPDH and P40 promoters.
Selectable Markers
[0192] It is also preferable to provide each construct with at
least one selectable marker, such as a gene to impart drug
resistance or to complement a host metabolic lesion. The presence
of the marker is useful in the subsequent selection of
transformants; for example, in yeast the URA3, H154, SUC2, G418,
BLA, or SH BLE genes may be used. A multitude of selectable markers
are known and available for use in yeast, fungi, plant, insect,
mammalian and other eukaryotic host cells.
Transformation
[0193] The nucleic acid library is then transformed into the host
organism. In yeast, any convenient method of DNA transfer may be
used, such as electroporation, the lithium chloride method, or the
spheroplast method. In filamentous fungi and plant cells,
conventional methods include particle bombardment, electroporation
and agrobacterium mediated transformation. To produce a stable
strain suitable for high-density culture (e.g., fermentation in
yeast), it is desirable to integrate the DNA library constructs
into the host chromosome. In a preferred embodiment, integration
occurs via homologous recombination, using techniques well-known in
the art. For example, DNA library elements are provided with
flanking sequences homologous to sequences of the host organism. In
this manner, integration occurs at a defined site in the host
genome, without disruption of desirable or essential genes.
[0194] In an especially preferred embodiment, library DNA is
integrated into the site of an undesired gene in a host chromosome,
effecting the disruption or deletion of the gene. For example,
integration into the sites of the OCH1, MNN1, or MNN4 genes allows
the expression of the desired library DNA while preventing the
expression of enzymes involved in yeast hypermannosylation of
glycoproteins. In other embodiments, library DNA may be introduced
into the host via a nucleic acid molecule, plasmid, vector (e.g.,
viral or retroviral vector), chromosome, and may be introduced as
an autonomous nucleic acid molecule or by homologous or random
integration into the host genome. In any case, it is generally
desirable to include with each library DNA construct at least one
selectable marker gene to allow ready selection of host organisms
that have been stably transformed. Recyclable marker genes such as
ura3, which can be selected for or against, are especially
suitable.
Screening and Selection Processes
[0195] After transformation of the host strain with the DNA
library, transformants displaying a desired glycosylation phenotype
are selected. Selection may be performed in a single step or by a
series of phenotypic enrichment and/or depletion steps using any of
a variety of assays or detection methods. Phenotypic
characterization may be carried out manually or using automated
high-throughput screening equipment. Commonly, a host microorganism
displays protein N-glycans on the cell surface, where various
glycoproteins are localized.
[0196] One may screen for those cells that have the highest
concentration of terminal GlcNAc on the cell surface, for example,
or for those cells which secrete the protein with the highest
terminal GlcNAc content. Such a screen may be based on a visual
method, like a staining procedure, the ability to bind specific
terminal GlcNAc binding antibodies or lectins conjugated to a
marker (such lectins are available from E.Y. Laboratories Inc., San
Mateo, Calif.), the reduced ability of specific lectins to bind to
terminal mannose residues, the ability to incorporate a
radioactively labeled sugar in vitro, altered binding to dyes or
charged surfaces, or may be accomplished by using a Fluorescence
Assisted Cell Sorting (FACS) device in conjunction with a
fluorophore labeled lectin or antibody (Guillen, 1998).
[0197] Accordingly, intact cells may be screened for a desired
glycosylation phenotype by exposing the cells to a lectin or
antibody that binds specifically to the desired N-glycan. A wide
variety of oligosaccharide-specific lectins are available
commercially (e.g., from EY Laboratories, San Mateo, Calif.).
Alternatively, antibodies to specific human or animal N-glycans are
available commercially or may be produced using standard
techniques. An appropriate lectin or antibody may be conjugated to
a reporter molecule, such as a chromophore, fluorophore,
radioisotope, or an enzyme having a chromogenic substrate (Guillen
et al., 1998. Proc. Nall. Acad. Sci. USA 95(14): 7888-7892)).
[0198] Screening may then be performed using analytical methods
such as spectrophotometry, fluorimetry, fluorescence activated cell
sorting, or scintillation counting. In other cases, it may be
necessary to analyze isolated glycoproteins or N-glycans from
transformed cells. Protein isolation may be carried out by
techniques known in the art. In a preferred embodiment, a reporter
protein is secreted into the medium and purified by affinity
chromatography (e.g. Ni-affinity or glutathione-S-transferase
affinity chromatography). In cases where an isolated N-glycan is
preferred, an enzyme such as endo-.beta.-N-acetylglucosaminidase
(Genzyme Co., Boston, Mass.; New England Biolabs, Beverly, Mass.)
may be used to cleave the N-glycans from glycoproteins. Isolated
proteins or N-glycans may then be analyzed by liquid chromatography
(e.g. HPLC), mass spectroscopy, or other suitable means. U.S. Pat.
No. 5,595,900 teaches several methods by which cells with desired
extracellular carbohydrate structures may be identified. In a
preferred embodiment, MALDI-TOF mass spectrometry is used to
analyze the cleaved N-glycans.
[0199] Prior to selection of a desired transformant, it may be
desirable to deplete the transformed population of cells having
undesired phenotypes. For example, when the method is used to
engineer a functional mannosidase activity into cells, the desired
transformants will have lower levels of mannose in cellular
glycoprotein. Exposing the transformed population to a lethal
radioisotope of mannose in the medium depletes the population of
transformants having the undesired phenotype, i.e. high levels of
incorporated mannose (Huffaker T C and Robbins P W., Proc Natl Acad
Sci USA. 1983 December; 80(24):7466-70). Alternatively, a cytotoxic
lectin or antibody, directed against an undesirable N-glycan, may
be used to deplete a transformed population of undesired phenotypes
(e.g., Stanley P and Siminovitch L. Somatic Cell Genet 1977 July;
3(4):391-405). U.S. Pat. No. 5,595,900 teaches several methods by
which cells with a desired extracellular carbohydrate structures
may be identified. Repeatedly carrying out this strategy allows for
the sequential engineering of more and more complex glycans in
lower eukaryotes.
[0200] To detect host cells having on their surface a high degree
of the human-like N-glycan intermediate
GlcNAcMan.sub.3GlcNAc.sub.2, for example, one may select for
transformants that allow for the most efficient transfer of GlcNAc
by GlcNAc Transferase from UDP-GlcNAc in an in vitro cell assay.
This screen may be carried out by growing cells harboring the
transformed library under selective pressure on an agar plate and
transferring individual colonies into a 96-well microtiter plate.
After growing the cells, the cells are centrifuged, the cells
resuspended in buffer, and after addition of UDP-GlcNAc and GnT II,
the release of UDP is determined either by HPLC or an enzyme linked
assay for UDP. Alternatively, one may use radioactively labeled
UDP-GlcNAc and GnT II, wash the cells and then look for the release
of radioactive GlcNAc by N-actylglucosaminidase. All this may be
carried manually or automated through the use of high throughput
screening equipment. Transformants that release more UDP, in the
first assay, or more radioactively labeled GlcNAc in the second
assay, are expected to have a higher degree of
GlcNAcMan.sub.3GlcNAc.sub.2 on their surface and thus constitute
the desired phenotype. Similar assays may be adapted to look at the
N-glycans on secreted proteins as well.
[0201] Alternatively, one may use any other suitable screen such as
a lectin binding assay that is able to reveal altered glycosylation
patterns on the surface of transformed cells. In this case the
reduced binding of lectins specific to terminal mannoses may be a
suitable selection tool. Galantus nivalis lectin binds specifically
to terminal .alpha.-1,3 mannose, which is expected to be reduced if
sufficient mannosidase II activity is present in the Golgi. One may
also enrich for desired transformants by carrying out a
chromatographic separation step that allows for the removal of
cells containing a high terminal mannose content. This separation
step would be carried out with a lectin column that specifically
binds cells with a high terminal mannose content (e.g., Galantus
nivalis lectin bound to agarose, Sigma, St. Louis, Mo.) over those
that have a low terminal mannose content.
[0202] In addition, one may directly create such fusion protein
constructs, as additional information on the localization of active
carbohydrate modifying enzymes in different lower eukaryotic hosts
becomes available in the scientific literature. For example, it is
known that human .beta.1,4-GalTr can be fused to the membrane
domain of MNT, a mannosyltransferase from S. cerevisiae, and
localized to the Golgi apparatus while retaining its catalytic
activity (Schwientek et al., 1995). If S. cerevisiae or a related
organism is the host to be engineered one may directly incorporate
such findings into the overall strategy to obtain complex N-glycans
from such a host. Several such gene fragments in P. pastoris have
been identified that are related to glycosyltransferases in S.
cerevisiae and thus could be used for that purpose.
Alteration of Host Cell Glycosylation Using
[0203] Fusion Constructs from Combinatorial Libraries
[0204] The construction of a preferred combinatorial DNA library is
illustrated schematically in FIG. 2 and described in Example 11.
The fusion construct may be operably linked to a multitude of
vectors, such as expression vectors well-known in the art. A wide
variety of such fusion constructs were assembled using
representative activities as shown in Table 6. Combinations of
targeting peptide/catalytic domains may be assembled for use in
targeting mannosidase, glycosyltransferase and glycosidase
activities in the ER, Golgi and the trans Golgi network according
to the invention. Surprisingly, the same catalytic domain may have
no effect to a very profound effect on N-glycosylation patterns,
depending on the type of targeting peptide used (see, e.g., Table
7, Example 11).
Mannosidase Fusion Constructs
[0205] A representative example of a mannosidase fusion construct
derived from a combinatorial DNA library of the invention is pFB8,
which a truncated Saccharomyces SEC12(m) targeting peptide
(988-1296 nucleotides of SEC12 from SwissProt P11655) ligated
in-frame to a 187 N-terminal amino acid deletion of a mouse
.alpha.-mannosidase IA (Genbank AN 6678787). The nomenclature used
herein, thus, refers to the targeting peptide/catalytic domain
region of a glycosylation enzyme as Saccharomyces SEC12 (m)/mouse
mannosidase IA .DELTA.187. The encoded fusion protein localizes in
the ER by means of the SEC12 targeting peptide sequence while
retaining its mannosidase catalytic domain activity and is capable
of producing in vivo N-glycans having a Man.sub.5GlcNAc.sub.2
structure (Example 11; FIG. 6F, FIG. 7B).
[0206] The fusion construct pGC5, Saccharomyces MNS1(m)/mouse
mannosidase IB .DELTA.99, is another example of a fusion construct
having intracellular mannosidase trimming activity (Example 11;
FIG. 5D, FIG. 8B). Fusion construct pBC18-5 (Saccharomyces
VAN1(s)/C. elegans mannosidase IB .DELTA.80) is yet another example
of an efficient fusion construct capable of producing N-glycans
having a Man.sub.5GlcNAc.sub.2 structure in vivo. By creating a
combinatorial DNA library of these and other such mannosidase
fusion constructs according to the invention, a skilled artisan may
distinguish and select those constructs having optimal
intracellular trimming activity from those having relatively low or
no activity. Methods using combinatorial DNA libraries of the
invention are advantageous because only a select few mannosidase
fusion constructs may produce a particularly desired N-glycan in
vivo.
[0207] In addition, mannosidase trimming activity may be specific
to a particular protein of interest. Thus, it is to be further
understood that not all targeting peptide/mannosidase catalytic
domain fusion constructs may function equally well to produce the
proper glycosylation on a glycoprotein of interest. Accordingly, a
protein of interest may be introduced into a host cell transfected
with a combinatorial DNA library to identify one or more fusion
constructs which express a mannosidase activity optimal for the
protein of interest. One skilled in the art will be able to produce
and select optimal fusion construct(s) using the combinatorial DNA
library approach described herein.
[0208] It is apparent, moreover, that other such fusion constructs
exhibiting localized active mannosidase catalytic domains (or more
generally, domains of any enzyme) may be made using techniques such
as those exemplified in Example 11 and described herein. It will be
a matter of routine experimentation for one skilled in the art to
make and use the combinatorial DNA library of the present invention
to optimize, for example, Man.sub.5GlcNAc.sub.2 production from a
library of fusion constructs in a particular expression vector
introduced into a particular host cell.
Glycosyltransferase Fusion Constructs
[0209] Similarly, a glycosyltransferase combinatorial DNA library
was made using the methods of the invention. A combinatorial DNA
library of sequences derived from glycosyltransferase I (GnTI)
activities were assembled with targeting peptides and screened for
efficient production in a lower eukaryotic host cell of a
GlcNAcMan.sub.5GlcNAc.sub.2 N-glycan structure on a marker
glycoprotein. A fusion construct shown to produce
GlcNAcMan.sub.5GlcNAc.sub.2 (pPB104), Saccharomyces MNN9(s)/human
GnTI 438 was identified (Example 15). A wide variety of such GnTI
fusion constructs were assembled (Example 15, Table 10). Other
combinations of targeting peptide/GnTI catalytic domains can
readily be assembled by making a combinatorial DNA library. It is
also apparent to one skilled in the art that other such fusion
constructs exhibiting glycosyltransferase activity may be made as
demonstrated in Example 15. It will be a matter of routine
experimentation for one skilled in the art to use the combinatorial
DNA library method described herein to optimize
GlcNAcMan.sub.5GlcNAc.sub.2 production using a selected fusion
construct in a particular expression vector and host cell line.
[0210] As stated above for mannosidase fusion constructs, not all
targeting peptide/GnTI catalytic domain fusion constructs will
function equally well to produce the proper glycosylation on a
glycoprotein of interest as described herein. However, one skilled
in the art will be able to produce and select optimal fusion
construct(s) using a DNA library approach as described herein.
Example 15 illustrates a preferred embodiment of a combinatorial
DNA library comprising targeting peptides and GnTI catalytic domain
fusion constructs involved in producing glycoproteins with
predominantly GlcNAcMan.sub.5GlcNAc.sub.2 structure.
Using Multiple Fusion Constructs to Alter Host Cell
Glycosylation
[0211] In another example of using the methods and libraries of the
invention to alter host cell glycosylation, a P. pastoris strain
with an OCH1 deletion that expresses a reporter protein (K3) was
transformed with multiple fusion constructs isolated from
combinatorial libraries of the invention to convert high mannose
N-glycans to human-like N-glycans (Example 15). First, the
mannosidase fusion construct pFB8 (Saccharomyces SEC12 (m)/mouse
mannosidase IA .DELTA.187) was transformed into a P. pastoris
strain lacking 1,6 initiating mannosyltransferases activity (i.e.
och1 deletion; Example 1). Second, pPB103 comprising a K. lactis
MNN2-2 gene (Genbank AN AF106080) encoding an UDP-GlcNAc
transporter was constructed to increase further production of
GlcNAcMan.sub.5GlcNAc.sub.2. The addition of the UDP-GlcNAc
transporter increased production of GlcNAcMan.sub.5GlcNAc.sub.2
significantly in the P. pastoris strain as illustrated in FIG. 10B.
Third, pPB104 comprising Saccharomyces MNN9 (s)/human GnTI 438 was
introduced into the strain. This P. pastoris strain is referred to
as "PBP-3."
[0212] It is understood by one skilled in the art that host cells
such as the above-described yeast strains can be sequentially
transformed and/or co-transformed with one or more expression
vectors. It is also understood that the order of transformation is
not particularly relevant in producing the glycoprotein of
interest. The skilled artisan recognizes the routine modifications
of the procedures disclosed herein may provide improved results in
the production of the glycoprotein of interest.
[0213] The importance of using a particular targeting peptide
sequence with a particular catalytic domain sequence becomes
readily apparent from the experiments described herein. The
combinatorial DNA library provides a tool for constructing enzyme
fusions that are involved in modifying N-glycans on a glycoprotein
of interest, which is especially useful in producing human-like
glycoproteins. (Any enzyme fusion, however, may be selected using
libraries and methods of the invention.) Desired transformants
expressing appropriately targeted, active .alpha.-1,2-mannosidase
produce K3 with N-glycans of the structure Man.sub.5GlcNAc.sub.2 as
shown in FIGS. 5D and 5E. This confers a reduced molecular mass to
the cleaved glycan compared to the K3 of the parent OCH1 deletion
strain, as was detected by MALDI-TOF mass spectrometry in FIG.
5C.
[0214] Similarly, the same approach was used to produce another
secreted glycoprotein: IFN-.beta. comprising predominantly
Man.sub.5GlcNAc.sub.2. The Man.sub.5GlcNAc.sub.2 was removed by
PNGase digestion (Papac et al. 1998 Glycobiology 8, 445-454) and
subjected to MALDI-TOF as shown in FIG. 6A-6F. A single prominent
peak at 1254 (m/z) confirms Man.sub.5GlcNA.sub.2 production on
IFN-.beta. in FIG. 6E (pGC5) (Saccharomyces MNS1(m)/mouse
mannosidase IB .DELTA.99) and 6F (pFB8) (Saccharomyces SEC12
(m)/mouse mannosidase IA .DELTA.187). Furthermore, in the P.
pastoris strain PBP-3 comprising pFB8 (Saccharomyces SEC12
(m)/mouse mannosidase IA .DELTA.187), pPB104 (Saccharomyces MNN9
(s)/human GnTI 438) and pPB103 (K. lactis MNN2-2 gene), the hybrid
N-glycan GlcNAcMan.sub.5GlcNAc.sub.2 [b] was detected by MALDI-TOF
(FIG. 10).
[0215] After identifying transformants with a high degree of
mannose trimming, additional experiments were performed to confirm
that mannosidase (trimming) activity occurred in vivo and was not
predominantly the result of extracellular activity in the growth
medium (Example 13; FIGS. 7-9).
Host Cells
[0216] Although the present invention is exemplified using a P.
pastoris host organism, it is understood by those skilled in the
art that other eukaryotic host cells, including other species of
yeast and fungal hosts, may be altered as described herein to
produce human-like glycoproteins. The techniques described herein
for identification and disruption of undesirable host cell
glycosylation genes, e.g. OCH1, is understood to be applicable for
these and/or other homologous or functionally related genes in
other eukaryotic host cells such as other yeast and fungal strains.
As described in Example 16, och1 mnn1 genes were deleted from K.
lactis to engineer a host cell leading to N-glycans that are
completely converted to Man.sub.5GlcNAc.sub.2 by 1,2-mannosidase
(FIG. 12C).
[0217] The MNN1 gene was cloned from K. lactis as described in
Example 16. The nucleic acid and deduced amino acid sequences of
the K. lactis MNN1 gene are shown in SEQ ID NOS: 43 and 44,
respectively. Using gene-specific primers, a construct was made to
delete the MNN1 gene from the genome of K. lactis (Example 16).
Host cells depleted in och1 and mnn1 activities produce N-glycans
having a Man.sub.9GlcNAc.sub.2 carbohydrate structure (see, e.g.,
FIG. 10). Such host cells may be engineered further using, e.g.,
methods and libraries of the invention, to produce mammalian- or
human-like glycoproteins.
[0218] Thus, in another embodiment, the invention provides an
isolated nucleic acid molecule having a nucleic acid sequence
comprising or consisting of at least forty-five, preferably at
least 50, more preferably at least 60 and most preferably 75 or
more nucleotide residues of the K. lactis MNN1 gene (SEQ ID NO:
43), and homologs, variants and derivatives thereof. The invention
also provides nucleic acid molecules that hybridize under stringent
conditions to the above-described nucleic acid molecules.
Similarly, isolated polypeptides (including muteins, allelic
variants, fragments, derivatives, and analogs) encoded by the
nucleic acid molecules of the invention are provided. In addition,
also provided are vectors, including expression vectors, which
comprise a nucleic acid molecule of the invention, as described
further herein. Similarly host cells transformed with the nucleic
acid molecules or vectors of the invention are provided.
[0219] Another aspect of the present invention thus relates to a
non-human eukaryotic host strain expressing glycoproteins
comprising modified N-glycans that resemble those made by
human-cells. Performing the methods of the invention in species
other than yeast and fungal cells is thus contemplated and
encompassed by this invention. It is contemplated that a
combinatorial nucleic acid library of the present invention may be
used to select constructs that modify the glycosylation pathway in
any eukaryotic host cell system. For example, the combinatorial
libraries of the invention may also be used in plants, algae and
insects, and in other eukaryotic host cells, including mammalian
and human cells, to localize proteins, including glycosylation
enzymes or catalytic domains thereof, in a desired location along a
host cell secretory pathway. Preferably, glycosylation enzymes or
catalytic domains and the like are targeted to a subcellular
location along the host cell secretory pathway where they are
capable of functioning, and preferably, where they are designed or
selected to function most efficiently.
[0220] As described in Examples 17 and 18, plant and insect cells
may be engineered to alter the glycosylation of expressed proteins
using the combinatorial library and methods of the invention.
Furthermore, glycosylation in mammalian cells, including human
cells, may also be modified using the combinatorial library and
methods of the invention. It may be possible, for example, to
optimize a particular enzymatic activity or to otherwise modify the
relative proportions of various N-glycans made in a mammalian host
cell using the combinatorial library and methods of the
invention.
[0221] Examples of modifications to glycosylation which can be
affected using a method according to this embodiment of the
invention are: (1) engineering a eukaryotic host cell to trim
mannose residues from Man.sub.8GlcNAc.sub.2 to yield a
Man.sub.5GlcNAc.sub.2N-glycan; (2) engineering eukaryotic host cell
to add an N-acetylglucosamine (GlcNAc) residue to
Man.sub.5GlcNAc.sub.2 by action of GlcNAc transferase I; (3)
engineering a eukaryotic host cell to functionally express an
enzyme such as an N-acetylglucosaminyl Transferase (GnTI, GnTII,
GnTIII, GnTIV, GnTV, GnTVI), mannosidase II, fucosyltransferase
(FT), galactosyl tranferase (GalT) or a sialyltransferase (ST).
[0222] By repeating the method, increasingly complex glycosylation
pathways can be engineered into a target host, such as a lower
eukaryotic microorganism. In one preferred embodiment, the host
organism is transformed two or more times with DNA libraries
including sequences encoding glycosylation activities. Selection of
desired phenotypes may be performed after each round of
transformation or alternatively after several transformations have
occurred. Complex glycosylation pathways can be rapidly engineered
in this manner.
Sequential Glycosylation Reactions
[0223] In a preferred embodiment, such targeting peptide/catalytic
domain libraries are designed to incorporate existing information
on the sequential nature of glycosylation reactions in higher
eukaryotes. Reactions known to occur early in the course of
glycoprotein processing require the targeting of enzymes that
catalyze such reactions to an early part of the Golgi or the ER.
For example, the trimming of Man.sub.8GlcNAc.sub.2 to
Man.sub.5GlcNAc.sub.2 by mannosidases is an early step in complex
N-glycan formation. Because protein processing is initiated in the
ER and then proceeds through the early, medial and late Golgi, it
is desirable to have this reaction occur in the ER or early Golgi.
When designing a library for mannosidase I localization, for
example, one thus attempts to match ER and early Golgi targeting
signals with the catalytic domain of mannosidase I.
Integration Sites
[0224] As one ultimate goal of this genetic engineering effort is a
robust protein production strain that is able to perform well in an
industrial fermentation process, the integration of multiple genes
into the host (e.g., fungal) chromosome preferably involves careful
planning. The engineered strain may likely have to be transformed
with a range of different genes, and these genes will have to be
transformed in a stable fashion to ensure that the desired activity
is maintained throughout the fermentation process. As described
herein, any combination of various desired enzyme activities may be
engineered into the fungal protein expression host, e.g.,
sialyltransferases, mannosidases, fucosyltransferases,
galactosyltransferases, glucosyltransferases, GlcNAc transferases,
ER and Golgi specific transporters (e.g. syn and antiport
transporters for UDP-galactose and other precursors), other enzymes
involved in the processing of oligosaccharides, and enzymes
involved in the synthesis of activated oligosaccharide precursors
such as UDP-galactose, CMP-N-acetylneuraminic acid. Examples of
preferred methods for modifying glycosylation in a lower eukaryotic
host cell, such as Pichia pastoris, are shown in Table 6. (The HDEL
and KDEL signal peptides in the second row of the third column are
shown in SEQ ID NOS5 and 6, respectively).
