U.S. patent application number 14/485314 was filed with the patent office on 2015-01-01 for production of isoprene under reduced oxygen inlet levels.
The applicant listed for this patent is Danisco US Inc., THE GOODYEAR TIRE & RUBBER COMPANY. Invention is credited to Gopal K. CHOTANI, Brian KIRSHNER, Jacob LATONE, Jeff P. PUCCI.
Application Number | 20150004665 14/485314 |
Document ID | / |
Family ID | 47522962 |
Filed Date | 2015-01-01 |
United States Patent
Application |
20150004665 |
Kind Code |
A1 |
CHOTANI; Gopal K. ; et
al. |
January 1, 2015 |
PRODUCTION OF ISOPRENE UNDER REDUCED OXYGEN INLET LEVELS
Abstract
This invention relates to methods for producing isoprene by
culturing recombinant cells (e.g., cells engineered to produce
isoprene) under reduced oxygen inlet levels.
Inventors: |
CHOTANI; Gopal K.;
(Cupertino, CA) ; KIRSHNER; Brian; (Foster City,
CA) ; LATONE; Jacob; (San Jose, CA) ; PUCCI;
Jeff P.; (Pacifica, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Danisco US Inc.
THE GOODYEAR TIRE & RUBBER COMPANY |
Palo Alto
Akron |
CA
OH |
US
US |
|
|
Family ID: |
47522962 |
Appl. No.: |
14/485314 |
Filed: |
September 12, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13725949 |
Dec 21, 2012 |
8865442 |
|
|
14485314 |
|
|
|
|
61580177 |
Dec 23, 2011 |
|
|
|
Current U.S.
Class: |
435/167 |
Current CPC
Class: |
C12P 5/007 20130101;
C12Y 402/03027 20130101; C12N 9/88 20130101 |
Class at
Publication: |
435/167 |
International
Class: |
C12P 5/00 20060101
C12P005/00 |
Claims
1-32. (canceled)
33. A method for producing isoprene comprising (a) culturing a
recombinant fungal host cell comprising a heterologous nucleic acid
encoding isoprene synthase under reduced oxygen inlet levels,
wherein the reduced oxygen inlet levels comprise between about 4%
to about 15% oxygen and wherein the cell is in fermentation or
production phase; and (b) producing isoprene.
34. The method of claim 33, further comprising recovering the
isoprene.
35. The method of claim 33, wherein the reduced oxygen inlet level
is between about 5% to about 15% oxygen.
36. The method of claim 35, wherein the reduced oxygen inlet level
is between about 7% to about 10% oxygen.
37. The method of claim 36, wherein the reduced oxygen inlet level
is about 7.7% oxygen.
38. The method of claim 36, wherein the reduced oxygen inlet level
is about 9.3% oxygen.
39. The method of claim 33, wherein the isoprene synthase is a
plant isoprene synthase.
40. The method of claim 39, wherein the plant isoprene synthase is
a poplar isoprene synthase, a kudzu isoprene synthase, a willow
isoprene synthase, or a eucalyptus isoprene synthase.
41. The method of claim 39, wherein the plant isoprene synthase is
an isoprene synthase from Pueraria or Populus or a hybrid, Populus
alba.times.Populus tremula.
42. The method of claim 39, wherein the plant isoprene synthase
polypeptide is selected from the group consisting of Pueraria
montana, Pueraria lobata, Populus tremuloides, Populus alba,
Populus nigra, and Populus trichocarpa.
43. The method of claim 33, wherein the isoprene synthase is an
isoprene synthase variant.
44. The method of claim 33, wherein the cell further comprises a
heterologous nucleic acid encoding for one or more mevalonate (MVA)
pathway polypeptides and/or one or more 1-deoxy-d-xylulose
5-phosphate (DXP) pathway polypeptides.
45. The method of claim 44, wherein the cell further comprises a
heterologous nucleic acid encoding for one or more isopentenyl
diphosphate isomerase (IDI) polypeptides.
46. The method of claim 44, wherein any one or more copies of a
heterologous nucleic acid is overexpressed.
47. The method of claim 44, wherein the heterologous nucleic acid
is cloned into a multicopy plasmid.
48. The method of claim 44, wherein the heterologous nucleic acid
is placed under an inducible promoter or a constitutive
promoter.
49. The method of claim 44, wherein any one or more of the
heterologous nucleic acids is integrated into the chromosome of the
recombinant host cell.
50. The method of claim 33, wherein the fungal host cells are
filamentous fungi cells.
51. The method of claim 50, wherein the filamentous fungi cells are
Aspergillus or Trichoderma cells.
52. The method of claim 50, wherein the filamentous fungi cells are
selected from the group consisting of A. oryzae, A. niger, T.
reesei, H. insolens, H. lanuginose, H. grisea, C. lucknowense, A.
sojae, A. japonicus, A. nidulans, A. aculeatus, A. awamori, F.
roseum, F. graminum F. cerealis, F. oxysporuim, F. venenatum, N.
crassa, M. miehei, T. viride, F. oxysporum, and F. solani
cells.
53. The method of claim 33, wherein the fungal host cells are yeast
cells.
54. The method of claim 53, wherein the yeast cells are selected
from the group consisting of Saccharomyces sp., Schizosaccharomyces
sp., Pichia sp., or Candida sp.
55. The method of claim 54, wherein the yeast cells are
Saccharomyces cerevisiae or Schizosaccharomyces pombe.
56. A method for producing isoprene comprising (a) culturing a
recombinant yeast or fungus host cell comprising a heterologous
nucleic acid encoding isoprene synthase under reduced oxygen inlet
levels having an inlet airflow rate of between about 8.0 standard
liter per minute (SLPM) and about 14 SLPM, wherein the cell is in
fermentation or production phase; and (b) producing isoprene.
57. The method of claim 56, further comprising recovering the
isoprene.
58. The method of claim 56, wherein the inlet airflow rate is about
10.0 SLPM.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 13/725,949, filed Dec. 21, 2012, which claims
priority to U.S. Provisional Application No. 61/580,177, filed Dec.
23, 2011, the disclosures of each of which are incorporated by
reference herein in their entirety.
INCORPORATION BY REFERENCE
[0002] The Sequence Listing submitted in an ASCII text file, in
accordance with 37 C.F.R. .sctn.1.821(c) and (e), is incorporated
herein by reference. The text file name is
643842004401SeqListing.TXT, the date of creation of the text file
is Aug. 20, 2014, and the size of the ASCII text file in bytes is
22,234.
FIELD OF THE INVENTION
[0003] The present invention relates generally to improved methods
for producing isoprene by culturing recombinant cells (e.g., cells
engineered to produce isoprene) under reduced oxygen inlet
levels.
BACKGROUND OF THE INVENTION
[0004] Isoprene (2-methyl-1,3-butadiene) is the critical starting
material for a variety of synthetic polymers, most notably
synthetic rubbers. Isoprene is naturally produced by a variety of
microbial, plant, and animal species. In particular, two pathways
have been identified for the biosynthesis of isoprene: the
mevalonate (MVA) pathway and the non-mevalonate (DXP) pathway.
However, the yield of isoprene from naturally-occurring organisms
is commercially unattractive. Isoprene can also be obtained by
fractionating petroleum, the purification of this material is
expensive and time-consuming. Petroleum cracking of the C5 stream
of hydrocarbons produces only about 15% isoprene. About 800,000
tons per year of cis-polyisoprene are produced from the
polymerization of isoprene; most of this polyisoprene is used in
the tire and rubber industry. Isoprene is also copolymerized for
use as a synthetic elastomer in other products such as footwear,
mechanical products, medical products, sporting goods, and
latex.
[0005] Recent developments in the production of isoprene disclose
methods for the production of isoprene at rates, titers, and
purities that can be sufficient to meet the demands of robust
commercial processes (see, for example, International Patent
Application Publication No. WO 2009/076676 A2); however, alternate
pathways to improve production and yields of the same are still
needed. Provided herein are methods and system for producing
isoprene using recombinant cells engineered to produce
isoprene.
[0006] Throughout this specification, various patents, patent
applications and other types of publications (e.g., journal
articles) are referenced. The disclosure of all patents, patent
applications, and publications cited herein are hereby incorporated
by reference in their entirety for all purposes.
BRIEF SUMMARY OF THE INVENTION
[0007] The invention provided herein discloses, inter alia,
methods, compositions and systems for improved production of
isoprene under reduced oxygen inlet levels. Accordingly, in one
aspect, the invention provides for methods for producing isoprene
by (a) culturing a recombinant host cell comprising a heterologous
nucleic acid encoding isoprene synthase under reduced oxygen inlet
levels; and (b) producing isoprene. In another aspect, the
invention provides for methods for producing isoprene by (a)
culturing a recombinant host cell comprising a heterologous nucleic
acid encoding isoprene synthase under reduced oxygen inlet levels
wherein the cell is in fermentation or production phase; and (b)
producing isoprene. In any of the aspects, the method can include
further recovery of the isoprene. In some aspects, the reduced
oxygen inlet level is between about 5% to about 15% oxygen. In some
aspects, the reduced oxygen inlet level is between about 5% to
about 11% oxygen. In some aspects, the reduced oxygen inlet level
is between about 7% to about 10% oxygen. In some aspects, the
reduced oxygen inlet level is between about 7% to about 10% oxygen.
In some aspects, the reduced oxygen inlet level is between about 7%
to about 9% oxygen. In some aspects, the reduced oxygen inlet level
is about 7.7% oxygen. In some aspects, the reduced oxygen inlet
level is about 9.3% oxygen.
[0008] In another aspect, the invention provides for methods for
producing isoprene by (a) culturing a recombinant host cell
comprising a heterologous nucleic acid encoding isoprene synthase
under reduced oxygen inlet levels having an inlet airflow rate of
between about 8.0 standard liter per minute (SLPM) and about 14
SLPM and (b) producing isoprene. In some aspects, the inlet airflow
rate is between about 6 SLPM and 14 SLPM. In some aspects, the
inlet airflow rate is between about 8 SLPM and 12 SLPM. In some
aspects, the inlet airflow rate is about 10 SLPM. In some aspects,
the method further comprises recovering the isoprene.
[0009] In some aspects, the isoprene synthase is a plant isoprene
synthase. In some aspects, the plant isoprene synthase polypeptide
is a poplar isoprene synthase polypeptide. In some aspects, the
plant isoprene synthase polypeptide is a kudzu isoprene synthase
polypeptide. In some aspects, the plant isoprene synthase
polypeptide is a willow isoprene synthase polypeptide. In some
aspects, the isoprene synthase is an isoprene synthase from
Pueraria or Populus or a hybrid, Populus alba.times.Populus
tremula. In some aspects, the isoprene synthase polypeptide is
selected from the group consisting of Pueraria montana or Pueraria
lobata, Populus tremuloides, Populus alba, Populus nigra, and
Populus trichocarpa. In some aspects, the plant isoprene synthase
is a poplar synthase, a kudzu isoprene synthase, a willow isoprene
synthase, or a eucalyptus isoprene synthase. In some aspects, the
isoprene synthase is an isoprene synthase variant.
[0010] In some aspects, the cell further comprises a heterologous
nucleic acid encoding for one or more MVA pathway polypeptide
and/or one or more DXP pathway polypeptide. In some aspects, the
cell further comprises a heterologous nucleic acid encoding for one
or more MVA pathway polypeptide and/or an endogenous nucleic acid
encoding for one or more DXP pathway polypeptide. In some aspects,
the cell further comprises a heterologous nucleic acid encoding for
one or more IDI polypeptide.
[0011] In some aspects, one or more copies of a heterologous
nucleic acid is overexpressed. In some aspects, the heterologous
nucleic acid is cloned into a multicopy plasmid. In some aspects,
the heterologous nucleic acid is placed under an inducible promoter
or a constitutive promoter. In some aspects, one or more of the
heterologous nucleic acids is integrated into the chromosome of the
recombinant host cell.
[0012] In some aspects, the recombinant host cell is selected from
the group consisting of bacterial, yeast, algal, and fungal cells.
In some aspects, the cells are bacterial cells. In some aspects,
the bacterial cells are gram-positive bacterial cells or
gram-negative bacterial cells. In some aspects, the bacterial cells
are selected from the group consisting of E. coli, P. citrea, B.
subtilis, B. licheniformis, B. lentus, B. brevis, B.
stearothermophilus, B. alkalophilus, B. amyloliquefaciens, B.
clausii, B. halodurans, B. megaterium, B. coagulans, B. circulans,
B. lautus, B. thuringiensis, S. albus, S. lividans, S. coelicolor,
S. griseus, Pseudomonas sp., P. alcaligenes, and Corynebacteria sp.
cells. In some aspects, the bacterial cells are E. coli.
[0013] In some aspects, the cells are algal cells. In some aspects,
the algal cells are selected from the group consisting of green
algae, red algae, glaucophytes, chlorarachniophytes, euglenids,
chromista, or dinoflagellates.
[0014] In some aspects, the cells are fungal cells. In some
aspects, the fungal cells are filamentous fungi. In some aspects,
the cells are yeast cells. In some aspects, the yeast cells are is
selected from the group consisting of Saccharomyces sp.,
Schizosaccharomyces sp., Pichia sp., or Candida sp. In some
aspects, the yeast cells are Saccharomyces cerevisiae.
[0015] In some aspects, the peak instantaneous yield of isoprene is
increased at least about 11% as compared to when ambient air is
used for inlet gas. In some aspects, the peak cumulative yield of
isoprene is increased at least about 8% as compared to when ambient
air is used for inlet gas. In some aspects, the CPI is increased at
least about 16% as compared to when ambient air is used for inlet
gas. In some aspects, the peak specific productivity is increased
at least about 26% as compared to when ambient air is used for
inlet gas.
[0016] In some aspects, the reduced oxygen inlet is used when the
cells are in production phase. In other aspects, the reduced oxygen
inlet is used when the cells are in growth phase. In other aspects,
the reduced oxygen inlet is used when the culture has cells where
some cells are in growth phase and other cells are in production
phase. In other aspects, the reduced oxygen inlet is used when the
culture has cells where the majority of cells are in production
phase.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] FIG. 1 depicts a graph showing yield of isoprene on glucose
achieved in each 15-L fermentation over time. All runs used a
production host of the same genotype. The oxygen inlet % is listed
below for each experiment. All runs using the lower oxygen inlet
gas (circles, squares, and diamonds in the figure below) achieved a
higher % yield of isoprene on glucose than the two runs using
standard house air (open and closed triangles in the figure).
[0018] Overall yield was calculated using the following
formula:
% wt Yield on glucose=Isoprene total(t)/[(Feed Wt(0)-Feed
Wt(t)+83.5)*0.59)],
where 0.59 is the wt % of glucose in the glucose feed solution and
83.5 is the grams of this feed batched into the fermentor at t=0.
Each feed had its weight % measured independently.
[0019] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0020] FIG. 2 depicts a graph showing instantaneous yield of
isoprene on glucose achieved in each 15-L fermentation over time.
All runs used a production host of the same genotype. The oxygen
inlet % is listed below for each experiment. All runs using the
lower oxygen inlet gas (circles, squares, and diamonds) achieved a
higher peak instantaneous % yield of isoprene on glucose than the
two runs using standard house air (open and closed triangles).
[0021] Isoprene Instantaneous yield was calculated using the
following formula:
Isoprene Inst. yield(g/g %)=Isoprene
produced(t.sub.1-t.sub.0)/consumed
glucose(t.sub.1-t.sub.0)*100.
[0022] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0023] FIG. 3 depicts a graph showing cell productivity index (CPI)
achieved in each 15-L fermentation over time. All runs used a
production host of the same genotype. The oxygen inlet % is listed
for each experiment. All runs using the lower concentration oxygen
inlet gas (circles, squares and diamonds) achieved a higher cell
productivity index compared to the two runs using standard house
air (open and closed triangles).
[0024] Cell Productivity Index (CPI) was calculated using the
following formula:
CPI=total grams Isoprene/total grams dry cell weight
[0025] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0026] FIG. 4 depicts a graph showing specific productivity
achieved in each 15-L fermentation over time. All runs used a
production host of the same genotype. The oxygen inlet % is listed
for each experiment. While runs using the 5.0% oxygen inlet gas
(20110909, 20110940) achieved about the same specific productivity
as the two runs using standard house air (20100522, 20100523), the
three runs using 7.7%, 7.7% and 9.3% (20111019, 20111020, 20111109,
respectively) achieved a significantly higher specific productivity
of isoprene.
[0027] Specific Productivity was calculated using the following
formula:
Specific productivity(mg/L/hr/OD)=HgER*68.117 g/mol/OD.
[0028] HgER is the Isoprene Evolution Rate in (mmol/L/hr).
OD=optical density=Absorbance at 550 nm*dilution factor in
water
[0029] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0030] FIG. 5 is a graph where the peak cumulative mass yield data
in table 1 is plotted as a bar graph. While runs using the 5.0%
oxygen inlet gas (20110909, 20110940) achieved a modestly higher
mass yield of isoprene on glucose than the two runs using standard
house air (20100522, 20100523), the three runs using 7.7%, 7.7% and
9.3% (20111019, 20111020, 20111109, respectively) achieved a
significantly higher mass yield of isoprene on glucose.
[0031] FIG. 6 is a graph where the peak instantaneous yield data in
table 1 is plotted as a bar graph. All runs using the lower oxygen
inlet gas (20110909, 20110940, 20111019, 20111020, 20111109)
achieved a higher instantaneous % yield of isoprene on glucose than
the two runs using standard house air (20100522, 20100523).
[0032] FIG. 7 is a graph where the cell productivity index data in
table 1 is plotted as bar graph. All runs using the lower oxygen
inlet gas (20110909, 20110940, 20111019, 20111020, 20111109)
achieved a higher cell productivity index than the two runs using
standard house air (20100522, 20100523).
[0033] FIG. 8 is a graph where the peak specific productivity data
in table 1 is plotted as bar graph. While runs using the 5.0%
oxygen inlet gas (20110909, 20110940) achieved about the same
specific productivity as the two runs using standard house air
(20100522, 20100523), the three runs using 7.7%, 7.7% and 9.3%
(20111019, 20111020, 20111109, respectively) achieved a
significantly higher peak specific productivity of isoprene.
[0034] FIG. 9 depicts yield of isoprene on glucose achieved by the
yddV-ispA strain CMP1082 (closed black squares), compared the
control strain CMP1043 (closed triangles) in a 15-L fermentation
over time.
[0035] FIG. 10 depicts the isoprene titer achieved by the yddV-ispA
strain CMP1082 (closed black squares), compared the control strain
CMP1043 (closed triangles) in a 15-L fermentation over time.
[0036] FIG. 11 depicts the Cell Productivity Index (CPI) achieved
by the yddV-ispA strain CMP1082 (closed black squares), compared to
the control strain CMP1043 (closed triangles) in a 15-L
fermentation over time.
[0037] FIG. 12 depicts the volumetric productivity achieved by the
yddV-ispA strain CMP1082 (closed black squares), compared the
control strain CMP1043 (closed triangles) in a 15-L fermentation
over time.
[0038] FIG. 13 depicts the specific productivity achieved by the
yddV-ispA strain CMP1082 (closed black squares), compared the
control strain CMP1043 (closed triangles) in a 15-L fermentation
over time.
[0039] FIG. 14 depicts yield of isoprene on glucose achieved in
each 15-L fermentation over time. CMP1082 (pgl+) is depicted by
open triangles and CMP1043 (pgl-) is depicted by closed
squares.
[0040] FIG. 15 depicts instantaneous yield of isoprene on glucose
achieved in each 15-L fermentation over time. CMP1082 (pgl+) is
depicted by open triangles and CMP1043 (pgl-) is depicted by closed
squares.
[0041] FIG. 16 depicts Cell Productivity Index (CPI) achieved in
each 15-L fermentation over time. CMP1082 (pgl+) is depicted by
open triangles and CMP1043 (pgl-) is depicted by closed
squares.
[0042] FIG. 17 depicts volumetric productivity achieved in each
15-L fermentation over time. CMP1082 (pgl+) is depicted by open
triangles and CMP1043 (pgl-) is depicted by closed squares.
[0043] FIG. 18 depicts specific productivity achieved in each 15-L
fermentation over time. CMP1082 (pgl+) is depicted by open
triangles and CMP1043 (pgl-) is depicted by closed squares.
[0044] FIG. 19 depicts a graph showing yield of isoprene on glucose
achieved in each 15-L fermentation over time. In run 20120522, an
improved yield was observed when the inlet gas flowrate was set to
10 standard liters per minute.
[0045] Overall yield was calculated using the following
formula:
% wt Yield on glucose=Isoprene total(t)/[(Feed Wt(0)-Feed
Wt(t)+83.5)*0.59)],
where 0.59 is the wt % of glucose in the glucose feed solution and
83.5 is the grams of this feed batched into the fermentor at t=0.
Each feed had its weight % measured independently.
[0046] The run 20120522: DW719 at 10 slpm inlet is depicted by open
circles. The run 20120521: DW719 at 14 slpm inlet is depicted by
open squares. The run 20120484: DW719 at 8 slpm inlet is depicted
by open diamonds.
[0047] FIG. 20 depicts a graph showing instantaneous yield of
isoprene on glucose achieved in each 15-L fermentation over time.
In run 20120522, an improved instantaneous yield was observed when
the inlet gas flowrate was set to 10 standard liters per
minute.
[0048] Isoprene instantaneous yield was calculated using the
following formula:
Isoprene Inst. yield(g/g %)=Isoprene
produced(t.sub.1-t.sub.0)/consumed
glucose(t.sub.1-t.sub.0)*100.
[0049] The run 20120522: DW719 at 10 slpm inlet is depicted by open
circles. The run 20120521: DW719 at 14 slpm inlet is depicted by
open squares. The run 20120484: DW719 at 8 slpm inlet is depicted
by open diamonds.
[0050] FIG. 21 depicts a graph showing the volumetric productivity
achieved in each 15-L fermentation over time. This process runs
dissolved oxygen limited from about 16 to 40 hrs EFT. After
dissolved oxygen limitation, the oxygen uptake rate is tightly
correlated with the oxygen delivery rate. With increasing inlet
flow rate came increased oxygen uptake rate, and isoprene
productivity correlated well with oxygen uptake rate.
[0051] Volumetric Productivity was calculated using the following
formula:
Volumetric
productivity(g/L/hr)=[.SIGMA.(HGER(t)/1000*68.117)]/[t-t.sub.0],
where the summation is from t.sub.0 to t. Tank turnaround time is
not factored in.
[0052] The run 20120522: DW719 at 10 slpm inlet is depicted by open
circles. The run 20120521: DW719 at 14 slpm inlet is depicted by
open squares. The run 20120484: DW719 at 8 slpm inlet is depicted
by open diamonds.
[0053] FIG. 22 depicts a graph showing the Cell Productivity Index
(CPI) achieved in each 15-L fermentation over time.
[0054] Cell Productivity Index (CPI) was calculated using the
following formula:
CPI=total grams Isoprene/total grams dry cell weight
[0055] The run 20120522: DW719 at 10 slpm inlet is depicted by open
circles. The run 20120521: DW719 at 14 slpm inlet is depicted by
open squares. The run 20120484: DW719 at 8 slpm inlet is depicted
by open diamonds.
[0056] FIG. 23 depicts a graph showing the specific productivity
achieved in each 15-L fermentation over time. In run 20120521, a
higher specific productivity was observed when the inlet gas
flowrate was set to 14 standard liters per minute.
[0057] Specific Productivity was calculated using the following
formula:
Specific productivity(mg/L/hr/OD)=HgER*68.117 g/mol/OD. [0058] HgER
is the Isoprene Evolution Rate in (mmol/L/hr). [0059] OD=optical
density=Absorbance at 550 nm*dilution factor in water
[0060] In run 20120522: DW719 at 10 slpm inlet is depicted by open
circles. In run 20120521: DW719 at 14 slpm inlet is depicted by
open squares. In run 20120484: DW719 at 8 slpm inlet is depicted by
open diamonds.
DETAILED DESCRIPTION
[0061] The invention provided herein discloses, inter alia,
methods, compositions and systems for improved production of
isoprene using recombinant host cells that have been engineered to
produce isoprene under reduced oxygen inlet levels. The invention
is based, in part, on the discovery that increased production of
isoprene can be achieved when recombinant host cells that have been
engineered to produce isoprene (e.g., recombinant cells containing
one or more copies of nucleic acid encoding for isoprene synthase)
are cultured under reduced oxygen inlet levels, in particular, when
these cells are in the production (or fermentation) phase. As is
further detailed herein, the recombinant host cells can contain any
type of nucleic acid encoding for isoprene synthase (e.g.,
heterologous or additional copies of endogeneous isoprene
synthase). The host cell can also contain additional molecular
engineering that can drive additional flux of carbon through
metabolic pathways (e.g., MVA pathway and/or DXP pathway) to
increase the starting substrate (e.g., DMAPP) for isoprene synthase
or to increase the pool of intermediates that can be eventually
converted to isoprene. Production of isoprene using recombinant
cells (e.g., recombinant cells in production phase) under reduced
oxygen inlet levels helps to reduce costs associated with
oxygenating fermentation systems, reduces safety hazards (e.g.,
explosions) and overcomes technical hurdles of increasing the
amount of isoprene production while adhering to safety standards
(e.g, national standards such as those set forth by National Fire
Protection Association 69 or NFPA 69 Standard on Explosion
Prevention Systems).
General Techniques
[0062] The practice of the present invention will employ, unless
otherwise indicated, conventional techniques of molecular biology
(including recombinant techniques), microbiology, cell biology,
biochemistry, and immunology, which are within the skill of the
art. Such techniques are explained fully in the literature,
"Molecular Cloning: A Laboratory Manual", third edition (Sambrook
et al., 2001); "Oligonucleotide Synthesis" (M. J. Gait, ed., 1984);
"Animal Cell Culture: A practical approach", third edition (J. R.
Masters, ed., 2000); "Methods in Enzymology" (Academic Press,
Inc.); "Current Protocols in Molecular Biology" (F. M. Ausubel et
al., eds., 1987, and periodic updates); "PCR: The Polymerase Chain
Reaction", (Mullis et al., eds., 1994). Singleton et al.,
Dictionary of Microbiology and Molecular Biology 3rd revised ed.,
J. Wiley & Sons (New York, N.Y. 2006), and March's Advanced
Organic Chemistry Reactions, Mechanisms and Structure 6th ed., John
Wiley & Sons (New York, N.Y. 2007), provide one skilled in the
art with a general guide to many of the terms used in the present
application.
DEFINITIONS
[0063] The term "isoprene" refers to 2-methyl-1,3-butadiene (CAS
#78-79-5). It can be the direct and final volatile C5 hydrocarbon
product from the elimination of pyrophosphate from DMAPP. It may
not involve the linking or polymerization of IPP molecules to DMAPP
molecules. The term "isoprene" is not generally intended to be
limited to its method of production unless indicated otherwise
herein.
[0064] The term "ispA" can refer to any geranyltransferase or
farnesyl diphosphate (FPP) synthase enzyme or any member of the
prenyl transferase family of enzymes that can catalyze the
condensation of isopentenyl diphosphate (IPP) with
3,3-dimethylallyl diphosphate (DMAPP) or geranyl diphosphate (GPP)
to yield FPP in any organism. In some embodiments, ispA is encoded
by an ispA gene.
[0065] As used herein, the term "polypeptides" includes
polypeptides, proteins, peptides, fragments of polypeptides, and
fusion polypeptides.
[0066] As used herein, an "isolated polypeptide" is not part of a
library of polypeptides, such as a library of 2, 5, 10, 20, 50 or
more different polypeptides and is separated from at least one
component with which it occurs in nature. An isolated polypeptide
can be obtained, for example, by expression of a recombinant
nucleic acid encoding the polypeptide.
[0067] By "heterologous polypeptide" is meant a polypeptide encoded
by a nucleic acid sequence derived from a different organism,
species, or strain than the host cell. In some embodiments, a
heterologous polypeptide is not identical to a wild-type
polypeptide that is found in the same host cell in nature.
[0068] As used herein, a "nucleic acid" refers to two or more
deoxyribonucleotides and/or ribonucleotides covalently joined
together in either single or double-stranded form.
[0069] By "recombinant nucleic acid" is meant a nucleic acid of
interest that is free of one or more nucleic acids (e.g., genes)
which, in the genome occurring in nature of the organism from which
the nucleic acid of interest is derived, flank the nucleic acid of
interest. The term therefore includes, for example, a recombinant
DNA which is incorporated into a vector, into an autonomously
replicating plasmid or virus, or into the genomic DNA of a
prokaryote or eukaryote, or which exists as a separate molecule
(e.g., a cDNA, a genomic DNA fragment, or a cDNA fragment produced
by PCR or restriction endonuclease digestion) independent of other
sequences.
[0070] By "heterologous nucleic acid" is meant a nucleic acid
sequence derived from a different organism, species or strain than
the host cell. In some embodiments, the heterologous nucleic acid
is not identical to a wild-type nucleic acid that is found in the
same host cell in nature.
[0071] As used herein, an "expression control sequence" means a
nucleic acid sequence that directs transcription of a nucleic acid
of interest. An expression control sequence can be a promoter, such
as a constitutive or an inducible promoter, or an enhancer. An
expression control sequence can be "native" or heterologous. A
native expression control sequence is derived from the same
organism, species, or strain as the gene being expressed. A
heterologous expression control sequence is derived from a
different organism, species, or strain as the gene being expressed.
An "inducible promoter" is a promoter that is active under
environmental or developmental regulation.
[0072] By "operably linked" is meant a functional linkage between a
nucleic acid expression control sequence (such as a promoter) and a
second nucleic acid sequence, wherein the expression control
sequence directs transcription of the nucleic acid corresponding to
the second sequence.
[0073] As used herein, the terms "minimal medium" or "minimal
media" refer to growth medium containing the minimum nutrients
possible for cell growth, generally without the presence of amino
acids. Minimal medium typically contains: (1) a carbon source for
bacterial growth; (2) various salts, which can vary among bacterial
species and growing conditions; and (3) water. The carbon source
can vary significantly, from simple sugars like glucose to more
complex hydrolysates of other biomass, such as yeast extract, as
discussed in more detail below. The salts generally provide
essential elements such as magnesium, nitrogen, phosphorus, and
sulfur to allow the cells to synthesize proteins and nucleic acids.
Minimal medium can also be supplemented with selective agents, such
as antibiotics, to select for the maintenance of certain plasmids
and the like. For example, if a microorganism is resistant to a
certain antibiotic, such as ampicillin or tetracycline, then that
antibiotic can be added to the medium in order to prevent cells
lacking the resistance from growing. Medium can be supplemented
with other compounds as necessary to select for desired
physiological or biochemical characteristics, such as particular
amino acids and the like.
[0074] As used herein, the term "mass yield" refers to the mass of
the product produced by the recombinant (e.g., bacterial) cells
divided by the mass of the glucose consumed by the recombinant
(e.g., bacterial) cells multiplied by 100.
[0075] By "specific productivity," it is meant the mass of the
product produced by the bacterial cell divided by the product of
the time for production, the cell density, and the volume of the
culture.
[0076] By "titer," it is meant the mass of the product produced by
the recombinant (e.g., bacterial) cells divided by the volume of
the culture.
[0077] As used herein, the term "cell productivity index (CPI)"
refers to the mass of the product produced by the recombinant
(e.g., bacterial) cells divided by the mass of the recombinant
(e.g., bacterial) cells produced in the culture.
[0078] Unless defined otherwise herein, all technical and
scientific terms used herein have the same meaning as commonly
understood by one of ordinary skill in the art to which this
invention pertains.
[0079] As used herein, the singular terms "a," "an," and "the"
include the plural reference unless the context clearly indicates
otherwise.
[0080] It is intended that every maximum numerical limitation given
throughout this specification includes every lower numerical
limitation, as if such lower numerical limitations were expressly
written herein. Every minimum numerical limitation given throughout
this specification will include every higher numerical limitation,
as if such higher numerical limitations were expressly written
herein. Every numerical range given throughout this specification
will include every narrower numerical range that falls within such
broader numerical range, as if such narrower numerical ranges were
all expressly written herein.
Recombinant Microorganisms Capable of Producing Isoprene
[0081] Isoprene (2-methyl-1,3-butadiene) is an important organic
compound used in a wide array of applications. For instance,
isoprene is employed as an intermediate or a starting material in
the synthesis of numerous chemical compositions and polymers,
including in the production of synthetic rubber. Isoprene is also
an important biological material that is synthesized naturally by
many plants and animals. The mevalonate-dependent biosynthetic
pathway (MVA pathway) is a key metabolic pathway present in all
higher eukaryotes and certain bacteria. In addition to being
important for the production of molecules used in processes as
diverse as protein prenylation, cell membrane maintenance, protein
anchoring, and N-glycosylation, the mevalonate pathway provides a
major source of dimethylallyl diphosphate (DMAPP) and isopentenyl
diphosphate (IPP), which serve as the basis for the biosynthesis of
both isoprenoids and isoprene. DMAPP and IPP provide the initial
carbon source input for the biosynthesis of isoprene. The enzyme
isoprene synthase uses these molecules to catalyze the production
of isoprene.
[0082] Various types of microorganism, further detailed herein, can
be recombinantly engineered to make isoprene. Recombinant cells
that have been engineered to produce isoprene can exhibit two
phases in culture: 1) a growth phase wherein the recombinant cells
divide in a linear fashion and 2) a production or fermentation
phase wherein the cells utilize a carbon source (e.g., glucose) to
produce isoprene. As is further detailed herein, various processes
and parameters (e.g., reduced oxygen inlet levels) can be used to
culture the recombinant microorganism such that it maximizes the
production of isoprene.
Isoprene Synthase Nucleic Acids and Polypeptides
[0083] In some aspects of the invention, the recombinant cells
described in any of the compositions or methods described herein
further comprise one or more nucleic acids encoding an isoprene
synthase polypeptide or a polypeptide having isoprene synthase
activity. In some aspects, the isoprene synthase polypeptide is an
endogenous polypeptide. In some aspects, the endogenous nucleic
acid encoding an isoprene synthase polypeptide is operably linked
to a constitutive promoter. In some aspects, the endogenous nucleic
acid encoding an isoprene synthase polypeptide is operably linked
to an inducible promoter. In some aspects, the endogenous nucleic
acid encoding an isoprene synthase polypeptide is operably linked
to a strong promoter. In some aspects, more than one endogenous
nucleic acid encoding an isoprene synthase polypeptide is used
(e.g, 2, 3, 4, or more copies of an endogenous nucleic acid
encoding an isoprene synthase polypeptide). In a particular aspect,
the cells are engineered to overexpress the endogenous isoprene
synthase pathway polypeptide relative to wild-type cells. In some
aspects, the endogenous nucleic acid encoding an isoprene synthase
polypeptide is operably linked to a weak promoter. In some aspects,
the isoprene synthase polypeptide is a polypeptide from Pueraria or
Populus or a hybrid such as Populus alba.times.Populus tremula. In
some aspects, the isoprene synthase polypeptide is from
Eucalyptus.
[0084] In some aspects, the isoprene synthase polypeptide is a
heterologous polypeptide. In some aspects, the cells comprise more
than one copy of a heterologous nucleic acid encoding an isoprene
synthase polypeptide. In some aspects, the heterologous nucleic
acid encoding an isoprene synthase polypeptide is operably linked
to a constitutive promoter. In some aspects, the heterologous
nucleic acid encoding an isoprene synthase polypeptide is operably
linked to an inducible promoter. In some aspects, the heterologous
nucleic acid encoding an isoprene synthase polypeptide is operably
linked to a strong promoter. In some aspects, the heterologous
nucleic acid encoding an isoprene synthase polypeptide is operably
linked to a weak promoter. In some aspects, the isoprene synthase
polypeptide is a polypeptide from Pueraria or Populus or a hybrid
such as Populus alba.times.Populus tremula. In some aspects, the
isoprene synthase polypeptide is from Eucalyptus.
[0085] The nucleic acids encoding an isoprene synthase
polypeptide(s) can be integrated into a genome of the host cells or
can be stably expressed in the cells. The nucleic acids encoding an
isoprene synthase polypeptide(s) can additionally be on a
vector.
[0086] Exemplary isoprene synthase nucleic acids include nucleic
acids that encode a polypeptide, fragment of a polypeptide,
peptide, or fusion polypeptide that has at least one activity of an
isoprene synthase polypeptide. Isoprene synthase polypeptides
convert dimethylallyl diphosphate (DMAPP) into isoprene. Exemplary
isoprene synthase polypeptides include polypeptides, fragments of
polypeptides, peptides, and fusions polypeptides that have at least
one activity of an isoprene synthase polypeptide. Exemplary
isoprene synthase polypeptides and nucleic acids include
naturally-occurring polypeptides and nucleic acids from any of the
source organisms described herein. In addition, variants of
isoprene synthase can possess improved activity such as improved
enzymatic activity. In some aspects, an isoprene synthase variant
has other improved properties, such as improved stability (e.g.,
thermo-stability), and/or improved solubility.
[0087] Standard methods can be used to determine whether a
polypeptide has isoprene synthase polypeptide activity by measuring
the ability of the polypeptide to convert DMAPP into isoprene in
vitro, in a cell extract, or in vivo. Isoprene synthase polypeptide
activity in the cell extract can be measured, for example, as
described in Silver et al., J. Biol. Chem. 270:13010-13016, 1995.
In one exemplary assay, DMAPP (Sigma) can be evaporated to dryness
under a stream of nitrogen and rehydrated to a concentration of 100
mM in 100 mM potassium phosphate buffer pH 8.2 and stored at
-20.degree. C. To perform the assay, a solution of 5 .mu.L of 1M
MgCl.sub.2, 1 mM (250 .mu.g/ml) DMAPP, 65 .mu.L of Plant Extract
Buffer (PEB) (50 mM Tris-HCl, pH 8.0, 20 mM MgCl.sub.2, 5%
glycerol, and 2 mM DTT) can be added to 25 .mu.L of cell extract in
a 20 ml Headspace vial with a metal screw cap and teflon coated
silicon septum (Agilent Technologies) and cultured at 370 C for 15
minutes with shaking. The reaction can be quenched by adding 200
.mu.L of 250 mM EDTA and quantified by GC/MS.
[0088] In some aspects, the heterologous isoprene synthase
polypeptide is a plant isoprene synthase polypeptide or a variant
thereof. In some aspects, the isoprene synthase polypeptide is an
isoprene synthase from Pueraria or a variant thereof. In some
aspects, the isoprene synthase polypeptide is an isoprene synthase
from Populus or a variant thereof. In some aspects, the isoprene
synthase polypeptide is a poplar isoprene synthase polypeptide or a
variant thereof. In some aspects, the isoprene synthase polypeptide
is a kudzu isoprene synthase polypeptide or a variant thereof. In
some aspects, the isoprene synthase polypeptide is a polypeptide
from Pueraria or Populus or a hybrid, Populus alba.times.Populus
tremula, or a variant thereof. In some aspects, the isoprene
synthase polypeptide is from Eucalyptus, or a variant thereof. In
other aspects, the isoprene synthase is from Robinia, Salix, or
Melaleuca, or variants thereof.
[0089] In some aspects, the isoprene synthase polypeptide or
nucleic acid is from the family Fabaceae, such as the Faboideae
subfamily. In some aspects, the isoprene synthase polypeptide or
nucleic acid is a polypeptide or nucleic acid from Pueraria montana
(kudzu) (Sharkey et al., Plant Physiology 137: 700-712, 2005),
Pueraria lobata, poplar (such as Populus alba, Populus nigra,
Populus trichocarpa, or Populus alba.times.tremula (CAC35696)
(Miller et al., Planta 213: 483-487, 2001), aspen (such as Populus
tremuloides) (Silver et al., JBC 270(22): 13010-1316, 1995),
English Oak (Quercus robur) (Zimmer et al., WO 98/02550), or a
variant thereof. In some aspects, the isoprene synthase polypeptide
is an isoprene synthase from Pueraria montana, Pueraria lobata,
Populus tremuloides, Populus alba, Populus nigra, or Populus
trichocarpa or a variant thereof. In some aspects, the isoprene
synthase polypeptide is an isoprene synthase from Populus alba or a
variant thereof. In some aspects, the isoprene synthase is Populus
balsamifera (Genbank JN173037), Populus deltoides (Genbank
JN173039), Populus fremontii (Genbank JN173040), Populus
granididenta (Genbank JN173038), Salix (Genbank JN173043), Robinia
pseudoacacia (Genbank JN173041), Wisteria (Genbank JN173042),
Eucalyptus globulus (Genbank AB266390) or Melaleuca alterniflora
(Genbank AY279379) or variants thereof. In some aspects, the
nucleic acid encoding the isoprene synthase (e.g., isoprene
synthase from Populus alba or a variant thereof) is codon
optimized.
[0090] In some aspects, the isoprene synthase nucleic acid or
polypeptide is a naturally-occurring polypeptide or nucleic acid
(e.g., naturally-occurring polypeptide or nucleic acid from
Populus). In some aspects, the isoprene synthase nucleic acid or
polypeptide is not a wild-type or naturally-occurring polypeptide
or nucleic acid. In some aspects, the isoprene synthase nucleic
acid or polypeptide is a variant of a wild-type or
naturally-occurring polypeptide or nucleic acid (e.g., a variant of
a wild-type or naturally-occurring polypeptide or nucleic acid from
Populus).
[0091] In some aspects, the isoprene synthase polypeptide is a
variant. In some aspects, the isoprene synthase polypeptide is a
variant of a wild-type or naturally occurring isoprene synthase. In
some aspects, the variant has improved activity such as improved
catalytic activity compared to the wild-type or naturally occurring
isoprene synthase. The increase in activity (e.g., catalytic
activity) can be at least about any of 10%, 20%, 30%, 40%, 50%,
60%, 70%, 80%, 90%, or 95%. In some aspects, the increase in
activity such as catalytic activity is at least about any of 1
fold, 2 folds, 5 folds, 10 folds, 20 folds, 30 folds, 40 folds, 50
folds, 75 folds, or 100 folds. In some aspects, the increase in
activity such as catalytic activity is about 10% to about 100 folds
(e.g., about 20% to about 100 folds, about 50% to about 50 folds,
about 1 fold to about 25 folds, about 2 folds to about 20 folds, or
about 5 folds to about 20 folds). In some aspects, the variant has
improved solubility compared to the wild-type or naturally
occurring isoprene synthase. The increase in solubility can be at
least about any of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or
95%. The increase in solubility can be at least about any of 1
fold, 2 folds, 5 folds, 10 folds, 20 folds, 30 folds, 40 folds, 50
folds, 75 folds, or 100 folds. In some aspects, the increase in
solubility is about 10% to about 100 folds (e.g., about 20% to
about 100 folds, about 50% to about 50 folds, about 1 fold to about
25 folds, about 2 folds to about 20 folds, or about 5 folds to
about 20 folds). In some aspects, the isoprene synthase polypeptide
is a variant of naturally occurring isoprene synthase and has
improved stability (such as thermo-stability) compared to the
naturally occurring isoprene synthase.
[0092] In some aspects, the variant has at least about 10%, at
least about 20%, at least about 30%, at least about 40%, at least
about 50%, at least about 60%, at least about 70%, at least about
80%, at least about 90%, at least about 100%, at least about 110%,
at least about 120%, at least about 130%, at least about 140%, at
least about 150%, at least about 160%, at least about 170%, at
least about 180%, at least about 190%, at least about 200% of the
activity of a wild-type or naturally occurring isoprene synthase.
The variant can share sequence similarity with a wild-type or
naturally occurring isoprene synthase. In some aspects, a variant
of a wild-type or naturally occurring isoprene synthase can have at
least about any of 40%, 50%, 60%, 70%, 75%, 80%, 90%, 91%, 92%,
93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.5%, or 99.9% amino acid
sequence identity as that of the wild-type or naturally occurring
isoprene synthase. In some aspects, a variant of a wild-type or
naturally occurring isoprene synthase has any of about 70% to about
99.9%, about 75% to about 99%, about 80% to about 98%, about 85% to
about 97%, or about 90% to about 95% amino acid sequence identity
as that of the wild-type or naturally occurring isoprene
synthase.
[0093] In some aspects, the variant comprises a mutation in the
wild-type or naturally occurring isoprene synthase. In some
aspects, the variant has at least one amino acid substitution, at
least one amino acid insertion, and/or at least one amino acid
deletion. In some aspects, the variant has at least one amino acid
substitution. In some aspects, the number of differing amino acid
residues between the variant and wild-type or naturally occurring
isoprene synthase can be one or more, e.g. 1, 2, 3, 4, 5, 10, 15,
20, 30, 40, 50, or more amino acid residues. Naturally occurring
isoprene synthases can include any isoprene synthases from plants,
for example, kudzu isoprene synthases, poplar isoprene synthases,
English oak isoprene synthases, and willow isoprene synthases. In
some aspects, the variant is a variant of isoprene synthase from
Populus alba. In some aspects, the variant of isoprene synthase
from Populus alba has at least one amino acid substitution, at
least one amino acid insertion, and/or at least one amino acid
deletion. In some aspects, the variant is a truncated Populus alba
isoprene synthase. In some aspects, the nucleic acid encoding
variant (e.g., variant of isoprene synthase from Populus alba) is
codon optimized (for example, codon optimized based on host cells
where the heterologous isoprene synthase is expressed).
[0094] The isoprene synthase polypeptide provided herein can be any
of the isoprene synthases or isoprene synthase variants described
in WO 2009/132220, WO 2010/124146, and U.S. Patent Application
Publication No.: 2010/0086978, the contents of which are expressly
incorporated herein by reference in their entirety with respect to
the isoprene synthases and isoprene synthase variants.
[0095] Any one of the promoters described herein (e.g., promoters
described herein and identified in the Examples of the present
disclosure including inducible promoters and constitutive
promoters) can be used to drive expression of any of the isoprene
synthases described herein.
[0096] Suitable isoprene synthases include, but are not limited to,
those identified by Genbank Accession Nos. AY341431, AY316691,
AY279379, AJ457070, and AY182241. Types of isoprene synthases which
can be used in any one of the compositions or methods including
methods of making microorganisms encoding isoprene synthase
described herein are also described in International Patent
Application Publication Nos. WO2009/076676, WO2010/003007,
WO2009/132220, WO2010/031062, WO2010/031068, WO2010/031076,
WO2010/013077, WO2010/031079, WO2010/148150, WO2010/124146,
WO2010/078457, WO2010/148256, and Sharkey et al., "Isoprene
Synthase Genes Form A Monophyletic Clade Of Acyclic Terpene
Synthases In The Tps-B Terpene Synthase Family", Evolution (2012)
(available on line at DOI: 10.1111/evo.12013), the contents of
which are expressly incorporated herein by reference in their
entirety with respect to the isoprene synthases and isoprene
synthase variants.
MVA Pathway Nucleic Acids and Polypeptides
[0097] The complete MVA pathway can be subdivided into two groups:
an upper and lower pathway. In the upper portion of the MVA
pathway, acetyl Co-A produced during cellular metabolism is
converted to mevalonate via the actions of polypeptides having
either: (a) (i) thiolase activity or (ii) acetoacetyl-CoA synthase
activity, (b) HMG-CoA reductase, and (c) HMG-CoA synthase enzymatic
activity. First, acetyl Co-A is converted to acetoacetyl CoA via
the action of a thiolase or an acetoacetyl-CoA synthase (which
utilizes acetyl-CoA and malonyl-CoA). Next, acetoacetyl-CoA is
converted to 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) by the
enzymatic action of HMG-CoA synthase. This Co-A derivative is
reduced to mevalonate by HMG-CoA reductase, which is the
rate-limiting step of the mevalonate pathway of isoprenoid
production. In the lower MVA pathway, mevalonate is then converted
into mevalonate-5-phosphate via the action of mevalonate kinase
which is subsequently transformed into 5-diphosphomevalonate by the
enzymatic activity of phosphomevalonate kinase. Finally, IPP is
formed from 5-diphosphomevalonate by the activity of the enzyme
mevalonate-5-pyrophosphate decarboxylase.
[0098] Exemplary MVA pathway polypeptides that can be used include,
but are not limited to: 3-hydroxy-3-methylglutaryl-CoA synthase
(HMG-CoA synthase) polypeptides (e.g., an enzyme encoded by mvaS),
3-hydroxy-3-methylglutaryl-CoA reductase (HMG-CoA reductase)
polypeptides (e.g., enzyme encoded by mvaR or enzyme encoded by
mvaE that has been modified to be thiolase-deficient but still
retains its reductase activity), mevalonate kinase (MVK)
polypeptides, phosphomevalonate kinase (PMK) polypeptides,
diphosphomevalonte decarboxylase (MVD) polypeptides,
phosphomevalonate decarboxylase (PMDC) polypeptides, isopentenyl
phosphate kinase (IPK) polypeptides, IPP isomerase polypeptides,
IDI polypeptides, and polypeptides (e.g., fusion polypeptides)
having an activity of two or more MVA pathway polypeptides. In
particular, MVA pathway polypeptides include polypeptides,
fragments of polypeptides, peptides, and fusions polypeptides that
have at least one activity of an MVA pathway polypeptide. Exemplary
MVA pathway nucleic acids include nucleic acids that encode a
polypeptide, fragment of a polypeptide, peptide, or fusion
polypeptide that has at least one activity of an MVA pathway
polypeptide. Exemplary MVA pathway polypeptides and nucleic acids
include naturally-occurring polypeptides and nucleic acids from any
of the source organisms described herein. In addition, variants of
MVA pathway polypeptide that confer the result of better isoprene
production can also be used as well. In one embodiment, the
recombinant cell can be engineered to have an ispA gene with
decreased functional activity.
[0099] Non-limiting examples of MVA pathway polypeptides which can
be used are described in International Patent Application
Publication No. WO2009/076676; WO2010/003007 and WO2010/148150.
Acetoacetyl-CoA Synthase Nucleic Acids and Polypeptides
[0100] The acetoacetyl-CoA synthase gene (aka nphT7) is a gene
encoding an enzyme having the activity of synthesizing
acetoacetyl-CoA from malonyl-CoA and acetyl-CoA and having minimal
activity (e.g., no activity) of synthesizing acetoacetyl-CoA from
two acetyl-CoA molecules. See, e.g., Okamura et al., PNAS Vol 107,
No. 25, pp. 11265-11270 (2010), the contents of which are expressly
incorporated herein for teaching about nphT7. An acetoacetyl-CoA
synthase gene from an actinomycete of the genus Streptomyces CL190
strain was described in JP Patent Publication (Kokai) No.
2008-61506 A and US2010/0285549. Acetoacetyl-CoA synthase can also
be referred to as acetyl CoA:malonyl CoA acyltransferase. A
representative acetoacetyl-CoA synthase (or acetyl CoA:malonyl CoA
acyltransferase) that can be used is Genbank AB540131.1.
[0101] In one embodiment, acetoacetyl-CoA synthase of the present
invention synthesizes acetoacetyl-CoA from malonyl-CoA and
acetyl-CoA via an irreversible reaction. The use of acetoacetyl-CoA
synthase to generate acetyl-CoA provides an additional advantage in
that this reaction is irreversible while acetoacetyl-CoA thiolase
enzyme's action of synthesizing acetoacetyl-CoA from two acetyl-CoA
molecules is reversible. Consequently, the use of acetoacetyl-CoA
synthase to synthesize acetoacetyl-CoA from malonyl-CoA and
acetyl-CoA can result in significant improvement in productivity
for isoprene compared with using thiolase to generate the end same
product.
[0102] Furthermore, the use of acetoacetyl-CoA synthase to produce
isoprene provides another advantage in that acetoacetyl-CoA
synthase can convert malonyl CoA to acetyl CoA via decarboxylation
of the malonyl CoA. Thus, stores of starting substrate are not
limited by the starting amounts of acetyl CoA. The synthesis of
acetoacetyl-CoA by acetoacetyl-CoA synthase can still occur when
the starting substrate is only malonyl-CoA. In one embodiment, the
pool of starting malonyl-CoA is increased by using host strains
that have more malonyl-CoA. Such increased pools can be naturally
occurring or be engineered by molecular manipulation. See, for
example Fowler, et. al, Applied and Environmental Microbiology,
Vol. 75, No. 18, pp. 5831-5839 (2009).
[0103] In any of the aspects or embodiments described herein, an
enzyme that has the ability to synthesize acetoacetyl-CoA from
malonyl-CoA and acetyl-CoA can be used. Non-limiting examples of
such an enzyme are described herein. In certain embodiments
described herein, an acetoacetyl-CoA synthase gene derived from an
actinomycete of the genus Streptomyces having the activity of
synthesizing acetoacetyl-CoA from malonyl-CoA and acetyl-CoA can be
used.
[0104] An example of such an acetoacetyl-CoA synthase gene is the
gene encoding a protein having the amino acid sequence of SEQ ID
NO: 1. Such a protein having the amino acid sequence of SEQ ID NO:
1 corresponds to an acetoacetyl-CoA synthase having activity of
synthesizing acetoacetyl-CoA from malonyl-CoA and acetyl-CoA and
having no activity of synthesizing acetoacetyl-CoA from two
acetyl-CoA molecules.
[0105] In one embodiment, the gene encoding a protein having the
amino acid sequence of SEQ ID NO: 1 can be obtained by a nucleic
acid amplification method (e.g., PCR) with the use of genomic DNA
obtained from an actinomycete of the Streptomyces sp. CL190 strain
as a template and a pair of primers that can be designed with
reference to JP Patent Publication (Kokai) No. 2008-61506A.