TABLE-US-00006 TABLE 6 Some preferred embodiments for modifying
glycosylation in a lower eukaroytic microorganism Suitable Suitable
Suitable Sources of Suitable Transporters Desired Catalytic
Localization Gene and/or Structure Activities Sequences Deletions
Phosphatases Man.sub.5GlcNAc.sub.2 .alpha.-1,2- Mns1 (N-terminus,
OCH1 none mannosidase S. cerevisiae) MNN4 (murine, Och1
(N-terminus, MNN6 human, S. cerevisiae, Bacillus sp., P. pastoris)
A. nidulans) Ktr1 Mnn9 Mnt1 (S. cerevisiae) KDEL, HDEL (C-terminus)
GlcNAcMan.sub.5GlcNAc.sub.2 GlcNAc Och1 (N-terminus, OCH1
UDP-GlcNAc Transferase I, S. cerevisiae, MNN4 transporter (human,
P. pastoris) MNN6 (human, murine, murine, rat KTR1 (N-terminus) K.
lactis) etc.) Mnn1 (N-terminus, UDPase S. cerevisiae) (human) Mnt1
(N-terminus, S. cerevisiae) GDPase (N-terminus, S. cerevisiae)
GlcNAcMan.sub.3GlcNAc.sub.2 mannosidase Ktr1 OCH1 UDP-GlcNAc II
Mnn1 (N-terminus, MNN4 transporter S. cerevisiae) MNN6 (human,
murine, Mnt1(N-terminus, K. lactis) S. cerevisiae) UDPase Kre2/Mnt1
(human) (S. cerevisiae) Kre2 (P. pastoris) Ktr1 (S. cerevisiae)
Ktr1 (P. pastoris) Mnn1 (S. cerevisiae)
GlcNAc.sub.(2-4)Man.sub.3GlcNAc.sub.2 GlcNAc Mnn1 (N-terminus, OCH1
UDP-GlcNAc Transferase S. cerevisiae) MNN4 transporter II, III, IV,
V Mnt1 (N-terminus, MNN6 (human, murine, (human, S. cerevisiae) K.
lactis) murine) Kre2/Mnt1 UDPase (S. cerevisiae) (human) Kre2 (P.
pastoris) Ktr1 (S. cerevisiae) Ktr1 (P. pastoris) Mnn1 (S.
cerevisiae) Gal.sub.(1-4)GlcNAc.sub.(2-4)- .beta.-1,4- Mnn1
(N-terminus, OCH1 UDP-Galactose Man.sub.3GlcNAc.sub.2 Galactosyl S.
cerevisiae) MNN4 transporter transferase Mnt1(N-terminus, MNN6
(human, S. pombe) (human) S. cerevisiae) Kre2/Mnt1 (S. cerevisiae)
Kre2 (P. pastoris) Ktr1 (S. cerevisiae) Ktr1 (P. pastoris) Mnn1 (S.
cerevisiae) NANA.sub.(1-4)- .alpha.-2,6- KTR1 OCH1 CMP-Sialic acid
Gal.sub.(1-4)GlcNAc.sub.(2-4)- Sialyltransferase MNN1 (N-terminus,
MNN4 transporter Man.sub.3GlcNAc.sub.2 (human) S. cerevisiae) MNN6
(human) .alpha.-2,3- MNT1 (N-terminus, Sialyltransferase S.
cerevisiae) Kre2/Mnt1 (S. cerevisiae) Kre2 (P. pastoris) Ktr1 (S.
cerevisiae) Ktr1 (P. pastoris) MNN1 (S. cerevisiae)
[0225] As any strategy to engineer the formation of complex
N-glycans into a host cell such as a lower eukaryote involves both
the elimination as well as the addition of particular
glycosyltransferase activities, a comprehensive scheme will attempt
to coordinate both requirements. Genes that encode enzymes that are
undesirable serve as potential integration sites for genes that are
desirable. For example, 1,6 mannosyltransferase activity is a
hallmark of glycosylation in many known lower eukaryotes. The gene
encoding alpha-1,6 mannosyltransferase (OCH1) has been cloned from
S. cerevisiae and mutations in the gene give rise to a viable
phenotype with reduced mannosylation. The gene locus encoding
alpha-1,6 mannosyltransferase activity therefore is a prime target
for the integration of genes encoding glycosyltransferase activity.
In a similar manner, one can choose a range of other chromosomal
integration sites that, based on a gene disruption event in that
locus, are expected to: (1) improve the cells ability to
glycosylate in a more human-like fashion, (2) improve the cells
ability to secrete proteins, (3) reduce proteolysis of foreign
proteins and (4) improve other characteristics of the process that
facilitate purification or the fermentation process itself.
Target Glycoproteins
[0226] The methods described herein are useful for producing
glycoproteins, especially glycoproteins used therapeutically in
humans. Glycoproteins having specific glycoforms may be especially
useful, for example, in the targeting of therapeutic proteins. For
example, mannose-6-phosphate has been shown to direct proteins to
the lysosome, which may be essential for the proper function of
several enzymes related to lysosomal storage disorders such as
Gaucher's, Hunter's, Hurler's, Scheie's, Fabry's and Tay-Sachs
disease, to mention just a few. Likewise, the addition of one or
more sialic acid residues to a glycan side chain may increase the
lifetime of a therapeutic glycoprotein in vivo after
administration. Accordingly, host cells (e.g., lower eukaryotic or
mammalian) may be genetically engineered to increase the extent of
terminal sialic acid in glycoproteins expressed in the cells.
Alternatively, sialic acid may be conjugated to the protein of
interest in vitro prior to administration using a sialic acid
transferase and an appropriate substrate. Changes in growth medium
composition may be employed in addition to the expression of enzyme
activities involved in human-like glycosylation to produce
glycoproteins more closely resembling human forms (S. Weikert, et
al., Nature Biotechnology, 1999, 17, 1116-1121; Werner, Noe, et al
1998 Arzneimittelforschung 48(8):870-880; Weikert, Papac et al.,
1999; Andersen and Goochee 1994 Cur. Opin. Biotechnol. 5: 546-549;
Yang and Butler 2000 Biotechnol. Bioengin. 68(4): 370-380).
Specific glycan modifications to monoclonal antibodies (e.g. the
addition of a bisecting GlcNAc) have been shown to improve antibody
dependent cell cytotoxicity (Umana P., et al. 1999), which may be
desirable for the production of antibodies or other therapeutic
proteins.
[0227] Therapeutic proteins are typically administered by
injection, orally, pulmonary, or other means. Examples of suitable
target glycoproteins which may be produced according to the
invention include, without limitation: erythropoietin, cytokines
such as interferon-.alpha., interferon-.beta., interferon-.gamma.,
interferon-.omega., and granulocyte-CSF, coagulation factors such
as factor VIII, factor IX, and human protein C, soluble IgE
receptor .alpha.-chain, IgG, IgG fragments, IgM, interleukins,
urokinase, chymase, and urea trypsin inhibitor, IGF-binding
protein, epidermal growth factor, growth hormone-releasing factor,
annexin V fusion protein, angiostatin, vascular endothelial growth
factor-2, myeloid progenitor inhibitory factor-1, osteoprotegerin,
.alpha.-1-antitrypsin and .alpha.-feto proteins.
[0228] The following are examples which illustrate the compositions
and methods of this invention. These examples should not be
construed as limiting: the examples are included for the purposes
of illustration only.
Example 1
Cloning and Disruption of the OCH1 gene in P. pastoria
[0229] Generation of an OCH1 Mutant of P. pastoris:
[0230] A 1215 bp ORF of the P. pastoris OCH1 gene encoding a
putative .alpha.-1,6 mannosyltransferase was amplified from P.
pastoris genomic DNA (strain X-33, Invitrogen, Carlsbad, Calif.)
using the oligonucleotides 5'-ATGGCGAAGGCAGATGGCAGT-3' (SEQ ID
NO:7) and 5'-TTAGTCCTTCCAACTTCCTTC-3' (SEQ ID NO:8) which were
designed based on the P. pastoris OCH1 sequence (Japanese Patent
Application Publication No. 8-336387). Subsequently, 2685 bp
upstream and 1175 bp downstream of the ORF of the OCH1 gene were
amplified from a P. pastoris genomic DNA library (Boehm, T. et al.
Yeast 1999 May; 15(7):563-72) using the internal oligonucleotides
5'-ACTGCCATCTGCCTTCGCCAT-3' (SEQ ID NO:9) in the OCH1 gene, and
5'-GTAATACGACTCACTATAGGGC-3' T7 (SEQ ID NO:10) and
5'-AATTAACCCTCACTAAAGGG-3' T3 (SEQ ID NO:11) oligonucleotides in
the backbone of the library bearing plasmid lambda ZAP II
(Stratagene, La Jolla, Calif.). The resulting 5075 bp fragment was
cloned into the pCR2.1-TOPO vector (Invitrogen, Carlsbad, Calif.)
and designated pBK9.
[0231] After assembling a gene knockout construct that substituted
the OCH1 reading frame with a HIS4 resistance gene, P. pastoris was
transformed and colonies were screened for temperature sensitivity
at 37.degree. C. OCH1 mutants of S. cerevisiae are temperature
sensitive and are slow growers at elevated temperatures. One can
thus identify functional homologs of OCH1 in P. pastoris by
complementing an OCH1 mutant of S. cerevisiae with a P. pastoris
DNA or cDNA library. About 20 temperature sensitive strains were
further subjected to a colony PCR screen to identify colonies with
a deleted och1 gene. Several och1 deletions were obtained.
[0232] The linearized pBK9.1, which has 2.1 kb upstream sequence
and 1.5 kb down stream sequence of OCH1 gene cassette carrying
Pichia HIS4 gene, was transformed into P. pastoris BK1 [GS115 (his4
Invitrogen Corp., San Diego, Calif.) carrying the human IFN-.beta.
gene in the AOX1 locus] to knock out the wild-type OCH1 gene. The
initial screening of transformants was performed using histidine
drop-out medium followed by replica plating to select the
temperature sensitive colonies. Twenty out of two hundred
histidine-positive colonies showed a temperature sensitive
phenotype at 37.degree. C. To exclude random integration of pBK9.1
into the Pichia genome, the 20 temperature-sensitive isolates were
subjected to colony PCR using primers specific to the upstream
sequence of the integration site and to HIS4 ORF. Two out of twenty
colonies were och1 defective and further analyzed using a Southern
blot and a Western blot indicating the functional och1 disruption
by the och1 knock-out construct. Genomic DNA were digested using
two separate restriction enzymes BgIII and ClaI to confirm the och1
knock-out and to confirm integration at the open reading frame. The
Western Blot showed och1 mutants lacking a discrete band produced
in the GS115 wild type at 46.2 kDa.
Example 2
Engineering of P. pastoris with .alpha.-1,2-Mannosidase to Produce
Man.sub.5GlcNAc.sub.2-Containing IFN-.beta. Precursors
[0233] An .alpha.-1,2-mannosidase is required for the trimming of
Man.sub.8GlcNAc.sub.2 to yield Man.sub.5GlcNAc.sub.2, an essential
intermediate for complex N-glycan formation. While the production
of a Man.sub.5GlcNAc.sub.2 precursor is essential, it is not
necessarily sufficient for the production of hybrid and complex
glycans because the specific isomer of Man.sub.5GlcNAc.sub.2 may or
may not be a substrate for GnTI. An och1 mutant of P. pastoris is
engineered to express secreted human interferon-.beta. under the
control of an aox promoter. A DNA library is constructed by the
in-frame ligation of the catalytic domain of human mannosidase IB
(an .alpha.-1,2-mannosidase) with a sub-library including sequences
encoding early Golgi and ER localization peptides. The DNA library
is then transformed into the host organism, resulting in a
genetically mixed population wherein individual transformants each
express interferon-.beta. as well as a synthetic mannosidase gene
from the library. Individual transformant colonies are cultured and
the production of interferon is induced by addition of methanol.
Under these conditions, over 90% of the secreted protein is
glycosylated interferon-.beta..
[0234] Supernatants are purified to remove salts and low-molecular
weight contaminants by C.sub.18 silica reversed-phase
chromatography. Desired transformants expressing appropriately
targeted, active .alpha.-1,2-mannosidase produce interferon-.beta.
including N-glycans of the structure Man.sub.5GlcNAc.sub.2, which
has a reduced molecular mass compared to the interferon-.beta. of
the parent strain. The purified interferon-.beta. is analyzed by
MALDI-TOF mass spectroscopy and colonies expressing the desired
form of interferon-.beta. are identified.
Example 3
Generation of an och1 Mutant Strain Expressing an
.alpha.-1,2-Mannosidase, GnTI and GnTII for Production of a
Human-Like Glycoprotein
[0235] The 1215 bp open reading frame of the P. pastoris OCH1 gene
as well as 2685 bp upstream and 1175 bp downstream was amplified by
PCR (see also WO 02/00879), cloned into the pCR2.1-TOPO vector
(Invitrogen) and designated pBK9. To create an och1 knockout strain
containing multiple auxotrophic markers, 100 .mu.g of pJN329, a
plasmid containing an och1::URA3 mutant allele flanked with SfiI
restriction sites was digested with SfiI and used to transform P.
pastoris strain JC308 (Cereghino et al. Gene 263 (2001) 159-169) by
electroporation. Following incubation on defined medium lacking
uracil for 10 days at room temperature, 1000 colonies were picked
and re-streaked. URA.sup.+ clones that were unable to grow at
37.degree. C., but grew at room temperature, were subjected to
colony PCR to test for the correct integration of the och1:: URA3
mutant allele. One clone that exhibited the expected PCR pattern
was designated YJN153. The Kringle 3 domain of human plasminogen
(K3) was used as a model protein. A Neo.sup.R marked plasmid
containing the K3 gene was transformed into strain YJN153 and a
resulting strain, expressing K3, was named BK64-1.
[0236] Plasmid pPB 103, containing the Kluyveromyces lactis MNN2-2
gene which encodes a Golgi UDP-N-acetylglucosamine transporter was
constructed by cloning a blunt BglII-HindIII fragment from vector
pDL02 (Abeijon et al. (1996) Proc. Natl. Acad. Sci. U.S.A.
93:5963-5968) into BglII and BamHI digested and blunt ended
pBLADE-SX containing the P. pastoris ADE1 gene (Cereghino et al.
(2001) Gene 263:159-169). This plasmid was linearized with EcoNI
and transformed into strain BK64-1 bp electroporation and one
strain confirmed to contain the MNN2-2 by PCR analysis was named
PBP1.
[0237] A library of mannosidase constructs was generated,
comprising in-frame fusions of the leader domains of several type I
or type II membrane proteins from S. cerevisiae and P. pastoris
fused with the catalytic domains of several .alpha.-1,2-mannosidase
genes from human, mouse, fly, worm and yeast sources (see, e.g.,
WO02/00879, incorporated herein by reference). This library was
created in a P. pastoris HIS4 integration vector and screened by
linearizing with SalI, transforming by electroporation into strain
PBP1, and analyzing the glycans released from the K3 reporter
protein. One active construct chosen was a chimera of the 988-1296
nucleotides (C-terminus) of the yeast SEC12 gene fused with a
N-terminal deletion of the mouse .alpha.-1,2-mannosidase IA gene
(FIG. 3), which was missing the 187 nucleotides. A P. pastoris
strain expressing this construct was named PBP2.
[0238] A library of GnTI constructs was generated, comprising
in-frame fusions of the same leader library with the catalytic
domains of GnTI genes from human, worm, frog and fly sources (WO
02/00879). This library was created in a P. pastoris ARG4
integration vector and screened by linearizing with AatII,
transforming by electroporation into strain PBP2, and analyzing the
glycans released from K3. One active construct chosen was a chimera
of the first 120 bp of the S. cerevisiae MNN9 gene fused to a
deletion of the human GnTI gene, which was missing the first 154
bp. A P. pastoris strain expressing this construct was named
PBP3.
[0239] A library of GnTII constructs was generated, which comprised
in-frame fusions of the leader library with the catalytic domains
of GnTII genes from human and rat sources (WO 02/00879). This
library was created in a P. pastoris integration vector containing
the NST.sup.R gene conferring resistance to the drug
nourseothricin. The library plasmids were linearized with EcoRI,
transformed into strain RDP27 by electroporation, and the resulting
strains were screened by analysis of the released glycans from
purified K3.
Materials for the Following Reactions
[0240] MOPS, sodium cacodylate, manganese chloride, UDP-galactose
and CMP-N-acetylneuraminic acid were from Sigma. Trifluoroacetic
acid (TFA) was from Sigma/Aldrich, Saint Louis, Mo. Recombinant rat
.alpha.2,6-sialyltransferase from Spodoptera frugiperda and
.beta.1,4-galactosyltransferase from bovine milk were from
Calbiochem (San Diego, Calif.). Protein N-glycosidase F,
mannosidases, and oligosaccharides were from Glyko (San Rafael,
Calif.). DEAE ToyoPearl resin was from TosoHaas. Metal chelating
"HisBind" resin was from Novagen (Madison, Wis.). 96-well
lysate-clearing plates were from Promega (Madison, Wis.).
Protein-binding 96-well plates were from Millipore (Bedford,
Mass.). Salts and buffering agents were from Sigma (St. Louis,
Mo.). MALDI matrices were from Aldrich (Milwaukee, Wis.).
Protein Purification
[0241] Kringle 3 was purified using a 96-well format on a Beckman
BioMek 2000 sample-handling robot (Beckman/Coulter Ranch Cucamonga,
Calif.). Kringle 3 was purified from expression media using a
C-terminal hexa-histidine tag. The robotic purification is an
adaptation of the protocol provided by Novagen for their HisBind
resin. Briefly, a 150 uL (.mu.L) settled volume of resin is poured
into the wells of a 96-well lysate-binding plate, washed with 3
volumes of water and charged with 5 volumes of 50 mM NiSO4 and
washed with 3 volumes of binding buffer (5 mM imidazole, 0.5M NaCl,
20 mM Tris-HCL pH7.9). The protein expression media is diluted 3:2,
media/PBS (60 mM PO4, 16 mM KCl, 822 mM NaCl pH7.4) and loaded onto
the columns. After draining, the columns are washed with 10 volumes
of binding buffer and 6 volumes of wash buffer (30 mM imidazole,
0.5M NaCl, 20 mM Tris-HCl pH7.9) and the protein is eluted with 6
volumes of elution buffer (1M imidazole, 0.5M NaCl, 20 mM Tris-HCl
pH7.9). The eluted glycoproteins are evaporated to dryness by
lyophilyzation.
Release of N-linked Glycans
[0242] The glycans are released and separated from the
glycoproteins by a modification of a previously reported method
(Papac, et al. A. J. S. (1998) Glycobiology 8, 445-454). The wells
of a 96-well MultiScreen IP (Immobilon-P membrane) plate
(Millipore) are wetted with 100 uL of methanol, washed with
3.times.150 uL of water and 50 uL of RCM buffer (8M urea, 360 mM
Tris, 3.2 mM EDTA pH8.6), draining with gentle vacuum after each
addition. The dried protein samples are dissolved in 30 uL of RCM
buffer and transferred to the wells containing 10 uL of RCM buffer.
The wells are drained and washed twice with RCM buffer. The
proteins are reduced by addition of 60 uL of 0.1M DTT in RCM buffer
for 1 hr at 37.degree. C. The wells are washed three times with 300
uL of water and carboxymethylated by addition of 60 uL of 0.1M
iodoacetic acid for 30 min in the dark at room temperature. The
wells are again washed three times with water and the membranes
blocked by the addition of 100 uL of 1% PVP 360 in water for 1 hr
at room temperature. The wells are drained and washed three times
with 300 uL of water and deglycosylated by the addition of 30 uL of
10 mM NH.sub.4HCO.sub.3 pH 8.3 containing one milliunit of
N-glycanase (Glyko). After 16 hours at 37.degree. C., the solution
containing the glycans was removed by centrifugation and evaporated
to dryness.
Matrix Assisted Laser Desorption Ionization Time of Flight Mass
Spectrometry
[0243] Molecular weights of the glycans were determined using a
Voyager DE PRO linear MALDI-TOF (Applied Biosciences) mass
spectrometer using delayed extraction. The dried glycans from each
well were dissolved in 15 uL of water and 0.5 uL spotted on
stainless steel sample plates and mixed with 0.5 uL of S-DHB matrix
(9 mg/mL of dihydroxybenzoic acid, 1 mg/mL of 5-methoxysalicilic
acid in 1:1 water/acetonitrile 0.1% TFA) and allowed to dry.
[0244] Ions were generated by irradiation with a pulsed nitrogen
laser (337 nm) with a 4 ns pulse time. The instrument was operated
in the delayed extraction mode with a 125 ns delay and an
accelerating voltage of 20 kV. The grid voltage was 93.00%, guide
wire voltage was 0.10%, the internal pressure was less than
5.times.10-7 torr, and the low mass gate was 875 Da. Spectra were
generated from the sum of 100-200 laser pulses and acquired with a
2 GHz digitizer. Man.sub.5GlcNAc.sub.2 oligosaccharide was used as
an external molecular weight standard. All spectra were generated
with the instrument in the positive ion mode. The estimated mass
accuracy of the spectra was 0.5%.
Example 4
Engineering a Strain to Produce Galactosyltransferase
Galactosyltransferase Reaction
[0245] Approximately 2 mg of protein (r-K3:hPg [PBP6-5]) was
purified by nickel-affinity chromatography, extensively dialyzed
against 0.1% TFA, and lyophilized to dryness. The protein was
redissolved in 150 .mu.L of 50 mM MOPS, 20 mM MnCl2, pH7.4. After
addition of 32.5 .mu.g (533 nmol) of UDP-galactose and 4 mU of
.beta.1,4-galactosyltransferase, the sample was incubated at 37 C
for 18 hours. The samples were then dialyzed against 0.1% TFA for
analysis by MALDI-TOF mass spectrometry.
[0246] The spectrum of the protein reacted with
galactosyltransferase showed an increase in mass consistent with
the addition of two galactose moieties when compared with the
spectrum of a similar protein sample incubated without enzyme.
Protein samples were next reduced, carboxymethylated and
deglycosylated with PNGase F. The recovered N-glycans were analyzed
by MALDI-TOF mass spectrometry. The mass of the predominant glycan
from the galactosyltransferase reacted protein was greater than
that of the control glycan by a mass consistent with the addition
of two galactose moieties (325.4 Da).
Example 5
Engineering a Strain to Express functional and active Mannosidase
II
[0247] To generate a human-like glycoform, a microorganism is
engineered to express a mannosidase II enzyme which removes the two
remaining terminal mannoses from the structure
GlcNAcMan.sub.5GlcNAc.sub.2 (see FIG. 1B). A DNA library including
sequences encoding cis and medial Golgi localization signals is
fused in-frame to a library encoding mannosidase II catalytic
domains. The host organism is a strain, e.g. a yeast, that is
deficient in hypermannosylation (e.g. an och1 mutant) and provides
N-glycans having the structure GlcNAcMan.sub.5GlcNAc.sub.2 in the
Golgi and/or ER. After transformation, organisms having the desired
glycosylation phenotype are selected. An in vitro assay is used in
one method. The desired structure GlcNAcMan.sub.3GlcNAc.sub.2 (but
not the undesired GlcNAcMan.sub.5GlcNAc.sub.2) is a substrate for
the enzyme GlcNAc Transferase II (see FIG. 1B). Accordingly, single
colonies may be assayed using this enzyme in vitro in the presence
of the substrate, UDP-GlcNAc. The release of UDP is determined
either by HPLC or an enzymatic assay for UDP. Alternatively,
radioactively labeled UDP-GlcNAc or MALDI-TOF may be used.
[0248] The foregoing in vitro assays are conveniently performed on
individual colonies using high-throughput screening equipment.
Alternatively a lectin binding assay is used. In this case the
reduced binding of lectins specific for terminal mannoses allows
the selection of transformants having the desired phenotype. For
example, Galantus nivalis lectin binds specifically to terminal
.alpha.-1,3-mannose, the concentration of which is reduced in the
presence of operatively expressed mannosidase II activity. In one
suitable method, G. nivalis lectin attached to a solid agarose
support (available from Sigma Chemical, St. Louis, Mo.) is used to
deplete the transformed population of cells having high levels of
terminal .alpha.-1,3-mannose.
Example 6
Engineering a Strain to Express Sialyltransferase
[0249] The enzymes .alpha.2,3-sialyltransferase and
.alpha.2,6-sialyltransferase add terminal sialic acid to galactose
residues in nascent human N-glycans, leading to mature
glycoproteins (see "a 2,3 ST; .alpha.2,6 ST" in FIG. 1B). In human
cells, the reactions occur in the trans Golgi or TGN. Accordingly,
a DNA library is constructed by the in-frame fusion of sequences
encoding sialyltransferase catalytic domains with sequences
encoding trans Golgi or TGN localization signals (Malissard et al.
Biochem Biophys Res Commun 2000 Jan. 7; 267(1):169-73; Borsig et
al. Biochem Biophys Res Commun 1995 May 5; 210(1):14-20). The host
organism is a strain, e.g. a yeast, that is deficient in
hypermannosylation (e.g., an och1 mutant), which provides N-glycans
having terminal galactose residues in the late Golgi or TGN, and
provides a sufficient concentration of CMP-sialic acid in the late
Golgi or TGN. Following transformation, transformants having the
desired phenotype are selected, e.g., using a fluorescent antibody
specific for N-glycans having a terminal sialic acid. In addition,
the strains are engineered to produce the CMP-NANA precursors.
Sialyltransferase Reaction
[0250] After resuspending the (galactosyltransferase reacted)
(Example 4) proteins in 10 .mu.L of 50 mM sodium cacodylate buffer
pH6.0, 300 .mu.g (488 nmol) of CMP-N-acetylneuraminic acid
(CMP-NANA) dissolved in 15 .mu.L of the same buffer, and 5 .mu.L (2
mU) of recombinant .alpha.-2,6 sialyltransferase were added. After
incubation at 37.degree. C. for 15 hours, an additional 200 .mu.g
of CMP-NANA and 1 mU of sialyltransferase were added. The protein
samples were incubated for an additional 8 hours and then dialyzed
and analyzed by MALDI-TOF-MS as above. The spectrum of the
glycoprotein reacted with sialyltransferase showed an increase in
mass when compared with that of the starting material (the protein
after galactosyltransferase reaction). The N-glycans were released
and analyzed as above. The increase in mass of the two ion-adducts
of the predominant glycan was consistent with the addition of two
sialic acid residues (580 and 583 Da).
Example 7
Engineering a strain to Express UDP-GlcNAc Transporter
[0251] The cDNA of human Golgi UDP-GlcNAc transporter has been
cloned by Ishida and coworkers. (Ishida, N., et al. 1999 J.
Biochem. 126(1): 68-77). Guillen and coworkers have cloned the
canine kidney Golgi UDP-GlcNAc transporter by phenotypic correction
of a Kluyveromyces lactis mutant deficient in Golgi UDP-GlcNAc
transport. (Guillen, E., et al. 1998). Thus a mammalian Golgi
UDP-GlcNAc transporter gene has all of the necessary information
for the protein to be expressed and targeted functionally to the
Golgi apparatus of yeast. These or other cloned transporter genes
may be engineered into a host organism to provide UDP-GlcNAc
substrates for efficient GnT reactions in the Golgi and/or ER of
the host. FIG. 10B demonstrates the effect of a strain expressing a
K. lactis UDP-GlcNAc transporter. In comparison to FIG. 10A, which
lacks a UDP-GlcNAc transporter, the effect of adding a UDP-GlcNAc
transporter shows a dramatic increase in the production of
GlcNAcMan.sub.5GlcNAc.sub.2.
Example 8
Engineering a strain to Express GDP-Fucose Transporter
[0252] The rat liver Golgi membrane GDP-fucose transporter has been
identified and purified by Puglielli, L. and C. B. Hirschberg 1999
J. Biol. Chem. 274(50):35596-35600. The corresponding gene can be
identified using standard techniques, such as N-terminal sequencing
and Southern blotting using a degenerate DNA probe. The intact gene
is then expressed in a host microorganism that also expresses a
fucosyltransferase.
Example 9
Engineering a strain to Express UDP-Galactose Transporter
[0253] Human UDP-galactose (UDP-Gal) transporter has been cloned
and shown to be active in S. cerevisiae. (Kainuma, M., et al. 1999
Glycobiology 9(2): 133-141). A second human UDP-galactose
transporter (hUGT1) has been cloned and functionally expressed in
Chinese Hamster Ovary Cells. Aoki, K., et al. 1999 J. Biochem.
126(5): 940-950. Likewise, Segawa and coworkers have cloned a
UDP-galactose transporter from Schizosaccharomyces pombe (Segawa,
H., et al. 1999 Febs Letters 451(3): 295-298). These or other
sequences encoding UDP-galactose transporter activities may be
introduced into a host cell directly or may be used as a component
of a sub-library of the invention to engineer a strain having
increased UDP-galactose transporter activity.
Example 10
Engineering a Strain to Express CMP-Sialic Acid Transporter
[0254] Human CMP-sialic acid transporter (hCST) has been cloned and
expressed in Lec 8 CHO cells by Aoki and coworkers (1999).
Molecular cloning of the hamster CMP-sialic acid transporter has
also been achieved (Eckhardt and Gerardy Schahn 1997 Eur. J.
Biochem. 248(1): 187-192). The functional expression of the murine
CMP-sialic acid transporter was achieved in Saccharomyces
cerevisiae by Berninsone, P., et al. 1997 J. Biol. Chem. 272
(19):12616-12619. These or other sequences encoding CMP-sialic acid
transporter activities may be introduced into a host cell directly
or may be used as a component of a sub-library of the invention to
engineer a strain having increased CMP-sialic acid transporter
activity.
Example 11
Engineering of P. pastoris to Produce Man.sub.5GlcNA.sub.2 as the
Predominant N-Glycan Structure Using a Combinatorial DNA
Library
[0255] An och1 mutant of P. pastoris (see Examples 1 and 3) was
engineered to express and secrete proteins such as the kringle 3
domain of human plasminogen (K3) under the control of the inducible
AOX1 promoter. The Kringle 3 domain of human plasminogen (K3) was
used as a model protein. A DNA fragment encoding the K3 was
amplified using Pfu turbo polymerase (Strategene, La Jolla, Calif.)
and cloned into EcoRI and XbaI sites of pPICZaA (Invitrogen,
Carlsbad, Calif.), resulting in a C-terminal 6-His tag. In order to
improve the N-linked glycosylation efficiency of K3 (Hayes et al.
1975 J. Arch. Biochem. Biophys. 171, 651-655), Pro.sub.46 was
replaced with Ser.sub.46 using site-directed mutagenesis. The
resulting plasmid was designated pBK64. The correct sequence of the
PCR construct was confirmed by DNA sequencing.
[0256] A combinatorial DNA library was constructed by the in-frame
ligation of murine .alpha.-1,2-mannosidase IB (Genbank AN 6678787)
and IA (Genbank AN 6754619) catalytic domains with a sub-library
including sequences encoding Cop II vesicle, ER, and early Golgi
localization peptides according to Table 6. The combined DNA
library was used to generate individual fusion constructs, which
were then transformed into the K3 expressing host organism,
resulting in a genetically mixed population wherein individual
transformants each express K3 as well as a localization
signal/mannosidase fusion gene from the library. Individual
transformants were cultured and the production of K3 was induced by
transfer to a methanol containing medium. Under these conditions,
after 24 hours of induction, over 90% of the protein in the medium
was K3. The K3 reporter protein was purified from the supernatant
to remove salts and low-molecular weight contaminants by
Ni-affinity chromatography. Following affinity purification, the
protein was desalted by size exclusion chromatography on a Sephadex
G10 resin (Sigma, St. Louis, Mo.) and either directly subjected to
MALDI-TOF analysis described below or the N-glycans were removed by
PNGase digestion as described below (Release of N-glycans) and
subjected to MALDI-TOF analysis Miele et al. 1997 Biotechnol. Appi.
Biochem. 25, 151-157.
[0257] Following this approach, a diverse set of transformants were
obtained; some showed no modification of the N-glycans compared to
the och1 knockout strain; and others showed a high degree of
mannose trimming (FIG. 5D, 5E). Desired transformants expressing
appropriately targeted, active .alpha.-1,2-mannosidase produced K3
with N-glycans of the structure Man.sub.5GlcNAc.sub.2. This confers
a reduced molecular mass to the glycoprotein compared to the K3 of
the parent och1 deletion strain, a difference which was readily
detected by MALDI-TOF mass spectrometry (FIG. 5). Table 7 indicates
the relative Man.sub.5GlcNAc.sub.2 production levels.
TABLE-US-00007 TABLE 7 A representative combinatorial DNA library
of localization sequences/catalytic domains exhibiting relative
levels of Man.sub.5GlcNAc.sub.2 production. Targeting peptide
sequences MNS1(s) MNS1(m) MNS1(l) SEC12(s) SEC12(m) Catalytic Mouse
mannosidase FB4 FB5 FB6 FB7 FB8 Domains 1A .DELTA.187 ++ + - ++
++++ Mouse mannosidase GB4 GB5 GB6 GB7 GB8 1B .DELTA.58 ++ + + ++ +
Mouse mannosidase GC4 GC5 GC6 GC7 GC8 1B .DELTA.99 - +++ + + +
Mouse mannosidase GD4 GD5 GD6 GD7 GD8 1B .DELTA.170 - - - + +
TABLE-US-00008 TABLE 8 Another combinatorial DNA library of
localization sequences/catalytic domains exhibiting relative levels
of Man.sub.5GlcNAc.sub.2 production. Targeting peptide sequences
VAN1(s) VAN1(m) VAN1(l) MNN10(s) MNN10(m) MNN10(l) Catalytic C.
elegans BC18-5 BC19 BC20 BC27 BC28 BC29 Domains mannosidase +++++
++++ +++ +++++ +++++ +++ 1B .DELTA.80 C. elegans BB18 BB19 BB20
BB18 BB19 BB20 mannosidase +++++ +++++ ++++ +++++ +++++ ++++ 1B
.DELTA.31
[0258] Targeting peptides were selected from MNS I (SwissProt
P32906) in S. cerevisiae (long, medium and short) (see supra
Nucleic Acid Libraries; Combinatorial DNA Library of Fusion
Constructs) and SEC12 (SwissProt P11655) in S. cerevisiae (988-1140
nucleotides: short) and (988-1296: medium). Although majority of
the targeting peptide sequences were N-terminal deletions, some
targeting peptide sequences, such as SEC12 were C-terminal
deletions. Catalytic domains used in this experiment were selected
from mouse mannosidase 1A with a 187 amino acid N-terminal
deletion; and mouse mannosidase 1B with a 58, 99 and 170 amino acid
deletion. The number of (+)s, as used herein, indicates the
relative levels of Man.sub.5GlcNA.sub.2 production. The notation
(-) indicates no apparent production of Man.sub.5GlcNA.sub.2. The
notation (+) indicates less than 10% production of
Man.sub.5GlcNA.sub.2. The notation (++) indicates about 10-20%
production of Man.sub.5GlcNA.sub.2. The notation with (+++)
indicates about 20-40% production of Man.sub.5GlcNA.sub.2. The
notation with (++++) indicates about 50% production of
Man.sub.5GlcNA.sub.2. The notation with (+++++) indicates greater
than 50% production of Man.sub.5GlcNA.sub.2.
[0259] Table 9 shows relative amount of Man.sub.5GlcNAc.sub.2 on
secreted K3. Six hundred and eight (608) different strains of P.
pastoris, .DELTA.och1 were generated by transforming them with a
single construct of a combinatorial genetic library that was
generated by fusing nineteen (19) .alpha.-1,2 mannosidase catalytic
domains to thirty-two (32) fungal ER, and cis-Golgi leaders.
TABLE-US-00009 TABLE 9 Amount of Man.sub.5GlcNAc.sub.2 on secreted
K3 (% of total glycans) Number of constructs (%) N.D.* 19 (3.1)
0-10% 341 (56.1) 10-20% 50 (8.2) 20-40& 75 (12.3) 40-60% 72
(11.8) More than 60% 51 (8.4) .sup..dagger. Total 608 (100)
*Several fusion constructs were not tested because the
corresponding plasmids could not be propagated in E. coli prior to
transformation into P. pastoris. .sup..dagger. Clones with the
highest degree of Man.sub.5GlcNAc.sub.2 trimming (30/51) were
further analyzed for mannosidase activity in the supernatant of the
medium. The majority (28/30) displayed detectable mannosidase
activity in the supernatant (e.g. FIG. 4B). Only two constructs
displayed high Man.sub.5GlcNAc.sub.2 levels, while lacking
mannosidase activity in the medium (e.g. FIG. 4C).
[0260] Table 7 shows two constructs pFB8 and pGC5, among others,
displaying Man.sub.5GlcNA.sub.2. Table 8 shows a more preferred
construct, pBC18-5, a S. cerevisiae VAN1(s) targeting peptide
sequence (from SwissProt 23642) ligated in-frame to a C. elegans
mannosidase IB (Genbank AN CAA98114) 80 amino acid N-terminal
deletion (Saccharomyces Van1(s)/C. elegans mannosidase IB A80).
This fusion construct also produces a predominant
Man.sub.5GlcNA.sub.2 structure, as shown in FIG. 5E. This construct
was shown to produce greater than 50% Man.sub.5GlcNA.sub.2
(+++++).
Generation of a Combinatorial Localization/Mannosidase Library:
[0261] Generating a combinatorial DNA library of
.alpha.-1,2-mannosidase catalytic domains fused to targeting
peptides required the amplification of mannosidase domains with
varying lengths of N-terminal deletions from a number of organisms.
To approach this goal, the full length open reading frames (ORFs)
of .alpha.-1,2-mannosidases were PCR amplified from either cDNA or
genomic DNA obtained from the following sources: Homo sapiens, Mus
musculus, Drosophila melanogaster, Caenorhabditis elegans,
Aspergillus nidulans and Penicillium citrinum. In each case, DNA
was incubated in the presence of oligonucleotide primers specific
for the desired mannosidase sequence in addition to reagents
required to perform the PCR reaction. For example, to amplify the
ORF of the M. musculus .alpha.-1,2-mannosidase IA, the 5'-primer
ATGCCCGTGGGGGGCCTGTTGCCGCTCTTCAGTAGC (SEQ ID NO:12) and the
3'-primer TCATTTCTCTTTGCCATCAATTTCCTTCTTCTGTTCACGG (SEQ ID NO:13)
were incubated in the presence of Pfu DNA polymerase (Stratagene,
La Jolla, Calif.) and amplified under the conditions recommended by
Stratagene using the cycling parameters: 94.degree. C. for 1 min (1
cycle); 94.degree. C. for 30 sec, 68.degree. C. for 30 sec,
72.degree. C. for 3 min (30 cycles). Following amplification the
DNA sequence encoding the ORF was incubated at 72.degree. C. for 5
min with 1 U Taq DNA polymerase (Promega, Madison, Wis.) prior to
ligation into pCR2.1-TOPO (Invitrogen, Carlsbad, Calif.) and
transformed into TOP 10 chemically competent E. coli, as
recommended by Invitrogen. The cloned PCR product was confirmed by
ABI sequencing using primers specific for the mannosidase ORF.
[0262] To generate the desired N-terminal truncations of each
mannosidase, the complete ORF of each mannosidase was used as the
template in a subsequent round of PCR reactions wherein the
annealing position of the 5'-primer was specific to the 5'-terminus
of the desired truncation and the 3'-primer remained specific for
the original 3'-terminus of the ORF. To facilitate subcloning of
the truncated mannosidase fragment into the yeast expression
vector, pJN347 (FIG. 2C) AscI and PacI restriction sites were
engineered onto each truncation product, at the 5'- and 3'-termini
respectively. The number and position of the N-terminal truncations
generated for each mannosidase ORF depended on the position of the
transmembrane (TM) region in relation to the catalytic domain (CD).
For instance, if the stem region located between the TM and CD was
less than 150 bp, then only one truncation for that protein was
generated. If, however, the stem region was longer than 150 bp then
either one or two more truncations were generated depending on the
length of the stem region.
[0263] An example of how truncations for the M. musculus
mannosidase IA (Genbank AN 6678787) were generated is described
herein, with a similar approach being used for the other
mannosidases. FIG. 3 illustrates the ORF of the M. musculus
.alpha.-1,2-mannosidase IA with the predicted transmembrane and
catalytic domains being highlighted in bold. Based on this
structure, three 5'-primers were designed (annealing positions
underlined in FIG. 3) to generate the .DELTA.65-, .DELTA.105- and
.DELTA.187-N-terminal deletions. Using the .DELTA.65 N-terminal
deletion as an example the 5'-primer used was
5'-GGCGCGCCGACTCCTCCAAGCTGCTCAGCGGGGTCCTGTTCCAC-3' (SEQ ID NO:14)
(with the AscI restriction site highlighted in bold) in conjunction
with the 3'-primer
5'-CCTTAATTAATCATTTCTCTTTGCCATCAATTTCCTTCTTCTGTTCACGG-3' (SEQ ID
NO:15) (with the PacI restriction site highlighted in bold). Both
of these primers were used to amplify a 1561 bp fragment under the
conditions outlined above for amplifying the full length M.
musculus mannosidase 1A ORF. Furthermore, like the product obtained
for the full length ORF, the truncated product was also incubated
with Taq DNA polymerase, ligated into pCR2.1-TOPO (Invitrogen,
Carlsbad, Calif.), transformed into TOP10 and ABI sequenced. After
having amplified and confirmed the sequence of the truncated
mannosidase fragment, the resulting plasmid,
pCR2.1-.DELTA.65mMannIA, was digested with AscI and PacI in New
England Biolabs buffer #4 (Beverly, Mass.) for 16 h at 37.degree.
C. In parallel, the pJN347 (FIG. 2C) was digested with the same
enzymes and incubated as described above. Post-digestion, both the
pJN347 (FIG. 2C) back-bone and the truncated catalytic domain were
gel extracted and ligated using the Quick Ligation Kit (New England
Biolabs, Beverly, Mass.), as recommended by the manufacturers, and
transformed into chemically competent DH5.alpha. cells (Invitrogen,
Carlsbad, Calif.). Colony PCR was used to confirm the generation of
the pJN347-mouse Mannosidase IA.DELTA.65 construct.
[0264] Having generated a library of truncated
.alpha.-1,2-mannosidase catalytic domains in the yeast expression
vector pJN347 (FIG. 2C) the remaining step in generating the
targeting peptide/catalytic domain library was to clone in-frame
the targeting peptide sequences (FIG. 2). Both the
pJN347-mannosidase constructs (FIG. 2D) and the
pCR2.1TOPO-targeting peptide constructs (FIG. 2B) such as were
incubated overnight at 37.degree. C. in New England Biolabs buffer
#4 in the presence of the restriction enzymes NotI and AscI.
Following digestion, both the pJN347-mannosidase back-bone and the
targeting peptide regions were gel-extracted and ligated using the
Quick Ligation Kit (New England Biolabs, Beverly, Mass.), as
recommended by the manufacturers, and transformed into chemically
competent DH5.alpha. cells (Invitrogen, Carlsbad, Calif.).
Subsequently, the pJN347-targeting peptide/mannosidase constructs
were ABI sequenced to confirm that the generated fusions were
in-frame. The estimated size of the final targeting
peptide/alpha-1,2-mannosidase library contains over 1300 constructs
generated by the approach described above. FIG. 2 illustrates
construction of the combinatorial DNA library.
Engineering a P. pastoris OCH1 Knock-Out Strain with Multiple
Auxotrophic Markers.
[0265] The first step in plasmid construction involved creating a
set of universal plasmids containing DNA regions of the KEX1 gene
of P. pastoris (Boehm et al. Yeast 1999 May; 15(7):563-72) as space
holders for the 5' and 3' regions of the genes to be knocked out.
The plasmids also contained the S. cerevisiae Ura-blaster (Alani et
al., Genetics 116, 541-545. 1987) as a space holder for the
auxotrophic markers, and an expression cassette with a multiple
cloning site for insertion of a foreign gene. A 0.9-kb fragment of
the P. pastoris KEX1-5' region was amplified by PCR using primers
GGCGAGCTCGGCCTACCCGGCCAAGGCTGAGATCATTTGTCCAGCTTCA GA (SEQ ID NO:16)
and GCCCACGTCGACGGATCCGTTTAAACATCGATTGGAGAGGCTGACACC GCTACTA (SEQ
ID NO:17) and P. pastoris genomic DNA as a template and cloned into
the SacI, SalI sites of pUC19 (New England Biolabs, Beverly,
Mass.). The resulting plasmid was cut with BamHI and SalI, and a
0.8-kb fragment of the KEX1-3' region that had been amplified using
primers CGGGATCCACTAGTATTTAAATCATATGTGCGAGTGTACAACTCTTCCC ACATGG
(SEQ ID NO:18) and GGACGCGTCGACGGCCTACCCGGCCGTACGAGGAATTTCTCGG
ATGACTCTTTTC (SEQ ID NO:19) was cloned into the open sites creating
pJN262. This plasmid was cut with BamHI and the 3.8-kb BamHI, BglII
fragment of pNKY51 (Alani et al. 1987) was inserted in both
possible orientations resulting in plasmids pJN263 (FIG. 4A) and
pJN284 (FIG. 4B).
[0266] An expression cassette was created with NotI and PacI as
cloning sites. The GAPDH promoter of P. pastoris was amplified
using primers CGGGATCCCTCGAGAGATCTTTTTTGTAGAAATGTCTTGGTGCCT (SEQ ID
NO:20) and GGACATGCATGCACTAGTGCGGCCGCCACGTGATAGTTGTTCA
ATTGATTGAAATAGGGACAA (SEQ ID NO:21) and plasmid pGAPZ-A
(Invitrogen) as template and cloned into the BamHI, SphI sites of
pUC19 (New England Biolabs, Beverly, Mass.) (FIG. 4B). The
resulting plasmid was cut with SpeI and SphI and the CYC1
transcriptional terminator region ("TT") that had been amplified
using primers CCTTGCTAGCTTAATTAACCGCGGCACGTCCGACGGCGGCCCA CGGGTCCCA
(SEQ ID NO:22) and GGACATGCATGCGGATCCCTTAAGAGCCGGCAGCTTGCAAATT
AAAGCCTTCGAGCGTCCC (SEQ ID NO:23) and plasmid pPICZ-A (Invitrogen)
as a template was cloned into the open sites creating pJN261 (FIG.
4B).
[0267] A knockout plasmid for the P. pastoris OCH1 gene was created
by digesting pJN263 with SalI and SpeI and a 2.9-kb DNA fragment of
the OCH1-5' region, which had been amplified using the primers
GAACCACGTCGACGGCCATTGCGGCCAAAACCTTTTTTCCTATT CAAACACAAGGCATTGC (SEQ
ID NO:24) and CTCCAATACTAGTCGAAGATTATCTTCTACGGTGCCTGGACTC (SEQ ID
NO:25) and P. pastoris genomic DNA as a template, was cloned into
the open sites (FIG. 4C). The resulting plasmid was cut with EcoRI
and PmeI and a 1.0-kb DNA fragment of the OCH1-3' region that had
been generated using the primers
TGGAAGGTTTAAACAAAGCTAGAGTAAAATAGATATAGCGAG ATTAGAGAATG (SEQ ID
NO:26) and AAGAATTCGGCTGGAAGGCCTTGTACCTTGATGTAGTTCCCGTT TTCATC (SEQ
ID NO:27) was inserted to generate pJN298 (FIG. 4C). To allow for
the possibility to simultaneously use the plasmid to introduce a
new gene, the BamHI expression cassette of pJN261 (FIG. 4B) was
cloned into the unique BamHI site of pJN298 (FIG. 4C) to create
pJN299 (FIG. 4E).