[0106] As described herein, an acetoacetyl-CoA synthase gene for
use in the present invention is not limited to a gene encoding a
protein having the amino acid sequence of SEQ ID NO: 1 from an
actinomycete of the Streptomyces sp. CL190 strain. Any gene
encoding a protein having the ability to synthesize acetoacetyl-CoA
from malonyl-CoA and acetyl-CoA and which does not synthesize
acetoacetyl-CoA from two acetyl-CoA molecules can be used in the
presently described methods. In certain embodiments, the
acetoacetyl-CoA synthase gene can be a gene encoding a protein
having an amino acid sequence with high similarity or substantially
identical to the amino acid sequence of SEQ ID NO: 1 and having the
function of synthesizing acetoacetyl-CoA from malonyl-CoA and
acetyl-CoA. The expression "highly similar" or "substantially
identical" refers to, for example, at least about 80% identity, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%,
and at least about 99% identity. As used above, the identity value
corresponds to the percentage of identity between amino acid
residues in a different amino acid sequence and the amino acid
sequence of SEQ ID NO: 1, which is calculated by performing
alignment of the amino acid sequence of SEQ ID NO: 1 and the
different amino acid sequence with the use of a program for
searching for a sequence similarity.
[0107] In other embodiments, the acetoacetyl-CoA synthase gene may
be a gene encoding a protein having an amino acid sequence derived
from the amino acid sequence of SEQ ID NO: 1 by substitution,
deletion, addition, or insertion of 1 or more amino acid(s) and
having the function of synthesizing acetoacetyl-CoA from
malonyl-CoA and acetyl-CoA. Herein, the expression "more amino
acids" refers to, for example, 2 to 30 amino acids, preferably 2 to
20 amino acids, more preferably 2 to 10 amino acids, and most
preferably 2 to 5 amino acids.
[0108] In still other embodiments, the acetoacetyl-CoA synthase
gene may consist of a polynucleotide capable of hybridizing to a
portion or the entirety of a polynucleotide having a nucleotide
sequence complementary to the nucleotide sequence encoding the
amino acid sequence of SEQ ID NO: 1 under stringent conditions and
capable of encoding a protein having the function of synthesizing
acetoacetyl-CoA from malonyl-CoA and acetyl-CoA. Herein,
hybridization under stringent conditions corresponds to maintenance
of binding under conditions of washing at 60.degree. C. 2.times..
Hybridization can be carried out by conventionally known methods
such as the method described in J. Sambrook et al. Molecular
Cloning, A Laboratory Manual, 3rd Ed., Cold Spring Harbor
Laboratory (2001).
[0109] As described herein, a gene encoding an acetoacetyl-CoA
synthase having an amino acid sequence that differs from the amino
acid sequence of SEQ ID NO: 1 can be isolated from potentially any
organism, for example, an actinomycete that is not obtained from
the Streptomyces sp. CL190 strain. In addition, acetoacetyl-CoA
synthase genes for use herein can be obtained by modifying a
polynucleotide encoding the amino acid sequence of SEQ ID NO: 1 by
a method known in the art. Mutagenesis of a nucleotide sequence can
be carried out by a known method such as the Kunkel method or the
gapped duplex method or by a method similar to either thereof. For
instance, mutagenesis may be carried out with the use of a
mutagenesis kit (e.g., product names; Mutant-K and Mutant-G (TAKARA
Bio)) for site-specific mutagenesis, product name; an LA PCR in
vitro Mutagenesis series kit (TAKARA Bio), and the like.
[0110] The activity of an acetoacetyl-CoA synthase having an amino
acid sequence that differs from the amino acid sequence of SEQ ID
NO: 1 can be evaluated as described below. Specifically, a gene
encoding a protein to be evaluated is first introduced into a host
cell such that the gene can be expressed therein, followed by
purification of the protein by a technique such as chromatography.
Malonyl-CoA and acetyl-CoA are added as substrates to a buffer
containing the obtained protein to be evaluated, followed by, for
example, incubation at a desired temperature (e.g., 10.degree. C.
to 60.degree. C.). After the completion of reaction, the amount of
substrate lost and/or the amount of product (acetoacetyl-CoA)
produced are determined. Thus, it is possible to evaluate whether
or not the protein being tested has the function of synthesizing
acetoacetyl-CoA from malonyl-CoA and acetyl-CoA and to evaluate the
degree of synthesis. In such case, it is possible to examine
whether or not the protein has the activity of synthesizing
acetoacetyl-CoA from two acetyl-CoA molecules by adding acetyl-CoA
alone as a substrate to a buffer containing the obtained protein to
be evaluated and determining the amount of substrate lost and/or
the amount of product produced in a similar manner.
Nucleic Acids Encoding Polypeptides of the Upper MVA Pathway
[0111] The upper portion of the MVA pathway uses acetyl Co-A
produced during cellular metabolism as the initial substrate for
conversion to mevalonate via the actions of polypeptides having
either: (a) (i) thiolase activity or (ii) acetoacetyl-CoA activity,
(b) HMG-CoA reductase, and (c) HMG-CoA synthase enzymatic activity.
First, acetyl Co-A is converted to acetoacetyl CoA via the action
of a thiolase or an acetoacetyl-CoA synthase (which utilizes
acetyl-CoA and malonyl-CoA). Next, acetoacetyl-CoA is converted to
3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) by the enzymatic action of
HMG-CoA synthase. This Co-A derivative is reduced to mevalonate by
HMG-CoA reductase, which is the rate-limiting step of the
mevalonate pathway of isoprenoid production.
[0112] Non-limiting examples of upper MVA pathway polypeptides that
can be used include: acetyl-CoA acetyltransferase (AA-CoA thiolase)
polypeptides, acetoacetyl-CoA synthase polypeptides,
3-hydroxy-3-methylglutaryl-CoA synthase (HMG-CoA synthase)
polypeptides, 3-hydroxy-3-methylglutaryl-CoA reductase (HMG-CoA
reductase) polypeptides. Upper MVA pathway polypeptides can include
polypeptides, fragments of polypeptides, peptides, and fusions
polypeptides that have at least one activity of an upper MVA
pathway polypeptide. Exemplary upper MVA pathway nucleic acids
include nucleic acids that encode a polypeptide, fragment of a
polypeptide, peptide, or fusion polypeptide that has at least one
activity of an upper MVA pathway polypeptide. Exemplary MVA pathway
polypeptides and nucleic acids include naturally-occurring
polypeptides and nucleic acids from any of the source organisms
described herein. Thus, it is contemplated herein that any gene
encoding an upper MVA pathway polypeptide can be used in the
present invention. In one embodiment, the recombinant cell can be
engineered to have an ispA gene with decreased functional
activity.
[0113] In certain embodiments, various options of mvaE and mvaS
genes from L. grayi, E. faecium, E. gallinarum, E. casseliflavus
and/or E. faecalis alone or in combination with one or more other
mvaE and mvaS genes encoding proteins from the upper MVA pathway
are contemplated within the scope of the invention. In other
embodiments, an acetoacetyl-CoA synthase gene is contemplated
within the scope of the present invention in combination with one
or more other genes encoding: (i) 3-hydroxy-3-methylglutaryl-CoA
synthase (HMG-CoA synthase) polypeptides and
3-hydroxy-3-methylglutaryl-CoA reductase (HMG-CoA reductase)
polypeptides. Thus, in certain aspects, any of the combinations of
genes contemplated can be expressed in recombinant cells in any of
the ways described herein. In one embodiment, the recombinant cell
can be engineered to have an ispA gene with decreased functional
activity.
[0114] Additional non-limiting examples of upper MVA pathway
polypeptides which can be used herein are described in
International Patent Application Publication No. WO2009/076676;
WO2010/003007 and WO2010/148150.
Genes Encoding mvaE and mvaS Polypeptides
[0115] In certain embodiments, various options of mvaE and mvaS
genes from L. grayi, E. faecium, E. gallinarum, E. casseliflavus
and/or E. faecalis alone or in combination with one or more other
mvaE and mvaS genes encoding proteins from the upper MVA pathway
are contemplated within the scope of the invention in conjunction
with an IspA having decreased functional activity in recombinant
cells. In L. grayi, E. faecium, E. gallinarum, E. casseliflavus,
and E. faecalis, the mvaE gene encodes a polypeptide that possesses
both thiolase and HMG-CoA reductase activities (Hedl, et al., J
Bacteriol. 2002 April; 184(8): 2116-2122). The mvaS gene, on the
other hand, encodes a polypeptide having an HMG-CoA synthase
activity.
[0116] Accordingly, recombinant cells (e.g., E. coli) can be
engineered to express one or more mvaE and mvaS genes from L.
grayi, E. faecium, E. gallinarum, E. casseliflavus and/or E.
faecalis, to produce isoprene. The one or more mvaE and mvaS genes
can be expressed on a multicopy plasmid. The plasmid can be a high
copy plasmid, a low copy plasmid, or a medium copy plasmid.
Alternatively, the one or more mvaE and mvaS genes can be
integrated into the host cell's chromosome. For both heterologous
expression of the one or more mvaE and mvaS genes on a plasmid or
as an integrated part of the host cell's chromosome, expression of
the genes can be driven by either an inducible promoter or a
constitutively expressing promoter. The promoter can be a strong
driver of expression, it can be a weak driver of expression, or it
can be a medium driver of expression of the one or more mvaE and
mvaS genes. In one embodiment, the recombinant cell can be
engineered to have an ispA gene with decreased functional
activity.
[0117] The mvaE gene encodes a polypeptide that possesses both
thiolase and HMG-CoA reductase activities. The thiolase activity of
the polypeptide encoded by the mvaE gene converts acetyl Co-A to
acetoacetyl CoA whereas the HMG-CoA reductase enzymatic activity of
the polypeptide converts 3-hydroxy-3-methylglutaryl-CoA to
mevalonate. Exemplary mvaE polypeptides and nucleic acids include
naturally-occurring polypeptides and nucleic acids from any of the
source organisms described herein as well as mutant polypeptides
and nucleic acids derived from any of the source organisms
described herein that have at least one activity of a mvaE
polypeptide.
[0118] Mutant mvaE polypeptides include those in which one or more
amino acid residues have undergone an amino acid substitution while
retaining mvaE polypeptide activity (i.e., the ability to convert
acetyl Co-A to acetoacetyl CoA as well as the ability to convert
3-hydroxy-3-methylglutaryl-CoA to mevalonate). The amino acid
substitutions can be conservative or non-conservative and such
substituted amino acid residues can or cannot be one encoded by the
genetic code. The standard twenty amino acid "alphabet" has been
divided into chemical families based on similarity of their side
chains. Those families include amino acids with basic side chains
(e.g., lysine, arginine, histidine), acidic side chains (e.g.,
aspartic acid, glutamic acid), uncharged polar side chains (e.g.,
glycine, asparagine, glutamine, serine, threonine, tyrosine,
cysteine), nonpolar side chains (e.g., alanine, valine, leucine,
isoleucine, proline, phenylalanine, methionine, tryptophan),
beta-branched side chains (e.g., threonine, valine, isoleucine) and
aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan,
histidine). A "conservative amino acid substitution" is one in
which the amino acid residue is replaced with an amino acid residue
having a chemically similar side chain (i.e., replacing an amino
acid having a basic side chain with another amino acid having a
basic side chain). A "non-conservative amino acid substitution" is
one in which the amino acid residue is replaced with an amino acid
residue having a chemically different side chain (i.e., replacing
an amino acid having a basic side chain with another amino acid
having an aromatic side chain).
[0119] Amino acid substitutions in the mvaE polypeptide can be
introduced to improve the functionality of the molecule. For
example, amino acid substitutions that increase the binding
affinity of the mvaE polypeptide for its substrate, or that improve
its ability to convert acetyl Co-A to acetoacetyl CoA and/or the
ability to convert 3-hydroxy-3-methylglutaryl-CoA to mevalonate can
be introduced into the mvaE polypeptide. In some aspects, the
mutant mvaE polypeptides contain one or more conservative amino
acid substitutions.
[0120] In one aspect, mvaE proteins that are not degraded or less
prone to degradation can be used for the production of isoprene.
Examples of gene products of mvaEs that are not degraded or less
prone to degradation which can be used include, but are not limited
to, those from the organisms E. faecium, E. gallinarum, E.
casseliflavus, E. faecalis, and L. grayi. One of skill in the art
can express mvaE protein in E. coli BL21 (DE3) and look for absence
of fragments by any standard molecular biology techniques. For
example, absence of fragments can be identified on Safestain
stained SDS-PAGE gels following His-tag mediated purification or
when expressed in mevalonate, isoprene or isoprenoid producing E.
coli BL21 using the methods of detection described herein.
[0121] Standard methods, such as those described in Hedl et al., (J
Bacteriol. 2002, April; 184(8): 2116-2122) can be used to determine
whether a polypeptide has mvaE activity, by measuring
acetoacetyl-CoA thiolase as well as HMG-CoA reductase activity. In
an exemplary assay, acetoacetyl-CoA thiolase activity is measured
by spectrophotometer to monitor the change in absorbance at 302 nm
that accompanies the formation or thiolysis of acetoacetyl-CoA.
Standard assay conditions for each reaction to determine synthesis
of acetoacetyl-CoA, are 1 mM acetyl-CoA, 10 mM MgCl.sub.2, 50 mM
Tris, pH 10.5 and the reaction is initiated by addition of enzyme.
Assays can employ a final volume of 200 .mu.l. For the assay, 1
enzyme unit (eu) represents the synthesis or thiolysis in 1 min of
1 .mu.mol of acetoacetyl-CoA. In another exemplary assay, of
HMG-CoA reductase activity can be monitored by spectrophotometer by
the appearance or disappearance of NADP(H) at 340 nm. Standard
assay conditions for each reaction measured to show reductive
deacylation of HMG-CoA to mevalonate are 0.4 mM NADPH, 1.0 mM
(R,S)--HMG-CoA, 100 mM KCl, and 100 mM K.sub.xPO.sub.4, pH 6.5.
Assays employ a final volume of 200 .mu.l. Reactions are initiated
by adding the enzyme. For the assay, 1 eu represents the turnover,
in 1 min, of 1 .mu.mol of NADP(H). This corresponds to the turnover
of 0.5 .mu.mol of HMG-CoA or mevalonate.
[0122] Exemplary mvaE nucleic acids include nucleic acids that
encode a polypeptide, fragment of a polypeptide, peptide, or fusion
polypeptide that has at least one activity of a mvaE polypeptide.
Exemplary mvaE polypeptides and nucleic acids include
naturally-occurring polypeptides and nucleic acids from any of the
source organisms described herein as well as mutant polypeptides
and nucleic acids derived from any of the source organisms
described herein. Exemplary mvaE nucleic acids include, for
example, mvaE nucleic acids isolated from Listeria grayi_DSM 20601,
Enterococcus faecium, Enterococcus gallinarum EG2, Enterococcus
faecalis, and/or Enterococcus casseliflavus. The mvaE nucleic acid
encoded by the Listeria grayi_DSM 20601 mvaE gene can have a 99%,
98%, 97%, 96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or
85% sequence identity to SEQ ID NO: 2. The mvaE nucleic acid
encoded by the Enterococcus faecium mvaE gene can have a 99%, 98%,
97%, 96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO: 3. The mvaE nucleic acid encoded by
the Enterococcus gallinarum EG2 mvaE gene can have a 99%, 98%, 97%,
96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO:4. The mvaE nucleic acid encoded by
the Enterococcus casseliflavus mvaE gene can have a 99%, 98%, 97%,
96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO:5. The mvaE nucleic acid encoded by
the Enterococcus faecalis mvaE gene can have a 99%, 98%, 97%, 96%,
95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85% sequence
identity to the mvaE gene previously disclosed in E. coli to
produce mevalonate (see US 2005/0287655 A1; Tabata, K. and
Hashimoto, S.-I. Biotechnology Letters 26: 1487-1491, 2004).
[0123] The mvaE nucleic acid can be expressed in a recombinant cell
on a multicopy plasmid. The plasmid can be a high copy plasmid, a
low copy plasmid, or a medium copy plasmid. Alternatively, the mvaE
nucleic acid can be integrated into the host cell's chromosome. For
both heterologous expression of an mvaE nucleic acid on a plasmid
or as an integrated part of the host cell's chromosome, expression
of the nucleic acid can be driven by either an inducible promoter
or a constitutively expressing promoter. The promoter can be a
strong driver of expression, it can be a weak driver of expression,
or it can be a medium driver of expression of the mvaE nucleic
acid.
[0124] The mvaS gene encodes a polypeptide that possesses HMG-CoA
synthase activity. This polypeptide can convert acetoacetyl CoA to
3-hydroxy-3-methylglutaryl-CoA (HMG-CoA). Exemplary mvaS
polypeptides and nucleic acids include naturally-occurring
polypeptides and nucleic acids from any of the source organisms
described herein as well as mutant polypeptides and nucleic acids
derived from any of the source organisms described herein that have
at least one activity of a mvaS polypeptide.
[0125] Mutant mvaS polypeptides include those in which one or more
amino acid residues have undergone an amino acid substitution while
retaining mvaS polypeptide activity (i.e., the ability to convert
acetoacetyl CoA to 3-hydroxy-3-methylglutaryl-CoA). Amino acid
substitutions in the mvaS polypeptide can be introduced to improve
the functionality of the molecule. For example, amino acid
substitutions that increase the binding affinity of the mvaS
polypeptide for its substrate, or that improve its ability to
convert acetoacetyl CoA to 3-hydroxy-3-methylglutaryl-CoA can be
introduced into the mvaS polypeptide. In some aspects, the mutant
mvaS polypeptides contain one or more conservative amino acid
substitutions.
[0126] Standard methods, such as those described in Quant et al.
(Biochem J., 1989, 262:159-164), can be used to determine whether a
polypeptide has mvaS activity, by measuring HMG-CoA synthase
activity. In an exemplary assay, HMG-CoA synthase activity can be
assayed by spectrophotometrically measuring the disappearance of
the enol form of acetoacetyl-CoA by monitoring the change of
absorbance at 303 nm. A standard 1 ml assay system containing 50
mm-Tris/HCl, pH 8.0, 10 mM-MgCl2 and 0.2 mM-dithiothreitol at
30.degree. C.; 5 mM-acetyl phosphate, 10, M-acetoacetyl-CoA and 5
.mu.l samples of extracts can be added, followed by simultaneous
addition of acetyl-CoA (100 .mu.M) and 10 units of PTA. HMG-CoA
synthase activity is then measured as the difference in the rate
before and after acetyl-CoA addition. The absorption coefficient of
acetoacetyl-CoA under the conditions used (pH 8.0, 10
mM-MgCl.sub.2), is 12.2.times.10.sup.3 M.sup.-1 cm.sup.-1. By
definition, 1 unit of enzyme activity causes 1 .mu.mol of
acetoacetyl-CoA to be transformed per minute.
[0127] Exemplary mvaS nucleic acids include nucleic acids that
encode a polypeptide, fragment of a polypeptide, peptide, or fusion
polypeptide that has at least one activity of a mvaS polypeptide.
Exemplary mvaS polypeptides and nucleic acids include
naturally-occurring polypeptides and nucleic acids from any of the
source organisms described herein as well as mutant polypeptides
and nucleic acids derived from any of the source organisms
described herein. Exemplary mvaS nucleic acids include, for
example, mvaS nucleic acids isolated from Listeria grayi_DSM 20601,
Enterococcus faecium, Enterococcus gallinarum EG2, Enterococcus
faecalis, and/or Enterococcus casseliflavus. The mvaS nucleic acid
encoded by the Listeria grayi_DSM 20601 mvaS gene can have a 99%,
98%, 97%, 96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or
85% sequence identity to SEQ ID NO: 6. The mvaS nucleic acid
encoded by the Enterococcus faecium mvaS gene can have a 99%, 98%,
97%, 96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO:7. The mvaS nucleic acid encoded by
the Enterococcus gallinarum EG2 mvaS gene can have a 99%, 98%, 97%,
96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO:8. The mvaS nucleic acid encoded by
the Enterococcus casseliflavus mvaS gene can have a 99%, 98%, 97%,
96%, 95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85%
sequence identity to SEQ ID NO:9. The mvaS nucleic acid encoded by
the Enterococcus faecalis mvaS gene can have a 99%, 98%, 97%, 96%,
95%, 95%, 93%, 92%, 91%, 90%, 89%, 88%, 87%, 86%, or 85% sequence
identity to the mvaE gene previously disclosed in E. coli to
produce mevalonate (see US 2005/0287655 A1; Tabata, K. and
Hashimoto, S.-I. Biotechnology Letters 26: 1487-1491, 2004).
[0128] The mvaS nucleic acid can be expressed in a recombinant cell
on a multicopy plasmid. The plasmid can be a high copy plasmid, a
low copy plasmid, or a medium copy plasmid. Alternatively, the mvaS
nucleic acid can be integrated into the host cell's chromosome. For
both heterologous expression of an mvaS nucleic acid on a plasmid
or as an integrated part of the host cell's chromosome, expression
of the nucleic acid can be driven by either an inducible promoter
or a constitutively expressing promoter. The promoter can be a
strong driver of expression, it can be a weak driver of expression,
or it can be a medium driver of expression of the mvaS nucleic
acid.
[0129] Compositions of recombinant cells as described herein are
contemplated within the scope of the invention as well. It is
understood that recombinant cells also encompass progeny cells as
well.
[0130] Nucleic Acids Encoding Polypeptides of the Lower MVA
Pathway
[0131] In some aspects of the invention, the cells described in any
of the compositions or methods described herein further comprise
one or more nucleic acids encoding a lower mevalonate (MVA) pathway
polypeptide(s). In some aspects, the lower MVA pathway polypeptide
is an endogenous polypeptide. In some aspects, the endogenous
nucleic acid encoding a lower MVA pathway polypeptide is operably
linked to a constitutive promoter. In some aspects, the endogenous
nucleic acid encoding a lower MVA pathway polypeptide is operably
linked to an inducible promoter. In some aspects, the endogenous
nucleic acid encoding a lower MVA pathway polypeptide is operably
linked to a strong promoter. In a particular aspect, the cells are
engineered to over-express the endogenous lower MVA pathway
polypeptide relative to wild-type cells. In some aspects, the
endogenous nucleic acid encoding a lower MVA pathway polypeptide is
operably linked to a weak promoter.
[0132] The lower mevalonate biosynthetic pathway comprises
mevalonate kinase (MVK), phosphomevalonate kinase (PMK), and
diphosphomevalonte decarboxylase (MVD). In some aspects, the lower
MVA pathway can further comprise isopentenyl diphosphate isomerase
(IDI). Cells provided herein can comprise at least one nucleic acid
encoding isoprene synthase, one or more upper MVA pathway
polypeptides, and/or one or more lower MVA pathway polypeptides.
Polypeptides of the lower MVA pathway can be any enzyme (a) that
phosphorylates mevalonate to mevalonate 5-phosphate; (b) that
converts mevalonate 5-phosphate to mevalonate 5-pyrophosphate; and
(c) that converts mevalonate 5-pyrophosphate to isopentenyl
pyrophosphate. More particularly, the enzyme that phosphorylates
mevalonate to mevalonate 5-phosphate can be from the group
consisting of M. mazei mevalonate kinase, Lactobacillus mevalonate
kinase polypeptide, Lactobacillus sakei mevalonate kinase
polypeptide, yeast mevalonate kinase polypeptide, Saccharomyces
cerevisiae mevalonate kinase polypeptide, Streptococcus mevalonate
kinase polypeptide, Streptococcus pneumoniae mevalonate kinase
polypeptide, Streptomyces mevalonate kinase polypeptide,
Streptomyces CL190 mevalonate kinase polypeptide, and
Methanococoides burtonii mevalonate kinase polypeptide. In another
aspect, the enzyme that phosphorylates mevalonate to mevalonate
5-phosphate is M. mazei mevalonate kinase.
[0133] In some aspects, the lower MVA pathway polypeptide is a
heterologous polypeptide. In some aspects, the cells comprise more
than one copy of a heterologous nucleic acid encoding a lower MVA
pathway polypeptide. In some aspects, the heterologous nucleic acid
encoding a lower MVA pathway polypeptide is operably linked to a
constitutive promoter. In some aspects, the heterologous nucleic
acid encoding a lower MVA pathway polypeptide is operably linked to
an inducible promoter. In some aspects, the heterologous nucleic
acid encoding a lower MVA pathway polypeptide is operably linked to
a strong promoter. In some aspects, the heterologous nucleic acid
encoding a lower MVA pathway polypeptide is operably linked to a
weak promoter. In some aspects, the heterologous lower MVA pathway
polypeptide is a polypeptide from Saccharomyces cerevisiae,
Enterococcus faecalis, Methanosarcina mazei, or Methanococoides
burtonii.
[0134] The nucleic acids encoding a lower MVA pathway
polypeptide(s) can be integrated into a genome of the cells or can
be stably expressed in the cells. The nucleic acids encoding a
lower MVA pathway polypeptide(s) can additionally be on a
vector.
[0135] Exemplary lower MVA pathway polypeptides are also provided
below: (i) mevalonate kinase (MVK); (ii) phosphomevalonate kinase
(PMK); (iii) diphosphomevalonate decarboxylase (MVD); and (iv)
isopentenyl diphosphate isomerase (IDI). In particular, the lower
MVK polypeptide can be from the genus Methanosarcina and, more
specifically, the lower MVK polypeptide can be from Methanosarcina
mazei. Additional examples of lower MVA pathway polypeptides can be
found in U.S. Patent Application Publication 2010/0086978 the
contents of which are expressly incorporated herein by reference in
their entirety with respect to lower MVK pathway polypeptides and
lower MVK pathway polypeptide variants.
[0136] Any one of the cells described herein can comprise IDI
nucleic acid(s) (e.g., endogenous or heterologous nucleic acid(s)
encoding IDI). Isopentenyl diphosphate isomerase polypeptides
(isopentenyl-diphosphate delta-isomerase or IDI) catalyzes the
interconversion of isopentenyl diphosphate (IPP) and dimethylallyl
diphosphate (DMAPP) (e.g., converting IPP into DMAPP and/or
converting DMAPP into IPP). Exemplary IDI polypeptides include
polypeptides, fragments of polypeptides, peptides, and fusions
polypeptides that have at least one activity of an IDI polypeptide.
Standard methods (such as those described herein) can be used to
determine whether a polypeptide has IDI polypeptide activity by
measuring the ability of the polypeptide to interconvert IPP and
DMAPP in vitro, in a cell extract, or in vivo. Exemplary IDI
nucleic acids include nucleic acids that encode a polypeptide,
fragment of a polypeptide, peptide, or fusion polypeptide that has
at least one activity of an IDI polypeptide. Exemplary IDI
polypeptides and nucleic acids include naturally-occurring
polypeptides and nucleic acids from any of the source organisms
described herein as well as mutant polypeptides and nucleic acids
derived from any of the source organisms described herein.
[0137] Lower MVA pathway polypeptides include polypeptides,
fragments of polypeptides, peptides, and fusions polypeptides that
have at least one activity of a lower MVA pathway polypeptide.
Exemplary lower MVA pathway nucleic acids include nucleic acids
that encode a polypeptide, fragment of a polypeptide, peptide, or
fusion polypeptide that has at least one activity of a lower MVA
pathway polypeptide. Exemplary lower MVA pathway polypeptides and
nucleic acids include naturally-occurring polypeptides and nucleic
acids from any of the source organisms described herein. In
addition, variants of lower MVA pathway polypeptides that confer
the result of better isoprene production can also be used as
well.
[0138] In some aspects, the lower MVA pathway polypeptide is a
polypeptide from Saccharomyces cerevisiae, Enterococcus faecalis,
Methanosarcina mazei, or Methanococoides burtonii. In some aspects,
the MVK polypeptide is selected from the group consisting of
Lactobacillus mevalonate kinase polypeptide, Lactobacillus sakei
mevalonate kinase polypeptide, yeast mevalonate kinase polypeptide,
Saccharomyces cerevisiae mevalonate kinase polypeptide,
Streptococcus mevalonate kinase polypeptide, Streptococcus
pneumoniae mevalonate kinase polypeptide, Streptomyces mevalonate
kinase polypeptide, Streptomyces CL190 mevalonate kinase
polypeptide, and Methanosarcina mazei mevalonate kinase
polypeptide. Any one of the promoters described herein (e.g.,
promoters described herein and identified in the Examples of the
present disclosure including inducible promoters and constitutive
promoters) can be used to drive expression of any of the MVA
polypeptides described herein.
DXP Pathway Nucleic Acids and Polypeptides
[0139] In some aspects of the invention, the recombinant cells
described in any of the compositions or methods described herein
further comprise one or more heterologous nucleic acids encoding a
DXS polypeptide or other DXP pathway polypeptides. In some aspects,
the cells further comprise a chromosomal copy of an endogenous
nucleic acid encoding a DXS polypeptide or other DXP pathway
polypeptides. In some aspects, the E. coli cells further comprise
one or more nucleic acids encoding an IDI polypeptide and a DXS
polypeptide or other DXP pathway polypeptides. In some aspects, one
nucleic acid encodes the isoprene synthase polypeptide, IDI
polypeptide, and DXS polypeptide or other DXP pathway polypeptides.
In some aspects, one plasmid encodes the isoprene synthase
polypeptide, IDI polypeptide, and DXS polypeptide or other DXP
pathway polypeptides. In some aspects, multiple plasmids encode the
isoprene synthase polypeptide, IDI polypeptide, and DXS polypeptide
or other DXP pathway polypeptides.
[0140] Exemplary DXS polypeptides include polypeptides, fragments
of polypeptides, peptides, and fusions polypeptides that have at
least one activity of a DXS polypeptide. Standard methods (such as
those described herein) can be used to determine whether a
polypeptide has DXS polypeptide activity by measuring the ability
of the polypeptide to convert pyruvate and
D-glyceraldehyde-3-phosphate into 1-deoxy-D-xylulose-5-phosphate in
vitro, in a cell extract, or in vivo. Exemplary DXS polypeptides
and nucleic acids and methods of measuring DXS activity are
described in more detail in International Publication No. WO
2009/076676, U.S. patent application Ser. No. 12/335,071 (US Publ.
No. 2009/0203102), WO 2010/003007, US Publ. No. 2010/0048964, WO
2009/132220, and US Publ. No. 2010/0003716.
[0141] Exemplary DXP pathways polypeptides include, but are not
limited to any of the following polypeptides: DXS polypeptides, DXR
polypeptides, MCT polypeptides, CMK polypeptides, MCS polypeptides,
HDS polypeptides, HDR polypeptides, and polypeptides (e.g., fusion
polypeptides) having an activity of one, two, or more of the DXP
pathway polypeptides. In particular, DXP pathway polypeptides
include polypeptides, fragments of polypeptides, peptides, and
fusions polypeptides that have at least one activity of a DXP
pathway polypeptide. Exemplary DXP pathway nucleic acids include
nucleic acids that encode a polypeptide, fragment of a polypeptide,
peptide, or fusion polypeptide that has at least one activity of a
DXP pathway polypeptide. Exemplary DXP pathway polypeptides and
nucleic acids include naturally-occurring polypeptides and nucleic
acids from any of the source organisms described herein as well as
mutant polypeptides and nucleic acids derived from any of the
source organisms described herein. Exemplary DXP pathway
polypeptides and nucleic acids and methods of measuring DXP pathway
polypeptide activity are described in more detail in International
Publication No.: WO 2010/148150
[0142] Exemplary DXS polypeptides include polypeptides, fragments
of polypeptides, peptides, and fusions polypeptides that have at
least one activity of a DXS polypeptide. Standard methods (such as
those described herein) can be used to determine whether a
polypeptide has DXS polypeptide activity by measuring the ability
of the polypeptide to convert pyruvate and
D-glyceraldehyde-3-phosphate into 1-deoxy-D-xylulose-5-phosphate in
vitro, in a cell extract, or in vivo. Exemplary DXS polypeptides
and nucleic acids and methods of measuring DXS activity are
described in more detail in International Publication No. WO
2009/076676, U.S. patent application Ser. No. 12/335,071 (US Publ.
No. 2009/0203102), WO 2010/003007, US Publ. No. 2010/0048964, WO
2009/132220, and US Publ. No. 2010/0003716.
[0143] In particular, DXS polypeptides convert pyruvate and
D-glyceraldehyde 3-phosphate into 1-deoxy-d-xylulose 5-phosphate
(DXP). Standard methods can be used to determine whether a
polypeptide has DXS polypeptide activity by measuring the ability
of the polypeptide to convert pyruvate and D-glyceraldehyde
3-phosphate in vitro, in a cell extract, or in vivo.
[0144] DXR polypeptides convert 1-deoxy-d-xylulose 5-phosphate
(DXP) into 2-C-methyl-D-erythritol 4-phosphate (MEP). Standard
methods can be used to determine whether a polypeptide has DXR
polypeptides activity by measuring the ability of the polypeptide
to convert DXP in vitro, in a cell extract, or in vivo.
[0145] MCT polypeptides convert 2-C-methyl-D-erythritol 4-phosphate
(MEP) into 4-(cytidine 5'-diphospho)-2-methyl-D-erythritol
(CDP-ME). Standard methods can be used to determine whether a
polypeptide has MCT polypeptides activity by measuring the ability
of the polypeptide to convert MEP in vitro, in a cell extract, or
in vivo.
[0146] CMK polypeptides convert 4-(cytidine
5'-diphospho)-2-C-methyl-D-erythritol (CDP-ME) into
2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
(CDP-MEP). Standard methods can be used to determine whether a
polypeptide has CMK polypeptides activity by measuring the ability
of the polypeptide to convert CDP-ME in vitro, in a cell extract,
or in vivo.
[0147] MCS polypeptides convert 2-phospho-4-(cytidine
5'-diphospho)-2-C-methyl-D-erythritol (CDP-MEP) into
2-C-methyl-D-erythritol 2,4-cyclodiphosphate (ME-CPP or cMEPP).
Standard methods can be used to determine whether a polypeptide has
MCS polypeptides activity by measuring the ability of the
polypeptide to convert CDP-MEP in vitro, in a cell extract, or in
vivo.
[0148] HDS polypeptides convert 2-C-methyl-D-erythritol
2,4-cyclodiphosphate into (E)-4-hydroxy-3-methylbut-2-en-1-yl
diphosphate (HMBPP or HDMAPP). Standard methods can be used to
determine whether a polypeptide has HDS polypeptides activity by
measuring the ability of the polypeptide to convert ME-CPP in
vitro, in a cell extract, or in vivo.
[0149] HDR polypeptides convert (E)-4-hydroxy-3-methylbut-2-en-1-yl
diphosphate into isopentenyl diphosphate (IPP) and dimethylallyl
diphosphate (DMAPP). In one embodiment, the ispH gene can be used
to encode for HDR polypeptides. IspH is also known as
1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate reductase, 4Fe-4S
protein, ECK0030, JW0027, lytB, yaaE, and b0029. Standard methods
can be used to determine whether a polypeptide has HDR polypeptides
activity by measuring the ability of the polypeptide to convert
HMBPP in vitro, in a cell extract, or in vivo.
Source Organisms for MVA Pathway, Isoprene Synthase, IDI, and DXP
Pathway Polypeptides
[0150] Isoprene synthase, IDI, DXP pathway, and/or MVA pathway
nucleic acids can be obtained from any organism that naturally
contains isoprene synthase, IDI, DXP pathway, and/or MVA pathway
nucleic acids. Isoprene is formed naturally by a variety of
organisms, such as bacteria, yeast, plants, and animals. Some
organisms contain the MVA pathway for producing isoprene. Isoprene
synthase nucleic acids can be obtained, e.g., from any organism
that contains an isoprene synthase. MVA pathway nucleic acids can
be obtained, e.g., from any organism that contains the MVA pathway.
IDI and DXP pathway nucleic acids can be obtained, e.g., from any
organism that contains the IDI and DXP pathway.
[0151] The nucleic acid sequence of the isoprene synthase, DXP
pathway, IDI, and/or MVA pathway nucleic acids can be isolated from
a bacterium, fungus, plant, algae, or cyanobacterium. Exemplary
source organisms include, for example, yeasts, such as species of
Saccharomyces (e.g., S. cerevisiae), bacteria, such as species of
Escherichia (e.g., E. coli), or species of Methanosarcina (e.g.,
Methanosarcina mazei), plants, such as kudzu or poplar (e.g.,
Populus alba or Populus alba.times.tremula CAC35696) or aspen
(e.g., Populus tremuloides). Exemplary sources for isoprene
synthases, IDI, and/or MVA pathway polypeptides which can be used
are also described in International Patent Application Publication
Nos. WO2009/076676, WO2010/003007, WO2009/132220, WO2010/031062,
WO2010/031068, WO2010/031076, WO2010/013077, WO2010/031079,
WO2010/148150, WO2010/078457, and WO2010/148256.
[0152] In some aspects, the source organism is a yeast, such as
Saccharomyces sp., Schizosaccharomyces sp., Pichia sp., or Candida
sp.
[0153] In some aspects, the source organism is a bacterium, such as
strains of Bacillus such as B. lichenformis or B. subtilis, strains
of Pantoea such as P. citrea, strains of Pseudomonas such as P.
alcaligenes, strains of Streptomyces such as S. lividans or S.
rubiginosus, strains of Escherichia such as E. coli, strains of
Corynebacteria, strains of Enterobacter, strains of Streptococcus,
or strains of Archaea such as Methanosarcina mazei.
[0154] As used herein, "the genus Bacillus" includes all species
within the genus "Bacillus," as known to those of skill in the art,
including but not limited to B. subtilis, B. licheniformis, B.
lentus, B. brevis, B. stearothermophilus, B. alkalophilus, B.
amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B.
coagulans, B. circulans, B. lautus, and B. thuringiensis. It is
recognized that the genus Bacillus continues to undergo taxonomical
reorganization. Thus, it is intended that the genus include species
that have been reclassified, including but not limited to such
organisms as B. stearothermophilus, which is now named "Geobacillus
stearothermophilus." The production of resistant endospores in the
presence of oxygen is considered the defining feature of the genus
Bacillus, although this characteristic also applies to the recently
named Alicyclobacillus, Amphibacillus, Aneurinibacillus,
Anoxybacillus, Brevibacillus, Filobacillus, Gracilibacillus,
Halobacillus, Paenibacillus, Salibacillus, Thermobacillus,
Ureibacillus, and Virgibacillus.
[0155] In some aspects, the source organism is a gram-positive
bacterium. Non-limiting examples include strains of Streptomyces
(e.g., S. lividans, S. coelicolor, or S. griseus) and Bacillus. In
some aspects, the source organism is a gram-negative bacterium,
such as E. coli or Pseudomonas sp. In some aspects, the source
organism is L. acidophilus.
[0156] In some aspects, the source organism is a plant, such as a
plant from the family Fabaceae, such as the Faboideae subfamily. In
some aspects, the source organism is kudzu, poplar (such as Populus
alba.times.tremula CAC35696), aspen (such as Populus tremuloides),
or Quercus robur.
[0157] In some aspects, the source organism is an algae, such as a
green algae, red algae, glaucophytes, chlorarachniophytes,
euglenids, chromista, or dinoflagellates.
[0158] In some aspects, the source organism is a cyanobacteria,
such as cyanobacteria classified into any of the following groups
based on morphology: Chroococcales, Pleurocapsales,
Oscillatoriales, Nostocales, or Stigonematales.
Phosphoketolase Nucleic Acids and Polypeptides
[0159] In some aspects of the invention, the recombinant cells
described in any of the compositions or methods described herein
further comprise one or more nucleic acids encoding an
phosphoketolase polypeptide or a polypeptide having phosphoketolase
activity. In some aspects, the phosphoketolase polypeptide is an
endogenous polypeptide. In some aspects, the endogenous nucleic
acid encoding a phosphoketolase polypeptide is operably linked to a
constitutive promoter. In some aspects, the endogenous nucleic acid
encoding a phosphoketolase polypeptide is operably linked to an
inducible promoter. In some aspects, the endogenous nucleic acid
encoding a phosphoketolase polypeptide is operably linked to a
strong promoter. In some aspects, more than one endogenous nucleic
acid encoding a phosphoketolase polypeptide is used (e.g, 2, 3, 4,
or more copies of an endogenous nucleic acid encoding a
phosphoketolase polypeptide). In a particular aspect, the cells are
engineered to overexpress the endogenous phosphoketolase
polypeptide relative to wild-type cells. In some aspects, the
endogenous nucleic acid encoding a phosphoketolase polypeptide is
operably linked to a weak promoter.
[0160] Phosphoketolase enzymes catalyze the conversion of xylulose
5-phosphate to glyceraldehyde 3-phosphate and acetyl phosphate
and/or the conversion of fructose 6-phosphate to erythrose
4-phosphate and acetyl phosphate. In certain embodiments, the
phosphoketolase enzyme is capable of catalyzing the conversion of
xylulose 5-phosphate to glyceraldehyde 3-phosphate and acetyl
phosphate. In other embodiments, the phosphoketolase enzyme is
capable of catalyzing the conversion of fructose 6-phosphate to
erythrose 4-phosphate and acetyl phosphate. Thus, without being
bound by theory, the expression of phosphoketolase as set forth
herein can result in an increase in the amount of acetyl phosphate
produced from a carbohydrate source. This acetyl phosphate can be
converted into acetyl-CoA which can then be utilized by the
enzymatic activities of the MVA pathway to produces mevalonate,
isoprenoid precursor molecules, isoprene and/or isoprenoids. Thus
the amount of these compounds produced from a carbohydrate
substrate may be increased. Alternatively, production of Acetyl-P
and AcCoA can be increased without the increase being reflected in
higher intracellular concentration. In certain embodiments,
intracellular acetyl-P or acetyl-CoA concentrations will remain
unchanged or even decrease, even though the phosphoketolase
reaction is taking place.
[0161] Exemplary phosphoketolase nucleic acids include nucleic
acids that encode a polypeptide, fragment of a polypeptide,
peptide, or fusion polypeptide that has at least one activity of a
phosphoketolase polypeptide. Exemplary phosphoketolase polypeptides
and nucleic acids include naturally-occurring polypeptides and
nucleic acids from any of the source organisms described herein as
well as mutant polypeptides and nucleic acids derived from any of
the source organisms described herein.
[0162] Standard methods can be used to determine whether a
polypeptide has phosphoketolase peptide activity by measuring the
ability of the peptide to convert D-fructose 6-phosphate or
D-xylulose 5-phosphate into acetyl-P. Acetyl-P can then be
converted into ferryl acetyl hydroxamate, which can be detected
spectrophotometrically (Meile et al., J. Bact. 183:2929-2936,
2001). Any polypeptide identified as having phosphoketolase peptide
activity as described herein is suitable for use in the present
invention.
[0163] In other aspects, exemplary phosphoketolase nucleic acids
include, for example, a phosphoketolase isolated from Lactobacillus
reuteri, Bifidobacterium longum, Ferrimonas balearica, Pedobactor
saltans, Streptomyces griseus, and/or Nocardiopsis dassonvillei.
Additional examples of phosphoketolase enzymes which can be used
herein are described in U.S. Pat. No. 7,785,858 and WO
2011159853A1, both of which are incorporated by reference
herein.
Pathways Involving the Entner-Doudoroff Pathway
[0164] The Entner-Doudoroff (ED) pathway is an alternative to the
Emden-Meyerhoff-Parnass (EMP-glycolysis) pathway. Some organisms,
like E. coli, harbor both the ED and EMP pathways, while others
have only one or the other. Bacillus subtilis has only the EMP
pathway, while Zymomonas mobilis has only the ED pathway (Peekhaus
and Conway. 1998. J. Bact. 180:3495-3502; Stulke and Hillen. 2000.
Annu. Rev. Microbiol. 54, 849-880; Dawes et al. 1966. Biochem. J.
98:795-803).
[0165] Phosphogluconate dehydratase (edd) removes one molecule of
H.sub.2O from 6-phospho-D-gluconate to form
2-dehydro-3-deoxy-D-gluconate 6-phosphate, while
2-keto-3-deoxygluconate 6-phosphate aldolase (eda) catalyzes an
aldol cleavage (Egan et al. 1992. J. Bact. 174:4638-4646). The two
genes are in an operon.
[0166] Metabolites that can be directed into the phosphoketolase
pathway can also be diverted into the ED pathway. To avoid
metabolite loss to the ED-pathway, phosphogluconate dehydratase
gene (e.g., the endogenous phosphogluconate dehydratase gene)
and/or an 2-keto-3-deoxygluconate 6-phosphate aldolase gene (e.g.,
the endogenous 2-keto-3-deoxygluconate 6-phosphate aldolase gene)
activity is attenuated. One way of achieving attenuation is by
deleting phosphogluconate dehydratase (edd) and/or
2-keto-3-deoxygluconate 6-phosphate aldolase (eda). This can be
accomplished by replacing one or both genes with a chloramphenicol
or kanamycin cassette followed by looping out of the cassette.
Without these enzymatic activities, more carbon can flux through
the phosphoketolase enzyme, thus increasing the yield of
mevalonate, isoprene or isoprenoids.
[0167] The activity of phosphogluconate dehydratase (edd) and/or
2-keto-3-deoxygluconate 6-phosphate aldolase (eda) can also be
decreased by other molecular manipulations of the enzymes. The
decrease of enzyme activity can be any amount of reduction of
specific activity or total activity as compared to when no
manipulation has been effectuated. In some instances, the decrease
of enzyme activity is decreased by at least about 1%, 2%, 3%, 4%,
5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or
99%.
[0168] In some cases, attenuating the activity of the endogenous
phosphogluconate dehydratase gene and/or the endogenous
2-keto-3-deoxygluconate 6-phosphate aldolase gene results in more
carbon flux into the mevalonate dependent biosynthetic pathway in
comparison to cells that do not have attenuated endogenous
phosphogluconate dehydratase gene and/or endogenous acetate
kinase2-keto-3-deoxygluconate 6-phosphate aldolase gene
expression.
[0169] Pathways Involving the Oxidative Branch of the Pentose
Phosphate Pathway
[0170] E. coli uses the pentose phosphate pathway to break down
hexoses and pentoses and to provide cells with intermediates for
various anabolic pathways. It is also a major producer of NADPH.
The pentose phosphate pathway is composed from an oxidative branch
(with enzymes like glucose 6-phosphate 1-dehydrogenase (zwf),
6-phosphogluconolactonase (pgl) or 6-phosphogluconate dehydrogenase
(gnd)) and a non-oxidative branch (with enzymes such as
transketolase (tktA), transaldolase (talA or talB),
ribulose-5-phosphate-epimerase and (or) ribose-5-phosphate
epimerase) (Sprenger. 1995. Arch. Microbiol. 164:324-330).
[0171] In order to direct carbon towards the phosphoketolase
enzyme, the non-oxidative branch of the pentose phosphate pathway
(transketolase, transaldolase, ribulose-5-phosphate-epimerase and
(or) ribose-5-phosphate epimerase) expression can be modulated
(e.g., increase enzyme activity) to allow more carbon to flux
towards fructose 6-phosphate and xylulose 5-phosphate, thereby
increasing the eventual production of mevalonate, isoprene and
isoprenoids. Increase of transketolase, transaldolase,
ribulose-5-phosphate-epimerase and (or) ribose-5-phosphate
epimerase activity can be any amount of increase of specific
activity or total activity as compared to when no manipulation has
been effectuated. In some instances, the enzyme activity is
increased by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%,
10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%, 45%, 50%, 55%, 60%, 65%,
70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%. In some
aspects, the activity of transketolase, transaldolase,
ribulose-5-phosphate-epimerase and (or) ribose-5-phosphate
epimerase is modulated by increasing the activity of an endogenous
transketolase, transaldolase, ribulose-5-phosphate-epimerase and
(or) ribose-5-phosphate epimerase. This can be accomplished by
replacing the endogenous transketolase, transaldolase,
ribulose-5-phosphate-epimerase and (or) ribose-5-phosphate
epimerase gene promoter with a synthetic constitutively high
expressing promoter. The genes encoding transketolase,
transaldolase, ribulose-5-phosphate-epimerase and (or)
ribose-5-phosphate epimerase can also be cloned on a plasmid behind
an appropriate promoter. The increase of the activity of
transketolase, transaldolase, ribulose-5-phosphate-epimerase and
(or) ribose-5-phosphate epimerase can result in more carbon flux
into the mevalonate dependent biosynthetic pathway in comparison to
cells that do not have increased expression of transketolase,
transaldolase, ribulose-5-phosphate-epimerase and (or)
ribose-5-phosphate epimerase.
Pathways Involving Phosphofructokinase
[0172] Phosphofructokinase is a crucial enzyme of glycolysis which
catalyzes the phosphorylation of fructose 6-phosphate. E. coli has
two isozymes encoded by pfkA and pfkB. Most of the
phosphofructokinase activity in the cell is due to pfkA (Kotlarz et
al. 1975 Biochim. Biophys. Acta 381:257-268).
[0173] In order to direct carbon towards the phosphoketolase
enzyme, phosphofructokinase expression can be modulated (e.g.,
decrease enzyme activity) to allow more carbon to flux towards
fructose 6-phosphate and xylulose 5-phosphate, thereby increasing
the eventual production of mevalonate, isoprene and isoprenoids.
Decrease of phosphofructokinase activity can be any amount of
reduction of specific activity or total activity as compared to
when no manipulation has been effectuated. In some instances, the
decrease of enzyme activity is decreased by at least about 1%, 2%,
3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%,
45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
98%, 99%. Or 100%. In some aspects, the activity of
phosphofructokinase is modulated by decreasing the activity of an
endogenous phosphofructokinase. This can be accomplished by
replacing the endogenous phosphofructokinase gene promoter with a
synthetic constitutively low expressing promoter. The gene encoding
phosphofructokinase can also be deleted. The decrease of the
activity of phosphofructokinase can result in more carbon flux into
the mevalonate dependent biosynthetic pathway in comparison to
cells that do not have decreased expression of
phosphofructokinase.
Additional Host Cell Mutations
[0174] The invention also contemplates additional host cell
mutations that increase carbon flux through the MVA pathway. By
increasing the carbon flow, more isoprene can be produced. The
recombinant cells comprising acetoacetyl-CoA synthase as described
herein can also be engineered for increased carbon flux towards
mevalonate production wherein the activity of one or more enzymes
from the group consisting of: (a) citrate synthase, (b)
phosphotransacetylase; (c) acetate kinase; (d) lactate
dehydrogenase; (e) NADP-dependent malic enzyme, and; (f) pyruvate
dehydrogenase is modulated.
Citrate Synthase Pathway
[0175] Citrate synthase catalyzes the condensation of oxaloacetate
and acetyl-CoA to form citrate, a metabolite of the Tricarboxylic
acid (TCA) cycle (Ner, S. et al. 1983. Biochemistry 22: 5243-5249;
Bhayana, V. and Duckworth, H. 1984. Biochemistry 23: 2900-2905)
(FIG. 5). In E. coli, this enzyme, encoded by gltA, behaves like a
trimer of dimeric subunits. The hexameric form allows the enzyme to
be allosterically regulated by NADH. This enzyme has been widely
studied (Wiegand, G., and Remington, S. 1986. Annual Rev.
Biophysics Biophys. Chem. 15: 97-117; Duckworth et al. 1987.
Biochem Soc Symp. 54:83-92; Stockell, D. et al. 2003. J. Biol.
Chem. 278: 35435-43; Maurus, R. et al. 2003. Biochemistry.
42:5555-5565). To avoid allosteric inhibition by NADH, replacement
by or supplementation with the Bacillus subtilis NADH-insensitive
citrate synthase has been considered (Underwood et al. 2002. Appl.
Environ. Microbiol. 68:1071-1081; Sanchez et al. 2005. Met. Eng.
7:229-239).
[0176] The reaction catalyzed by citrate synthase is directly
competing with the thiolase catalyzing the first step of the
mevalonate pathway, as they both have acetyl-CoA as a substrate
(Hedl et al. 2002. J. Bact. 184:2116-2122). Therefore, one of skill
in the art can modulate citrate synthase expression (e.g., decrease
enzyme activity) to allow more carbon to flux into the mevalonate
pathway, thereby increasing the eventual production of mevalonate
and isoprene. Decrease of citrate synthase activity can be any
amount of reduction of specific activity or total activity as
compared to when no manipulation has been effectuated. In some
instances, the decrease of enzyme activity is decreased by at least
about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%,
35%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
95%, 96%, 97%, 98%, or 99%. In some aspects, the activity of
citrate synthase is modulated by decreasing the activity of an
endogenous citrate synthase gene. This can be accomplished by
chromosomal replacement of an endogenous citrate synthase gene with
a transgene encoding an NADH-insensitive citrate synthase or by
using a transgene encoding an NADH-insensitive citrate synthase
that is derived from Bacillus subtilis. The activity of citrate
synthase can also be modulated (e.g., decreased) by replacing the
endogenous citrate synthase gene promoter with a synthetic
constitutively low expressing promoter. The decrease of the
activity of citrate synthase can result in more carbon flux into
the mevalonate dependent biosynthetic pathway in comparison to
microorganisms that do not have decreased expression of citrate
synthase.
Pathways Involving Phosphotransacetylase and/or Acetate Kinase
[0177] Phosphotransacetylase (pta) (Shimizu et al. 1969. Biochim.
Biophys. Acta 191: 550-558) catalyzes the reversible conversion
between acetyl-CoA and acetylphosphate (acetyl-P), while acetate
kinase (ackA) (Kakuda, H. et al. 1994. J. Biochem. 11:916-922) uses
acetyl-P to form acetate. These genes can be transcribed as an
operon in E. coli. Together, they catalyze the dissimilation of
acetate, with the release of ATP. Thus, one of skill in the art can
increase the amount of available acetyl Co-A by attenuating the
activity of phosphotransacetylase gene (e.g., the endogenous
phosphotransacetylase gene) and/or an acetate kinase gene (e.g.,
the endogenous acetate kinase gene). One way of achieving
attenuation is by deleting phosphotransacetylase (pta) and/or
acetate kinase (ackA). This can be accomplished by replacing one or
both genes with a chloramphenicol cassette followed by looping out
of the cassette. Acetate is produced by E. coli for a variety of
reasons (Wolfe, A. 2005. Microb. Mol. Biol. Rev. 69:12-50). Without
being bound by theory, since ackA-pta use acetyl-CoA, deleting
those genes might allow carbon not to be diverted into acetate and
to increase the yield of mevalonate and/or isoprene.