[0268] The P. pastoris Ura3-blaster cassette was constructed using
a similar strategy as described in Lu. P., et al. 1998 (Cloning and
disruption of the .beta.-isopropylmalate dehydrogenase gene (Leu2)
of Pichia stipidis with URA3 and recovery of the double auxotroph.
Appl. Microbiol. Biotechnol. 49, 141-146.) A 2.0-kb PstI, SpeI
fragment of P. pastoris URA3 was inserted into the PstI, XbaI sites
of pUC19 (New England Biolabs, Beverly, Mass.) to create pJN306
(FIG. 4D). Then a 0.7-kb SacI, PvuII DNA fragment of the lacZ open
reading frame was cloned into the SacI, SmaI sites to yield pJN308
(FIG. 4D). Following digestion of pJN308 (FIG. 4D) with PstI, and
treatment with T4 DNA polymerase, the SacI-PvuII fragment from lacZ
that had been blunt-ended with T4 DNA polymerase was inserted
generating pJN315 (FIG. 4D). The lacZ/URA3 cassette was released by
digestion with SacI and SphI, blunt ended with T4 DNA polymerase
and cloned into the backbone of pJN299 that had been digested with
PmeI and OH and blunt ended with T4 DNA polymerase. The resulting
plasmid was named pJN329 (FIG. 4E).
[0269] A HIS4 marked expression plasmid was created by cutting
pJN261 (FIG. 4F) with EcoICRI (FIG. 4F). A 2.7 kb fragment of the
Pichia pastoris HIS4 gene that had been amplified using the primers
GCCCAAGCCGGCCTTAAGGGATCTCCTGATGACTGACTCACTGATAATA AAAATACGG (SEQ ID
NO:28) and GGGCGCGTATTTAAATACTAGTGGATCTATCGAATCTAAATGTAAGTTA
AAATCTCTAA (SEQ ID NO:29) cut with NgoMIV and Swal and then
blunt-ended using T4 DNA polymerase, was then ligated into the open
site. This plasmid was named pJN337 (FIG. 4F). To construct a
plasmid with a multiple cloning site suitable for fusion library
construction, pJN337 was cut with NotI and PacI and the two
oligonucleotides GGCCGCCTGCAGATTTAAATGAATTCGGCGCGCCTTAAT (SEQ ID
NO:30) and TAAGGCGCGCCGAATTCATTTAAATCTGCAGGGC (SEQ ID NO:31), that
had been annealed in vitro were ligated into the open sites,
creating pJN347 (FIG. 4F).
[0270] To create an och1 knockout strain containing multiple
auxotrophic markers, 100 .mu.g of pJN329 was digested with SfiI and
used to transform P. pastoris strain JC308 (Cereghino et al. Gene
263 (2001) 159-169) by electroporation. Following transformation,
the URA dropout plates were incubated at room temperature for 10
days. One thousand (1000) colonies were picked and restreaked. All
1000 clones were then streaked onto 2 sets of URA dropout plates.
One set was incubated at room temperature, whereas the second set
was incubated at 37.degree. C. The clones that were unable to grow
at 37.degree. C., but grew at room temperature, were subjected to
colony PCR to test for the correct OCH1 knockout. One clone that
showed the expected PCR signal (about 4.5 kb) was designated
YJN153.
Example 12
Characterization of the Combinatorial DNA Library
[0271] Positive transformants screened by colony PCR confirming
integration of the mannosidase construct into the P. pastoris
genome were subsequently grown at room temperature in 50 ml BMGY
buffered methanol-complex medium consisting of 1% yeast extract, 2%
peptone, 100 mM potassium phosphate buffer, pH 6.0, 1.34% yeast
nitrogen base, 4.times.10.sup.-5% biotin, and 1% glycerol as a
growth medium) until OD.sub.600nm 2-6 at which point they were
washed with 10 ml BMMY (buffered methanol-complex medium consisting
of 1% yeast extract, 2% peptone, 100 mM potassium phosphate buffer,
pH 6.0, 1.34% yeast nitrogen base, 4.times.10.sup.-5% biotin, and
1.5% methanol as a growth medium) media prior to induction of the
reporter protein for 24 hours at room temperature in 5 ml BMMY.
Consequently, the reporter protein was isolated and analyzed by
mass spectrophotometry and HPLC to characterize its glycan
structure. Using the targeting peptides in Table 6, mannosidase
catalytic domains localized to either the ER or the Golgi showed
significant level of trimming of a glycan predominantly containing
Man.sub.8GlcNAc.sub.2 to a glycan predominantly containing
Man.sub.5GlcNAc.sub.2. This is evident when the glycan structure of
the reporter glycoprotein is compared between that of P. pastoris
och1 knock-out in FIGS. 5C, 6C and the same strain transformed with
M. musculus mannosidase constructs as shown in FIGS. 5D, 5E, 6D-6F.
FIGS. 5 and 6 show expression of constructs generated from the
combinatorial DNA library which show significant mannosidase
activity in P. pastoris. Expression of pGC5 (Saccharomyces
MNS1(m)/mouse mannosidase IB .DELTA.99) (FIG. 5D, 6E) produced a
protein which has approximately 30% of all glycans trimmed to
Man.sub.5GlcNAc.sub.2, while expression of pFB8 (Saccharomyces
SEC12(m)/mouse mannosidase IA .DELTA.187) (FIG. 6F) produced
approximately 50% Man.sub.5GlcNAc.sub.2 and expression of pBC18-5
(Saccharomyces VAN1(s)/C. elegans mannosidase IB .DELTA.80) (FIG.
5E) produced 70% Man.sub.5GlcNAc.sub.2.
Release of N-Glycans
[0272] The glycans were released and separated from the
glycoproteins by a modification of a previously reported method
(Papac et al. 1998 Glycobiology 8, 445-454). After the proteins
were reduced and carboxymethylated and the membranes blocked, the
wells were washed three time with water. The protein was
deglycosylated by the addition of 30 .mu.l of 10 mM NH4HCO3 pH 8.3
containing one milliunit of N-glycanase (Glyko, Novato, Calif.).
After 16 hr at 37.degree. C., the solution containing the glycans
was removed by centrifugation and evaporated to dryness.
Matrix Assisted Laser Desorption Ionization Time of Flight Mass
Spectrometry
[0273] After the N-glycans were released by PNGase digestion, they
were analyzed by Matrix Assisted Laser Desorption Ionization Time
of Flight Mass Spectrometry. Molecular weights of the glycans were
determined using a Voyager DE PRO linear MALDI-TOF (Applied
Biosciences) mass spectrometer using delayed extraction. The dried
glycans from each well were dissolved in 15 .mu.l of water and 0.5
.mu.l was spotted on stainless steel sample plates and mixed with
0.5 .mu.l of S-DHB matrix (9 mg/ml of dihydroxybenzoic acid, 1
mg/ml of 5-methoxysalicilic acid in 1:1 water/acetonitrile 0.1%
TFA) and allowed to dry. Ions were generated by irradiation with a
pulsed nitrogen laser (337 nm) with a 4 ns pulse time. The
instrument was operated in the delayed extraction mode with a 125
ns delay and an accelerating voltage of 20 kV. The grid voltage was
93.00%, guide wire voltage was 0.1%, the internal pressure was less
than 5.times.10-7 torr, and the low mass gate was 875 Da. Spectra
were generated from the sum of 100-200 laser pulses and acquired
with a 500 MHz digitizer. Man.sub.5GlcNAc.sub.2 oligosaccharide was
used as an external molecular weight standard. All spectra were
generated with the instrument in the positive ion mode.
Example 13
Trimming In Vivo by Alpha-1,2-Mannosidase
[0274] To ensure that the novel engineered strains of Example 11 in
fact produced the desired Man.sub.5GlcNAc.sub.2 structure in vivo,
cell supernatants were tested for mannosidase activity (see FIGS.
7-9). For each construct/host strain described below, HPLC was
performed at 30.degree. C. with a 4.0 mm.times.250 mm column of
Altech (Avondale, Pa., USA) Econosil-NH.sub.2 resin (5 .mu.m) at a
flow rate of 1.0 ml/min for 40 min. In FIGS. 7 and 8, degradation
of the standard Man.sub.9GlcNAc.sub.2 [b] was shown to occur
resulting in a peak which correlates to Man.sub.8GlcNAc.sub.2. In
FIG. 7, the Man.sub.9GlcNAc.sub.2 [b] standard eluted at 24.61 min
and Man.sub.5GlcNAc.sub.2 [a] eluted at 18.59 min. In FIG. 8,
Man.sub.9GlcNAc.sub.2 eluted at 21.37 min and Man.sub.5GlcNAc.sub.2
at 15.67 min. In FIG. 9, the standard Man.sub.8GlcNAc.sub.2 [b] was
shown to elute at 20.88 min.
[0275] P. pastoris cells comprising plasmid pFB8 (Saccharomyces
SEC12 (m)/mouse mannosidase TA 4187) were grown at 30.degree. C. in
BMGY to an OD600 of about 10. Cells were harvested by
centrifugation and transferred to BMMY to induce the production of
K3 (kringle 3 from human plasminogen) under control of an AOX1
promoter. After 24 hours of induction, cells were removed by
centrifugation to yield an essentially clear supernatant. An
aliquot of the supernatant was removed for mannosidase assays and
the remainder was used for the recovery of secreted soluble K3. A
single purification step using CM-sepharose chromatography and an
elution gradient of 25 mM NaAc, pH5.0 to 25 mM NaAc, pH5.0, 1M
NaCl, resulted in a 95% pure K3 eluting between 300-500 mM NaCl.
N-glycan analysis of the K3 derived glycans is shown in FIG. 6F.
The earlier removed aliquot of the supernatant was further tested
for the presence of secreted mannosidase activity. A commercially
available standard of 2-aminobenzamide-labeled N-linked-type
oligomannose 9 (Mang-2-AB) (Glyko, Novato, Calif.) was added to:
BMMY (FIG. 7A), the supernatant from the above aliquot (FIG. 7B),
and BMMY containing 10 ng of 75 mU/mL of .alpha.-1,2-mannosidase
from Trichoderma reesei (obtained from Contreras et al., WO
02/00856 A2) (FIG. 7C). After incubation for 24 hours at room
temperature, samples were analyzed by amino silica HPLC to
determine the extent of mannosidase trimming.
[0276] P. pastoris cells comprising plasmid pGC5 (Saccharomyces
MNS1(m)/mouse mannosidase IB .DELTA.99) were similarly grown and
assayed. Cells were grown at room temperature in BMGY to an OD600
of about 10. Cells were harvested by centrifugation and transferred
to BMMY to induce the production of K3 under control of an AOX1
promoter. After 24 hours of induction, cells were removed by
centrifugation to yield an essentially clear supernatant. An
aliquot of the supernatant was removed for mannosidase assays and
the remainder was used for the recovery of secreted soluble K3. A
single purification step using CM-sepharose chromatography and an
elution gradient of 25 mM NaAc, pH5.0 to 25 mM NaAc, pH5.0, 1M
NaCl, resulted in a 95% pure K3 eluting between 300-500 mM NaCl.
N-glycan analysis of the K3 derived glycans is shown in FIG. 5D.
The earlier removed aliquot of the supernatant was further tested
for the presence of secreted mannosidase activity as shown in FIG.
8B. A commercially available standard of Man9-2-AB (Glyko, Novato,
Calif.) were added to: BMMY (FIG. 8A), supernatant from the above
aliquot (FIG. 8B), and BMMY containing 10 ng of 75 mU/mL of
.alpha.-1,2-mannosidase from Trichoderma reesei (obtained from
Contreras et al., WO 02/00856 A2) (FIG. 8C). After incubation for
24 hours at room temperature, samples were analyzed by amino silica
HPLC to determine the extent of mannosidase trimming.
[0277] Man9-2-AB was used as a substrate and it is evident that
after 24 hours of incubation, mannosidase activity was virtually
absent in the supernatant of the pFB8 (Saccharomyces SEC12
(m)/mouse mannosidase IA .DELTA.187) strain digest (FIG. 7B) and
pGC5 (Saccharomyces MNS1(m)/mouse mannosidase IB .DELTA.99) strain
digest (FIG. 8B) whereas the positive control (purified
.alpha.-1,2-mannosidase from T. reesei obtained from Contreras)
leads to complete conversion of Man.sub.9GlcNAc.sub.2 to
Man.sub.5GlcNAc.sub.2 under the same conditions, as shown in FIGS.
7C and 8C. This is conclusive data showing in vivo mannosidase
trimming in P. pastoris pGC5 strain; and pFB8 strain, which is
distinctly different from what has been reported to date (Contreras
et al., WO 02/00856 A2).
[0278] FIG. 9 further substantiates localization and activity of
the mannosidase enzyme. P. pastoris comprising pBC18-5
(Saccharomyces VAN1(s)/C. elegans mannosidase IB .DELTA.80) was
grown at room temperature in BMGY to an OD600 of about 10. Cells
were harvested by centrifugation and transferred to BMMY to induce
the production of K3 under control of an AOX1 promoter. After 24
hours of induction, cells were removed by centrifugation to yield
an essentially clear supernatant. An aliquot of the supernatant was
removed for mannosidase assays and the remainder was used for the
recovery of secreted soluble K3. A single purification step using
CM-sepharose chromatography and an elution gradient 25 mM NaAc,
pH5.0 to 25 mM NaAc, pH5.0, 1M NaCl, resulted in a 95% pure K3
eluting between 300-500 mM NaCl. N-glycan analysis of the K3
derived glycans is shown in FIG. 5E. The earlier removed aliquot of
the supernatant was further tested for the presence of secreted
mannosidase activity as shown in FIG. 9B. A commercially available
standard of Man8-2-AB (Glyko, Novato, Calif.) was added to: BMMY
(FIG. 9A), supernatant from the above aliquot pBC18-5
(Saccharomyces VAN1(s)/C. elegans mannosidase IB .DELTA.80) (FIG.
9B), and BMMY containing media from a different fusion construct
pDD28-3 (Saccharomyces MNN10(m) (from SwissProt 50108)/H. sapiens
mannosidase IB .DELTA.99) (FIG. 9C). After incubation for 24 hours
at room temperature, samples were analyzed by amino silica HPLC to
determine the extent of mannosidase trimming. FIG. 9B demonstrates
intracellular mannosidase activity in comparison to a fusion
construct pDD28-3 (Saccharomyces MNN10(m) H. sapiens mannosidase IB
.DELTA.99) exhibiting a negative result (FIG. 9C).
Example 14
pH Optimum Assay of Engineered .alpha.-1,2-mannosidase
[0279] P. pastoris cells comprising plasmid pBB27-2 (Saccharomyces
MNN10 (s) (from SwissProt 50108)/C. elegans mannosidase IB
.DELTA.31) were grown at room temperature in BMGY to an OD600 of
about 17. About 80 .mu.L of these cells were inoculated into 600
.mu.L BMGY and were grown overnight. Subsequently, cells were
harvested by centrifugation and transferred to BMMY to induce the
production of K3 (kringle 3 from human plasminogen) under control
of an AOX1 promoter. After 24 hours of induction, cells were
removed by centrifugation to yield an essentially clear supernatant
(pH 6.43). The supernatant was removed for mannosidase pH optimum
assays. Fluorescence-labeled Man.sub.8GlcNAc.sub.2 (0.5 .mu.g) was
added to 20 .mu.L of supernatant adjusted to various pH (FIG. 11)
and incubated for 8 hours at room temperature. Following incubation
the sample was analyzed by HPLC using an Econosil NH2 4.6.times.250
mm, 5 micron bead, amino-bound silica column (Altech, Avondale,
Pa.). The flow rate was 1.0 ml/min for 40 min and the column was
maintained to 30.degree. C. After eluting isocratically (68% A:32%
B) for 3 min, a linear solvent gradient (68% A:32% B to 40% A:60%
B) was employed over 27 min to elute the glycans (18). Solvent A
(acetonitrile) and solvent B (ammonium formate, 50 mM, pH 4.5. The
column was equilibrated with solvent (68% A:32% B) for 20 min
between runs.
Example 15
Engineering of P. pastoris to Produce N-glycans with the Structure
GlcNAcMan.sub.5GlcNAc.sub.2
[0280] GlcNAc Transferase I activity is required for the maturation
of complex and hybrid N-glycans (U.S. Pat. No. 5,834,251).
Man.sub.5GlcNAc.sub.2 may only be trimmed by mannosidase II, a
necessary step in the formation of human glycoforms, after the
addition of N-acetylglucosamine to the terminal .alpha.-1,3 mannose
residue of the trimannose stem by GlcNAc Transferase I (Schachter,
1991 Glycobiology 1(5):453-461). Accordingly, a combinatorial DNA
library was prepared including DNA fragments encoding suitably
targeted catalytic domains of GlcNAc Transferase I genes from C.
elegans and Homo sapiens; and localization sequences from GLS, MNS,
SEC, MNN9, VAN1, ANP1, HOC1, MNN10, MNN11, MNT1, KTR1, KTR2, MNN2,
MNN5, YURI, MNN1, and MNN6 from S. cerevisiae and P. pastoris
putative .alpha.-1,2-mannosyltransferases based on the homology
from S. cerevisiae: D2, D9 and J3, which are KTR homologs. Table 10
includes but does not limit targeting peptide sequences such as SEC
and OCH1, from P. pastoris and K. lactis GnTI, (See Table 6 and
Table 10)
TABLE-US-00010 TABLE 10 A representative combinatorial library of
targeting peptide sequences/ catalytic domain for
UDP-N-Acetylglucosaminyl Transferase I (GnTI) Targeting peptide
OCHI(s) OCHI(m) OCHI(l) MNN9(s) MNN9(m) Catalytic Human, GnTI,
.DELTA.38 PB105 PB106 PB107 PB104 N/A Domain Human, GnTI, .DELTA.86
NB12 NB13 NB14 NB15 NB C. elegans, GnTI, .DELTA.88 OA12 OA13 OA14
OA15 OA16 C. elegans, GnTI, .DELTA.35 PA12 PA13 PA14 PA15 PA16 C.
elegans, GnTI, .DELTA.63 PB12 PB13 PB14 PB15 PB16 X. leavis, GnTI,
.DELTA.33 QA12 QA13 QA14 QA15 QA16 X. leavis, GnTI, .DELTA.103 QB12
QB13 QB14 QB15 QB 16
[0281] Targeting peptide sequences were selected from OCH1 in P.
pastoris (long, medium and short) (see Example 11) and MNN9
(SwissProt P39107) in S. cerevisiae short, and medium. Catalytic
domains were selected from human GnTI with a 38 and 86 amino acid
N-terminal deletion, C. elegans (gly-12) GnTI with a 35 and 63
amino acid deletion as well as C. elegans (gly-14) GnTI with a 88
amino acid N-terminal deletion and X. leavis GnTI with a 33 and 103
amino acid N-terminal deletion, respectively.
[0282] A portion of the gene encoding human N-acetylglucosaminyl
Transferase I (MGATI, Accession# NM002406), lacking the first 154
bp, was amplified by PCR using oligonucleotides
5'-TGGCAGGCGCGCCTCAGTCAGCGCTCTCG-3' (SEQ ID NO:32) and
5'-AGGTTAATTA AGTGCTAATTCCAGCTAGG-3' (SEQ ID NO:33) and vector
pHG4.5 (ATCC#79003) as template. The resulting PCR product was
cloned into pCR2.1-TOPO and the correct sequence was confirmed.
Following digestion with AscI and PacI the truncated GnTI was
inserted into plasmid pJN346 to create pNA. After digestion of
pJN271 with Not' and AscI, the 120 bp insert was ligated into pNA
to generate an in-frame fusion of the MNN9 transmembrane domain
with the GnTI, creating pNA15.
[0283] The host organism is a strain of P. pastoris that is
deficient in hypermannosylation (e.g. an och1 mutant), provides the
substrate UDP-GlcNAc in the Golgi and/or ER (i.e. contains a
functional UDP-GlcNAc transporter), and provides N-glycans of the
structure Man.sub.5GlcNAc.sub.2 in the Golgi and/or ER (e.g. P.
pastoris pFB8 (Saccharomyces SEC12 (m)/mouse mannosidase IA
.DELTA.187) from above). First, P. pastoris pFB8 was transformed
with pPB103 containing the Kluyveromyces lactis MNN2-2 gene
(Genbank AN AF106080) (encoding UDP-GlcNAc transporter) cloned into
BamHI and BglII site of pBLADE-SX plasmid (Cereghino et al. Gene
263 (2001) 159-169). Then the aforementioned combinatorial DNA
library encoding a combination of exogenous or endogenous
GnTI/localization genes was transformed and colonies were selected
and analyzed for the presence of the GnTI construct by colony PCR.
Our transformation and integration efficiency was generally above
80% and PCR screening can be omitted once robust transformation
parameters have been established.
Protein Purification
[0284] K3 was purified from the medium by Ni-affinity
chromatography utilizing a 96-well format on a Beckman BioMek 2000
laboratory robot. The robotic purification is an adaptation of the
protocol provided by Novagen for their HisBind resin. Another
screening method may be performed using a specific terminal GlcNAc
binding antibody, or a lectin such as the GSII lectin from
Griffonia simplificolia, which binds terminal GlcNAc (EY
Laboratories, San Mateo, Calif.). These screens can be automated by
using lectins or antibodies that have been modified with
fluorescent labels such as FITC or analyzed by MALDI-TOF.
[0285] Secreted K3 can be purified by Ni-affinity chromatography,
quantified and equal amounts of protein can be bound to a high
protein binding 96-well plate. After blocking with BSA, plates can
be probed with a GSII-FACS lectin and screened for maximum
fluorescent response. A preferred method of detecting the above
glycosylated proteins involves the screening by MALDI-TOF mass
spectrometry following the affinity purification of secreted K3
from the supernatant of 96-well cultured transformants. Transformed
colonies were picked and grown to an OD600 of 10 in a 2 ml, 96-well
plate in BMGY at 30.degree. C. Cells were harvested by
centrifugation, washed in BMMY and resuspended in 250 ul of BMMY.
Following 24 hours of induction, cells were removed by
centrifugation, the supernatant was recovered and K3 was purified
from the supernatant by Ni affinity chromatography. The N-glycans
were released and analyzed by MALDI-TOF delayed extraction mass
spectrometry as described herein.
[0286] In summary, the methods of the invention yield strains of P.
pastoris that produce GlcNAcMan.sub.5GlcNAc.sub.2 in high yield, as
shown in FIG. 10B. At least 60% of the N-glycans are
GlcNAcMan.sub.5GlcNAc.sub.2. To date, no report exists that
describes the formation of GlcNAcMan.sub.5GlcNAc.sub.2 on secreted
soluble glycoproteins in any yeast. Results presented herein show
that addition of the UDP-GlcNAc transporter along with GnTI
activity produces a predominant GlcNAcMan.sub.5GlcNAc.sub.2
structure, which is confirmed by the peak at 1457 (m/z) (FIG.
10B).
Construction of Strain PBP-3:
[0287] The P. pastoris strain expressing K3, (.DELTA.och1, arg-,
ade-, his-) was transformed successively with the following
vectors. First, pFB8 (Saccharomyces SEC12 (m)/mouse mannosidase IA
.DELTA.187) was transformed in the P. pastoris strain by
electroporation. Second, pPB103 containing Kluyveromyces lactis
MNN2-2 gene (Genbank AN AF106080) (encoding UDP-GlcNAc transporter)
cloned into pBLADE-SX plasmid (Cereghino et al. Gene 263 (2001)
159-169) digested with BamHI and Bg/II enzymes was transformed in
the P. pastoris strain. Third, pPB104 containing Saccharomyces
MNN9(s)/human GnTI .DELTA.38 encoding gene cloned as NotI-PacI
fragment into pJN336 was transformed into the P. pastoris
strain.
Example 16
Engineering K. lactis Cells to Produce N-glycans with the Structure
Man.sub.5GlcNAc.sub.2
[0288] Identification and Disruption of the K. lactis OCH1 gene
[0289] The OCH1 gene of the budding yeast S. cerevisiae encodes a
1,6-mannosyltransferase that is responsible for the first Golgi
localized mannose addition to the Man.sub.8GlcNAc.sub.2 N-glycan
structure on secreted proteins (Nakayama et al, J Biol Chem.;
268(35):26338-45 (Dec. 15, 1993)). This mannose transfer is
generally recognized as the key initial step in the fungal specific
polymannosylation of N-glycan structures (Nakanishi-Shindo et al,
1993; Nakayama et al, 1992; Morin-Ganet et al, Traffic 1(1):56-68.
(January 2000)). Deletion of this gene in S. cerevisiae results in
a significantly shorter N-glycan structure that does not include
this typical polymannosylation or a growth defect at elevated
temperatures (Nakayama et al, EMBO J.; 11(7):2511-9 (July
1992)).
[0290] The Och1p sequence from S. cerevisiae was aligned with known
homologs from Candida albicans (Genbank accession # AAL49987), and
P. pastoris (B. K. Choi et al. in prep) along with the Hoc1
proteins of S. cerevisiae (Neiman et al, Genetics, 145(3):637-45
(March 1997) and K. lactis (PENDANT EST database) which are related
but distinct mannosyltransferases. Regions of high homology that
were in common among Och1p homologs but distinct from the Hoc1p
homologs were used to design pairs of degenerate primers that were
directed against genomic DNA from the K. lactis strain MG1/2
(Bianchi et al, Current Genetics 12, 185-192 (1987)). PCR
amplification with primers RCD33 (CCAGAAGAATTCAATTYTGYCARTGG) (SEQ
ID NO:34) and RCD34 (CAGTGAAAATACCTGGNCCNGTCCA) (SEQ ID NO:35)
resulted in a 302 bp product that was cloned and sequenced and the
predicted translation was shown to have a high degree of homology
to Och1 proteins (>55% to S. cerevisiae Och1p).
[0291] The 302 bp PCR product was used to probe a Southern blot of
genomic DNA from K. lactis strain (MG1/2) with high stringency
(Sambrook et al, 1989). Hybridization was observed in a pattern
consistent with a single gene indicating that this 302 bp segment
corresponds to a portion of the K. lactis genome and K. lactis
(K1OCH1) contains a single copy of the gene. To clone the entire
K1OCH1 gene, the Southern blot was used to map the genomic locus.
Accordingly, a 5.2 kb BamHI/PstI fragment was cloned by digesting
genomic DNA and ligating those fragments in the range of 5.2 kb
into pUC19 (New England Biolabs, Beverly, Mass.) to create a K.
lactis subgenomic library. This subgenomic library was transformed
into E. coli and several hundred clones were tested by colony PCR
using RCD 33/34. The 5.2 kb clone containing the predicted K1OCH1
gene was sequenced and an open reading frame of 1362 bp encoding a
predicted protein that is 46.5% identical to the S. cerevisiae OCH1
gene. The 5.2 kb sequence was used to make primers for construction
of an och1::KAN.sup.R deletion allele using a PCR overlap method
(Davidson et al, Microbiology. 148(Pt 8):2607-15. August 2002).
This deletion allele was transformed into two K. lactis strains and
G418 resistant colonies selected. These colonies were screened by
both PCR and for temperature sensitivity to obtain a strain deleted
for the OCH1 ORF. The results of the experiment show strains which
reveal a mutant PCR pattern, which were characterized by analysis
of growth at various temperatures and N-glycan carbohydrate
analysis of secreted and cell wall proteins following PNGase
digestion. The och1 mutation conferred a temperature sensitivity
which allowed strains to grow at 30.degree. C. but not at
35.degree. C. FIG. 12A shows a MALDI-TOF analysis of a wild type K.
lactis strain producing N-glycans of Man.sub.8GlcNAc.sub.2 [c] and
higher.
Identification, Cloning, and Disruption of the K. lactis MNN1
gene
[0292] S. cerevisiae MNN1 is the structural gene for the Golgi
.alpha.-1,3-mannosyltransferase. The product of MNN1 is a 762-amino
acid type II membrane protein (Yip et al., Proc Natl Acad Sci USA.
91(7):2723-7. (1994)). Both N-linked and O-linked oligosaccharides
isolated from mnn1 mutants lack .alpha.-1,3-mannose linkages
(Raschke et al., J Biol Chem., 248(13):4660-6. (Jul. 10, 1973).
[0293] The Mnn1p sequence from S. cerevisiae was used to search the
K. lactis translated genomic sequences (PEDANT). One 405 bp DNA
sequence encoding a putative protein fragment of significant
similarity to Mnn1p was identified. An internal segment of this
sequence was subsequently PCR amplified with primers KMN1
(TGCCATCTTTTAGGTCCAGGCCCGTTC) (SEQ ID NO:36) and KMN2
(GATCCCACGACGCATCGTATTTCTTTC), (SEQ ID NO:37) and used to probe a
Southern blot of genomic DNA from K. lactis strain (MG1/2). Based
on the Southern hybridization data a 4.2 Kb BamHI-PstI fragment was
cloned by generating a size-selected library as described herein. A
single clone containing the K. lactis MNN1 gene was identified by
whole colony PCR using primers KMN1 (SEQ ID NO:36) and KMN2 (SEQ ID
NO:37) and sequenced. Within this clone a 2241 bp ORF was
identified encoding a predicted protein that was 34% identical to
the S. cerevisiae MNN1 gene. Primers were designed for construction
of a mnn1::NAT.sup.R deletion allele using the PCR overlap method
(Davidson et al. 2002).
[0294] This disruption allele was transformed into a strain of K.
lactis by electroporation and Noursethoicin resistant transformants
were selected and PCR amplified for homologous insertion of the
disruption allele. Strains that reveal a mutant PCR pattern may be
subjected to N-glycan carbohydrate analysis of a known reporter
gene.
[0295] FIG. 12B depicts the N-glycans from the K. lactis och1 mnn1
deletion strain observed following PNGase digestion the MALDI-TOF
as described herein. The predominant peak at 1908 (m/z) indicated
as [d] is consistent with the mass of Man.sub.9GlcNAc.sub.2.
Example 17
Engineering Plant Cells To Express GlcNAc Transferases or
Galactosyltransferases
[0296] GlcNAc transferase IV is required for the addition of
.beta.1,4 GlcNAc to the .alpha.-1,6 mannose residue and the
.alpha.-1,3 mannose residues in complex N-glycans in humans. So far
GlcNAc transferase IV has not been detected in or isolated from
plants. A transgenic plant that is capable of adding human-like
N-glycans must therefore be engineered to express GlcNAc
transferase IV. Thus, the plant host cell or transgenic plant must
also localize an expressed GlcNAc transferase IV to the correct
intracellular compartment in the host so that the enzyme can add
the .beta.1,4 GlcNAc to the appropriate mannose residues.
[0297] There is some evidence that glycosyltransferases from
mammals and plants have similar targeting signals. For example, a
full-length rat .alpha.-2,6-sialyltransferase has been shown to
correctly localize to the trans Golgi network in transgenic
arabidopsis though not necessarily active (Wee E et al. Plant Cell
1998 October; 10(10): 1759-68). A fusion construct having fifty-two
N-terminal amino acids from .alpha.-2,6-sialyltransferase fused to
a green fluorescent reporter protein (GFP) was also shown to
correctly localize to the plant Golgi (Boevink et al. Plant J 1998
August; 15(3):441-7). Two mammalian proteins--TGN30 and furin--and
AtELP, an arabidopsis integral membrane protein (Sanderfoot et al.
Proc Natl Acad Sci USA 1998 Aug. 18; 95(17):9920-5), which localize
to the trans Golgi network, each contain a tyrosine tetrapeptide
motif which targets them to the Golgi, probably by a recycling
mechanism via the plasma membrane. Although mammals and plants
appear to share some common mechanisms related to protein
targeting, exogenous glycosylases may nonetheless not target
correctly in a plant cell, however, localization does not
necessarily equal enzyme activity. It therefore becomes essential
to devise means to correctly target in a plant cell these enzymes
and/or other enzymes which participate in forming complex,
human-like N-glycans.
[0298] Glycosylation enzymes are integral membrane proteins which
reside in the endoplasmic reticulum and Golgi apparatus. The
targeting and localization signals are normally contained in the
cytoplasmic and/or transmembrane domains and in some cases are
contained in some lumenal amino acids. For example, fifty-two amino
acids that make up the transmembrane domain, nine cytoplasmic amino
acids and twenty-six lumenal amino acids of
.alpha.-2,6-sialyltransferase are required to target GFP to the
trans Golgi network (Boevink et al. Plant J 1998 August;
15(3):441-7).
[0299] Thus, a library of sequences encoding cellular targeting
signal peptides comprising of either just the cytoplasmic and
transmembrane domains or the cytoplasmic, transmembrane and lumenal
domains of endoplasmic reticulum and Golgi specific proteins is
generated, as described in Example 11. The targeting peptide
sequences maybe chosen from ER and Golgi-resident plant, yeast or
animal proteins. A glycosylation related protein, e.g., an enzyme
(or catalytic domain thereof) such as a glycosylase or integral
membrane enzyme can be fused in-frame to the library of targeting
peptide sequences and introduced into plants (FIG. 13). Plant
targeting peptide sequences may be most efficient in localizing the
chimeric enzymes to the ER and Golgi, although targeting peptide
sequences from fungi and mammals may also be effective. For
example, the N-terminal 77 amino acids from tobacco
N-acetylglucosaminyl Transferase I have been shown to correctly
target a reporter protein to the Golgi (Essl D. et al., FEBS Lett
1999 Jun. 18; 453(1-2):169-73). In one embodiment, one or more
N-terminal fragments comprising these 77 amino acids (or subsets of
these amino acids) is fused to one or more fragments comprising a
catalytic domain of GlcNAc transferase IV. At least one resulting
fusion protein correctly localizes a functional GlcNAc transferase
IV to the Golgi apparatus in a plant cell, as evidenced by
monitoring the glycosylation state of a reporter glycoprotein
resident or introduced into the plant host cell using techniques
described herein.
[0300] Another plant enzyme shown to localize to the Golgi is
Arabidopsis GlcNAc transferase II (Strasser R et al., Glycoconj J
1999 December; 16(12):787-91). Thus, in another embodiment, one or
more different fragments of the arabidopsis GlcNAc transferase II
targeting peptide are fused to a GlcNAc transferase IV catalytic
domain and fusion constructs produced and tested as described
above. The plant specific .beta.1,2-xylosyltransferase from
Arabidopsis thaliana is another protein that localizes to the Golgi
and its localization and retention in the Golgi is dependent on its
cytoplasmic and transmembrane sequences (Dirnberger et al., Plant
Mol Biol 2002 September; 50(2):273-81). Thus, in another
embodiment, one or more fragments comprising the cytoplasmic and
transmembrane sequences of .beta.1,2-xylosyltransferase are fused
to one or more fragments comprising a GlcNAc transferase IV
catalytic domain and resulting fusion constructs are transformed
into plant cells and tested for their ability to produce a
human-like N-glycan and to otherwise modulate glycosylation in the
plant host cell.
[0301] Because GlcNAc transferase IV or Galactosyltransferase from
one organism may function more efficiently in a specific plant host
than one from another organism, fragments comprising GlcNAc
transferase IVs (or catalytic domains) from various eukaryotic
organisms are fused in-frame to the library of endoplasmic
reticulum (ER) and Golgi targeting peptide sequences and are then
introduced into plants. The use of a library of nucleic acids
encoding enzyme domains isolated or derived from different species
increases the chances of efficient glycosylation--in addition to
correct localization and glycosylation by GlcNAc transferase
IV.
[0302] The methods and combinatorial nucleic acid libraries of the
invention may be used to introduce and localize, sequentially or en
masse, multiple enzymes required to glycosylate proteins in a plant
cell with human-like N-glycans. As different plant species may
require different growth conditions, protocols for transformation
may vary depending on the species being transformed (Potrykus,
"Gene transfer methods for plants and cell cultures." Ciba Found
Symp 1990; 154:198-208; discussion 208-12). The commonly used
methods for generating transgenic plants include Agrobacterium
mediated transformation, particle bombardment (Sanford, J. C. et
al, Biolistic plant transformation. Physiol. Plant. 1990, 79:
206-209) and electroporation.
Agrobacterium Method
[0303] The catalytic domains of GlcNAc transferase IVs are fused
in-frame to multiple different targeting peptide sequences known to
target proteins to the ER and Golgi in plants. Each of these fusion
constructs is introduced under the control of the ubiquitously
expressed promoters like the 35S CaMV, ubiquitin or actin
promoters, tissue specific promoters or inducible promoters. A
plant specific terminator region is also used. This cassette
(Promoter::targeting peptide-GlcNAc transferase IV::terminator) is
cloned into a vector suitable for Agrobacterium mediated
transformation (FIG. 13). The vector also contains a selectable
marker that allows one to select for transformed plants. The common
selectable markers used include those resulting in kanamycin,
hygromycin and basta resistance. The construct is introduced into
Agrobacterium via well-established transformation methods, which
are available in the art. An Agrobacterium library of
Golgi-targeted GlcNAc transferase IVs is thereby generated.
[0304] Embryonic and meristematic tissue may be transformed and can
regenerate transgenic plants. To transform tissue, tissue explants
(these could be plumules and radicals from germinated seeds) are
first soaked and coated with an Agrobacterium innoculum. They are
then cultured on plates containing the innoculum to form an
undifferentiated mass of cells termed the callus.
[0305] Transformed plant cells are selected for by adding to the
medium the relevant kanamycin, hygromycin or basta (depending on
the selectable marker used on the construct). The transformed plant
cells can either be grown in culture and remain undifferentiated or
they are treated with shoot regenerating and shoot elongation
medium. Explants that differentiate are transferred onto rooting
medium to generate transgenic plants. Some plants like Arabidopsis
can be transformed by dipping flowers into an Agrobacterium
solution. Seeds from the transformed plants are germinated on
plates containing the relevant herbicide or antibiotic selection.
Transgenic plants are those that grow on the selection media. The
transgenic plants are then screened for those with properly
glycosylated proteins (i.e., those which have complex, human-like
N-glycans) by isolating glycoproteins from plant extracts and
analyzing glycoprotein patterns as described elsewhere herein,
e.g., by using a specific antibody or lectin. Although the
Agrobacterium method is economical and simple, it is limited to
certain species of plants. Accordingly, plants that cannot be
transformed using Agrobacterium can be transformed by ballistics or
electroporation.
Particle Bombardment Method and Electroporation
[0306] Compared to Agrobacterium mediated transformation, these
methods have a greater tendency to insert multiple copies of the
transgene into the genome. This could result in gene silencing and
cosuppression. However, unlike Agrobacterium mediated
transformation, these methods are not species limited and are
therefore useful when an Agrobacterium method cannot be employed to
generate transgenic plants. In the particle bombardment method,
cultured plant cells are bombarded with very small tungsten or gold
particle that have been coated with DNA (Promoter::targeting
peptide-GlcNAc transferase IV-terminator::selectable marker) (FIG.
13) (rb and lb not required) while in the electroporation method,
plant cells in a DNA (Promoter::targeting peptide-GlcNAc
transferase IV-terminator::selectable marker) solution are treated
with an electric pulse that perforates the cell, allowing it to
take up DNA. The cells are then cultured and allowed to recover.
Stable transformants are selected for by culturing and regenerating
plants on appropriate selection medium.
Engineering Soybeans to Express GlcNAc Transferase IV Using a
Soybean Cotyledonary Node Agrobacterium Mediated Transformation
System
[0307] An Agrobacterium library of Golgi-targeted GlcNAc
transferase IV is generated as described above. Soybean explants
are transformed with the library using a protocol described by
Hinchee et al (Bio/Technology 1988. 6:915). A reporter protein is
expressed with a His tag, purified and then analyzed. Transgenic
plants are assayed for proteins with the .alpha.-1,6 mannose and
the .alpha.-1,3 mannose residues using, e.g., mass
spectroscopy.
Engineering Pea to Express GlcNAc Transferase IV Using Particle
Bombardment
[0308] A GlcNAc transferase IV plasmid library is coated onto
tungsten or gold particles and used as microprojectiles to bombard
calli derived from pea embryonic tissue as described (Molnar et
al., Symposium on Recent Advances in Plant Biotechnology, Sep.
4-11, 1999, Stara Lesna, Slovak Republic). A reporter protein is
expressed with a His tag, purified and then analyzed. Transgenic
plants are assayed for proteins with the .alpha.-1,6 mannose and
the .alpha.-1,3 mannose residues using, e.g., MALDI.
Engineering Plants to Express GlcNAc Transferase I
[0309] GlcNAc transferase I is involved in the addition of GlcNAc
to the terminal .alpha.-1,3 mannose residue to form
Man.sub.5GlcNAc.sub.2, an essential step in the maturation of
complex N-glycans. Although GlcNAc transferase I has been isolated
from plants and appears to have the same function as its mammalian
homolog, it may not be the most efficient enzyme for glycosylation
of mammalian or exogenous proteins and may not be found in every
plant species. As the addition of GlcNAc to the terminal
.alpha.-1,3 mannose residue is a controlling step in the mammalian
glycosylation pathway, it is advantageous to have transgenic plants
that can carry out this step efficiently. To create transgenic
plants that express GlcNAc transferase I that can function
efficiently to promote the formation of complex N-glycans, a
library of GlcNAc transferase I isolated or derived from various
organisms is fused in-frame to multiple plant Golgi targeting
peptide sequences according to the methods described herein. The
combinatorial library thus created is introduced into a plant cell
or organism as described above for GlcNAc transferase IV.
Engineering Maize to Express GlcNAc Transferase I Using Particle
Bombardment
[0310] Transgenic maize can be obtained using a protocol similar to
the one used to generate peas that express GlcNAc transferase IV.
Here the GlcNAc transferase I plasmid library is coated onto
tungsten or gold particles and used to bombard calli derived from
maize embryonic tissue, e.g., using a protocol specific for the
generation of transgenic maize (Gordon-Kamm W J et al., Plant Cell
1990 July; 2(7):603-618)). Transgenic plants are assayed for
proteins having GlcNAc on the terminal .alpha.-1,3 mannose residue,
e.g., using specific antibodies or by assaying reduced binding of
the N-glycans to certain lectins or by using MALDI-TOF.
[0311] Other useful references for using plant host cells according
to the invention include: Christou P. Plant Mol Biol 1997
September; 35(1-2):197-203; Chowrira G M et al. Mol Biotechnol 1995
February; 3(1):17-23; Dirnberger et al., Plant Mol Biol 2002
September; 50(2):273-81; Frame B R et al. Plant Physiol 2002 May;
129(1):13-22; Gomord V et al. Biochimie 1999 June; 81(6):607-18;
Laursen C M et al. Plant Mol Biol 1994 January; 24(1):51-61; Orci L
et al. J Cell Biol 2000 Sep. 18; 150(6):1263-70; Newell C A. Mol
Biotechnol 2000 September; 16(1):53-65; Pawlowski Wp et al. Mol
Biotechnol 1996 August; 6(1):17-30; Schroeder H E et al. Plant
Physiol 1993 March; 101(3):751-757; Sorokin, A P et al. Plant Sci.
2000 Jul. 28; 156(2):227-233; Strasser R et al. Glycoconj J 1999
December; 16(12):787-91; and Tomes D T et al. Plant Mol Biol 1990
February; 14(2):261-8.
Engineering Plant Cells to Produce
.beta.1,4-Galactosyltransferases
[0312] .beta.1,4-galactosyltransferase is an important human
glycosyltransferase that is absent in plants. Lerouge P et al.
Plant Mol Biol 1998 September; 38(1-2):31-48. In mammals,
.beta.1,4-galactosyltransferase is localized in the Golgi and is
responsible for the transfer of galactose residues to the terminal
N-acetylglucosamine of the core Man.sub.3GlcNAc.sub.2 of complex
N-glycans. In plants, the Man.sub.3GlcNAc.sub.2 core contains
.beta.1,2-xylose and .alpha.1,3-fucose residues and lacks the
.beta.1,4-galactose. The xylose and fucose modifications are
implicated in allergies and act as antigenic epitopes and are
therefore not desirable modifications of therapeutic proteins.
[0313] The galactose modifications carried out by
.beta.1,4-galactosyltransferase can be important for the proper
functioning of the therapeutic proteins. In mammals,
.beta.1,4-galactosyltransferase acts after
N-acetylglucosaminyltransferase I and
N-acetylglucosaminyltransferase II and has been shown to initiate
branching of the complex N-glycan. Lerouge P et al. Plant Mol Biol
1998 September; 38(1-2):31-48. Palacpac N et al. Proc Natl Acad Sci
USA 1999 Apr. 13; 96(8):4692-7. In tobacco cells, expression of
human .beta.1,4-galactosyltransferase has been shown to result in
galactosylated N-glycans with reduced fucose and xylose
modifications. Bakker H et al. Proc Natl Acad Sci USA 2001 Feb. 27;
98(5):2899-904 Fujiyama K et al. Biochem Biophys Res Commun 2001
Nov. 30; 289(2):553-7. Palacpac N et al. Proc Natl Acad Sci USA
1999 Apr. 13; 96(8):4692-7. In these studies, a 1.2 kb fragment of
human .beta.1,4-galactosyltransferase was cloned downstream of the
cauliflower mosaic virus promoter (35SCaMV), introduced into the
binary vector pGA482, and finally into tobacco cells. Palacpac N et
al. Proc Natl Acad Sci USA 1999 Apr. 13; 96(8):4692-7.
[0314] Tobacco cells were transformed using the agrobacterium
method described by Rempel et al. (Rempel, H. C. et al. 1995.
Transgenic Res. 4(3):199-207.) Transformation of tobacco cells has
also been described (An, G 1985. Plant Physiol. 79:568-570).
Expression of .beta.1,4-galactosyltransferase under the 35SCaMV
resulted in ubiquitous expression of the gene in tobacco cells.
Tobacco cells expressing human .beta.1,4-galactosyltransferase
showed the presence of galactosylated N-glycans. (Palacpac N et al.
Proc Natl Acad Sci USA 1999 Apr. 13; 96(8):4692-7). Bakker et al.
showed that crossing tobacco plants expressing human
.beta.1,4-galactosyltransferase with plants expressing the heavy
and light chain of a mouse antibody resulted in plants in which the
antibody showed 30% galactosylation (Bakker H et al. Proc Natl Acad
Sci USA 2001 Feb. 27; 98(5):2899-904).
[0315] A combinatorial DNA library can be constructed to obtain a
.beta.1,4-galactosyltransferase line for the addition of galactose
residues. The combinatorial DNA library can effectively produce
lines which are more efficient in the addition of galactose
residues. Once such a line is made it can be easily crossed to
lines expressing other glycosylation enzymes and to those
expressing therapeutic proteins to produce therapeutic proteins
with human-like glycosylation. The final line can then be grown as
plants and harvested to extract proteins or can be cultured as
plant cells in suspension cultures to produce proteins in
bioreactors. By expressing the therapeutic proteins using the
library of signal peptides, it is possible to retain the
therapeutic protein within the cells or have them secreted into the
medium. Tobacco cells expressing .beta.1,4-galactosyltransferase
secrete galactosylated N-glycans (Ryo Misaki et al. Glycobiology
2002 Dec. 17; 10:1093). While horseradish peroxidase isozyme C
expressed in tobacco plants expressing
.beta.1,4-galactosyltransferase contained xylose and fucose
modifications, no xylose or fucose modification could be detected
in horseradish peroxidase isozyme C expressed in tobacco cells
expressing .beta.1,4-galactosyltransferase (GT6 cells). (Fujiyama K
et al. Biochem Biophys Res Commun 2001 Nov. 30; 289(2):553-7). This
indicates that it may be advantageous to express therapeutic
proteins in cell lines instead of whole plants.