[0178] In some aspects, the recombinant microorganism produces
decreased amounts of acetate in comparison to microorganisms that
do not have attenuated endogenous phosphotransacetylase gene and/or
endogenous acetate kinase gene expression. Decrease in the amount
of acetate produced can be measured by routine assays known to one
of skill in the art. The amount of acetate reduction is at least
about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%,
35%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
95%, 96%, 97%, 98%, or 99% as compared when no molecular
manipulations are done.
[0179] The activity of phosphotransacetylase (pta) and/or acetate
kinase (ackA) can also be decreased by other molecular manipulation
of the enzymes. The decrease of enzyme activity can be any amount
of reduction of specific activity or total activity as compared to
when no manipulation has been effectuated. In some instances, the
decrease of enzyme activity is decreased by at least about 1%, 2%,
3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%,
45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%,
98%, or 99%.
[0180] In some cases, attenuating the activity of the endogenous
phosphotransacetylase gene and/or the endogenous acetate kinase
gene results in more carbon flux into the mevalonate dependent
biosynthetic pathway in comparison to microorganisms that do not
have attenuated endogenous phosphotransacetylase gene and/or
endogenous acetate kinase gene expression.
Pathways Involving Lactate Dehydrogenase
[0181] In E. coli, D-Lactate is produced from pyruvate through the
enzyme lactate dehydrogenase (ldhA--FIG. 5) (Bunch, P. et al. 1997.
Microbiol. 143:187-195). Production of lactate is accompanied with
oxidation of NADH, hence lactate is produced when oxygen is limited
and cannot accommodate all the reducing equivalents. Thus,
production of lactate could be a source for carbon consumption. As
such, to improve carbon flow through to mevolnate production (and
isopren production, if desired), one of skill in the art can
modulate the activity of lactate dehydrogenase, such as by
decreasing the activity of the enzyme.
[0182] Accordingly, in one aspect, the activity of lactate
dehydrogenase can be modulated by attenuating the activity of an
endogenous lactate dehydrogenase gene. Such attenuation can be
achieved by deletion of the endogenous lactate dehydrogenase gene.
Other ways of attenuating the activity of lactate dehydrogenase
gene known to one of skill in the art may also be used. By
manipulating the pathway that involves lactate dehydrogenase, the
recombinant microorganism produces decreased amounts of lactate in
comparison to microorganisms that do not have attenuated endogenous
lactate dehydrogenase gene expression. Decrease in the amount of
lactate produced can be measured by routine assays known to one of
skill in the art. The amount of lactate reduction is at least about
1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%,
35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%,
96%, 97%, 98%, or 99% as compared when no molecular manipulations
are done.
[0183] The activity of lactate dehydrogenase can also be decreased
by other molecular manipulations of the enzyme. The decrease of
enzyme activity can be any amount of reduction of specific activity
or total activity as compared to when no manipulation has been
effectuated. In some instances, the decrease of enzyme activity is
decreased by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%,
10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%, 45%, 50%, 55%, 60%, 65%,
70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99%.
[0184] Accordingly, in some cases, attenuation of the activity of
the endogenous lactate dehydrogenase gene results in more carbon
flux into the mevalonate dependent biosynthetic pathway in
comparison to microorganisms that do not have attenuated endogenous
lactate dehydrogenase gene expression.
Pathways Involving Malic Enzyme
[0185] Malic enzyme (in E. coli sfcA and maeB) is an anaplerotic
enzyme that catalyzes the conversion of malate into pyruvate (using
NAD+ or NADP+) by the equation below:
(S)-malate+NAD(P).sup.+.revreaction.pyruvate+CO.sub.2+NAD(P)H
[0186] Thus, the two substrates of this enzyme are (S)-malate and
NAD(P).sup.+, whereas its 3 products are pyruvate, CO.sub.2, and
NADPH.
[0187] Expression of the NADP-dependent malic enzyme (maeB--FIG. 5)
(Iwikura, M. et al. 1979. J. Biochem. 85: 1355-1365) can help
increase mevalonate and/or isoprene yield by 1) bringing carbon
from the TCA cycle back to pyruvate, direct precursor of
acetyl-CoA, itself direct precursor of the mevalonate pathway and
2) producing extra NADPH which could be used in the HMG-CoA
reductase reaction (Oh, M K et al. (2002) J. Biol. Chem. 277:
13175-13183; Bologna, F. et al. (2007) J. Bact. 189:5937-5946).
[0188] As such, more starting substrate (pyruvate or acetyl-CoA)
for the downstream production of mevalonate and/or isoprene can be
achieved by modulating, such as increasing, the activity and/or
expression of malic enzyme. The NADP-dependent malic enzyme gene
can be an endogenous gene. One non-limiting way to accomplish this
is by replacing the endogenous NADP-dependent malic enzyme gene
promoter with a synthetic constitutively expressing promoter.
Another non-limiting way to increase enzyme activity is by using
one or more heterologous nucleic acids encoding an NADP-dependent
malic enzyme polypeptide. One of skill in the art can monitor the
expression of maeB RNA during fermentation or culturing using
readily available molecular biology techniques.
[0189] Accordingly, in some embodiments, the recombinant
microorganism produces increased amounts of pyruvate in comparison
to microorganisms that do not have increased expression of an
NADP-dependent malic enzyme gene. In some aspects, increasing the
activity of an NADP-dependent malic enzyme gene results in more
carbon flux into the mevalonate dependent biosynthetic pathway in
comparison to microorganisms that do not have increased
NADP-dependent malic enzyme gene expression.
[0190] Increase in the amount of pyruvate produced can be measured
by routine assays known to one of skill in the art. The amount of
pyruvate increase can be at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%,
8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 35%, 40%, 45%, 50%, 55%, 60%,
65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% as
compared when no molecular manipulations are done.
[0191] The activity of malic enzyme can also be increased by other
molecular manipulations of the enzyme. The increase of enzyme
activity can be any amount of increase of specific activity or
total activity as compared to when no manipulation has been
effectuated. In some instances, the increase of enzyme activity is
at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%,
25%, 30%, 35%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, 96%, 97%, 98%, or 99%.
Pathways Involving Pyruvate Dehydrogenase Complex
[0192] The pyruvate dehydrogenase complex, which catalyzes the
decarboxylation of pyruvate into acetyl-CoA, is composed of the
proteins encoded by the genes aceE, aceF and lpdA. Transcription of
those genes is regulated by several regulators. Thus, one of skill
in the art can increase acetyl-CoA by modulating the activity of
the pyruvate dehydrogenase complex. Modulation can be to increase
the activity and/or expression (e.g., constant expression) of the
pyruvate dehydrogenase complex. This can be accomplished by
different ways, for example, by placing a strong constitutive
promoter, like PL.6
(aattcatataaaaaacatacagataaccatctgcggtgataaattatctctggcggtgttgacataaatacc-
actggcggtgatactgagcacatca gcaggacgcactgaccaccatgaaggtg-lambda
promoter, GenBank NC.sub.--001416 (SEQ ID NO:10)), in front of the
operon or using one or more synthetic constitutively expressing
promoters.
[0193] Accordingly, in one aspect, the activity of pyruvate
dehydrogenase is modulated by increasing the activity of one or
more genes of the pyruvate dehydrogenase complex consisting of (a)
pyruvate dehydrogenase (E1), (b) dihydrolipoyl transacetylase, and
(c) dihydrolipoyl dehydrogenase. It is understood that any one, two
or three of these genes can be manipulated for increasing activity
of pyruvate dehydrogenase. In another aspect, the activity of the
pyruvate dehydrogenase complex can be modulated by attenuating the
activity of an endogenous pyruvate dehydrogenase complex repressor
gene, further detailed below. The activity of an endogenous
pyruvate dehydrogenase complex repressor can be attenuated by
deletion of the endogenous pyruvate dehydrogenase complex repressor
gene.
[0194] In some cases, one or more genes of the pyruvate
dehydrogenase complex are endogenous genes. Another way to increase
the activity of the pyruvate dehydrogenase complex is by
introducing into the microorganism one or more heterologous nucleic
acids encoding one or more polypeptides from the group consisting
of (a) pyruvate dehydrogenase (E1), (b) dihydrolipoyl
transacetylase, and (c) dihydrolipoyl dehydrogenase.
[0195] By using any of these methods, the recombinant microorganism
can produce increased amounts of acetyl Co-A in comparison to
microorganisms wherein the activity of pyruvate dehydrogenase is
not modulated. Modulating the activity of pyruvate dehydrogenase
can result in more carbon flux into the mevalonate dependent
biosynthetic pathway in comparison to microorganisms that do not
have modulated pyruvate dehydrogenase expression.
Combinations of Mutations
[0196] It is understood that for any of the enzymes and/or enzyme
pathways described herein, molecular manipulations that modulate
any combination (two, three, four, five or six) of the enzymes
and/or enzyme pathways described herein is expressly contemplated.
For ease of the recitation of the combinations, citrate synthase
(gltA) is designated as A, phosphotransacetylase (ptaB) is
designated as B, acetate kinase (ackA) is designated as C, lactate
dehydrogenase (ldhA) is designated as D, malic enzyme (sfcA or
maeB) is designated as E, and pyruvate decarboxylase (aceE, aceF,
and/or lpdA) is designated as F. As discussed above, aceE, aceF,
and/or lpdA enzymes of the pyruvate decarboxylase complex can be
used singly, or two of three enzymes, or three of three enzymes for
increasing pyruvate decarboxylase activity.
[0197] Accordingly, for combinations of any two of the enzymes A-F,
non-limiting combinations that can be used are: AB, AC, AD, AE, AF,
BC, BD, BE, BF, CD, CE, CF, DE, DF and EF. For combinations of any
three of the enzymes A-F, non-limiting combinations that can be
used are: ABC, ABD, ABE, ABF, BCD, BCE, BCF, CDE, CDF, DEF, ACD,
ACE, ACF, ADE, ADF, AEF, BDE, BDF, BEF, and CEF. For combinations
of any four of the enzymes A-F, non-limiting combinations that can
be used are: ABCD, ABCE, ABCF, ABDE, ABDF, ABEF, BCDE, BCDF, CDEF,
ACDE, ACDF, ACEF, BCEF, BDEF, and ADEF. For combinations of any
five of the enzymes A-F, non-limiting combinations that can be used
are: ABCDE, ABCDF, ABDEF, BCDEF, ACDEF, and ABCEF. In another
aspect, all six enzyme combinations are used: ABCDEF.
[0198] Accordingly, the recombinant microorganism as described
herein can achieve increased mevalonate production that is
increased compared to microorganisms that are not grown under
conditions of tri-carboxylic acid (TCA) cycle activity, wherein
metabolic carbon flux in the recombinant microorganism is directed
towards mevalonate production by modulating the activity of one or
more enzymes from the group consisting of (a) citrate synthase, (b)
phosphotransacetylase and/or acetate kinase, (c) lactate
dehydrogenase, (d) malic enzyme, and (e) pyruvate decarboxylase
complex.
Other Regulators and Factors for Increased Isoprene Production
[0199] Other molecular manipulations can be used to increase the
flow of carbon towards isoprene production. One method is to
reduce, decrease or eliminate the effects of negative regulators
for pathways that feed into the mevalonate pathway. For example, in
some cases, the genes aceEF-lpdA are in an operon, with a fourth
gene upstream pdhR. pdhR is a negative regulator of the
transcription of its operon. In the absence of pyruvate, it binds
its target promoter and represses transcription. It also regulates
ndh and cyoABCD in the same way (Ogasawara, H. et al. 2007. J.
Bact. 189:5534-5541). In one aspect, deletion of pdhR regulator can
improve the supply of pyruvate, and hence the production mevalonate
and/or isoprene.
[0200] In other aspects, the introduction of
6-phosphogluconolactonase (PGL) into microorganisms (such as
various E. coli strains) which lack PGL can be used to improve
production of mevalonate and/or isoprene. PGL may be introduced
using chromosomal integration or extrachromosomal vehicles, such as
plasmids. In other aspects, PGL may be deleted from the genome of
microorganisms (such as various E. coli strains) which express an
endogenous PGL to improve production of mevalonate and/or isoprene.
In some aspects, deletion of PGL results in any of about 10%, 20%,
30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any values in between these percentages, higher percent yield of
isoprene in comparison to microorganisms that express PGL. In other
aspects, deletion of PGL results in any of about 10%, 20%, 30%,
40%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including any
values in between these percentages, higher instantaneous percent
yield of isoprene in comparison to microorganisms that express PGL.
In other aspects, deletion of PGL results in any of about 10%, 20%,
30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any values in between these percentages, higher cell productivity
index for isoprene in comparison to microorganisms that express
PGL. In other aspects, deletion of PGL results in any of about 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive,
including any values in between these percentages, higher
volumetric productivity of isoprene in comparison to microorganisms
that express PGL. In other aspects, deletion of PGL results in any
of about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or 100%,
inclusive, including any values in between these percentages,
higher peak specific productivity of isoprene in comparison to
microorganisms that express PGL. In some aspects the deletion of
PGL results in peak specific productivity being maintained for a
longer period of time in comparison to microorganisms that express
PGL.
Recombinant Cells with IspA Manipulations
[0201] Isoprene can also be made using recombinant cells that have
been engineered to downregulate the expression or functional
activity of the ispA gene during precise time periods during
fermentation. The aspect is based on the observation that decreased
expression of the ispA gene of recombinant cells during
fermentation results in higher levels of isoprene production in
comparison to cells that do not possess decreased ispA gene
functional activity. Without being bound to theory, it is believed
that decreasing ispA gene expression and/or functional activity
improves isoprene yields by decreasing the production and
accumulation of higher molecular weight isoprenoid molecules
thereby resulting in higher carbon availability for isoprene
synthesis as well as improved cell viability. However, because the
ispA gene produces an enzyme that is essential for the robust
growth of bacteria and other microorganisms, total elimination of
this gene, such as through a gene knock out, is not a practical
option for improving isoprene yields as it has been reported to
result in either impaired growth (Fukisaki et al., 2005, J.
Biochem., 137(3):395-400) or in the death (worldwide
web.genome.wisc.edu/resources/essential.htm; Baba et al., 2006,
Mol. Syst. Biol., 2006.0008) of the cells. Accordingly, in one
aspect, one of skill in the art can utilize specific and
temporally-precise decreased expression and/or functional activity
of the ispA gene during isoprene production (e.g. subsequent to the
linear growth phase of fermentation) to achieve higher isoprene
yield, titer, cell productivity, volumetric productivity, specific
productivity, and cell viability by the recombinant cells.
[0202] Thus, in some embodiments, the recombinant cells comprise an
ispA having decreased functional activity. In one aspect, the
functional activity of ispA is decreased only during the
fermentation (or production) phase of cell culture. In another
aspect, the functional activity of ispA is not decreased during the
linear growth phase during cell culture. In some aspects, the
functional activity of ispA is decreased in both the growth and
fermentation phases of cell culture. In yet another aspect, the
functional activity of ispA is decreased in both the growth and
fermentation phases of cell culture, but the decrease is larger in
the fermentation phase. Any method can be used to decrease the
functional activity of ispA, such as, but not limited to, deleting
the ispA gene, decreasing ispA gene expression, or decreasing the
activity or availability of the polypeptide encoded by the ispA
gene. In other aspects, the recombinant cells of the present
invention comprise an ispA having decreased functional activity and
one or more of a group of genes involved in isoprene biosynthesis
that enables the synthesis of isoprene in the host microorganism.
In another aspect, the recombinant host cells of the present
invention comprise a recombinant ispA gene that has been codon
optimized for expression in host cells. In some aspects, the codon
optimized ispA gene is integrated into the host cell genome. In
other aspects, the codon optimized ispA gene is expressed on a
piece of extrachromosomal DNA (such as a plasmid). In another
aspect, the codon optimized ispA gene is integrated into the host
cell genome at the yhfS locus and the endogenous ispA gene is
deleted.
[0203] In some aspects, the recombinant host cells of the present
invention comprise a recombinant ispA gene that encodes a FPP
synthase with an increased Km value (for example, an avian FPP
synthase) for DMAPP in comparison to the Km value for DMAPP
exhibited by the endogenously encoded FPP synthase. Such high Km
FPP synthases have been described, for example, in Fernandez et
al., Biochemistry, 2000, 39(50):15316-21. In other aspects, the
recombinant host cells of the present invention can comprise a
thermophilic FPP synthase (such as the FPP synthase described in
Koyama et al., J. Biochem., 113:355-363), a psychrophilic FPP
synthase (such as the FPP synthase described in Nichols et al.,
2004, J. Bact., 186:8508-8515, the contents of which is
incorporated by reference herein in its entirety), or an FPP
synthase from a marine prokaryote (such as the FPP synthase
described in Ranzer et al., 2009, Mar. Biotechnol, 11:62-73). In
some aspects, the endogenous host cell ispA gene in any of the
recombinant cells described herein is replaced by any of the
alternative genes encoding an FPP synthase described herein.
[0204] In some aspects, the recombinant host cells of the present
invention comprise an ispA gene under the control of a weak
promoter (i.e., a promoter driving the expression of an ispA gene,
wherein the amount of expression is less than what is observed by
the endogenous or wild type ispA promoter). In some aspects, the
promoter controlling the expression of the ispA gene expresses the
ispA gene at a higher level during the linear growth phase during
cell culture in comparison to the expression of the ispA gene
during the fermentation phase.
Decreased Functional Activity of ispA
[0205] In some aspects, the recombinant cells described herein
comprise an ispA having decreased functional activity. "Decreased
functional activity" in this context refers to the ability of an
ispA polypeptide (for example, a polypeptide encoded by an ispA
gene) to convert IPP and DMAPP to GPP and/or FPP (i.e., the
molecules necessary for subsequent production of isoprenoids). In
some aspects, any of the recombinant cells disclosed herein can
comprise an ispA gene wherein functional activity of ispA is
decreased such that the cells produce less than about 1%, 2%, 3%,
4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including any
percentages in between these values, of the concentration of GPP
and/or FPP in comparison to the concentration of these molecules in
cells that do not comprise an ispA having decreased functional
activity. In another aspect, recombinant cells that have been
engineered to produce isoprene comprising one or more heterologous
nucleic acids encoding one or members of the MVA pathway and an
ispA having decreased functional activity produce less than about
1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%,
40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any percentages in between these values, of the concentration of
GPP and/or FPP in comparison to the concentration of these
molecules in recombinant cells that comprise one or more
heterologous nucleic acids encoding one or more members of the MVA
pathway but that do not comprise an ispA having decreased
functional activity. In other aspects, any of the recombinant cells
disclosed herein can comprise ispA wherein functional activity of
ispA is decreased such that the cells produce less than about 1%,
2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%,
45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including any
percentages in between these values, of the concentration of
isoprenoids in comparison to the concentration of these molecules
in cells that do not comprise ispA having decreased functional
activity. In other aspects, any of the recombinant cells disclosed
herein can comprise ispA wherein functional activity of the ispA
gene is decreased such that the cells exhibit any of about 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 100%, inclusive, including any percentages
in between these values, improved viability in comparison to the
viability of cells that do not comprise ispA having decreased
functional activity. In another aspect, recombinant cells that have
been engineered to produce isoprene comprising one or more
heterologous nucleic acids encoding one or members of the MVA
pathway and an ispA having decreased functional activity can
exhibit any of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%,
inclusive, including any percentages in between these values,
improved viability in comparison to the viability of cells that
comprise one or more heterologous nucleic acids encoding one or
more members of the MVA pathway but that do not comprise an ispA
having decreased functional activity. As used herein, "improved
viability" means there are less dead, dying, or otherwise
morphologically abnormal cells produced during the course of
fermentation. Morphological abnormalities can include, but are not
limited to, elongated cells and/or cellular debris from dead or
dying cells. In some embodiments, "improved viability" can mean
that a greater number of cells are determined to be alive through a
cell biological, molecular biological, or biochemical technique
that is known in the art (such as, but not limited to, Fluorescent
Activated Cell Sorting (FACS) or DiBAC4(3) staining). In some
aspects, ispA functional activity is decreased during the peak
isoprene production phase of fermentation. In other aspects, ispA
functional activity is not decreased during the linear growth phase
of fermentation.
[0206] Methods to measure decreased functional activity of ispA are
many and well known in the art. For example, standard methods can
be used to determine the production of metabolites (for example,
FPP and GPP) in cells, such as by the chemical extraction of
metabolites from whole cells followed by identification via mass
spectrometry. Similarly, standard methods can be used to assay
viability of cells with decreased ispA functional activity such as
morphological analysis by microscopy or by assessing membrane
potential. Cells with intact membrane potential are assumed to be
alive and metabolically active, while cells with no membrane
potential were assumed to be dead and metabolically inactive.
Decreased Expression of the ispA Gene
[0207] In some aspects, the functional activity of the ispA gene is
decreased by decreasing the expression of the ispA gene. This can
include deleting the ispA gene itself, either in whole or in part,
or by decreasing its expression through any number of methods as
described herein.
Temporally-Regulated Decreased Expression Via Auto-Regulatory
Promoters
[0208] In some aspects, ispA gene expression is decreased by
placing the ispA gene under the control of an auto-regulatory
promoter. In certain embodiments, promoters which are repressed
only during late stage fermentation of recombinant cells that have
been engineered to produce increased levels of isoprene can be used
to decrease the functional activity of the ispA gene. Without being
bound to theory, it is hypothesized that such promoters are
repressed during periods of increased accumulation of isoprenoid
compounds as fermentation progresses. Therefore, placing the ispA
gene under the control of these promoters can be used to temporally
control the expression of ispA, such that ispA repression occurs at
time periods which correspond to increased flux through the
isoprenoid pathway. However, at time periods where the isoprenoid
pathway flux is low, such as during the linear growth phase of
fermentation, then the promoter will remain induced and thereby
permit expression of the ispA gene. This signature activity profile
constitutes an auto-regulatory ispA expression control system.
[0209] Accordingly, in some aspects, any of the recombinant cells
described herein can comprise an ispA gene having decreased
functional activity, wherein the functional activity of the ispA
gene is decreased by placing the ispA gene under the control of an
auto-regulatory promoter. In some aspects, the auto-regulatory
promoter is selected from the group consisting of: efeO, kpsC,
kpsD, kpsD, kpsE, kpsF, kpsS, kpsU, nmpC, sodA, ybl129, ybl130,
ybl131, yddV, and ydiU. In one aspect, the ispA gene is placed
under control of the yddV promoter. In other aspects, the
endogenous ispA gene can be deleted from the genome of the
recombinant cell (for example, a recombinant E. coli cell) and a
new ispA gene can be substituted into the genome at a different
locus. In one aspect, a heterologous ispA gene is inserted into the
genome of the recombinant cell (for example, a recombinant E. coli
cell) at the yhfS locus. The heterologous ispA gene can be
identical to the deleted endogenous ispA gene or be an ispA gene
from another source. In other aspects, the heterologous ispA gene
under control of an auto-regulatory promoter is expressed
extrachromosomally. In another aspect, the recombinant host cells
of the present invention comprise a recombinant ispA gene that has
been codon optimized for expression in host cells. In some aspects,
the codon optimized ispA gene is integrated into the host cell
genome. In another aspect, the codon optimized ispA gene is under
the control of an auto-regulatory promoter selected from the group
consisting of: efeO, kpsC, kpsD, kpsD, kpsE, kpsF, kpsS, kpsU,
nmpC, sodA, ybl129, ybl130, ybl131, yddV, and ydiU. In some
aspects, the codon optimized ispA gene is under the control of the
yddV promoter. In yet another aspect, any of the auto-regulatory
promoters described herein can drive the expression of an ispA gene
selected from the group consisting of: a codon-optimized ispA, an
ispA allele (for example, an avian ispA allele) encoding an enzyme
comprising a Km that is higher in comparison to ispA-encoded
enzymes from microorganisms, and an endogenous ispA allele.
[0210] In some aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an ispA gene under
the control of an auto-regulatory promoter produce less than about
1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%,
40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any percentages in between these values, of the concentration of
GPP and/or FPP in comparison to the concentration of these
molecules in cells that do not comprise an ispA gene under the
control of an auto-regulatory promoter. In another aspect,
recombinant cells that have been engineered to produce isoprene
comprising one or more heterologous nucleic acids encoding one or
members of the MVA pathway and an ispA gene under the control of an
auto-regulatory promoter produce less than about 1%, 2%, 3%, 4%,
5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
60%, 70%, 80%, 90%, or 100%, inclusive, including any percentages
in between these values, of the concentration of GPP and/or FPP in
comparison to the concentration of these molecules in recombinant
cells that comprise one or more heterologous nucleic acids encoding
one or more members of the MVA pathway but that do not comprise an
ispA gene under the control of an auto-regulatory promoter. In some
aspects, recombinant cells (such as any of the recombinant cells
disclosed herein) expressing an ispA gene under the control of an
auto-regulatory promoter produce less than about 1%, 2%, 3%, 4%,
5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
60%, 70%, 80%, 90%, or 100%, inclusive, including any percentages
in between these values, of the concentration of isoprenoids in
comparison to the concentration of these molecules in cells that do
not comprise an ispA gene under the control of an auto-regulatory
promoter. In other aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an ispA gene under
the control of an auto-regulatory promoter exhibit any of 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 100%, inclusive, including any percentages
in between these values, improved viability in comparison to the
viability of cells that do not comprise an ispA gene under the
control of an auto-regulatory promoter. In another aspect,
recombinant cells that have been engineered to produce isoprene
comprising one or more heterologous nucleic acids encoding one or
members of the MVA pathway and an ispA gene under the control of an
auto-regulatory promoter can exhibit any of about 5%, 10%, 15%,
20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, or 100%, inclusive, including any percentages in
between these values, improved viability in comparison to the
viability of cells that comprise one or more heterologous nucleic
acids encoding one or more members of the MVA pathway but that do
not comprise an ispA gene under the control of an auto-regulatory
promoter.
Temporally-Regulated Decreased Expression Via the Heterologous
Repressor Protein HrcA
[0211] An alternate method to control expression of ispA utilizes
the transcriptional repressor protein HrcA of Caulobacter
crescentus (Roberts et al., Journal of Bacteriology, 1996, 178:7,
1829-41; Susin et al., Journal of Bacteriology, 2004, 186:20,
6759-67). The gene encoding HrcA is not naturally found in E. coli
and there is no known information suggesting that the CIRCE
element, which is recognized by HrcA, is involved in governing E.
coli gene expression. Therefore, incorporating the CIRCE element
within the regulatory sequence governing ispA expression within an
E. coli isoprene producing system would permit HrcA-mediated
repression of ispA. In addition, the heterologous hrcA gene can be
introduced into an E. coli isoprene-producing host where its
expression can be governed by at least one of a number of tightly
regulated means
[0212] Therefore, in some aspects, any of the recombinant cells
described herein can comprise an ispA gene having decreased
functional activity, wherein the functional activity of the ispA
gene is decreased by an HrcA transcriptional repressor protein
encoded by an hrcA gene and wherein a CIRCE element is engineered
into a regulatory sequence governing ispA expression. In some
aspects, hrcA expression is controlled by a linear growth phase
regulated promoter identified within the transcriptional profile of
cells across a large scale isoprene-generating fermentation. In
some aspects, the linear growth phase regulated promoter is
selected from the group consisting of otsA, amiB, and deoC.