Engineering Plants to Produce Sialyltransferase
[0316] In mammals, sialyltransferase is a trans golgi enzyme that
adds terminal sialic acid residues to glycosylated polypeptides.
Thus far, terminal sialic acid residues have not been detected in
plants (Wee E et al. Plant Cell 1998 October; 10(10):1759-68). Wee
et al. expressed the rat .alpha.-2,6-sialyltransferase in
transgenic arabidopsis and showed that the enzyme properly
localized to the golgi and was functional. Wee et al. demonstrated
that membranes isolated from transgenic arabidopsis, when incubated
with CMP-.sup.3H-sialic acid and asialofetuin acceptor, resulted in
the addition of sialic acid residues while membrane isolated from
wild-type arabidopsis did not. While expressing the rat
.alpha.-2,6-sialyltransferase in arabidopsis resulted in a
functional enzyme that was able to incorporate sialic acid
residues, fusing the mammalian enzymes
.alpha.-2,3-sialyltransferase and .alpha.-2,6-sialyltransferase to
a variety of transit peptides using the library approach of the
present invention described earlier can result in more efficient
sialylation in other plant species. Wee E et al had to isolate
membranes and incubate them with CMP-.sup.3H-sialic acid and
asialofetuin acceptor since arabidopsis does not have CMP-sialic
acid or its transporter. In order to overcome this additional step
and obtain sialic acid addition in the plant, CMP-sialic acid
biosynthetic pathway and the CMP-sialic acid transporter can be
co-expressed in transgenic plants expressing
.alpha.-2,3-sialyltransferase and .alpha.-2,6-sialyltransferase. As
an alternative the CMP-sialic acid transporter can be co-expressed
.alpha.-2,3-sialyltransferase and .alpha.-2,6-sialyltransferase in
plant cells grown in suspension culture, and CMP-sialic acid or
other precursors of CMP-sialic acid supplied in the medium.
Expressing .alpha.-2,3-Sialyltransferase and
.alpha.-2,6-Sialyltransferase in Lemna
[0317] As described in the U.S. Pat. No. 6,040,498, lemna
(duckweed) can be transformed using both agrobacterium and
ballistic methods. Using protocols described in the patent, lemna
will be transformed with a library of golgi targeted
.alpha.-2,3-sialyltransferase and/or .alpha.-2,6-sialyltransferase
and a library of mammalian CMP-sialic acid transporters. Transgenic
plants can be assayed for proteins with terminal sialic acid
residues.
Expressing .alpha.-2,3-Sialyltransferase and
.alpha.-2,6-Sialyltransferase in Tobacco Cells
[0318] Alpha-2,3-sialyltransferase and/or
.alpha.-2,6-sialyltransferase and/or a library of mammalian
CMP-sialic acid transporters can also be introduced into tobacco
cells grown in suspension culture as described for
.beta.1,4-galactosyltransferases. CMP-sialic acid can be added to
the medium. Both the cells and the culture medium (secreted
proteins) can be assayed for proteins with terminal sialic acid
residues residues.
Example 18
Engineering Insect Cells to Produce Glycosyltransferases
[0319] Insect cells provide another mechanism for producing
glycoproteins but the resulting glycoproteins are not complex
human-like glycoproteins. Marz et al. 1995 Glycoproteins,
29:543-563; Jarvis 1997 The Baculoviruses 389-431. It is another
feature of the present invention to provide enzymes in insect
cells, which are targeted to the organelles in the secretory
pathway. In a preferred embodiment, enzymes such as
glycosyltransferases, galactosyltransferases and sialyltransferases
are targeted to the ER, Golgi or the trans Golgi network in
lepidopteran insect cells (Sf9). Expression of mammalian
.beta.1,4-galactosyltransferase has been shown in Sf9 cells.
Hollister et al. Glycobiology. 1998 8(5):473-480. These enzymes are
targeted by means of a chimeric protein comprising a cellular
targeting signal peptide not normally associated with the enzyme.
The chimeric proteins are made by constructing a nucleic acid
library comprising targeting sequences as described herein and the
glycosylation enzymes. Baculovirus expression in insect cells is
commonly used for stable transformation for adding mammalian
glycosyltransferases in insect cells. Hollister et al.
Glycobiology. 2001 11(1):1-9.
TABLE-US-00011 TABLE 11 DNA and Protein Sequence Resources 1.
European Bioinformatics Institute (EBI) is a centre for research
and services in bioinformatics 2. Swissprot database 3. List of
known glycosyltransferases and their origin. 4. human cDNA, Kumar
et al (1990) Proc. Natl. Acad. Sci. USA 87: 9948-9952 5. human
gene, Hull et al (1991) Biochem. Biophys. Res. Commun. 176: 608-615
6. mouse cDNA, Kumar et al (1992) Glycobiology 2: 383-393 7. mouse
gene, Pownall et al (1992) Genomics 12: 699-704 8. murine gene (5'
flanking, non-coding), Yang et al (1994) Glycobiology 5: 703-712 9.
rabbit cDNA, Sarkar et al (1991) Proc. Natl. Acad. Sci. USA 88:
234-238 10. rat cDNA, Fukada et al (1994) Biosci. Biotechnol.
Biochem. 58: 200-201 1,2 (GnTII) EC 2.4.1.143 11. human gene, Tan
et al (1995) Eur. J. Biochem. 231: 317-328 12. rat cDNA, D'Agostaro
et al (1995) J. Biol. Chem. 270: 15211-15221 13. .beta.1,4 (GnTIII)
EC 2.4.1.144 14. human cDNA, Ihara et al (1993) J. Biochem. 113:
692-698 15. murine gene, Bhaumik et al (1995) Gene 164: 295-300 16.
rat cDNA, Nishikawa et al (1992) J. Biol. Chem. 267: 18199-18204
.beta.1,4 (GnTIV) EC 2.4.1.145 17. human cDNA, Yoshida et al (1998)
Glycoconjugate Journal 15: 1115-1123 18. bovine cDNA, Minowa et
al., European Patent EP 0 905 232 .beta.1,6 (GnT V) EC 2.4.1.155
19. human cDNA, Saito et al (1994) Biochem. Biophys. Res. Commun.
198: 318-327 20. rat cDNA, Shoreibah et al (1993) J. Biol. Chem.
268: 15381-15385 .beta.1,4 Galactosyltransferase, EC 2.4.1.90
(LacNAc synthetase) EC 2.4.1.22 (lactose synthetase) 21. bovine
cDNA, D'Agostaro et al (1989) Eur. J. Biochem. 183: 211-217 22.
bovine cDNA (partial), Narimatsu et al (1986) Proc. Natl. Acad.
Sci. USA 83: 4720-4724 23. bovine cDNA (partial), Masibay &
Qasba (1989) Proc. Natl. Acad. Sci, USA 86: 5733-5377 24. bovine
cDNA (5' end), Russo et al (1990) J. Biol. Chem. 265: 3324 25.
chicken cDNA (partial), Ghosh et al (1992) Biochem. Biophys. Res.
Commun. 1215-1222 26. human cDNA, Masri et al (1988) Biochem.
Biophys. Res. Commun. 157: 657-663 27. human cDNA, (HeLa cells)
Watzele & Berger (1990) Nucl. Acids Res. 18: 7174 28. human
cDNA, (partial) Uejima et al (1992) Cancer Res. 52: 6158-6163 29.
human cDNA, (carcinoma) Appert et al (1986) Biochem. Biophys. Res.
Commun. 139: 163-168 30. human gene, Mengle-Gaw et al (1991)
Biochem. Biophys. Res. Commun. 176: 1269-1276 31. murine cDNA,
Nakazawa et al (1988) J. Biochem. 104: 165-168 32. murine cDNA,
Shaper et al (1988) J. Biol. Chem. 263: 10420-10428 33. murine cDNA
(novel), Uehara & Muramatsu unpublished 34. murine gene, Hollis
et al (1989) Biochem. Biophys. Res. Commun. 162: 1069- 1075 35. rat
protein (partial), Bendiak et al (1993) Eur. J. Biochem. 216:
405-417 2,3-Sialytransferase, (ST3Gal II) (N-linked)
(Gal-1,3/4-GlcNAc) EC 2.4.99.6 36. human cDNA, Kitagawa &
Paulson (1993) Biochem. Biophys. Res. Commun. 194: 375-382 37. rat
cDNA, Wen et al (1992) J. Biol. Chem. 267: 21011-21019
2,6-Sialytransferase, (ST6Gal I) EC 2.4.99.1 38. chicken, Kurosawa
et al (1994) Eur. J. Biochem 219: 375-381 39. human cDNA (partial),
Lance et al (1989) Biochem. Biophys. Res. Commun. 164: 225-232 40.
human cDNA, Grundmann et al (1990) Nucl. Acids Res. 18: 667 41.
human cDNA, Zettlmeisl et al (1992) Patent EPO475354-A/3 42. human
cDNA, Stamenkovic et al (1990) J. Exp. Med. 172: 641-643 (CD75) 43.
human cDNA, Bast et al (1992) J. Cell Biol. 116: 423-435 44. human
gene (partial), Wang et al (1993) J. Biol. Chem. 268: 4355-4361 45.
human gene (5' flank), Aasheim et al (1993) Eur. J. Biochem. 213:
467-475 46. human gene (promoter), Aas-Eng et al (1995) Biochim.
Biophys. Acta 1261: 166-169 47. mouse cDNA, Hamamoto et al (1993)
Bioorg. Med. Chem. 1: 141-145 48. rat cDNA, Weinstein et al (1987)
J. Biol. Chem. 262: 17735-17743 49. rat cDNA (transcript
fragments), Wang et al (1991) Glycobiology 1: 25-31, Wang et al
(1990) J. Biol. Chem. 265: 17849-17853 50. rat cDNA (5' end),
O'Hanlon et al (1989) J. Biol. Chem. 264: 17389-17394; Wang et al
(1991) Glycobiology 1: 25-31 51. rat gene (promoter), Svensson et
al (1990) J. Biol. Chem. 265: 20863-20688 52. rat mRNA (fragments),
Wen et al (1992) J. Biol. Chem. 267: 2512-2518
[0320] Additional methods and reagents which can be used in the
methods for modifying the glycosylation are described in the
literature, such as U.S. Pat. No. 5,955,422, U.S. Pat. No.
4,775,622, U.S. Pat. No. 6,017,743, U.S. Pat. No. 4,925,796, U.S.
Pat. No. 5,766,910, U.S. Pat. No. 5,834,251, U.S. Pat. No.
5,910,570, U.S. Pat. No. 5,849,904, U.S. Pat. No. 5,955,347, U.S.
Pat. No. 5,962,294, U.S. Pat. No. 5,135,854, U.S. Pat. No.
4,935,349, U.S. Pat. No. 5,707,828, and U.S. Pat. No. 5,047,335.
Appropriate yeast expression systems can be obtained from sources
such as the American Type Culture Collection, Rockville, Md.
Vectors are commercially available from a variety of sources.
SEQUENCE LISTINGS
TABLE-US-00012 [0321] SEQ ID NO: 1-6 can be found in U.S. Pat.
Application No. 09/892,591 SEQ ID NO: 7 Primer: regions of high
homology within 1,6 mannosyltransferases
5'-atggcgaaggcagatggcagt-3' SEQ ID NO: 8 Primer: regions of high
homology within 1,6 mannosyltransferases
5'-ttagtccttccaacttccttc-3' SEQ ID NO: 9 internal primer:
5'-actgccatctgccttcgccat-3' SEQ ID NO: 10 internal primer:
5'-GTAATACGACTCACTATAGGGC-3' T7 SEQ ID NO: 11 Internal primer:
5'-AATTAACCCTCACTAAAGGG-3' T3 SEQ ID NO: 12 Primer: atgcccgtgg
ggggcctgtt gccgctcttc agtagc SEQ ID NO: 13 Primer: tcatttctct
ttgccatcaa tttccttctt ctgttcacgg SEQ ID NO: 14 Primer: ggcgcgccga
ctcctccaag ctgctcagcg ggggcctgtt ccac SEQ ID NO: 15 Primer:
ccttaattaa tcatttctct ttgccatcaa tttccttctt ctgttcacgg SEQ ID NO:
16 Primer: ggcgagctcg gcctacccgg ccaaggctga gatcatttgt ccagcttcaga
SEQ ID NO: 17 Primer: gcccacgtcg acggatccgt ttaaacatcg attggagagg
ctgacaccgc tacta SEQ ID NO: 18 Primer: cgggatccac tagtatttaa
atcatatgtg cgagtgtaca actcttccca catgg SEQ ID NO: 19 Primer:
ggacgcgtcg acggcctacc cggccgtacg aggaatttct cggatgactc ttttc SEQ ID
NO: 20 Primer: cgggatccct cgagagatct tttttgtaga aatgtcttgg tgcct
SEQ ID NO: 21 Primer: ggacatgcat gcactagtgc ggccgccacg tgatagttgt
tcaattgatt gaaataggga caa SEQ ID NO: 22 Primer: ccttgctagc
ttaattaacc gcggcacgtc cgacggcggc ccacgggtcc ca SEQ ID NO: 23
Primer: ggacatgcat gcggatccct taagagccgg cagcttgcaa attaaagcct
tcgagcgtcc c SEQ ID NO: 24 Primer: gaaccacgtc gacggccatt gcggccaaaa
ccttttttcc tattcaaaca caaggcattg c SEQ ID NO: 25 Primer: ctccaatact
agtcgaagat tatcttctac ggtgcctgga ctc SEQ ID NO: 26 Primer:
tggaaggttt aaacaaagct agagtaaaa tagatatagc gagattagag aatg SEQ ID
NO: 27 Primer: aagaattcgg ctggaaggcc ttgtaccttg atgtagttcc
cgttttcatc SEQ ID NO: 28 Primer: gcccaagccg gccttaaggg atctcctgat
gactgactca ctgataataa aaatacgg SEQ ID NO: 29 Primer: gggcgcgta
tttaaatacta gtggatctat cgaatctaaa tgtaagttaa aatctctaa SEQ ID NO:
30 Primer: ggccgcctgc agatttaaat gaattcgg cgcgccttaat SEQ ID NO: 31
Primer: taaggcgcgc cgaattcatt taaatctgca gggc SEQ ID NO: 32 Primer:
5'-tggcaggcgcgcctcagtcagcgctctcg-3' SEQ ID NO: 33 Primer:
5'-aggttaatta agtgctaattccagctagg-3' SEQ ID NO: 34 primer for
K.lactis OCH1 gene: ccagaagaat tcaattytgy cartgg SEQ ID NO: 35
primer for K.lactis OCH1 gene: cagtgaaaat acctggnccn gtcca SEQ ID
NO: 36 primer for K.lactis MNN1 gene: tgccatcttt taggtccagg cccgttc
SEQ ID NO: 37 primer for K.lactis MNN1 gene: gatcccacga cgcatcgtat
ttctttc SEQ ID NO: 38 DNA sequence of the 302 by segment of the
putative KlOCH1 gene:
gcccttcagtgaaaatacctggcccggtccagttcataatatcggtaccatctgtatttttggcggttttcttt-
tgttgatgttt
gtaatttttgttgaacttctttttatccctcatgttgacattataatcatctgcaatgtcttttaatacttcag-
c
atcatctaaaggaatgctgcttttaacatttgccacgctctccaatgttgttgcggtgatatttgtgatcaatt-
cgcgcaataa
tggatggccagattttgattgtattgtccactgacaaaattgaattctctggaagggc SEQ ID
NO: 39 Translation of putative KlOCH1 gene (excluding primers):
TIQSKSGHPLLRELITNITATTLESVANVKSSIPLDDAEVLKDIADDYNVNM
RDKKKFNKNYKHQQKKTAKNTDGTDIMN SEQ ID NO: 40 DNA sequence of the 405
by segment of the putative KlMNN1 gene:
cccagcgtgccattaccgtatttgccgccgtttgaaatactcaatattcatgatggttgtaaggcgttttttat-
cattcgcgat
ataatatgccatcttttaggtccaggcccgttctcttagctatctttggtgtctgtgctaccgtgatatggtac-
ct
attctttttccagtctaatctgaagatggcagatttgaaaaaggtagcaacttcaaggtatctttcacaagaac-
cgtcgttat
cagaacttatgtcaaatgtgaagatcaagcctattgaagaaaccccggtttcgccattggagttgattccagat-
atcgaa
atatcgactagaaagaaatacgatgcgtcgtgggatctgttgttccgtggtagaaaatataaatcgttcaacga-
ttatgat SEQ ID NO: 41 DNA sequence of the K.lactis OCH1 gene:
atggggttaccaaagatttcaagaagaacgaggtacattattgtcattgtgctgatactgtacttattgttttc-
tgtgcaatg
gaatactgcgaaagtgaatcaccatttctataacagcattggcacggtgcttcccagtacagctcgcgtggatc-
acttga
acttgaaaaacttggacttagcaggtacgagcaataacggtgatcatttgatggatctacgagttcaattggct-
agtcaat
tcccctacgattctcgagtacccatccccaaaaaggtatggcagacctggaagattgatcccagttcaaagtca-
caggt
ttcttccatttcaaaatgccagaatgattggaaacatttcagtgcatccgaggaaccgccatatcaataccaat-
taatcaca
gatgatcaaatgataccacttctagagcagctatatggtggggtcccacaagtgataaaggcttttgaatcctt-
gccactt
ccaattcttaaagcagactttttcagatacttgatcctttatgcaagaggtggtatatattctgacatggatac-
gttcccatta
aagccattgtcgtcatggccatcgacttctcagtcctacttttctagtttaaagaatccacaaaggtatagaaa-
ttccttgga
caaccttgaaacgctagaagcttcagaacctggctttgtcattggtatcgaggctgatccggatagaagcgatt-
gggca
gagtggtacgccaggagaatacaattctgtcagtggacaatacaatcaaaatctggccatccattattgcgcga-
attgat
cacaaatatcaccgcaacaacattggagagcgtggcaaatgttaaaagcagcattcctttagatgatgctgaag-
tattaa
aagacattgcagatgattataatgtcaacatgagggataaaaagaagttcaacaaaaattacaaacatcaacaa-
aagaa
aaccgccaaaaatacagatggtaccgatattatgaactggactggtccaggtattttttcagatgttattttcc-
agtatctta
ataacgttatccagaagaatgatgacattttaattttcaatgataatcttaatgttatcaacaaacatggatcc-
aaacatgata
caactatgagattctataaagacattgttaaaaatttacaaaacgacaaaccctcattgttctggggattcttt-
tcattgatga
cagagcctattctagtggacgacatcatggtacttccgattacttctttctcaccaggtatcagaacaatgggc-
gctaaag aagacaacgacgagatggcatttgttaagcatatttttgaaggaagttggaaagactga
SEQ ID NO: 42 Translation of putative K.lactis OCH1 gene:
MGLPKISRRTRYIIVIVLILYLLFSVQWNTAKVNHHFYNSIGTVLPSTARVD
HLNLKNLDLAGTSNNGDHLMDLRVQLASQFPYDSRVPIPKKVWQTWKID
PSSKSQVSSISKCQNDWKHFSASEEPPYQYQLITDDQMIPLLEQLYGGVPQ
VIKAFESLPLPILKADFFRYLILYARGGIYSDMDTFPLKPLSSWPSTSQSYFS
SLKNPQRYRNSLDNLETLEASEPGFVIGIEADPDRSDWAEWYARRIQFCQW
TIQSKSGHPLLRELITNITATTLESVANVKSSIPLDDAEVLKDIADDYNVNM
RDKKKFNKNYKHQQKKTAKNTDGTDIMNWTGPGIFSDVIFQYLNNVIQK
NDDILIFNDNLNVINKHGSKHDTTMRFYKDIVKNLQNDKPSLFWGFFSLMT
EPILVDDIMVLPITSFSPGIRTMGAKEDNDEMAFVKHIFEGSWKDZ SEQ ID NO: 43 DNA
sequence of the K.lactis MNN1 gene:
atgatggttgtaaggcgttttttatcagcttcgcgatataatatgccatcttttaggtccaggcccgttctctt-
agctatctttg
gtgtctgtgctaccgtgatatggtacctattctttttccagtctaatctgaagatggcagatttgaaaaaggta-
g
caacttcaaggtatctttcacaagaaccgtcgttatcagaacttatgtcaaatgtgaagatcaagcctattgaa-
gaaaccc
cggtttcgccattggagttgattccagatatcgaaatatcgactagaaagaaatacgatgcgtcgtgggatctg-
ttgttcc
gtggtagaaaatataaatcgttcaacgattatgatcttcatacgaaatgtgagttttatttccagaatttatac-
aatttgaacg
aggattggaccaataatattcggacgttcactttcgatattaacgatgtagacacgtctacgaaaattgacgct-
cttaaag
attccgatggggttcaattggtggacgagaaggctatacgtttatacaagagaacgcataacgttgccttggct-
acgga
aaggttacgtctttatgataaatgttttgtcaatagtccaggttcaaacccattgaaaatggatcaccttttca-
gatcgaaca
agaagagtaagactacggctttggatgacgaagtcactgggaaccgtgatacttttaccaagacgaagaaaact-
tcgtt
cttaagcgatatggacacgagtagtttccagaagtacgatcaatgggatttcgaacatagaatgttccccatga-
tcccat
atttcgaggaacacaatttcaccaacgtgatgcctattttcaccggctcaaacggtggggaacctttacctcaa-
gggaaa
ttcccggtattagatccaaaatccggtgaattgttacgtgtagagactttcagatatgataaatcgaaatcgct-
ttggaaga
actggaatgatatgtcctctgcttctggtaaacgtggtattatcttggctgctggcgacggccaagtggaccaa-
tgcatcc
gtcttattgctacgttgagagctcaaggaaacgctctacctattcaaattatccacaacaaccaattgaatgag-
aaatctgt
gaaactgttatcggaggccgctaaatctaccgaattctcatccggtagagctcaatctctttggttagtgaatg-
tgggccc
cacgttggaatcttcaatgaagagcaattttgggagatttaagaataagtggttgtcagttattttcaacactt-
ttgaagaatt
tatattcatagatacagatgccatctcctacattaatatggctgattatttcaacttcaaggagtacaaatcta-
ctggaacac
tcttctttaaggataggtctttggcaattggaactgaacagaaatgtggtcctttgttcgaaactcttgaacca-
agaattctt
gaaatgtactatttcaatactttacctatgatcaatggtgattacgtggaacagcaatgtatgggcatgctcac-
cccagag
gaaaaagtttacaaacgtttctttgaagttggtcatcaacacaacttggaaagtggattattggccatcaacaa-
aaacgaa
cacatcatgggattggttactgcaacagtcttaaatatcgcaccaaaggtcggaggttgcggttggggtgacaa-
agagt
ttttctggcttggtttgttggttgctggccaacgctactcgatctatgatatagatgcaagtgcaattggtgtt-
cctcaacag
aagcaatctatcgctaacggagacgaatttgatgaatataggatttgttctttacaagtggcacatacttcata-
cgacgga
catttactatggataaatggtggctacagtactgtaagaaaccagagactrttgaaggtgattggaccaacatt-
aagga
gcttcgtgaatcgtattctgatgataaagaaaaggactgaaggcttatagtgatacagttaaggtggaagcagc-
aatcg
tgccagattccagaagtaatggttggggtagagacgatcaaagatgtaaaggctacttctggtgcggcaaattt-
acttca
aagctgaaaccgtatacttataacacggtggtaactaaaggtgatttgatccgtttcggagacgaggaaatcga-
aagtat ctccaagattaataagatctggaatgatgctattattccagacggagcttaa SEQ ID
NO: 44 Translation of putative K.lactis MNN1 gene:
MMVVRRFLSASRYNMPSFRSRPVLLAIFGVCATVIWYLFFFQSNLKMADL
KKVATSRYLSQEPSLSELMSNVKIKPIEETPVSPLELIPDIEISTRKKYDASW
DLLFRGRKYKSFNDYDLHTKCEFYFQNLYNLNEDWTNNIRTFTFDINDVD
TSTKIDALKDSDGVQLVDEKAIRLYKRTHNVALATERLRLYDKCFVNSPG
SNPLKMDHLFRSNKKSKTTALDDEVTGNRDTFTKTKKTSFLSDMDTSSFQ
KYDQWDFEHRMFPMIPYFEEHNFTNVMPIFTGSNGGEPLPQGKFPVLDPKS
GELLRVETFRYDKSKSLWKNWNDMSSASGKRGIILAAGDGQVDQCIRLIA
TLRAQGNALPIQIIHNNQLNEKSVKLLSEAAKSTEFSSGRAQSLWLVNVGP
TLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNFKEYKST
GTLFFKDRSLAIGTEQKCGPLFETLEPRILEMYYFNTLPMINGDYVEQQCM
GMLTPEEKVYKRFFEVGHQHNLESGLLAINKNEHIMGLVTATVLNIAPKV
GGCGWGDKEFFWLGLLVAGQRYSIYDIDASAIGVPQQKQSIANGDEFDEY
RICSLQVAHTSYDGHLLWINGGSQYCKKPETFEGDWTNIKELRESYSDDKE
KALKAYSDTVKVEAAIVPDSRSNGWGRDDQRCKGYFWCGKFTSKLKPYT
YNTVVTKGDLIRFGDEEIESISKINKIWNDAIIPDGA
REFERENCES
[0322] Aebi, M., J. Gassenhuber, et al. (1996). "Cloning and
characterization of the ALG3 gene of Saccharomyces cerevisiae."