[0213] In other aspects, hrcA expression may be controlled by a
positive regulatory-loop that is itself turned on during the
desired slow growth phase of fermentation via an inducing signal,
such as acute nutrient limitation or altered temperature. In this
aspect, a transactivator peptide, such as transactivator T, is
functionally linked to a particular signal-sensing promoter.
Introduction of the inducing signal will induce activity of the
signal-sensing promoter, which, in turn, upregulates the expression
of transactivator T. By linking further copies of transactivator T
genes to transactivator T-dependent promoters a positive feedback
loop is initiated and sustained once the inducing signal is
removed. In other aspects, the hrcA gene is linked to at least one
transactivator T-dependent promoter resulting in HrcA being
continually expressed during periods subsequent to activation of
the positive regulatory loop. In certain aspects, the
transactivator T gene driven by transactivator T dependent promoter
is located on the same operon as the hrcA gene. In other aspects,
the transactivator T gene driven by transactivator T dependent
promoters is located in an independent locus not containing the
hrcA gene.
[0214] In some aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an ispA gene under
the control of an HrcA repressor protein produce less than about
1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%,
40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any percentages in between these values, of the concentration of
GPP and/or FPP in comparison to the concentration of these
molecules in cells that do not comprise an ispA gene under the
control of an HrcA repressor protein. In another aspect,
recombinant cells that have been engineered to produce isoprene
comprising one or more heterologous nucleic acids encoding one or
members of the MVA pathway and an ispA gene under the control of an
HrcA repressor protein produce less than about 1%, 2%, 3%, 4%, 5%,
6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%,
70%, 80%, 90%, or 100%, inclusive, including any percentages in
between these values, of the concentration of GPP and/or FPP in
comparison to the concentration of these molecules in recombinant
cells that comprise one or more heterologous nucleic acids encoding
one or more members of the MVA pathway but that do not comprise an
ispA gene under the control of an HrcA repressor protein. In some
aspects, recombinant cells (such as any of the recombinant cells
disclosed herein) expressing an ispA gene under the control of an
HrcA repressor protein produce less than about 1%, 2%, 3%, 4%, 5%,
6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%,
70%, 80%, 90%, or 100%, inclusive, including any percentages in
between these values, of the concentration of isoprenoids in
comparison to the concentration of these molecules in cells that do
not comprise an ispA gene under the control of an HrcA repressor
protein. In other aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an ispA gene under
the control of an HrcA repressor protein exhibit any of 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 100%, inclusive, including any percentages
in between these values, improved viability in comparison to the
viability of cells that do not comprise an ispA gene under the
control of an HrcA repressor protein. In another aspect,
recombinant cells that have been engineered to produce isoprene
comprising one or more heterologous nucleic acids encoding one or
members of the MVA pathway and an ispA gene under the control of an
HrcA repressor protein can exhibit any of about 5%, 10%, 15%, 20%,
25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%,
90%, 95%, or 100%, inclusive, including any percentages in between
these values, improved viability in comparison to the viability of
cells that comprise one or more heterologous nucleic acids encoding
one or more members of the MVA pathway but that do not comprise an
ispA gene under the control of an HrcA repressor protein.
Temporally-Regulated Decreased Expression Via Xylose-Regulated
Expression of ispA
[0215] Regulated gene expression mediated by carbon source
availability is another scalable alternative to controlling ispA
gene expression within a production host (for example, an E. coli
production host). Such a method offers the ability to provide
relatively normal and/or sufficient levels of ispA gene expression
required for healthy robust fast growing cells, allowing quick
biomass placement. In addition, such a method offers the ability to
restrict expression of ispA during glucose-supported isoprene
production when FPP synthase activity is believed to be detrimental
to cell viability, resulting in reduced yield of isoprene produced
from glucose.
[0216] Consequently, in some aspects, any of the recombinant cells
described herein can comprise an ispA gene having decreased
functional activity, wherein the functional activity of the ispA
gene is decreased by placing the ispA gene under direct control of
a xylose-regulated promoter. In some aspects, ispA expression in
recombinant cell (such as a recombinant E. coli cell) is placed
under the direct control of an endogenous xylA or xylF promoters or
under control of any promoter that is positively influence by
D-xylose and negatively influenced by glucose within the
recombinant cell. This is accomplished by deleting the endogenous
ispA gene and substituting a heterologous ispA under the control of
either the xylA or xylF D-xylose-responsive promoters. The
divergent xylA-xylF promoters of E. coli and their positive
regulation via D-xylose and the transcriptional activator XylR as
well as their negative regulation by glucose and catabolite
repression have been described (S. Song and C. Park J. Bacterial.
1997, 179(22):7025-7032). In some aspects, ispA gene expression is
governed positively by the availability of xylose in the absence of
glucose and negatively by the presence of glucose. In some aspects,
the xylose-inducible ispA locus is present within the chromosome of
the recombinant cell (such as a recombinant E. coli cell), but,
alternatively, may also be encoded on an extrachromosomal
nucleotide sequence such as a plasmid. Construction of the
xylose-inducible ispA construct and its introduction into the
isoprene producing E. coli host can be performed using standard
molecular and microbiology techniques (J. Sambrook, E. F. Fritsch,
and T. Maniatis Cold Spring Harbor Laboratory Press, NY. 1989).
[0217] In some aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an ispA gene under
the control of an xylose-inducible promoter produce less than about
1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%,
40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including
any percentages in between these values, of the concentration of
GPP and/or FPP in comparison to the concentration of these
molecules in cells that do not comprise an ispA gene under the
control of an xylose-inducible promoter. In another aspect,
recombinant cells that have been engineered to produce isoprene
comprising one or more heterologous nucleic acids encoding one or
members of the MVA pathway and an ispA gene under the control of an
xylose-inducible promoter produce less than about 1%, 2%, 3%, 4%,
5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
60%, 70%, 80%, 90%, or 100%, inclusive, including any percentages
in between these values, of the concentration of GPP and/or FPP in
comparison to the concentration of these molecules in recombinant
cells that comprise one or more heterologous nucleic acids encoding
one or more members of the MVA pathway but that do not comprise an
ispA gene under the control of an xylose-inducible promoter. In
some aspects, recombinant cells (such as any of the recombinant
cells disclosed herein) expressing an ispA gene under the control
of an xylose-inducible promoter produce less than about 1%, 2%, 3%,
4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including any
percentages in between these values, of the concentration of
isoprenoids in comparison to the concentration of these molecules
in cells that do not comprise an ispA gene under the control of an
xylose-inducible promoter. In other aspects, recombinant cells
(such as any of the recombinant cells disclosed herein) expressing
an ispA gene under the control of an xylose-inducible promoter
exhibit any of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%, inclusive,
including any percentages in between these values, improved
viability in comparison to the viability of cells that do not
comprise an ispA gene under the control of an xylose-inducible
promoter. In another aspect, recombinant cells that have been
engineered to produce isoprene comprising one or more heterologous
nucleic acids encoding one or members of the MVA pathway and an
ispA gene under the control of an xylose-inducible promoter can
exhibit any of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%,
inclusive, including any percentages in between these values,
improved viability in comparison to the viability of cells that
comprise one or more heterologous nucleic acids encoding one or
more members of the MVA pathway but that do not comprise an ispA
gene under the control of an xylose-inducible promoter.
Decreased FPP Synthase Activity
[0218] In some aspects, the functional activity of the ispA gene is
decreased by decreasing the activity of the IspA protein, FPP
synthase. This can include inhibiting the translation of the IspA
mRNA or by degrading FPP synthase itself through any number of
methods as described herein.
Translational Fusion of the IspA Protein with a Proteolytic Tag
[0219] In some aspects of any of the recombinant cells described
herein, FPP synthase is targeted for proteolytic degradation by
engineering a DNA sequence into the ispA gene which encodes an 11
amino acid protein tag (Andersen et al., Appl Environ Microbiol.,
1998, 64(6), 2240-46). The proteolytic tmRNA tag then targets FPP
synthase for degradation in host cells. In some aspects, the
proteolytic tag is fused to the C-terminus of the FPP synthase
protein. In other aspects, the proteolytic tag is fused to the
N-terminus of the FPP synthase protein.
[0220] In some aspects, recombinant cells (such as any of the
recombinant cells disclosed herein) expressing an FPP synthase
protein fused to a proteolytic tag produce less than about 1%, 2%,
3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 60%, 70%, 80%, 90%, or 100%, inclusive, including any
percentages in between these values, of the concentration of GPP
and/or FPP in comparison to the concentration of these molecules in
cells that do not comprise an FPP synthase protein fused to a
proteolytic tag. In another aspect, recombinant cells (such as any
of the recombinant cells disclosed herein) expressing an FPP
synthase protein fused to a proteolytic tag that have been
engineered to produce isoprene comprising one or more heterologous
nucleic acids encoding one or members of the MVA pathway produce
less than about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%,
25%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%,
inclusive, including any percentages in between these values, of
the concentration of GPP and/or FPP in comparison to the
concentration of these molecules in recombinant cells that comprise
one or more heterologous nucleic acids encoding one or more members
of the MVA pathway but do not comprise an FPP synthase protein
fused to a proteolytic tag. In some aspects, recombinant cells
(such as any of the recombinant cells disclosed herein) expressing
an FPP synthase protein fused to a proteolytic tag produce less
than about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%,
30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 90%, or 100%, inclusive,
including any percentages in between these values, of the
concentration of isoprenoids in comparison to the concentration of
these molecules in cells that do not comprise an FPP synthase
protein fused to a proteolytic tag. In other aspects, recombinant
cells (such as any of the recombinant cells disclosed herein)
expressing an FPP synthase protein fused to a proteolytic tag
exhibit any of 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%, inclusive,
including any percentages in between these values, improved
viability in comparison to the viability of cells that do not
comprise an IspA protein fused to a proteolytic tag. In another
aspect, recombinant cells (such as any of the recombinant cells
disclosed herein) expressing an FPP synthase protein fused to a
proteolytic tag comprising one or more heterologous nucleic acids
encoding one or members of the MVA pathway and an ispA gene can
exhibit any of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%,
inclusive, including any percentages in between these values,
improved viability in comparison to the viability of cells that
comprise one or more heterologous nucleic acids encoding one or
more members of the MVA pathway but that do not comprise an FPP
synthase protein fused to a proteolytic tag.
Decreased IspA Protein Expression Via the Use of Antisense mRNA and
Ribosomal Binding Mutations
[0221] In some aspects, antisense mRNA directed towards ispA mRNA
is used to prevent the translation of ispA mRNA into IspA protein
and result in decreased IspA protein activity. Antisense is well
known in the art and has been used in E. coli, among other
organisms, to reduce the production of molecules such as acetate
(Kim J. and Cha H. J., Biotech Bioeng., 2003, 83:841-853) or to
engineer a catalase knockout phenotype (Chan E. et al., J. Exp.
Microbiol. Immunol., 2010, 14:127-134). Design of antisense
constructs targeted to the ispA gene of E. coli can be prepared
using methods described by Shao Y. et al., Nucleic Acids Res.,
2006, 34:5660-5669. The antisense RNA molecules can be stabilized
using paired termini (Nakashima N. et al., Nucleic Acids Res.,
2006, 34: e138). In some aspects, the antisense oligonucleotide is
about 150 by long. Decreased translation of ispA mRNA due to
antisense mRNA treatment can be measured by any means known in the
art including, but not limited to, enzyme activity assays, Western
Blot, Northern Blot, or RT-PCR.
[0222] In other aspects, IspA protein activity is decreased through
the introduction of one or more mutations into one or more
ribosomal binding sites located in the ispA mRNA molecule.
Introduction of ribosomal-binding mutations interferes or abolishes
the translation of the IspA mRNA leading to decreased IspA protein
activity. Decreased translation of ispA mRNA due to the
introduction of one or more mutations into one or more ribosomal
binding sites located in the ispA mRNA molecule can be measured by
any means known in the art including, but not limited to, enzyme
activity assays or Western Blot.
Exemplary Host Cells
[0223] One of skill in the art will recognize that expression
vectors are designed to contain certain components which optimize
gene expression for certain host strains. Such optimization
components include, but are not limited to origin of replication,
promoters, and enhancers. The vectors and components referenced
herein are described for exemplary purposes and are not meant to
narrow the scope of the invention.
[0224] Any microorganism or progeny thereof can be used to express
any of the genes (heterologous or endogenous) described herein.
Bacteria cells, including gram positive or gram negative bacteria
can be used to express any of the genes described herein. In
particular, the genes described herein can be expressed in any one
of E. coli, P. citrea, B. subtilis, B. licheniformis, B. lentus, B.
brevis, B. stearothermophilus, B. alkalophilus, B.
amyloliquefaciens, B. clausii, B. halodurans, B. megaterium, B.
coagulans, B. circulans, B. lautus, B. thuringiensis, S. albus, S.
lividans, S. coelicolor, S. griseus, Pseudomonas sp.,
Corynebacteria sp., P. alcaligenes, and L. acidophilus cells.
[0225] There are numerous types of anaerobic cells that can be used
as host cells in the compositions and methods of the present
invention. In one aspect of the invention, the cells described in
any of the compositions or methods described herein are obligate
anaerobic cells and progeny thereof. Obligate anaerobes typically
do not grow well, if at all, in conditions where oxygen is present.
It is to be understood that a small amount of oxygen may be
present, that is, there is some tolerance level that obligate
anaerobes have for a low level of oxygen. In one aspect, obligate
anaerobes engineered to produce isoprene can serve as host cells
for any of the methods and/or compositions described herein and are
grown under substantially oxygen-free conditions, wherein the
amount of oxygen present is not harmful to the growth, maintenance,
and/or fermentation of the anaerobes.
[0226] In another aspect of the invention, the host cells described
and/or used in any of the compositions or methods described herein
are facultative anaerobic cells and progeny thereof. Facultative
anaerobes can generate cellular ATP by aerobic respiration (e.g.,
utilization of the TCA cycle) if oxygen is present. However,
facultative anaerobes can also grow in the absence of oxygen. This
is in contrast to obligate anaerobes which die or grow poorly in
the presence of greater amounts of oxygen. In one aspect,
therefore, facultative anaerobes can serve as host cells for any of
the compositions and/or methods provided herein and can be
engineered to produce isoprene. Facultative anaerobic host cells
can be grown under substantially oxygen-free conditions, wherein
the amount of oxygen present is not harmful to the growth,
maintenance, and/or fermentation of the anaerobes, or can be
alternatively grown in the presence of greater amounts of
oxygen.
[0227] The host cell can additionally be a filamentous fungal cell
and progeny thereof. (See, e.g., Berka & Barnett, Biotechnology
Advances, (1989), 7(2):127-154). In some aspects, the filamentous
fungal cell can be any of Trichoderma longibrachiatum, T. viride,
T. koningii, T. harzianum, Penicillium sp., Humicola insolens, H.
lanuginose, H. grisea, Chrysosporium sp., C. lucknowense,
Gliocladium sp., Aspergillus sp., such as A. oryzae, A. niger, A
sojae, A. japonicus, A. nidulans, or A. awamori, Fusarium sp., such
as F. roseum, F. graminum F. cerealis, F. oxysporuim, or F.
venenatum, Neurospora sp., such as N. crassa, Hypocrea sp., Mucor
sp., such as M. miehei, Rhizopus sp. or Emericella sp. In some
aspects, the fungus is A. nidulans, A. awamori, A. oryzae, A.
aculeatus, A. niger, A. japonicus, T. reesei, T. viride, F.
oxysporum, or F. solani. In certain embodiments, plasmids or
plasmid components for use herein include those described in U.S.
patent pub. No. US 2011/0045563.
[0228] The host cell can also be a yeast, such as Saccharomyces
sp., Schizosaccharomyces sp., Pichia sp., or Candida sp. In some
aspects, the Saccharomyces sp. is Saccharomyces cerevisiae (See,
e.g., Romanos et al., Yeast, (1992), 8(6):423-488). In certain
embodiments, plasmids or plasmid components for use herein include
those described in U.S. Pat. No. 7,659,097 and U.S. patent pub. No.
US 2011/0045563.
[0229] The host cell can additionally be a species of algae, such
as a green algae, red algae, glaucophytes, chlorarachniophytes,
euglenids, chromista, or dinoflagellates. (See, e.g., Saunders
& Warmbrodt, "Gene Expression in Algae and Fungi, Including
Yeast," (1993), National Agricultural Library, Beltsville, Md.). In
certain embodiments, plasmids or plasmid components for use herein
include those described in U.S. Patent Pub. No. US 2011/0045563. In
some aspects, the host cell is a cyanobacterium, such as
cyanobacterium classified into any of the following groups based on
morphology: Chlorococcales, Pleurocapsales, Oscillatoriales,
Nostocales, or Stigonematales (See, e.g., Lindberg et al., Metab.
Eng., (2010) 12(1):70-79). In certain embodiments, plasmids or
plasmid components for use herein include those described in U.S.
patent pub. No. US 2010/0297749; US 2009/0282545 and Intl. Pat.
Appl. No. WO 2011/034863.
[0230] E. coli cells can be used as a host cell in the compositions
and methods described herein. In one aspect, the host cell is a
recombinant cell of an Escherichia coli (E. coli) strain, or
progeny thereof, capable of producing mevalonate that expresses one
or more heterologous nucleic acids described herein. In other
aspects, the E. coli cells are in culture.
Vectors
[0231] Suitable vectors can be used for any of the compositions and
methods described herein. For example, suitable vectors can be used
to optimize the expression of one or more copies of a gene encoding
a HMG-CoA reductase, an isoprene synthase, and/or one or more
non-thiolase MVA pathway polypeptides. In some aspects, the vector
contains a selective marker. Examples of selectable markers
include, but are not limited to, antibiotic resistance nucleic
acids (e.g., kanamycin, ampicillin, carbenicillin, gentamicin,
hygromycin, phleomycin, bleomycin, neomycin, or chloramphenicol)
and/or nucleic acids that confer a metabolic advantage, such as a
nutritional advantage on the host cell. In some aspects, one or
more copies of HMG-CoA reductase, an isoprene synthase, and/or one
or more non-thiolase MVA pathway polypeptides nucleic acid(s)
integrate into the genome of host cells without a selective marker.
Any one of the vectors characterized or used in the Examples of the
present disclosure can be used.
Transformation Methods
[0232] Nucleic acids encoding acetoacetyl-CoA synthase, an enzyme
that produces acetoacetyl-CoA synthase from malonyl-CoA and
acetyl-CoA, non-thiolase MVA pathway polypeptides, DXP pathway
polypeptides, isoprene synthase polypeptides, IDI, and any other
enzyme needed to produce isoprene can be introduced into host cells
(e.g., a plant cell, a fungal cell, a yeast cell, or a bacterial
cell) by any technique known to one of the skill in the art.
[0233] Standard techniques for introduction of a DNA construct or
vector into a host cell, such as transformation, electroporation,
nuclear microinjection, transduction, transfection (e.g.,
lipofection mediated or DEAE-Dextrin mediated transfection or
transfection using a recombinant phage virus), incubation with
calcium phosphate DNA precipitate, high velocity bombardment with
DNA-coated microprojectiles, and protoplast fusion can be used.
General transformation techniques are known in the art (See, e.g.,
Current Protocols in Molecular Biology (F. M. Ausubel et al. (eds.)
Chapter 9, 1987; Sambrook et al., Molecular Cloning: A Laboratory
Manual, 3.sup.rd ed., Cold Spring Harbor, 2001; and Campbell et
al., Curr. Genet. 16:53-56, 1989). The introduced nucleic acids can
be integrated into chromosomal DNA or maintained as
extrachromosomal replicating sequences. Transformants can be
selected by any method known in the art. Suitable methods for
selecting transformants are described in International Publication
No. WO 2009/076676, U.S. patent application Ser. No. 12/335,071 (US
Publ. No. 2009/0203102), WO 2010/003007, U.S. Patent Appl. Publ.
No. 2010/0048964, WO 2009/132220, and U.S. Patent Appl. Publ. No.
2010/0003716.
[0234] In one embodiment, a bacterium such as Escherichia coli is
used as a host. In this embodiment, an expression vector can be
selected and/or engineered to be able to autonomously replicate in
such bacterium. Promoters, a ribosome binding sequence,
transcription termination sequence(s) can also be included in the
expression vector, in addition to the genes listed herein.
Optionally, an expression vector may contain a gene that controls
promoter activity.
[0235] Any promoter may be used as long as it can be expressed in a
host such as Escherichia coli. Examples of such promoter that can
be used include a trp promoter, an lac promoter, a PL promoter, a
PR promoter, and the like from Escherichia coli, and a T7 promoter
from a phage. Further, an artificially designed or modified
promoter such as a tac promoter may be used.
[0236] A method for introduction of an expression vector is not
particularly limited as long as DNA is introduced into a bacterium
thereby. Examples thereof include a method using calcium ions
(Cohen, S, N., et al.: Proc. Natl. Acad. Sci., USA, 69:2110-2114
(1972) and an electroporation method.
[0237] When a yeast is used as a host, Saccharomyces cerevisiae,
Schizosaccharomyces pombe, Pichia pastoris, or the like can be
used. In this case, a promoter is not particularly limited as long
as it can be expressed in yeast. Examples thereof include a gall
promoter, a gal10 promoter, a heat-shock protein promoter, an
MF.alpha.1 promoter, a PHOS promoter, a PGK promoter, a GAP
promoter, an ADH promoter, and an AOX1 promoter.
[0238] A method for introducing a recombinant vector into yeast is
not particularly limited as long as DNA is introduced into yeast
thereby. Examples thereof include the electroporation method
(Becker, D. M., et al. Methods. Enzymol., 194: 182-187 (1990)), the
spheroplast method (Hinnen, A. et al.: Proc. Natl. Acad. Sci., USA,
75: 1929-1933 (1978)), and the lithium acetate method (Itoh, H.: J.
Bacteriol., 153: 163-168 (1983)).
Exemplary Cell Culture Media
[0239] As used herein, the terms "minimal medium" or "minimal
media" refer to growth medium containing the minimum nutrients
possible for cell growth, generally, but not always, without the
presence of one or more amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, or more amino acids). Minimal medium typically contains: (1)
a carbon source for bacterial growth; (2) various salts, which can
vary among bacterial species and growing conditions; and (3) water.
The carbon source can vary significantly, from simple sugars like
glucose to more complex hydrolysates of other biomass, such as
yeast extract, as discussed in more detail below. The salts
generally provide essential elements such as magnesium, nitrogen,
phosphorus, and sulfur to allow the cells to synthesize proteins
and nucleic acids. Minimal medium can also be supplemented with
selective agents, such as antibiotics, to select for the
maintenance of certain plasmids and the like. For example, if a
microorganism is resistant to a certain antibiotic, such as
ampicillin or tetracycline, then that antibiotic can be added to
the medium in order to prevent cells lacking the resistance from
growing. Medium can be supplemented with other compounds as
necessary to select for desired physiological or biochemical
characteristics, such as particular amino acids and the like.
[0240] Any minimal medium formulation can be used to cultivate the
host cells. Exemplary minimal medium formulations include, for
example, M9 minimal medium and TM3 minimal medium. Each liter of M9
minimal medium contains (1) 200 ml sterile M9 salts (64 g
Na.sub.2HPO.sub.4-7H.sub.2O, 15 g KH.sub.2PO.sub.4, 2.5 g NaCl, and
5.0 g NH.sub.4Cl per liter); (2) 2 ml of 1 M MgSO.sub.4 (sterile);
(3) 20 ml of 20% (w/v) glucose (or other carbon source); and (4)
100 .mu.l of 1 M CaCl.sub.2 (sterile). Each liter of TM3 minimal
medium contains (1) 13.6 g K.sub.2HPO.sub.4; (2) 13.6 g
KH.sub.2PO.sub.4; (3) 2 g MgSO.sub.4.7H.sub.2O; (4) 2 g Citric Acid
Monohydrate; (5) 0.3 g Ferric Ammonium Citrate; (6) 3.2 g
(NH.sub.4).sub.2SO.sub.4; (7) 0.2 g yeast extract; and (8) 1 ml of
1000.times. Trace Elements solution; pH is adjusted to .about.6.8
and the solution is filter sterilized. Each liter of 1000.times.
Trace Elements contains: (1) 40 g Citric Acid Monohydrate; (2) 30 g
MnSO.sub.4*H.sub.2O; (3) 10 g NaCl; (4) 1 g FeSO.sub.4*7H.sub.2O;
(4) 1 g CoCl.sub.2*6H.sub.2O; (5) 1 g ZnSO.sub.4*7H.sub.2O; (6) 100
mg CuSO.sub.4*5H.sub.2O; (7) 100 mg H.sub.3BO.sub.3; and (8) 100 mg
NaMoO.sub.4*2H.sub.2O; pH is adjusted to .about.3.0.
[0241] An additional exemplary minimal media includes (1) potassium
phosphate K.sub.2HPO.sub.4, (2) Magnesium Sulfate
MgSO.sub.4*7H.sub.2O, (3) citric acid monohydrate
C.sub.6H.sub.8O.sub.7*H.sub.2O, (4) ferric ammonium citrate
NH.sub.4FeC.sub.6H.sub.5O.sub.7, (5) yeast extract (from
biospringer), (6) 1000.times. Modified Trace Metal Solution, (7)
sulfuric acid 50% w/v, (8) foamblast 882 (Emerald Performance
Materials), and (9) Macro Salts Solution 3.36 ml All of the
components are added together and dissolved in deionized H.sub.2O
and then heat sterilized. Following cooling to room temperature,
the pH is adjusted to 7.0 with ammonium hydroxide (28%) and q.s. to
volume. Vitamin Solution and spectinomycin are added after
sterilization and pH adjustment.
[0242] Any carbon source can be used to cultivate the host cells.
The term "carbon source" refers to one or more carbon-containing
compounds capable of being metabolized by a host cell or organism.
For example, the cell medium used to cultivate the host cells can
include any carbon source suitable for maintaining the viability or
growing the host cells. In some aspects, the carbon source is a
carbohydrate (such as monosaccharide, disaccharide,
oligosaccharide, or polysaccharides), or invert sugar (e.g.,
enzymatically treated sucrose syrup). In one aspect, the host cells
are initially cultured in a medium (such as a TM3 medium)
containing D-xylose as a carbon source during the linear growth
phase of fermentation. In another aspect, the carbon source is
changed from D-xylose to glucose once the host cells reach the
isoprene-production phase of fermentation.
[0243] In some aspects, the carbon source includes yeast extract or
one or more components of yeast extract. In some aspects, the
concentration of yeast extract is 0.1% (w/v), 0.09% (w/v), 0.08%
(w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03%
(w/v), 0.02% (w/v), or 0.01% (w/v) yeast extract. In some aspects,
the carbon source includes both yeast extract (or one or more
components thereof) and another carbon source, such as glucose.
[0244] Exemplary monosaccharides include glucose and fructose;
exemplary oligosaccharides include lactose and sucrose, and
exemplary polysaccharides include starch and cellulose. Exemplary
carbohydrates include C6 sugars (e.g., fructose, mannose,
galactose, or glucose) and C5 sugars (e.g., xylose or
arabinose).
Exemplary Cell Culture Conditions
[0245] Materials and methods suitable for the maintenance and
growth of the recombinant cells of the invention are described
infra, e.g., in the Examples section. Other materials and methods
suitable for the maintenance and growth of bacterial cultures are
well known in the art. Exemplary techniques can be found in
International Publication No. WO 2009/076676, U.S. patent
application Ser. No. 12/335,071 (U.S. Publ. No. 2009/0203102), WO
2010/003007, US Publ. No. 2010/0048964, WO 2009/132220, US Publ.
No. 2010/0003716, Manual of Methods for General Bacteriology
Gerhardt et al., eds), American Society for Microbiology,
Washington, D.C. (1994) or Brock in Biotechnology: A Textbook of
Industrial Microbiology, Second Edition (1989) Sinauer Associates,
Inc., Sunderland, Mass. In some aspects, the cells are cultured in
a culture medium under conditions permitting the expression of one
or more isoprene synthase, one or more DXP pathway polypeptides,
one or more MVA pathway polypeptides, IDI, or PGL polypeptides
encoded by a nucleic acid inserted into the host cells.
[0246] Standard cell culture conditions can be used to culture the
cells (see, for example, WO 2004/033646 and references cited
therein). In some aspects, cells are grown and maintained at an
appropriate temperature, gas mixture, and pH (such as at about
20.degree. C. to about 37.degree. C., at about 6% to about 84%
CO.sub.2, and at a pH between about 5 to about 9). In some aspects,
cells are grown at 35.degree. C. in an appropriate cell medium. In
some aspects, the pH ranges for fermentation are between about pH
5.0 to about pH 9.0 (such as about pH 6.0 to about pH 8.0 or about
6.5 to about 7.0). Cells can be grown under aerobic conditions
based on the requirements of the host cells. In addition, more
specific cell culture conditions can be used to culture the cells.
For example, in some embodiments, the bacterial cells (such as E.
coli cells) express one or more heterologous nucleic acids
described herein under the control of a strong promoter in a low to
medium copy plasmid and are cultured at 34.degree. C.
[0247] Standard culture conditions and modes of fermentation, such
as batch, fed-batch, or continuous fermentation that can be used
are described in International Publication No. WO 2009/076676, U.S.
patent application Ser. No. 12/335,071 (U.S. Publ. No.
2009/0203102), WO 2010/003007, US Publ. No. 2010/0048964, WO
2009/132220, US Publ. No. 2010/0003716. Batch and Fed-Batch
fermentations are common and well known in the art and examples can
be found in Brock, Biotechnology: A Textbook of Industrial
Microbiology, Second Edition (1989) Sinauer Associates, Inc.
[0248] In some aspects, the cells are cultured under limited
glucose conditions. By "limited glucose conditions" is meant that
the amount of glucose that is added is less than or about 105%
(such as about 100%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, or
10%) of the amount of glucose that is consumed by the cells. In
particular aspects, the amount of glucose that is added to the
culture medium is approximately the same as the amount of glucose
that is consumed by the cells during a specific period of time. In
some aspects, the rate of cell growth is controlled by limiting the
amount of added glucose such that the cells grow at the rate that
can be supported by the amount of glucose in the cell medium. In
some aspects, glucose does not accumulate during the time the cells
are cultured. In various aspects, the cells are cultured under
limited glucose conditions for greater than or about 1, 2, 3, 5,
10, 15, 20, 25, 30, 35, 40, 50, 60, or 70 hours. In various
aspects, the cells are cultured under limited glucose conditions
for greater than or about 5, 10, 15, 20, 25, 30, 35, 40, 50, 60,
70, 80, 90, 95, or 100% of the total length of time the cells are
cultured. While not intending to be bound by any particular theory,
it is believed that limited glucose conditions can allow more
favorable regulation of the cells.
[0249] In some aspects, the recombinant (e.g., bacterial) cells are
grown in batch culture. The cells can also be grown in fed-batch
culture or in continuous culture. Additionally, the cells can be
cultured in minimal medium, including, but not limited to, any of
the minimal media described above. The minimal medium can be
further supplemented with 1.0% (w/v) glucose, or any other six
carbon sugar, or less. Specifically, the minimal medium can be
supplemented with 1% (w/v), 0.9% (w/v), 0.8% (w/v), 0.7% (w/v),
0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v), 0.2% (w/v), or 0.1%
(w/v) glucose. Additionally, the minimal medium can be supplemented
0.1% (w/v) or less yeast extract. Specifically, the minimal medium
can be supplemented with 0.1% (w/v), 0.09% (w/v), 0.08% (w/v),
0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v), 0.03% (w/v),
0.02% (w/v), or 0.01% (w/v) yeast extract. Alternatively, the
minimal medium can be supplemented with 1% (w/v), 0.9% (w/v), 0.8%
(w/v), 0.7% (w/v), 0.6% (w/v), 0.5% (w/v), 0.4% (w/v), 0.3% (w/v),
0.2% (w/v), or 0.1% (w/v) glucose and with 0.1% (w/v), 0.09% (w/v),
0.08% (w/v), 0.07% (w/v), 0.06% (w/v), 0.05% (w/v), 0.04% (w/v),
0.03% (w/v), 0.02% (w/v), or 0.01% (w/v) yeast extract.
Methods of Using the Recombinant Cells to Produce Isoprene
[0250] The invention contemplates methods of producing isoprene by
culturing any of the recombinant cells described herein under
reduced oxygen inlet levels and/or the other culturing conditions
as those disclosed herein.
Reduced Oxygen Inlet Levels
[0251] Isoprene can be produced by culturing the recombinant cells
described herein under reduced oxygen inlet levels. Measurement of
oxygen inlet in the fermentator is known to one of skill in the
art. For example, oxygen sensors can be placed near or at the inlet
where one or more types of gases are introduced into the fermentor.
The different oxygen levels can be monitored and different types of
calculation (e.g., averaging) can be done to determine oxygen
levels. Adjustments can be made so that the desired oxygen levels
are reached and/or maintained during fermentation. One
consideration for production of isoprene is the flammability and
explosive capability during production and/or recovery. Ambient air
contains about 21% oxygen, however, this level of oxygen in the
off-gas can be hazardous due to safety concerns for explosions,
fires and other flammability considerations. Accordingly, for any
of the aspect herein, care should be taken to keep the levels of
oxygen in the off-gas within safe operating ranges, such those
promulgated by NFPA 69 and/or as taught in WO 2010/003007, the
contents of which are specifically incorporated for teaching for
safe operating ranges and flammability levels.
[0252] Increased performance of the recombinant cells to produce
isoprene can be achieved when the fermentation run is conducted at
reduced oxygen inlet levels. In one aspect, the reduced oxygen
inlet level can be between about 5% to about 15% oxygen. In another
aspect, the reduced oxygen inlet level can be between about 5% to
about 11% oxygen. In another aspect, the reduced oxygen inlet level
can be between about 7% to about 10% oxygen. In another aspect, the
reduced oxygen inlet level can be between about 7% to about 10%
oxygen. In another aspect, the reduced oxygen inlet level can be
between about 7% to about 9% oxygen. In other aspects, the reduced
oxygen inlet level can be about 5%, 5.1%, 5.2%, 5.3%, 5.4%, 5.5%,
5.6%, 5.7%, 5.8%, 5.9%, 6%, 6.1%, 6.2%, 6.3%, 6.4%, 6.5%, 6.6%,
6.7%, 6.8%, 6.9%, 7%, 7.1%, 7.2% 7.3%, 7.4%, 7.5%, 7.6%, 7.7%,
7.8%, 7.9%, 8%, 8.1%, 8.2%, 8.3%, 8.4%, 8.5%, 8.6%, 8.7%, 8.8%,
8.9%, 9%, 9.1%, 9.2%, 9.3%, 9.4%, 9.5%, 9.6%, 9.7%, 9.8%, 9.9% or
10% oxygen. In one embodiment, the reduced oxygen inlet level is
about 7.7% oxygen. In one embodiment, the reduced oxygen inlet
level is about 9.3% oxygen.
[0253] As described herein, the recombinant cells are grown under
reduced oxygen inlet levels. In other aspects, the cells are grown
under atmospheric conditions comprising any of about 4%, 5%, 6%,
7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, or 15%, inclusive, including
any values in between these percentages, oxygen. In other aspects,
the cells are grown under atmospheric conditions comprising any of
about 3-8%, 3.5-8.5%, 4-9%, 4.5-9.5%, 5-10%, 5.5-10.5%, 6-11%, or
6.5-11.5% oxygen. In any of these aspects or embodiments,
regardless of the starting amount of the oxygen inlet, the oxygen
level in the off-gas is kept at a level that is below the buffer
zone set forth by national standards, such as NFPA 69. In other
embodiments, the oxygen level in the off-gas is kept at a level
that is below the flammability zone as by national standards, such
as NFPA 69 and/or as taught in WO 2010/003007.
[0254] Other sources of fermentor inlet vapor can also be used. For
example, one of skill in the art can mix controlled ratios (wt:wt
or v:v) of compressed air that may contain super-ambient, ambient
or sub-ambient levels of oxygen with compressed nitrogen that may
have various levels of impurities including (O.sub.2, CO.sub.2,
Argon and/or other inerts and/or hydrocarbons such as isoprene) to
create a vapor mixture that meets the desired inlet [O.sub.2] vapor
composition.
[0255] These compressed vapors can be produced from air directly or
by using membranes, cryo-separation or electrolysis techniques to
create one or both of the compressed vapors. The individual vapors
can be created and used immediately or one or both streams can be
prepared in advance and stored separately in cylinders, trailers
and/or cryogenic storage tanks or pre-mixed and stored separately
in cylinders, trailers and/or cryogenic storage tanks. The vapor(s)
may be dried to remove moisture and/or filtered to remove solids
and/or biological contaminants prior to introducing the vapor into
the fermentor.
[0256] As noted above, the cells grow in two general phases: (1)
growth phase (such as linear growth phase) where the recombinant
cells propagate and expand in number and (2) fermentation or
production phase, where recombinant the cells are producing
isoprene in commercially relevant amounts (see, e.g., WO
2010/003007, which is incorporated herein for teachings on
commercially relevant amounts of isoprene). In one aspect, isoprene
can be made by culturing recombinant cells that are in the
production phase under reduced oxygen inlet levels as described
herein. In another aspect, isoprene can be made by culturing
recombinant cells that are in the growth phase under reduced oxygen
inlet level as described herein. In another aspect, isoprene can be
made by culturing recombinant cells that have a mix of cells in
both the growth and the production phase under reduced oxygen inlet
level as described herein. In one embodiment, the cell culture is
at least about 99% in production phase. In other embodiments, the
cell culture is at least about 98%, 97%, 96%, 95%, 94%, 93%, 92%,
91%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, and 50% in production
phase. As previously described above, the recombinant cells that
are being cultured under reduced oxygen inlet levels can have
nucleic acids encoding for isoprene synthase, one or more of the
DXP pathway polypeptides, one or more of the MVA pathway
polypeptides. The cells can further contain nucleic acids encoding
for IDI and other engineering steps (e.g., reducing IspA activity)
to make the recombinant cells produce isoprene at an increased
amount as compared with to the same cell without the
engineering.
[0257] In some aspects, the improved method for producing isoprene
using reduced oxygen inlet levels is capable improving production
of isoprene by at least about 5% as compared to using ambient air
or oxygen levels in ambient air (e.g., about 21% oxygen). In other
aspects, the improved production of isoprene is at least about 6%,
7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17% 18%, 19%, or 20%
as compared to using ambient air or oxygen levels in ambient air.
In other aspects, the improved production of isoprene is at least
about 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%,
85%, 90%, 95%, or 100% as compared to using ambient air or oxygen
levels in ambient air. In other aspects, the improved production of
isoprene is at least about 120%, 150%, 175%, 200%, 250% or 300% as
compared to using ambient air or oxygen levels in ambient air.
[0258] In other aspects, isoprene productivity can be affected by
varying the inlet airflow rates. In some aspects, the inlet airflow
rate is between about 8 SLPM and 14 SLPM. In another aspect, the
inlet airflow rate is between about 6 SLPM and 14 SLPM. In another
aspect, the inlet airflow rate is between about 8 SLPM and 12 SLPM.
In another aspect, the inlet airflow rate is about 10 SLPM. In
other aspects, the inlet airflow rate is about 6 SLPM, 7 SLPM, 8
SLPM, 9 SLPM, 10 SLPM, 11 SLPM, 12 SLPM, 13 SLPM, or 14 SLPM.
[0259] As shown in Example 1, the peak instantaneous yield of
isoprene was increased by about 11.6% when 5% oxygen inlet levels
was used as compared to when ambient oxygen levels (.about.21%) was
used. When 7.7% oxygen inlet level was used, peak instantaneous
yield was increased by about 35.8% as compared to when ambient
oxygen level was used. When 9.3% oxygen inlet levels was used, peak
instantaneous yield was increased by about 37.6% as compared to
when ambient oxygen levels was used.
[0260] The peak cumulative mass yield of isoprene was increased by
about 8% when 5% oxygen inlet levels was used as compared to when
ambient oxygen levels (.about.21%) was used. When 7.7% oxygen inlet
level was used, peak cumulative mass yield was increased by about
32.3% as compared to when ambient oxygen level was used. When 9.3%
oxygen inlet levels was used, peak cumulative mass yield was
increased by about 41.7% as compared to when ambient oxygen levels
was used.
[0261] The CPI was increased by about 16.8% when 5% oxygen inlet
levels was used as compared to when ambient oxygen levels
(.about.21%) was used. When 7.7% oxygen inlet level was used, CPI
was increased by about 61% as compared to when ambient oxygen level
was used. When 9.3% oxygen inlet levels was used, CPI was increased
by about 72.6% as compared to when ambient oxygen levels was
used.
[0262] The peak specific productivity was increased by about 39.7%
when 7.7% oxygen inlet levels was used as compared to when ambient
oxygen levels (.about.21%) was used. When 9.3% oxygen inlet levels
was used, peak cumulative mass yield was increased by about 26% as
compared to when ambient oxygen levels was used.
[0263] In another aspect, isoprene can be produced by culturing
recombinant cells comprising an ispA gene having decreased
functional activity and one or more nucleic acids encoding: (a) an
isoprene synthase polypeptide, wherein the isoprene synthase
polypeptide is encoded by a heterologous nucleic acid; and (b) one
or more mevalonate (MVA) pathway polypeptides. In one aspect, one
or more heterologous nucleic acids encoding a HMG-CoA reductase, a
lower MVA pathway polypeptide, and an isoprene synthase polypeptide
can be used. In another aspect, isoprene can be produced by
culturing recombinant cells comprising one or more heterologous
nucleic acids encoding a HMG-CoA reductase and HMG-CoA synthase, a
lower MVA pathway polypeptide, and an isoprene synthase
polypeptide. In some aspects, the recombinant cells described
herein exhibit any of about 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 95%, or 100%, inclusive,
including any value in between these percentages, increased
isoprene production in comparison to cells which do not comprise an
IspA having decreased functional activity. The isoprene can be
produced from any of the cells described herein and according to
any of the methods described herein. Any of the cells can be used
for the purpose of producing isoprene from carbohydrates, including
six carbon sugars such as glucose.
[0264] The cells can further comprise one or more nucleic acid
molecules encoding the lower MVA pathway polypeptide(s) described
above (e.g., MVK, PMK, MVD, and/or IDI) and any of the isoprene
synthase polypeptide(s) described above (e.g. P. alba isoprene
synthase). In some aspects, the recombinant (e.g., bacterial) cells
can be any of the cells described herein. Any of the isoprene
synthases or variants thereof described herein, any of the
bacterial strains described herein, any of the promoters described
herein, and/or any of the vectors described herein can also be used
to produce isoprene using any of the energy sources (e.g. glucose
or any other six carbon sugar) described herein. In some aspects,
the method of producing isoprene further comprises a step of
recovering the isoprene.
[0265] In some aspects, the amount of isoprene produced is measured
at a productivity time point. In some aspects, the productivity for
the cells is about any of the amounts of isoprene disclosed herein.
In some aspects, the cumulative, total amount of isoprene produced
is measured. In some aspects, the cumulative total productivity for
the cells is about any of the amounts of isoprene disclosed
herein.
[0266] In some aspects, any of the cells described herein (for
examples the cells in culture) produce isoprene at greater than
about any of or about any of 1, 10, 25, 50, 100, 150, 200, 250,
300, 400, 500, 600, 700, 800, 900, 1,000, 1,250, 1,500, 1,750,
2,000, 2,500, 3,000, 4,000, 5,000, or more nmole of isoprene/gram
of cells for the wet weight of the cells/hour (nmole/g.sub.wcm/hr).
In some aspects, the amount of isoprene is between about 2 to about
5,000 nmole/g.sub.wcm/hr, such as between about 2 to about 100
nmole/g.sub.wcm/hr, about 100 to about 500 nmole/g.sub.wcm/hr,
about 150 to about 500 nmole/g.sub.wcm/hr, about 500 to about 1,000
nmole/g.sub.wcm/hr, about 1,000 to about 2,000 nmole/g.sub.wcm/hr,
or about 2,000 to about 5,000 nmole/g.sub.wcm/hr. In some aspects,
the amount of isoprene is between about 20 to about 5,000
nmole/g.sub.wcm/hr, about 100 to about 5,000 nmole/g.sub.wcm/hr,
about 200 to about 2,000 nmole/g.sub.wcm/hr, about 200 to about
1,000 nmole/g.sub.wcm/hr, about 300 to about 1,000
nmole/g.sub.wcm/hr, or about 400 to about 1,000
nmole/g.sub.wcm/hr.
[0267] In some aspects, the cells in culture produce isoprene at
greater than or about 1, 10, 25, 50, 100, 150, 200, 250, 300, 400,
500, 600, 700, 800, 900, 1,000, 1,250, 1,500, 1,750, 2,000, 2,500,
3,000, 4,000, 5,000, 10,000, 100,000, or more ng of isoprene/gram
of cells for the wet weight of the cells/hr (ng/g.sub.wcm/h). In
some aspects, the amount of isoprene is between about 2 to about
5,000 ng/g.sub.wcm/h, such as between about 2 to about 100
ng/g.sub.wcm/h, about 100 to about 500 ng/g.sub.wcm/h, about 500 to
about 1,000 ng/g.sub.wcm/h, about 1,000 to about 2,000
ng/g.sub.wcm/h, or about 2,000 to about 5,000 ng/g.sub.wcm/h. In
some aspects, the amount of isoprene is between about 20 to about
5,000 ng/g.sub.wcm/h, about 100 to about 5,000 ng/g.sub.wcm/h,
about 200 to about 2,000 ng/g.sub.wcm/h, about 200 to about 1,000
ng/g.sub.wcm/h, about 300 to about 1,000 ng/g.sub.wcm/h, or about
400 to about 1,000 ng/g.sub.wcm/h.
[0268] In some aspects, the cells in culture produce a cumulative
titer (total amount) of isoprene at greater than about any of or
about any of 1, 10, 25, 50, 100, 150, 200, 250, 300, 400, 500, 600,
700, 800, 900, 1,000, 1,250, 1,500, 1,750, 2,000, 2,500, 3,000,
4,000, 5,000, 10,000, 50,000, 100,000, or more mg of isoprene/L of
broth (mg/L.sub.broth, wherein the volume of broth includes the
volume of the cells and the cell medium). In some aspects, the
amount of isoprene is between about 2 to about 5,000
mg/L.sub.broth, such as between about 2 to about 100
mg/L.sub.broth, about 100 to about 500 mg/L.sub.broth, about 500 to
about 1,000 mg/L.sub.broth, about 1,000 to about 2,000
mg/L.sub.broth, or about 2,000 to about 5,000 mg/L.sub.broth. In
some aspects, the amount of isoprene is between about 20 to about
5,000 mg/L.sub.broth, about 100 to about 5,000 mg/L.sub.broth,
about 200 to about 2,000 mg/L.sub.broth, about 200 to about 1,000
mg/L.sub.broth, about 300 to about 1,000 mg/L.sub.broth, or about
400 to about 1,000 mg/L.sub.broth.
[0269] In some aspects, the isoprene produced by the cells in
culture (such as any of the recombinant cells described herein)
comprises at least about 1, 2, 5, 10, 15, 20, or 25% by volume of
the fermentation offgas. In some aspects, the isoprene comprises
between about 1 to about 25% by volume of the offgas, such as
between about 5 to about 15%, about 15 to about 25%, about 10 to
about 20%, or about 1 to about 10%.
[0270] In some aspects, the cells in culture (such as any of the
recombinant cells described herein) produce any of about 5%, 10%,
15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%,
80%, 85%, 90%, 95%, or 100%, inclusive, including any percentages
in between these values, higher cumulative isoprene yield on
glucose in comparison to cells that do not comprise decreased IspA
functional activity. In another aspect, the cells in culture (such
as any of the recombinant cells described herein) produce any of
about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%,
65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%, inclusive, including
any percentages in between these values, greater isoprene
productivity in comparison to cells that do not comprise decreased
IspA functional activity. In other aspects, the cells in culture
(such as any of the recombinant cells described herein) produce any
of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%,
65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%, inclusive, including
any percentages in between these values, greater isoprene peak
specific productivity in comparison to cells that do not comprise
decreased IspA functional activity. In some aspects, the cells in
culture (such as any of the recombinant cells described herein)
produce any of about 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100%,
inclusive, including any percentages in between these values,
greater cell isoprene productivity index in comparison to cells
that do not comprise decreased IspA functional activity.
Exemplary Purification Methods
[0271] In some aspects, any of the methods described herein further
include a step of recovering isoprene produced by any of the
recombinant cells disclosed herein. In some aspects, the isoprene
is recovered by absorption stripping (See, e.g., U.S. Patent
Application Publication No. 2011/0178261 A1). In some aspects, any
of the methods described herein further include a step of
recovering the heterologous polypeptide.
[0272] Suitable purification methods are described in more detail
in U.S. Patent Application Publication No. US2010/0196977 A1.
[0273] Throughout this specification, various patents, patent
applications and other types of publications (e.g., journal
articles) are referenced. The disclosure of all patents, patent
applications, and publications cited herein are hereby incorporated
by reference in their entirety for all purposes.
[0274] The invention can be further understood by reference to the
following examples, which are provided by way of illustration and
are not meant to be limiting.
EXAMPLES
General Information
Strains Used
TABLE-US-00001 [0275] Strain name Genotype Parent Plasmids CMP451
BL21 pgl PL.2mKKDyI None GI 1.2 gltA CMP457 BL21 pgl+ PL.2 mKKDyI
CMP451 pDW34, GI1.2 gltA, MCM82 pTrc(MEA)alba_mMVK,
pCLPtrcUpper_Efaecalis CMP561 HMB GI1.2gltA, pDW72, pCLPtrcUpper,
pTrc(MEA pMCM82 G491S)alba mMVK CMP596 BL21 pgl PL.2mKKDyI CMP451
None GI 1.2 gltA ldhA::Kan CMP722 BL21 pgl PL.2mKKDyI CMP596 None
GI 1.2 gltA ldhA CMP876 BL21 pgl PL.2mK*KDyI CMP451 None GI 1.2
gltA ldhA CMP882 BL21 pgl PL.2mKKDyI CMP451 pTrcHis2B, GI 1.2 gltA,
pTrcHis2B, pCL1920 pCL1920 CMP884 BL21 pgl PL.2mK*KDyI CMP451
pTrcHis2B, GI 1.2 gltA, pTrcHis2B, pCL1920 pCL1920 CMP981 BL21 pgl
PL.2mKKDyI CMP451 None GI1.2gltA yhfSpKD3IspAyhfS CMP992 BL21 pgl
PL.2mKKDyI CMP981 None GI1.2gltA yhfSFRTIspAyhfS CMP1018 BL21 pgl
PL.2mKKDyI CMP992 None GI1.2gltA yhfSFRTIspAyhfS thipKD3truncIspA
CMP1024 BL21 pgl PL.2mKKDyI CMP722 None GI 1.2 gltA ldhA
Cm::ispA-proteolytic tag CMP1030 BL21 pgl PL.2mKKDyI CMP1018 None
GI1.2gltA yhfSFRTIspAyhfS thiFRTtruncIspA CMP1034 BL21 pgl
PL.2mKKDyI CMP1024 None GI 1.2 gltA ldhA ispA- proteolytic tag
CMP1043 HMB GI1.2gltA, CMP561 pDW72, pCLPtrcUpper, pTrc(MEA pMCM82
G491S)alba mMVK CMP1059 BL21 pgl PL.2mKKDyI CMP1034 MCM82, GI 1.2
gltA ldhA ispA- pCHL243 proteolytic tag, pCLPtrcUpper, pTrc(MEA
variant)alba mMVK CMP1061 BL21 pgl PL.2mKKDyI CMP1030 MCM82,
GI1.2gltA pCHL243 yhfSFRTIspAyhfS thiFRT3truncIspA, pCLPtrcUpper,
pTrc(MEA variant)alba mMVK CMP1067 BL21 pgl PL.2mKKDyI CMP1018 None
GI1.2gltA yhfSpKD4PyddVIspAyhfS thipKD3truncIspA CMP1075 BL21 pgl
PL.2mKKDyI CMP1067 None GI1.2gltA yhfSFRTPyddVIspAyhfS
thiFRTtruncIspA CMP1082 BL21 pgl PL.2mKKDyI CMP1075 MCM82,
GI1.2gltA pCHL243 yhfSFRTPyddVIspAyhfS thiFRTtruncIspA,
pCLPtrcUpper_Efaecalis, pTrc(MEA variant)alba mMVK CMP1101 BL21 pgl
PL.2mKKDyI CMP1018 None GI1.2gltA yhfSFRTIspAyhfS thipKD3truncIspA
yhfS- pKD4- PispA_avianA166W CMP1102 BL21 pgl PL.2mKKDyI CMP1018
None GI1.2gltA yhfSFRTIspAyhfS thipKD3truncIspA yhfS- pKD4-
PispA_avianN144'W CMP1107 BL21 pgl PL.2mKKDyI CMP1101 None
GI1.2gltA yhfSFRTIspAyhfS thipKD3truncIspA yhfS-
FRT-PispA_avianA166W CMP1108 BL21 pgl PL.2mKKDyI CMP1102 None
GI1.2gltA yhfSFRTIspAyhfS thipKD3truncIspA yhfS-
FRT-PispA_avianN144'W CMP1112 BL21 pgl PL.2mKKDyI CMP1107 MCM82,
GI1.2gltA pCHL243 yhfSFRTIspAyhfS thipKD3truncIspA yhfS-
FRT-PispA_avianA166W, pCLPtrcUpper_Efaecalis, pTrc(MEA variant)alba
mMVK CMP1113 BL21 pgl PL.2mKKDyI CMP1108 MCM82, GI1.2gltA pCHL243
yhfSFRTIspAyhfS thipKD3truncIspA yhfS- FRT-PispA_avianN144'W,
pCLPtrcUpper_Efaecalis, pTrc(MEA variant)alba mMVK CMP1125 BL21
pgl::Kan CMP1075 None PL.2mKKDyI GI1.2gltA yhfSFRTPyddVIspAyhfS
thiFRTtruncIspA CMP1133 BL21 .DELTA.pgl PL.2mKKDyI CMP1125 None
GI1.2gltA yhfSFRTPyddVIspAyhfS thiFRTtruncIspA CMP1136 BL21
.DELTA.pgl PL.2mKKDyI CMP1133 MCM82, GI1.2gltA pCHL243
yhfSFRTPyddVIspAyhfS thiFRTtruncIspA, pCLPtrcUpper_Efaecalis,
pTrc(MEA variant)alba mMVK MCM1020 BL21 t pgl, pTrcHis2B, CMP258
pTrcHis2B, pCL1920 pCL1920
Example 1
[0276] This purpose of this experiment was to evaluate isoprene
production from E. coli(BL21) expressing introduced genes from the
mevalonate pathway and grown in fed-batch culture at the 15-L
scale. An isoprene producing strain CMP1043 (HMB GI1.2 gltA pMCM82,
pDW72) was run in a fed-batch fermentation process which varied the
oxygen concentration of the inlet gas (5.0, 7.7 and 9.3 vol %, in
respective runs), while maintaining the volumetric gas flow rate at
8.0 standard liters per minute. CMP1043 strain expresses wild type
ispA. MCM82 is pCL PtrcUpperPathway encoding E. faecalis mvaE and
mvaS. pDW72 encodes for P. alba truncated isoprene synthase MEA
G491S variant, also described in WO 2009/132220, the contents of
which are specifically incorporated for its disclosure. The balance
gas in the three preceding cases was nitrogen. The performance
metrics (cumulative isoprene yield on glucose, instantaneous
isoprene yield on glucose, specific productivity and cell
productivity index) are compared to an isogenic strain CMP561 (HMB
GI1.2 gltA pMCM82, pDW72) that was run in the same conditions
except the inlet gas was air (20.95 vol %).