Glycobiology 6(4): 439-444. [0323] Altmann, F., E. Staudacher, et
al. (1999). "Insect cells as hosts for the expression of
recombinant glycoproteins." Glycoconjugate Journal 16(2): 109-123.
[0324] Andersen, D. C. and C. F. Goochee (1994). "The effect of
cell-culture conditions on the oligosaccharide structures of
secreted glycoproteins." Current Opinion in Biotechnology 5:
546-549. [0325] Bardor, M., L. Faye, et al. (1999). "Analysis of
the N-glycosylation of recombinant glycoproteins produced in
transgenic plants." Trends in Plant Science 4(9): 376-380. [0326]
Bretthauer, R. K. and F. J. Castellino (1999). "Glycosylation of
Pichia pastoris-derived proteins." Biotechnology and Applied
Biochemistry 30: 193-200. [0327] Burda, P. and M. Aebi (1999). "The
dolichol pathway of N-linked glycosylation." Biochimica Et
Biophysica Acta--General Subjects 1426(2): 239-257. [0328] Chiba,
Y., M. Suzuki, et al. (1998). "Production of human compatible high
mannose-type (Man(5)GlcNAc(2)) sugar chains in Saccharomyces
cerevisiae." Journal of Biological Chemistry 273(41): 26298-26304.
[0329] Cole, E. S., E. Higgins, et al. (1994). "Glycosylation
Patterns of Human Proteins Expressed in Transgenic Goat Milk."
Journal of Cellular Biochemistry: 265-265. [0330] Davies et al.
Biotechnol Bioeng. 2001 Aug. 20; 74(4):288-294. (Expression of
GnTIII in a Recombinant Anti-CD20 CHO Production Cell Line:
Expression of Antibodies with Altered Glycoforms Leads to an
Increase in ADCC Through Higher Affinity for FcgRIII). [0331]
Dente, L., U. Ruther, et al. (1988). "Expression of Human
Alpha-1-Acid Glycoprotein Genes in Cultured-Cells and in Transgenic
Mice." Genes & Development 2(2): 259-266. [0332] Huffaker, T.
C. and P. W. Robbins (1983). "Yeast Mutants Deficient in Protein
Glycosylation." Proceedings of the National Academy of Sciences of
the United States of America-Biological Sciences 80(24): 7466-7470.
[0333] Jarvis, D. L., Z. S. Kawar, et al. (1998). "Engineering
N-glycosylation pathways in the baculovirus-insect cell system."
Current Opinion in Biotechnology 9(5): 528-533. [0334] Kimura,
T.sub.m N. Kitamoto, et al. (1997). "A novel yeast gene, RHK1, is
involved in the synthesis of the cell wall receptor for the HM-1
killer toxin that inhibits beta-1,3-glucan synthesis." Molecular
& General Genetics 254(2): 139-147. [0335] Kimura, T.sub.m T.
Komiyama, et al. (1999). "N-glycosylation is involved in the
sensitivity of Saccharomyces cerevisiae to HM-1 killer toxin
secreted from Hansenula mrakii IFO 0895." Applied Microbiology and
Biotechnology 51(2): 176-184. [0336] Malissard, M., S. Zeng, et al.
(2000). "Expression of functional soluble forms of human
beta-1,4-galactosyltransferase I, alpha-2,6-sialyltransferase, and
alpha-1,3-fucosyltransferase VI in the methylotrophic yeast Pichia
pastoris." Biochemical and Biophysical Research Communications
267(1): 169-173. [0337] Maras, M. and R. Contreras (1994). Methods
of Modifying Carbohydrate Moieties. United States, Alko Group Ltd.,
Helsinki, Finland. [0338] Maras, M., A. De Bruyn, et al. (1999).
"In vivo synthesis of complex N-glycans by expression of human
N-acetylglucosaminyltransferase I in the filamentous fungus
Trichoderma reesei." Febs Letters 452(3): 365-370. [0339] Maras,
M., X. Saelens, et al. (1997). "In vitro conversion of the
carbohydrate moiety of fungal glycoproteins to mammalian-type
oligosaccharides--Evidence for
N-acetylglucosaminyltransferase-I-accepting glycans from
Trichoderma reesei." European Journal of Biochemistry 249(3):
701-707. [0340] Martinet, W., M. Maras, et al. (1998).
"Modification of the protein glycosylation pathway in the
methylotrophic yeast Pichia pastoris." Biotechnology Letters
20(12): 1171-1177. [0341] McGarvey, P. B., J. Hammond, et al.
(1995). "Expression of the Rabies Virus Glycoprotein in Transgenic
Tomatoes." Bio-Technology 13(13): 1484-1487. [0342] Moens, S. and
J. Vanderleyden (1997). "Glycoproteins in prokaryotes." Archives of
Microbiology 168(3): 169-175. [0343] Nakanishishindo, Y., K.
Nakayama, et al. (1993). "Structure of the N-Linked
Oligosaccharides That Show the Complete Loss of
Alpha-1,6-Polymannose Outer Chain From Och1, Och1 Mnn1, and Och1
Mnn1 Alg3 Mutants of Saccharomyces--Cerevisiae." Journal of
Biological Chemistry 268(35): 26338-26345. [0344] Raju, T. S., J.
B. Briggs, et al. (2000). "Species-specific variation in
glycosylation of IgG: evidence for the species-specific sialylation
and branch-specific galactosylation and importance for engineering
recombinant glycoprotein therapeutics." Glycobiology 10(5):
477-486. [0345] Sharma, C. B., R. Knauer, et al. (2001).
"Biosynthesis of lipid-linked oligosaccharides in yeast: the ALG3
gene encodes the DoI-P-Man: Man(5)GlcNAc(2)-PP-DoI
mannosyltransferase." Biological Chemistry 382(2): 321-328. [0346]
Staub, J. M., B. Garcia, et al. (2000). "High-yield production of a
human therapeutic protein in tobacco chloroplasts." Nature
Biotechnology 18(3): 333-338. [0347] Takeuchi, M. (1997). "Trial
for molecular breeding of yeast for the production of glycoprotein
therapeutics." Trends in Glycoscience and Glycotechnology 9:
S29-S35. [0348] Umana et al., Nat Biotechnol. 1999a February
(17)176-180. (Engineered glycoforms of an antineuroblastoma IgG1
with optimized antibodydependent cellular cytotoxic activity)
[0349] Umana et al., Biotechnol Bioeng. 1999b December 5;
65(5):542-549. (Regulated Overexpression of glycosyltransferase).
[0350] Verostek, M. F., P. H. Atkinson, et al. (1993).
"Glycoprotein-Biosynthesis in the Alg3 Saccharomyces-Cerevisiae
Mutant 0.1. Role of Glucose in the Initial Glycosylation of
Invertase in the Endoplasmic-Reticulum." Journal of Biological
Chemistry 268(16): 12095-12103. [0351] Verostek, M. F., P. H.
Atkinson, et al. (1993). "Glycoprotein-Biosynthesis in the Alg3
Saccharomyces-Cerevisiae Mutant 0.2. Structure of Novel
Man6-10glcnac2 Processing Intermediates On Secreted Invertase."
Journal of Biological Chemistry 268(16): 12104-12115. [0352]
Weikert, S., D. Papac, et al. (1999). "Engineering Chinese hamster
ovary cells to maximize sialic acid content of recombinant
glycoproteins." Nature Biotechnology 17(11): 1116-1121. [0353]
Werner, R. G., W. Noe, et al. (1998). "Appropriate mammalian
expression systems for biopharmaceuticals."
Arzneimittel-Forschung-Drug Research 48(8): 870-880. [0354] Yang,
M. and M. Butler (2000). "Effects of ammonia on CHO cell growth,
erythropoietin production, and glycosylation." Biotechnology and
Bioengineering 68(4): 370-380. Zufferey, R., R. Knauer, et al.
(1995). "Stt3, a Highly Conserved Protein Required for Yeast
Oligosaccharyl Transferase-Activity in-Vivo." EMBO Journal 14(20):
4949-4960,
Sequence CWU 1
1
47121DNAArtificial SequencePrimer 1atggcgaagg cagatggcag t
21221DNAArtificial SequencePrimer 2ttagtccttc caacttcctt c
21326DNAArtificial SequencePrimer 3taytggmgng tngarcynga yatnaa
26420DNAArtificial SequencePrimer 4gcrtcncccc anckytcrta
2054PRTArtificial SequenceIllustrative signal tetrapeptide 5His Asp
Glu Leu 1 64PRTArtificial SequenceIllustrative signal tetrapeptide
6Lys Asp Glu Leu 1 721DNAArtificial Sequenceprimer 7atggcgaagg
cagatggcag t 21821DNAArtificial Sequenceprimer 8ttagtccttc
caacttcctt c 21921DNAArtificial Sequenceprimer 9actgccatct
gccttcgcca t 211022DNAArtificial Sequenceprimer 10gtaatacgac
tcactatagg gc 221120DNAArtificial Sequenceprimer 11aattaaccct
cactaaaggg 201236DNAArtificial Sequenceprimer 12atgcccgtgg
ggggcctgtt gccgctcttc agtagc 361340DNAArtificial Sequenceprimer
13tcatttctct ttgccatcaa tttccttctt ctgttcacgg 401444DNAArtificial
Sequenceprimer 14ggcgcgccga ctcctccaag ctgctcagcg gggtcctgtt ccac
441550DNAArtificial Sequenceprimer 15ccttaattaa tcatttctct
ttgccatcaa tttccttctt ctgttcacgg 501651DNAArtificial Sequenceprimer
16ggcgagctcg gcctacccgg ccaaggctga gatcatttgt ccagcttcag a
511755DNAArtificial Sequenceprimer 17gcccacgtcg acggatccgt
ttaaacatcg attggagagg ctgacaccgc tacta 551854DNAArtificial
Sequenceprimer 18cgggatccac tagtatttaa atcatatgtc gagtgtacaa
ctcttcccac atgg 541955DNAArtificial Sequenceprimer 19ggacgcgtcg
acggcctacc cggccgtacg aggaatttct cggatgactc ttttc
552045DNAArtificial Sequenceprimer 20cgggatccct cgagagatct
tttttgtaga aatgtcttgg tgcct 452163DNAArtificial Sequenceprimer
21ggacatgcat gcactagtgc ggccgccacg tgatagttgt tcaattgatt gaaataggga
60caa 632252DNAArtificial Sequenceprimer 22ccttgctagc ttaattaacc
gcggcacgtc cgacggcggc ccacgggtcc ca 522361DNAArtificial
Sequenceprimer 23ggacatgcat gcggatccct taagagccgg cagcttgcaa
attaaagcct tcgagcgtcc 60c 612461DNAArtificial Sequenceprimer
24gaaccacgtc gacggccatt gcggccaaaa ccttttttcc tattcaaaca caaggcattg
60c 612543DNAArtificial Sequenceprimer 25ctccaatact agtcgaagat
tatcttctac ggtgcctgga ctc 432653DNAArtificial Sequenceprimer
26tggaaggttt aaacaaagct agagtaaaat agatatagcg agattagaga atg
532750DNAArtificial Sequenceprimer 27aagaattcgg ctggaaggcc
ttgtaccttg atgtagttcc cgttttcatc 502858DNAArtificial Sequenceprimer
28gcccaagccg gccttaaggg atctcctgat gactgactca ctgataataa aaatacgg
582959DNAArtificial Sequenceprimer 29gggcgcgtat ttaaatacta
gtggatctat cgaatctaaa tgtaagttaa aatctctaa 593039DNAArtificial
Sequenceprimer 30ggccgcctgc agatttaaat gaattcggcg cgccttaat
393134DNAArtificial Sequenceprimer 31taaggcgcgc cgaattcatt
taaatctgca gggc 343229DNAArtificial Sequenceprimer 32tggcaggcgc
gcctcagtca gcgctctcg 293329DNAArtificial Sequenceprimer
33aggttaatta agtgctaatt ccagctagg 293426DNAArtificial
Sequenceprimer 34ccagaagaat tcaattytgy cartgg 263525DNAArtificial
Sequenceprimer 35cagtgaaaat acctggnccn gtcca 253627DNAArtificial
Sequenceprimer 36tgccatcttt taggtccagg cccgttc 273727DNAArtificial
Sequenceprimer 37gatcccacga cgcatcgtat ttctttc
2738302DNAKluveromyces lactis 38gcccttcagt gaaaatacct ggcccggtcc
agttcataat atcggtacca tctgtatttt 60tggcggtttt cttttgttga tgtttgtaat
ttttgttgaa cttcttttta tccctcatgt 120tgacattata atcatctgca
atgtctttta atacttcagc atcatctaaa ggaatgctgc 180ttttaacatt
tgccacgctc tccaatgttg ttgcggtgat atttgtgatc aattcgcgca
240ataatggatg gccagatttt gattgtattg tccactgaca aaattgaatt
ctctggaagg 300gc 3023980PRTKluveromyces lactis 39Thr Ile Gln Ser
Lys Ser Gly His Pro Leu Leu Arg Glu Leu Ile Thr 1 5 10 15 Asn Ile
Thr Ala Thr Thr Leu Glu Ser Val Ala Asn Val Lys Ser Ser 20 25 30
Ile Pro Leu Asp Asp Ala Glu Val Leu Lys Asp Ile Ala Asp Asp Tyr 35
40 45 Asn Val Asn Met Arg Asp Lys Lys Lys Phe Asn Lys Asn Tyr Lys
His 50 55 60 Gln Gln Lys Lys Thr Ala Lys Asn Thr Asp Gly Thr Asp
Ile Met Asn 65 70 75 80 40404DNAKluveromyces lactis 40cccagcgtgc
cattaccgta tttgccgccg tttgaaatac tcaatattca tgatggttgt 60aaggcgtttt
ttatcattcg cgatataata tgccatcttt taggtccagg cccgttctct
120tagctatctt tggtgtctgt gctaccgtga tatggtacct attctttttc
cagtctaatc 180tgaagatggc agatttgaaa aaggtagcaa cttcaaggta
tctttcacaa gaaccgtcgt 240tatcagaact tatgtcaaat gtgaagatca
agcctattga agaaaccccg gtttcgccat 300tggagttgat tccagatatc
gaaatatcga ctagaaagaa atacgatgcg tcgtgggatc 360tgttgttccg
tggtagaaaa tataaatcgt tcaacgatta tgat 404411363DNAKluveromyces
lactis 41atggggttac caaagatttc aagaagaacg aggtacatta ttgtcattgt
gctgatactg 60tacttattgt tttctgtgca atggaatact gcgaaagtga atcaccattt
ctataacagc 120attggcacgg tgcttcccag tacagctcgc gtggatcact
tgaacttgaa aaacttggac 180ttagcaggta cgagcaataa cggtgatcat
ttgatggatc tacgagttca attggctagt 240caattcccct acgattctcg
agtacccatc cccaaaaagg tatggcagac ctggaagatt 300gatcccagtt
caaagtcaca ggtttcttcc atttcaaaat gccagaatga ttggaaacat
360ttcagtgcat ccgaggaacc gccatatcaa taccaattaa tcacagatga
tcaaatgata 420ccacttctag agcagctata tggtggggtc ccacaagtga
taaaggcttt tgaatccttg 480ccacttccaa ttcttaaagc agactttttc
agatacttga tcctttatgc aagaggtggt 540atatattctg acatggatac
gttcccatta aagccattgt cgtcatggcc atcgacttct 600cagtcctact
tttctagttt aaagaatcca caaaggtata gaaattcctt ggacaacctt
660gaaacgctag aagcttcaga acctggcttt gtcattggta tcgaggctga
tccggataga 720agcgattggg cagagtggta cgccaggaga atacaattct
gtcagtggac aatacaatca 780aaatctggcc atccattatt gcgcgaattg
atcacaaata tcaccgcaac aacattggag 840agcgtggcaa atgttaaaag
cagcattcct ttagatgatg ctgaagtatt aaaagacatt 900gcagatgatt
ataatgtcaa catgagggat aaaaagaagt tcaacaaaaa ttacaaacat
960caacaaaaga aaaccgccaa aaatacagat ggtaccgata ttatgaactg
gactggtcca 1020ggtatttttt cagatgttat tttccagtat cttaataacg
ttatccagaa gaatgatgac 1080attttaattt tcaatgataa tcttaatgtt
atcaacaaac atggatccaa acatgataca 1140actatgagat tctataaaga
cattgttaaa aatttacaaa acgacaaacc cctcattgtt 1200ctggggattc
ttttcattga tgacagagcc tattctagtg gacgacatca tggtacttcc
1260gattacttct ttctcaccag gtatcagaac aatgggcgct aaagaagaca
acgacgagat 1320ggcatttgtt aagcatattt ttgaaggaag ttggaaagac tga
136342453PRTKluveromyces lactis 42Met Gly Leu Pro Lys Ile Ser Arg
Arg Thr Arg Tyr Ile Ile Val Ile 1 5 10 15 Val Leu Ile Leu Tyr Leu
Leu Phe Ser Val Gln Trp Asn Thr Ala Lys 20 25 30 Val Asn His His
Phe Tyr Asn Ser Ile Gly Thr Val Leu Pro Ser Thr 35 40 45 Ala Arg
Val Asp His Leu Asn Leu Lys Asn Leu Asp Leu Ala Gly Thr 50 55 60
Ser Asn Asn Gly Asp His Leu Met Asp Leu Arg Val Gln Leu Ala Ser 65
70 75 80 Gln Phe Pro Tyr Asp Ser Arg Val Pro Ile Pro Lys Lys Val
Trp Gln 85 90 95 Thr Trp Lys Ile Asp Pro Ser Ser Lys Ser Gln Val
Ser Ser Ile Ser 100 105 110 Lys Cys Gln Asn Asp Trp Lys His Phe Ser
Ala Ser Glu Glu Pro Pro 115 120 125 Tyr Gln Tyr Gln Leu Ile Thr Asp
Asp Gln Met Ile Pro Leu Leu Glu 130 135 140 Gln Leu Tyr Gly Gly Val
Pro Gln Val Ile Lys Ala Phe Glu Ser Leu 145 150 155 160 Pro Leu Pro
Ile Leu Lys Ala Asp Phe Phe Arg Tyr Leu Ile Leu Tyr 165 170 175 Ala
Arg Gly Gly Ile Tyr Ser Asp Met Asp Thr Phe Pro Leu Lys Pro 180 185
190 Leu Ser Ser Trp Pro Ser Thr Ser Gln Ser Tyr Phe Ser Ser Leu Lys
195 200 205 Asn Pro Gln Arg Tyr Arg Asn Ser Leu Asp Asn Leu Glu Thr
Leu Glu 210 215 220 Ala Ser Glu Pro Gly Phe Val Ile Gly Ile Glu Ala
Asp Pro Asp Arg 225 230 235 240 Ser Asp Trp Ala Glu Trp Tyr Ala Arg
Arg Ile Gln Phe Cys Gln Trp 245 250 255 Thr Ile Gln Ser Lys Ser Gly
His Pro Leu Leu Arg Glu Leu Ile Thr 260 265 270 Asn Ile Thr Ala Thr
Thr Leu Glu Ser Val Ala Asn Val Lys Ser Ser 275 280 285 Ile Pro Leu
Asp Asp Ala Glu Val Leu Lys Asp Ile Ala Asp Asp Tyr 290 295 300 Asn
Val Asn Met Arg Asp Lys Lys Lys Phe Asn Lys Asn Tyr Lys His 305 310
315 320 Gln Gln Lys Lys Thr Ala Lys Asn Thr Asp Gly Thr Asp Ile Met
Asn 325 330 335 Trp Thr Gly Pro Gly Ile Phe Ser Asp Val Ile Phe Gln
Tyr Leu Asn 340 345 350 Asn Val Ile Gln Lys Asn Asp Asp Ile Leu Ile
Phe Asn Asp Asn Leu 355 360 365 Asn Val Ile Asn Lys His Gly Ser Lys
His Asp Thr Thr Met Arg Phe 370 375 380 Tyr Lys Asp Ile Val Lys Asn
Leu Gln Asn Asp Lys Pro Ser Leu Phe 385 390 395 400 Trp Gly Phe Phe
Ser Leu Met Thr Glu Pro Ile Leu Val Asp Asp Ile 405 410 415 Met Val
Leu Pro Ile Thr Ser Phe Ser Pro Gly Ile Arg Thr Met Gly 420 425 430
Ala Lys Glu Asp Asn Asp Glu Met Ala Phe Val Lys His Ile Phe Glu 435
440 445 Gly Ser Trp Lys Asp 450 432241DNAKluveromyces lactis
43atgatggttg taaggcgttt tttatcagct tcgcgatata atatgccatc ttttaggtcc
60aggcccgttc tcttagctat ctttggtgtc tgtgctaccg tgatatggta cctattcttt
120ttccagtcta atctgaagat ggcagatttg aaaaaggtag caacttcaag
gtatctttca 180caagaaccgt cgttatcaga acttatgtca aatgtgaaga
tcaagcctat tgaagaaacc 240ccggtttcgc cattggagtt gattccagat
atcgaaatat cgactagaaa gaaatacgat 300gcgtcgtggg atctgttgtt
ccgtggtaga aaatataaat cgttcaacga ttatgatctt 360catacgaaat
gtgagtttta tttccagaat ttatacaatt tgaacgagga ttggaccaat
420aatattcgga cgttcacttt cgatattaac gatgtagaca cgtctacgaa
aattgacgct 480cttaaagatt ccgatggggt tcaattggtg gacgagaagg
ctatacgttt atacaagaga 540acgcataacg ttgccttggc tacggaaagg
ttacgtcttt atgataaatg ttttgtcaat 600agtccaggtt caaacccatt
gaaaatggat caccttttca gatcgaacaa gaagagtaag 660actacggctt
tggatgacga agtcactggg aaccgtgata cttttaccaa gacgaagaaa
720acttcgttct taagcgatat ggacacgagt agtttccaga agtacgatca
atgggatttc 780gaacatagaa tgttccccat gatcccatat ttcgaggaac
acaatttcac caacgtgatg 840cctattttca ccggctcaaa cggtggggaa
cctttacctc aagggaaatt cccggtatta 900gatccaaaat ccggtgaatt
gttacgtgta gagactttca gatatgataa atcgaaatcg 960ctttggaaga
actggaatga tatgtcctct gcttctggta aacgtggtat tatcttggct
1020gctggcgacg gccaagtgga ccaatgcatc cgtcttattg ctacgttgag
agctcaagga 1080aacgctctac ctattcaaat tatccacaac aaccaattga
atgagaaatc tgtgaaactg 1140ttatcggagg ccgctaaatc taccgaattc
tcatccggta gagctcaatc tctttggtta 1200gtgaatgtgg gccccacgtt
ggaatcttca atgaagagca attttgggag atttaagaat 1260aagtggttgt
cagttatttt caacactttt gaagaattta tattcataga tacagatgcc
1320atctcctaca ttaatatggc tgattatttc aacttcaagg agtacaaatc
tactggaaca 1380ctcttcttta aggataggtc tttggcaatt ggaactgaac
agaaatgtgg tcctttgttc 1440gaaactcttg aaccaagaat tcttgaaatg
tactatttca atactttacc tatgatcaat 1500ggtgattacg tggaacagca
atgtatgggc atgctcaccc cagaggaaaa agtttacaaa 1560cgtttctttg
aagttggtca tcaacacaac ttggaaagtg gattattggc catcaacaaa
1620aacgaacaca tcatgggatt ggttactgca acagtcttaa atatcgcacc
aaaggtcgga 1680ggttgcggtt ggggtgacaa agagtttttc tggcttggtt
tgttggttgc tggccaacgc 1740tactcgatct atgatataga tgcaagtgca
attggtgttc ctcaacagaa gcaatctatc 1800gctaacggag acgaatttga
tgaatatagg atttgttctt tacaagtggc acatacttca 1860tacgacggac
atttactatg gataaatggt ggctctcagt actgtaagaa accagagact
1920tttgaaggtg attggaccaa cattaaggag cttcgtgaat cgtattctga
tgataaagaa 1980aaggctctga aggcttatag tgatacagtt aaggtggaag
cagcaatcgt gccagattcc 2040agaagtaatg gttggggtag agacgatcaa
agatgtaaag gctacttctg gtgcggcaaa 2100tttacttcaa agctgaaacc
gtatacttat aacacggtgg taactaaagg tgatttgatc 2160cgtttcggag
acgaggaaat cgaaagtatc tccaagatta ataagatctg gaatgatgct
2220attattccag acggagctta a 224144747PRTKluveromyces lactis 44Met
Met Val Val Arg Arg Phe Leu Ser Ala Ser Arg Tyr Asn Met Pro 1 5 10
15 Ser Phe Arg Ser Arg Pro Val Leu Leu Ala Ile Phe Gly Val Cys Ala
20 25 30 Thr Val Ile Trp Tyr Leu Phe Phe Phe Gln Ser Asn Leu Lys
Met Ala 35 40 45 Asp Leu Lys Lys Val Ala Thr Ser Arg Tyr Leu Ser
Gln Glu Pro Ser 50 55 60 Leu Ser Glu Leu Met Ser Asn Val Lys Ile
Lys Pro Ile Glu Glu Thr 65 70 75 80 Pro Val Ser Pro Leu Glu Leu Ile
Pro Asp Ile Glu Ile Ser Thr Arg 85 90 95 Lys Lys Tyr Asp Ala Ser
Trp Asp Leu Leu Phe Arg Gly Arg Lys Tyr 100 105 110 Lys Ser Phe Asn
Asp Tyr Asp Leu His Thr Lys Cys Glu Phe Tyr Phe 115 120 125 Gln Asn
Leu Tyr Asn Leu Asn Glu Asp Trp Thr Asn Asn Ile Arg Thr 130 135 140
Phe Thr Phe Asp Ile Asn Asp Val Asp Thr Ser Thr Lys Ile Asp Ala 145
150 155 160 Leu Lys Asp Ser Asp Gly Val Gln Leu Val Asp Glu Lys Ala
Ile Arg 165 170 175 Leu Tyr Lys Arg Thr His Asn Val Ala Leu Ala Thr
Glu Arg Leu Arg 180 185 190 Leu Tyr Asp Lys Cys Phe Val Asn Ser Pro
Gly Ser Asn Pro Leu Lys 195 200 205 Met Asp His Leu Phe Arg Ser Asn
Lys Lys Ser Lys Thr Thr Ala Leu 210 215 220 Asp Asp Glu Val Thr Gly
Asn Arg Asp Thr Phe Thr Lys Thr Lys Lys 225 230 235 240 Thr Ser Phe
Leu Ser Asp Met Asp Thr Ser Ser Phe Gln Lys Tyr Asp 245 250 255 Gln
Trp Asp Phe Glu His Arg Met Phe Pro Met Ile Pro Tyr Phe Glu 260 265
270 Glu His Asn Phe Thr Asn Val Met Pro Ile Phe Thr Gly Ser Asn Gly
275 280 285 Gly Glu Pro Leu Pro Gln Gly Lys Phe Pro Val Leu Asp Pro
Lys Ser 290 295 300 Gly Glu Leu Leu Arg Val Glu Thr Phe Arg Tyr Asp
Lys Ser Lys Ser 305 310 315 320 Leu Trp Lys Asn Trp Asn Asp Met Ser
Ser Ala Ser Gly Lys Arg Gly 325 330 335 Ile Ile Leu Ala Ala Gly Asp
Gly Gln Val Asp Gln Cys Ile Arg Leu 340 345 350 Ile Ala Thr Leu Arg
Ala Gln Gly Asn Ala Leu Pro Ile Gln Ile Ile 355 360 365 His Asn Asn
Gln Leu Asn Glu Lys Ser Val Lys Leu Leu Ser Glu Ala 370 375 380 Ala
Lys Ser Thr Glu Phe Ser Ser Gly Arg Ala Gln Ser Leu Trp Leu 385 390
395 400 Val Asn Val Gly Pro Thr Leu Glu Ser Ser Met Lys Ser Asn Phe
Gly 405 410 415 Arg Phe Lys Asn Lys Trp Leu Ser Val Ile Phe Asn Thr
Phe Glu Glu 420 425 430 Phe Ile Phe Ile Asp Thr Asp Ala Ile Ser Tyr
Ile Asn Met Ala Asp 435 440 445 Tyr Phe Asn Phe Lys Glu Tyr Lys Ser
Thr Gly Thr Leu Phe Phe Lys 450 455 460 Asp Arg Ser Leu Ala Ile Gly
Thr Glu Gln Lys Cys Gly Pro Leu Phe 465 470 475 480 Glu Thr Leu Glu
Pro Arg Ile Leu Glu Met Tyr Tyr Phe Asn Thr Leu 485 490 495 Pro Met
Ile Asn Gly Asp Tyr Val Glu Gln Gln Cys Met Gly Met Leu 500 505 510
Thr Pro Glu Glu Lys Val Tyr Lys Arg Phe Phe Glu Val Gly His Gln 515
520
525 His Asn Leu Glu Ser Gly Leu Leu Ala Ile Asn Lys Asn Glu His Ile
530 535 540 Met Gly Leu Val Thr Ala Thr Val Leu Asn Ile Ala Pro Lys
Val Gly 545 550 555 560 Gly Cys Gly Trp Gly Asp Lys Glu Phe Phe Trp
Leu Gly Leu Leu Val 565 570 575 Ala Gly Gln Arg Tyr Ser Ile Tyr Asp
Ile Asp Ala Ser Ala Ile Gly 580 585 590 Val Pro Gln Gln Lys Gln Ser
Ile Ala Asn Gly Asp Glu Phe Asp Glu 595 600 605 Tyr Arg Ile Cys Ser
Leu Gln Val Ala His Thr Ser Tyr Asp Gly His 610 615 620 Leu Leu Trp
Ile Asn Gly Gly Ser Gln Tyr Cys Lys Ile Cys Pro Glu 625 630 635 640
Thr Phe Glu Gly Asp Trp Thr Asn Ile Lys Glu Leu Arg Glu Ser Tyr 645
650 655 Ser Asp Asp Lys Glu Lys Ala Leu Lys Ala Tyr Ser Asp Thr Val
Lys 660 665 670 Val Glu Ala Ala Ile Val Pro Asp Ser Arg Ser Asn Gly
Trp Gly Arg 675 680 685 Asp Asp Gln Arg Cys Lys Gly Tyr Phe Trp Cys
Gly Lys Phe Thr Ser 690 695 700 Lys Leu Lys Pro Tyr Thr Tyr Asn Thr
Val Val Thr Lys Gly Asp Leu 705 710 715 720 Ile Arg Phe Gly Asp Glu
Glu Ile Glu Ser Ile Ser Lys Ile Asn Lys 725 730 735 Ile Trp Asn Asp
Ala Ile Ile Pro Asp Gly Ala 740 745 451968DNAMus
musculusCDS(1)..(1965) 45atg ccc gtg ggg ggc ctg ttg ccg ctc ttc
agt agc cct ggg ggc ggc 48Met Pro Val Gly Gly Leu Leu Pro Leu Phe
Ser Ser Pro Gly Gly Gly 1 5 10 15 ggc ctg ggc agt ggc ctg ggc ggg
ggg ctt ggc ggc ggg agg aag ggg 96Gly Leu Gly Ser Gly Leu Gly Gly
Gly Leu Gly Gly Gly Arg Lys Gly 20 25 30 tct ggc ccc gct gcc ttc
cgc ctc acc gag aag ttc gtg ctg ctg ctg 144Ser Gly Pro Ala Ala Phe
Arg Leu Thr Glu Lys Phe Val Leu Leu Leu 35 40 45 gtg ttc agc gcc
ttc atc acg ctc tgc ttc ggg gca atc ttc ttc ctg 192Val Phe Ser Ala
Phe Ile Thr Leu Cys Phe Gly Ala Ile Phe Phe Leu 50 55 60 cct gac
tcc tcc aag ctg ctc agc ggg gtc ctg ttc cac tcc aac cct 240Pro Asp
Ser Ser Lys Leu Leu Ser Gly Val Leu Phe His Ser Asn Pro 65 70 75 80
gcc ttg cag ccg ccg gcg gag cac aag ccc ggg ctc ggg gcg cgt gcg
288Ala Leu Gln Pro Pro Ala Glu His Lys Pro Gly Leu Gly Ala Arg Ala
85 90 95 gag gat gcc gcc gag ggg aga gtc cgg cac cgc gag gaa ggc
gcg cct 336Glu Asp Ala Ala Glu Gly Arg Val Arg His Arg Glu Glu Gly
Ala Pro 100 105 110 ggg gac cct gga gct gga ctg gaa gac aac tta gcc
agg atc cgc gaa 384Gly Asp Pro Gly Ala Gly Leu Glu Asp Asn Leu Ala
Arg Ile Arg Glu 115 120 125 aac cac gag cgg gct ctc agg gaa gcc aag
gag acc ctg cag aag ctg 432Asn His Glu Arg Ala Leu Arg Glu Ala Lys
Glu Thr Leu Gln Lys Leu 130 135 140 ccg gag gag atc caa aga gac att
ctg ctg gag aag gaa aag gtg gcc 480Pro Glu Glu Ile Gln Arg Asp Ile
Leu Leu Glu Lys Glu Lys Val Ala 145 150 155 160 cag gac cag ctg cgt
gac aag gat ctg ttt agg ggc ttg ccc aag gtg 528Gln Asp Gln Leu Arg
Asp Lys Asp Leu Phe Arg Gly Leu Pro Lys Val 165 170 175 gac ttc ctg
ccc ccc gtc ggg gta gag aac cgg gag ccc gct gac gcc 576Asp Phe Leu
Pro Pro Val Gly Val Glu Asn Arg Glu Pro Ala Asp Ala 180 185 190 acc
atc cgt gag aag agg gca aag atc aaa gag atg atg acc cat gct 624Thr
Ile Arg Glu Lys Arg Ala Lys Ile Lys Glu Met Met Thr His Ala 195 200
205 tgg aat aat tat aaa cgc tat gcg tgg ggc ttg aac gaa ctg aaa cct
672Trp Asn Asn Tyr Lys Arg Tyr Ala Trp Gly Leu Asn Glu Leu Lys Pro
210 215 220 ata tca aaa gaa ggc cat tca agc agt ttg ttt ggc aac atc
aaa gga 720Ile Ser Lys Glu Gly His Ser Ser Ser Leu Phe Gly Asn Ile
Lys Gly 225 230 235 240 gct aca ata gta gat gcc ctg gat acc ctt ttc
att atg ggc atg aag 768Ala Thr Ile Val Asp Ala Leu Asp Thr Leu Phe
Ile Met Gly Met Lys 245 250 255 act gaa ttt caa gaa gct aaa tcg tgg
att aaa aaa tat tta gat ttt 816Thr Glu Phe Gln Glu Ala Lys Ser Trp
Ile Lys Lys Tyr Leu Asp Phe 260 265 270 aat gtg aat gct gaa gtt tct
gtt ttt gaa gtc aac ata cgc ttc gtc 864Asn Val Asn Ala Glu Val Ser
Val Phe Glu Val Asn Ile Arg Phe Val 275 280 285 ggt gga ctg ctg tca
gcc tac tat ttg tcc gga gag gag ata ttt cga 912Gly Gly Leu Leu Ser
Ala Tyr Tyr Leu Ser Gly Glu Glu Ile Phe Arg 290 295 300 aag aaa gca
gtg gaa ctt ggg gta aaa ttg cta cct gca ttt cat act 960Lys Lys Ala
Val Glu Leu Gly Val Lys Leu Leu Pro Ala Phe His Thr 305 310 315 320
ccc tct gga ata cct tgg gca ttg ctg aat atg aaa agt ggg atc ggg
1008Pro Ser Gly Ile Pro Trp Ala Leu Leu Asn Met Lys Ser Gly Ile Gly
325 330 335 cgg aac tgg ccc tgg gcc tct gga ggc agc agt atc ctg gcc
gaa ttt 1056Arg Asn Trp Pro Trp Ala Ser Gly Gly Ser Ser Ile Leu Ala
Glu Phe 340 345 350 gga act ctg cat tta gag ttt atg cac ttg tcc cac
tta tca gga gac 1104Gly Thr Leu His Leu Glu Phe Met His Leu Ser His
Leu Ser Gly Asp 355 360 365 cca gtc ttt gcc gaa aag gtt atg aaa att
cga aca gtg ttg aac aaa 1152Pro Val Phe Ala Glu Lys Val Met Lys Ile
Arg Thr Val Leu Asn Lys 370 375 380 ctg gac aaa cca gaa ggc ctt tat
cct aac tat ctg aac ccc agt agt 1200Leu Asp Lys Pro Glu Gly Leu Tyr
Pro Asn Tyr Leu Asn Pro Ser Ser 385 390 395 400 gga cag tgg ggt caa
cat cat gtg tcg gtt gga gga ctt gga gac agc 1248Gly Gln Trp Gly Gln
His His Val Ser Val Gly Gly Leu Gly Asp Ser 405 410 415 ttt tat gaa
tat ttg ctt aag gcg tgg tta atg tct gac aag aca gat 1296Phe Tyr Glu
Tyr Leu Leu Lys Ala Trp Leu Met Ser Asp Lys Thr Asp 420 425 430 ctc
gaa gcc aag aag atg tat ttt gat gct gtt cag gcc atc gag act 1344Leu
Glu Ala Lys Lys Met Tyr Phe Asp Ala Val Gln Ala Ile Glu Thr 435 440
445 cac ttg atc cgc aag tca agt ggg gga cta acg tac atc gca gag tgg
1392His Leu Ile Arg Lys Ser Ser Gly Gly Leu Thr Tyr Ile Ala Glu Trp
450 455 460 aag ggg ggc ctc ctg gaa cac aag atg ggc cac ctg acg tgc
ttt gca 1440Lys Gly Gly Leu Leu Glu His Lys Met Gly His Leu Thr Cys
Phe Ala 465 470 475 480 gga ggc atg ttt gca ctt ggg gca gat gga gct
ccg gaa gcc cgg gcc 1488Gly Gly Met Phe Ala Leu Gly Ala Asp Gly Ala
Pro Glu Ala Arg Ala 485 490 495 caa cac tac ctt gaa ctc gga gct gaa
att gcc cgc act tgt cat gaa 1536Gln His Tyr Leu Glu Leu Gly Ala Glu
Ile Ala Arg Thr Cys His Glu 500 505 510 tct tat aat cgt aca tat gtg
aag ttg gga ccg gaa gcg ttt cga ttt 1584Ser Tyr Asn Arg Thr Tyr Val
Lys Leu Gly Pro Glu Ala Phe Arg Phe 515 520 525 gat ggc ggt gtg gaa
gct att gcc acg agg caa aat gaa aag tat tac 1632Asp Gly Gly Val Glu
Ala Ile Ala Thr Arg Gln Asn Glu Lys Tyr Tyr 530 535 540 atc tta cgg
ccc gag gtc atc gag aca tac atg tac atg tgg cga ctg 1680Ile Leu Arg
Pro Glu Val Ile Glu Thr Tyr Met Tyr Met Trp Arg Leu 545 550 555 560
act cac gac ccc aag tac agg acc tgg gcc tgg gaa gcc gtg gag gct
1728Thr His Asp Pro Lys Tyr Arg Thr Trp Ala Trp Glu Ala Val Glu Ala
565 570 575 cta gaa agt cac tgc aga gtg aac gga ggc tac tca ggc tta
cgg gat 1776Leu Glu Ser His Cys Arg Val Asn Gly Gly Tyr Ser Gly Leu
Arg Asp 580 585 590 gtt tac att gcc cgt gag agt tat gac gat gtc cag
caa agt ttc ttc 1824Val Tyr Ile Ala Arg Glu Ser Tyr Asp Asp Val Gln
Gln Ser Phe Phe 595 600 605 ctg gca gag aca ctg aag tat ttg tac ttg
ata ttt tcc gat gat gac 1872Leu Ala Glu Thr Leu Lys Tyr Leu Tyr Leu
Ile Phe Ser Asp Asp Asp 610 615 620 ctt ctt cca cta gaa cac tgg atc
ttc aac acc gag gct cat cct ttc 1920Leu Leu Pro Leu Glu His Trp Ile
Phe Asn Thr Glu Ala His Pro Phe 625 630 635 640 cct ata ctc cgt gaa
cag aag aag gaa att gat ggc aaa gag aaa tga 1968Pro Ile Leu Arg Glu
Gln Lys Lys Glu Ile Asp Gly Lys Glu Lys 645 650 655 46655PRTMus
musculus 46Met Pro Val Gly Gly Leu Leu Pro Leu Phe Ser Ser Pro Gly
Gly Gly 1 5 10 15 Gly Leu Gly Ser Gly Leu Gly Gly Gly Leu Gly Gly
Gly Arg Lys Gly 20 25 30 Ser Gly Pro Ala Ala Phe Arg Leu Thr Glu
Lys Phe Val Leu Leu Leu 35 40 45 Val Phe Ser Ala Phe Ile Thr Leu
Cys Phe Gly Ala Ile Phe Phe Leu 50 55 60 Pro Asp Ser Ser Lys Leu
Leu Ser Gly Val Leu Phe His Ser Asn Pro 65 70 75 80 Ala Leu Gln Pro
Pro Ala Glu His Lys Pro Gly Leu Gly Ala Arg Ala 85 90 95 Glu Asp
Ala Ala Glu Gly Arg Val Arg His Arg Glu Glu Gly Ala Pro 100 105 110
Gly Asp Pro Gly Ala Gly Leu Glu Asp Asn Leu Ala Arg Ile Arg Glu 115
120 125 Asn His Glu Arg Ala Leu Arg Glu Ala Lys Glu Thr Leu Gln Lys
Leu 130 135 140 Pro Glu Glu Ile Gln Arg Asp Ile Leu Leu Glu Lys Glu
Lys Val Ala 145 150 155 160 Gln Asp Gln Leu Arg Asp Lys Asp Leu Phe
Arg Gly Leu Pro Lys Val 165 170 175 Asp Phe Leu Pro Pro Val Gly Val
Glu Asn Arg Glu Pro Ala Asp Ala 180 185 190 Thr Ile Arg Glu Lys Arg
Ala Lys Ile Lys Glu Met Met Thr His Ala 195 200 205 Trp Asn Asn Tyr
Lys Arg Tyr Ala Trp Gly Leu Asn Glu Leu Lys Pro 210 215 220 Ile Ser
Lys Glu Gly His Ser Ser Ser Leu Phe Gly Asn Ile Lys Gly 225 230 235
240 Ala Thr Ile Val Asp Ala Leu Asp Thr Leu Phe Ile Met Gly Met Lys
245 250 255 Thr Glu Phe Gln Glu Ala Lys Ser Trp Ile Lys Lys Tyr Leu
Asp Phe 260 265 270 Asn Val Asn Ala Glu Val Ser Val Phe Glu Val Asn
Ile Arg Phe Val 275 280 285 Gly Gly Leu Leu Ser Ala Tyr Tyr Leu Ser
Gly Glu Glu Ile Phe Arg 290 295 300 Lys Lys Ala Val Glu Leu Gly Val
Lys Leu Leu Pro Ala Phe His Thr 305 310 315 320 Pro Ser Gly Ile Pro
Trp Ala Leu Leu Asn Met Lys Ser Gly Ile Gly 325 330 335 Arg Asn Trp
Pro Trp Ala Ser Gly Gly Ser Ser Ile Leu Ala Glu Phe 340 345 350 Gly
Thr Leu His Leu Glu Phe Met His Leu Ser His Leu Ser Gly Asp 355 360
365 Pro Val Phe Ala Glu Lys Val Met Lys Ile Arg Thr Val Leu Asn Lys
370 375 380 Leu Asp Lys Pro Glu Gly Leu Tyr Pro Asn Tyr Leu Asn Pro
Ser Ser 385 390 395 400 Gly Gln Trp Gly Gln His His Val Ser Val Gly
Gly Leu Gly Asp Ser 405 410 415 Phe Tyr Glu Tyr Leu Leu Lys Ala Trp
Leu Met Ser Asp Lys Thr Asp 420 425 430 Leu Glu Ala Lys Lys Met Tyr
Phe Asp Ala Val Gln Ala Ile Glu Thr 435 440 445 His Leu Ile Arg Lys
Ser Ser Gly Gly Leu Thr Tyr Ile Ala Glu Trp 450 455 460 Lys Gly Gly
Leu Leu Glu His Lys Met Gly His Leu Thr Cys Phe Ala 465 470 475 480
Gly Gly Met Phe Ala Leu Gly Ala Asp Gly Ala Pro Glu Ala Arg Ala 485
490 495 Gln His Tyr Leu Glu Leu Gly Ala Glu Ile Ala Arg Thr Cys His
Glu 500 505 510 Ser Tyr Asn Arg Thr Tyr Val Lys Leu Gly Pro Glu Ala
Phe Arg Phe 515 520 525 Asp Gly Gly Val Glu Ala Ile Ala Thr Arg Gln
Asn Glu Lys Tyr Tyr 530 535 540 Ile Leu Arg Pro Glu Val Ile Glu Thr
Tyr Met Tyr Met Trp Arg Leu 545 550 555 560 Thr His Asp Pro Lys Tyr
Arg Thr Trp Ala Trp Glu Ala Val Glu Ala 565 570 575 Leu Glu Ser His
Cys Arg Val Asn Gly Gly Tyr Ser Gly Leu Arg Asp 580 585 590 Val Tyr
Ile Ala Arg Glu Ser Tyr Asp Asp Val Gln Gln Ser Phe Phe 595 600 605
Leu Ala Glu Thr Leu Lys Tyr Leu Tyr Leu Ile Phe Ser Asp Asp Asp 610
615 620 Leu Leu Pro Leu Glu His Trp Ile Phe Asn Thr Glu Ala His Pro
Phe 625 630 635 640 Pro Ile Leu Arg Glu Gln Lys Lys Glu Ile Asp Gly
Lys Glu Lys 645 650 655 4726DNAArtificial Sequenceprimer
47taytggmgng tngarcynga yathaa 26
* * * * *