[0277] Phenotype is full (upper/lower) MVA pathway with archeal MVK
and MEA G491S isoprene synthase.
Results
[0278] While runs using the 5.0% oxygen inlet gas (20110909,
20110940) achieved a modestly higher mass yield of isoprene on
glucose than the two runs using standard house air (20100522,
20100523), the three runs using 7.7%, 7.7% and 9.3% (20111019,
20111020, 20111109, respectively) achieved a significantly higher
mass yield of isoprene on glucose. See, e.g., Table 1, FIG. 1 and
FIG. 5. FIG. 1 depicts a graph showing yield of isoprene on glucose
achieved in each 15-L fermentation over time is shown in chart 1.
All runs used a production host of the same genotype. The oxygen
inlet % is listed below for each experiment. All runs using the
lower oxygen inlet gas (circles, squares, and diamonds in the
figure below) achieved a higher % yield of isoprene on glucose than
the two runs using standard house air (open and closed triangles in
the figure).
[0279] Overall yield was calculated using the following
formula:
% wt Yield on glucose=Isoprene total(t)/[(Feed Wt(0)-Feed
Wt(t)+83.5)*0.59)],
where 0.59 is the wt % of glucose in the glucose feed solution and
83.5 is the grams of this feed batched into the fermentor at t=0.
Each feed had its weight % measured independently.
[0280] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0281] All runs using the lower oxygen inlet gas (20110909,
20110940, 20111019, 20111020, 20111109) achieved a higher peak
instantaneous % yield of isoprene on glucose than the two runs
using standard house air (20100522, 20100523). See Table 1, FIG. 2
and FIG. 6. FIG. 2 depicts a graph showing instantaneous yield of
isoprene on glucose achieved in each 15-L fermentation over time.
All runs used a production host of the same genotype. The oxygen
inlet % is listed below for each experiment. All runs using the
lower oxygen inlet gas (circles, squares, and diamonds) achieved a
higher peak instantaneous % yield of isoprene on glucose than the
two runs using standard house air (open and closed triangles). FIG.
6 is a graph where the peak instantaneous yield data in table 1 is
plotted as a bar graph. All runs using the lower oxygen inlet gas
(20110909, 20110940, 20111019, 20111020, 20111109) achieved a
higher instantaneous % yield of isoprene on glucose than the two
runs using standard house air (20100522, 20100523).
[0282] Isoprene Instantaneous yield was calculated using the
following formula:
Isoprene Inst. yield(g/g %)=Isoprene
produced(t.sub.1-t.sub.0)/consumed
glucose(t.sub.1-t.sub.0)*100.
[0283] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
[0284] All runs using the lower oxygen inlet gas (20110909,
20110940, 20111019, 20111020, 20111109) achieved a higher overall
cell productivity index than the two runs using standard house air
(20100522, 20100523). See Table 1, FIG. 3 and FIG. 7. FIG. 3
depicts a graph showing cell productivity index (CPI) achieved in
each 15-L fermentation over time. All runs used a production host
of the same genotype. The oxygen inlet % is listed for each
experiment. All runs using the lower concentration oxygen inlet gas
(circles, squares and diamonds) achieved a higher cell productivity
index compared to the two runs using standard house air (open and
closed triangles). FIG. 7 is a graph where the cell productivity
index data in table 1 is plotted as bar graph. All runs using the
lower oxygen inlet gas (20110909, 20110940, 20111019, 20111020,
20111109) achieved a higher cell productivity index than the two
runs using standard house air (20100522, 20100523).
[0285] Cell Productivity Index (CPI) was calculated using the
following formula:
CPI=total grams Isoprene/total grams dry cell weight
[0286] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940:
[0287] CMP1043 at 5.0% O2 inlet is depicted by closed black
squares. The run 20110909: CMP1043 at 5.0% O2 inlet is depicted by
open black squares. The run 20111019: CMP1043 at 7.7% O2 inlet is
depicted by closed black diamonds. The run 20111020: CMP1043 at
7.7% O2 inlet is depicted by open black diamonds. The run 20111109:
CMP1043 at 9.3% O2 inlet is depicted by closed black circles.
[0288] While runs using the 5.0% oxygen inlet gas (20110909,
20110940) achieved about the same peak specific productivity as the
two runs using standard house air (20100522, 20100523), the three
runs using 7.7%, 7.7% and 9.3% (20111019, 20111020, 20111109,
respectively) achieved a significantly higher peak specific
productivity of isoprene. See Table 1, FIG. 4 and FIG. 8. FIG. 4
depicts a graph showing specific productivity achieved in each 15-L
fermentation over time. All runs used a production host of the same
genotype. The oxygen inlet % is listed for each experiment. While
runs using the 5.0% oxygen inlet gas (20110909, 20110940) achieved
about the same specific productivity as the two runs using standard
house air (20100522, 20100523), the three runs using 7.7%, 7.7% and
9.3% (20111019, 20111020, 20111109, respectively) achieved a
significantly higher specific productivity of isoprene. FIG. 8 is a
graph where the peak specific productivity data in table 1 is
plotted as bar graph. While runs using the 5.0% oxygen inlet gas
(20110909, 20110940) achieved about the same specific productivity
as the two runs using standard house air (20100522, 20100523), the
three runs using 7.7%, 7.7% and 9.3% (20111019, 20111020, 20111109,
respectively) achieved a significantly higher peak specific
productivity of isoprene.
[0289] Specific Productivity was calculated using the following
formula:
Specific productivity(mg/L/hr/OD)=HgER*68.117 g/mol/OD.
[0290] HgER is the Isoprene Evolution Rate in (mmol/L/hr).
OD=optical density=Absorbance at 550 nm*dilution factor in
water
[0291] The run 20100522: CMP561 at 20.9% O2 inlet is depicted by
closed black triangles. The run 20100523: CMP561 at 20.9% O2 inlet
is depicted by open black triangles. The run 20110940: CMP1043 at
5.0% O2 inlet is depicted by closed black squares. The run
20110909: CMP1043 at 5.0% O2 inlet is depicted by open black
squares. The run 20111019: CMP1043 at 7.7% O2 inlet is depicted by
closed black diamonds. The run 20111020: CMP1043 at 7.7% O2 inlet
is depicted by open black diamonds. The run 20111109: CMP1043 at
9.3% O2 inlet is depicted by closed black circles.
Method:
Medium Recipe (Per Liter Fermentation Medium):
[0292] K2HPO4 7.5 g, MgSO4*7H2O 2 g, citric acid monohydrate 2 g,
ferric ammonium citrate 0.3 g, yeast extract 0.5 g, 50% sulphuric
acid 1.6 mL, 1000.times. Modified Trace Metal Solution 1 ml. All of
the components were added together and dissolved in Di H2O. This
solution was heat sterilized (123.degree. C. for 20 minutes). The
pH was adjusted to 7.0 with ammonium hydroxide (28%) and q.s. to
volume. Glucose 10 g, Vitamin Solution 8 mL, and antibiotics were
added after sterilization and pH adjustment.
1000.times. Modified Trace Metal Solution (Per Liter):
[0293] Citric Acids*H.sub.2O 40 g, MnSO4*H.sub.2O 30 g, NaCl 10 g,
FeSO4*7H2O 1 g, CoCl2*6H2O 1 g, ZnSO*7H2O 1 g, CuSO4*5H2O 100 mg,
H.sub.3BO3 100 mg, NaMoO4*2H2O 100 mg. Each component was dissolved
one at a time in Di H2O, pH was adjusted to 3.0 with HCl/NaOH, and
then the solution was q.s. to volume and filter sterilized with a
0.22 micron filter.
Vitamin Solution (Per Liter):
[0294] Thiamine hydrochloride 1.0 g, D-(+)-biotin 1.0 g, nicotinic
acid 1.0 g, pyridoxine hydrochloride 4.0 g. Each component was
dissolved one at a time in Di H2O, pH was adjusted to 3.0 with
HCl/NaOH, and then the solution was q.s. to volume and filter
sterilized with 0.22 micron filter.
Macro Salt Solution (Per Liter):
[0295] MgSO4*7H2O 296 g, citric acid monohydrate 296 g, ferric
ammonium citrate 49.6 g. All components were dissolved in water,
q.s. to volume and filter sterilized with 0.22 micron filter.
Feed Solution (Per Kilogram):
[0296] Glucose 0.590 kg, Di H2O 0.393 kg, K2HPO4 7.4 g, and 100%
Foamblast882 8.9 g. All components were mixed together and
autoclaved. After autoclaving the feed solution, nutrient
supplements are added to the feed bottle in a sterile hood. Post
sterilization additions to the feed are (per kilogram of feed
solution), Macro Salt Solution 5.54 ml, Vitamin Solution 6.55 ml,
1000.times. Modified Trace Metal Solution 0.82 ml.
[0297] This experiment was carried out to monitor isoprene
formation from glucose at the desired fermentation pH (7.0) and
temperature (34.degree. C.). A frozen vial of the E. coli strain
was thawed and inoculated into a flask with tryptone-yeast extract
medium and the appropriate antibiotics. After the inoculum grew to
optical density 1.0, measured at 550 nm (OD.sub.550), 500 mL was
used to inoculate a 15-L bioreactor and bring the initial tank
volume to 5 L.
[0298] The inlet gas using to maintain bioreactor backpressure at
0.7 bar gauge and to provide the oxygen to the production organisms
was supplied by Matheson Tri-Gas, Inc in compressed gas
cylinders.
Various concentrations of oxygen were used, and can be summarized
as follows.
TABLE-US-00002 Inlet gas Rate Run (standard liters per Inlet gas
Number minute) composition Strain used 20100522 8 SLPM 20.95%
Oxygen, CMP561 20100523 78% Nitrogen, 0.9% Argon, 0.036% Carbon
Dioxide (Air from house compressors) 20110871 8 SLPM 5% oxygen
CMP1043 20110909 95% nitrogen 20111019 8 SLPM 7.7% oxygen CMP1043
20111020 92.3% nitrogen 20111109 8 SLPM 9.3% oxygen CMP1043 90.7
nitrogen
[0299] The batched media had glucose batched in at 9.7 g/L.
Induction was achieved by adding
isopropyl-beta-D-1-thiogalactopyranoside (IPTG). IPTG was added to
the tank to bring the concentration to 200 uM when the cells were
at an OD.sub.550 of 6. Once the glucose was consumed by the
culture, as signaled by a rise in pH, the glucose feed solution was
fed to meet metabolic demands at rates less than or equal to 10
g/min. The fermentation was run long enough to determine the
maximum isoprene mass yield on glucose, a total of 48 to 56 hrs
elapsed fermentation time.
Results
[0300] Isoprene is volatile and can be efficiently swept from the
tank by the inlet gas. The isoprene level in the bioreactor off-gas
was determined using two mass spectrometers, an iSCAN (Hamilton
Sundstrand), and a Hiden HPR20 (Hiden Analytical) mass
spectrometer. Oxygen, Nitrogen, and CO2 levels in the offgas were
determined by the same mass spec units.
[0301] Dissolved Oxygen in the fermentation broth is measured by
sanitary, sterilizable probe with an optical sensor provided
Hamilton Company. The citrate, glucose, acetate, and mevalonate
concentrations in the fermentor broth was determined in broth
samples taken at 4 hour intervals by an HPLC analysis.
Concentration in broth samples was determined by comparison of the
refractive index response versus a previously generated calibration
curve using standard of a known concentration.
HPLC Information
System: Waters Alliance 2695
[0302] Column: BioRad-Aminex HPX-87H Ion Exclusion Column 300
mm.times.7.8 mm Catalog #125-0140
Column Temperature: 50 C
[0303] Guard column: BioRad-Microguard Cation H refill 30
mm.times.4.6 mm Catalog #125-0129 Running buffer: 0.01N
H.sub.2SO.sub.4 Running buffer flow rate: 0.6 ml/min Approximate
running pressure: .about.1100-1200 psi Injection volume: 20
microliters
Detector: Refractive Index (Knauer K-2301)
[0304] Runtime: 26 minutes
TABLE-US-00003 TABLE 1 Peak Peak instantaneous cumulative CPI at
max yield of mass yield overall Peak Specific Oxygen isoprene on of
Isoprene isoprene yield Productivity Strain inlet Conc. Run glucose
on glucose (g Isoprene/g (mg isoprene/ description (vol %) Number
(g/g %) (g/g) DCW) L/hr/OD) CMP1043 5.0% 20110909 13.81 10.6 1.07
19.49 20110940 14.5 11.12 1.15 21.07 Average 14.2 10.86 1.11 20.28
7.7% 20111019 16.22 12.76 1.34 27.82 20111020 17.03 13.86 1.71
31.78 Average 16.63 13.31 1.53 29.8 9.3% 20111109 16.85 14.26 1.64
26.87 Average 16.85 14.26 1.64 26.87 CMP561 20.95% 20100522 12.26
9.85 0.92 21.89 20100523 12.22 10.26 0.98 20.75 Average 12.24 10.06
0.95 21.32
[0305] The peak instantaneous yield of isoprene was increased by
about 11.6% when 5% oxygen inlet levels was used as compared to
when ambient oxygen levels (.about.21%) was used. When 7.7% oxygen
inlet level was used, peak instantaneous yield was increased by
about 35.8% as compared to when ambient oxygen level was used. When
9.3% oxygen inlet levels was used, peak instantaneous yield was
increased by about 37.6% as compared to when ambient oxygen levels
was used.
[0306] The peak cumulative mass yield of isoprene was increased by
about 8% when 5% oxygen inlet levels was used as compared to when
ambient oxygen levels (.about.21%) was used. When 7.7% oxygen inlet
level was used, peak cumulative mass yield was increased by about
32.3% as compared to when ambient oxygen level was used. When 9.3%
oxygen inlet levels was used, peak cumulative mass yield was
increased by about 41.7% as compared to when ambient oxygen levels
was used.
[0307] The CPI was increased by about 16.8% when 5% oxygen inlet
levels was used as compared to when ambient oxygen levels
(.about.21%) was used. When 7.7% oxygen inlet level was used, CPI
was increased by about 61% as compared to when ambient oxygen level
was used. When 9.3% oxygen inlet levels was used, CPI was increased
by about 72.6% as compared to when ambient oxygen levels was
used.
[0308] The peak specific productivity was increased by about 39.7%
when 7.7% oxygen inlet levels was used as compared to when ambient
oxygen levels (.about.21%) was used. When 9.3% oxygen inlet levels
was used, peak cumulative mass yield was increased by about 26% as
compared to when ambient oxygen levels was used.
[0309] Thus, this example demonstrates that reduced oxygen inlet
levels helps to increase production of isoprene, as shown by
measuring various production parameters.
Example 2
Large Scale Fermentation of CMP1082
[0310] Fermentation runs were performed to test certain performance
metrics (cumulative isoprene yield on glucose, isoprene
productivity, peak specific productivity and cell productivity
index) of strain CMP1082 (HMB GI1.2 gltA, PyddVlspA_GO, truncIspA,
MCM82, pCHL243) to that of a control strain CMP1043 (HMB GI1.2
gltA, -MCM82, pCHL243) according to the following protocol.
[0311] Medium Recipe (Per Liter Fermentation Medium):
[0312] K2HPO4 7.5 g, MgSO4*7H2O 2 g, citric acid monohydrate 2 g,
ferric ammonium citrate 0.3 g, yeast extract 0.5 g, 50% sulphuric
acid 1.6 mL, 1000.times. Modified Trace Metal Solution 1 ml. All of
the components were added together and dissolved in Di H.sub.2O.
This solution was heat sterilized (123.degree. C. for 20 minutes).
The pH was adjusted to 7.0 with ammonium hydroxide (28%) and q.s.
to volume. Glucose 10 g, Vitamin Solution 8 mL, and antibiotics
were added after sterilization and pH adjustment.
[0313] 1000.times. Modified Trace Metal Solution (Per Liter):
[0314] Citric Acids*H2O 40 g, MnSO4*H2O 30 g, NaCl 10 g, FeSO4*7H2O
1 g, CoCl2*6H2O 1 g, ZnSO*7H2O 1 g, CuSO4*5H2O 100 mg, H3BO3 100
mg, NaMoO4*2H2O 100 mg. Each component was dissolved one at a time
in Di H2O, pH was adjusted to 3.0 with HCl/NaOH, and then the
solution was q.s. to volume and filter sterilized with a 0.22
micron filter.
[0315] Vitamin Solution (Per Liter):
[0316] Thiamine hydrochloride 1.0 g, D-(+)-biotin 1.0 g, nicotinic
acid 1.0 g, pyridoxine hydrochloride 4.0 g. Each component was
dissolved one at a time in Di H2O, pH was adjusted to 3.0 with
HCl/NaOH, and then the solution was q.s. to volume and filter
sterilized with 0.22 micron filter.
[0317] Macro Salt Solution (Per Liter):
[0318] MgSO4*7H2O 296 g, citric acid monohydrate 296 g, ferric
ammonium citrate 49.6 g. All components were dissolved in water,
q.s. to volume and filter sterilized with 0.22 micron filter.
[0319] Feed Solution (Per Kilogram):
[0320] Glucose 0.590 kg, Di H2O 0.393 kg, K2HPO4 7.4 g, and 100%
Foamblast882 8.9 g. All components were mixed together and
autoclaved. After autoclaving the feed solution, nutrient
supplements are added to the feed bottle in a sterile hood. Post
sterilization additions to the feed are (per kilogram of feed
solution), Macro Salt Solution 5.54 ml, Vitamin Solution 6.55 ml,
1000.times. Modified Trace Metal Solution 0.82 ml.
[0321] Metabolite Analysis:
[0322] Metabolite extraction from E. coli. was achieved by
withdrawing approximately 3 mL of culture into a tube filled with 9
mL of dry ice-cold methanol. The resulting samples were weighed to
calculate the amount of sampled broth and then stored at
-80.degree. C. until further analysis. For metabolite extraction
and concentration, 0.5 mL aliquots of cell suspension (1 mL aliquot
was used if cell density of the culture measured as OD.sub.600 was
below 50) were diluted with 2.5 mL of methanol/ammonium acetate
buffer (5 mM, pH=8.0) mixture (6:1, v/v) and cell debris was
pelleted by a 5 minute centrifugation. The supernatant was
collected and loaded onto Strata-X-AW columns from Phenomenex (33
.mu.m 30 mg/3 mL Polymeric Weak Anion Exchange). The cell pellet
was extracted two more times, first with 3 mL of the
methanol/ammonium acetate buffer (5 mM, pH=8.0) mixture (6:1 v/v),
and then with 3 mL of methanol/ammonium acetate buffer (5 mM,
pH=8.0) mixture (1:1 v/v). Both times the cells were pelleted by
centrifugation, and the resulting supernatants were consecutively
loaded onto the same Strata-X-AW columns. During the
extraction-centrifugation, samples with cells were kept below
4.degree. C. After washing the columns with 1 mL of water and 1 mL
of methanol, metabolites of interest were eluted from the columns
first with 0.3 mL of concentrated NH.sub.4OH/methanol (1:14, v/v)
mixture and then with 0.3 mL of concentrated
NH.sub.4OH/methanol/water (1:12:2, v/v/v) mixture. The resulting
eluant was neutralized by adding 20 .mu.L of glacial acetic acid,
and then cleared by centrifugation.
[0323] Analysis of metabolites was carried out by mass spectrometry
using a TSQ Quantum Access TSQ system (Thermo Scientific). All
system control, data acquisition, and mass spectral data evaluation
were performed using XCalibur and LCQuan software (Thermo
Scientific). For the LC-ESI-MS/MS method, a chiral Nucleodex
.beta.-OH 5 .mu.M HPLC column (100.times.2 mm, Macherey-Nagel,
Germany) was used with a CC 8/4 Nucleodex beta-OH guard cartridge.
A mobile phase gradient was applied in which mobile phase A was 100
mM ammonium acetate (SigmaUltra grade, Sigma) buffer (pH=8) in
MilliQ-grade water, mobile phase B was MilliQ-grade water, and
mobile phase C was LC-MS grade acetonitrile (Chromasolv, Riedel-de
Haen). The column and sample tray temperatures were reduced to
5.degree. C. and 4.degree. C., respectively. The injection volume
was 10 .mu.L.
[0324] Mass detection was carried out using electrospray ionization
in the negative mode (ESI spray voltage of 3.0 kV and ion transfer
tube temperature of 390.degree. C.). The following m/z values for
precursor ions were selected to detect the metabolites of interest
in SRM mode: 245.0 for IPP and DMAPP, 313.1 for GPP, 381.1 for FPP,
227.0 for MVP, and 307.1 for MVPP. Concentrations of metabolites
were determined based on the integrated intensities of peaks
generated by PO3--product ion (m/z=79.0). Calibration curves
obtained by injection of standards were used to calculate
concentrations of metabolites in cell extracts. IPP, DMAPP, GPP,
and FPP standards were purchased from Echelon Biosciences Inc. and
MVP and MVPP (R-forms) were purchased from Sigma-Aldrich.
Intracellular concentrations of metabolites were determined based
on the assumption that in 1 mL of the culture at OD.sub.600=200 the
integrated volume of all cells is 50 .mu.L.
[0325] This experiment was carried at pH 7.0 and temperature
34.degree. C. A frozen vial of the E. coli strain was thawed and
inoculated into a flask with tryptone-yeast extract medium and the
appropriate antibiotics. After the inoculum grew to optical density
1.0, measured at 550 nm (OD.sub.550), 500 mL was used to inoculate
a 15-L bioreactor and bring the initial tank volume to 5 L. The
batched media had glucose batched in at 9.7 g/L. Induction was
achieved by adding isopropyl-beta-D-1-thiogalactopyranoside (IPTG)
at a final concentration of 200 uM when the cells were at an
OD.sub.550 of 6. Once the glucose was consumed by the culture, as
signaled by a rise in pH, the glucose feed solution was fed to meet
metabolic demands at rates less than or equal to 10 g/min. The
fermentation was run long enough to determine the maximum isoprene
mass yield on glucose, a total of 48 to 72 hrs elapsed fermentation
time.
[0326] Isoprene is volatile and can be efficiently swept from the
tank by the inlet gas. The isoprene level in the bioreactor off-gas
was determined using an iSCAN (Hamilton Sundstrand) mass
spectrometer. The inlet gas was a custom blend of oxygen and
nitrogen (.about.9.3 vol % and 90.7 vol % respectively). The
citrate, glucose, acetate, and mevalonate concentrations in the
fermentor broth were determined in broth samples taken at 4 hour
intervals by an HPLC analysis. Concentration in broth samples were
determined by comparison of the refractive index response versus a
previously generated calibration curve using standard of a known
concentration.
[0327] Results
TABLE-US-00004 TABLE 2 Isoprene Productivity Metrics Peak
cumulative Isoprene mass yield Peak Specific Isoprene Volumetric of
Isoprene CPI Productivity Strain description/ EFT Titer
Productivity on glucose (g Isoprene/ (mg isoprene/ Run Number (hrs)
(g/L) (g/L/hr) (g/g) g DCW) L/hr/OD) CMP1043 44 74.41 1.69 14.26
1.64 26.87 (at Control strain 16 hrs EFT) CMP1082 44 83.95 1.91
16.03 1.79 30.31 (at PyddV-ispA strain 12 hrs EFT) % wt Yield on
glucose = Isoprene total (t)/[(Feed Wt(0) - Feed Wt(t) +
83.5)*0.59)], where 0.59 is the wt % of glucose in the glucose feed
solution and 83.5 is the grams of this feed batched into the
fermentor at t = 0. Each feed had its weight % measured
independently. Isoprene Titer (g/L) = Integrated isoprene evolution
rate (mol/L) * molecular weight of isoprene (g/mol) CPI = total
grams Isoprene/total grams dry cell weight Specific productivity
(mg/L/hr/OD) = HgER*68.117 g/mol/OD. HgER is the Isoprene Evolution
Rate in (mmol/L/hr). OD = optical density = Absorbance at 550 nm *
dilution factor in water
CONCLUSIONS
[0328] The fermentation with the modified ispA promoter strain
(CMP1082) had a higher isoprene yield on glucose than the control
strain (CMP1043) which uses a wild type ispA promoter, see FIG. 9
and Table 2. The fermentation with the modified ispA promoter
strain (CMP1082) had a higher isoprene titer (see FIG. 10 and Table
2), a higher cell productivity index (see FIG. 11 and Table 2), a
higher isoprene volumetric productivity (see FIG. 12 and Table 2),
and a higher peak isoprene specific productivity (in the 12 hr
range; see FIG. 13 and Table 2) than the control strain (CMP1043)
which uses a wild type ispA promoter.
Example 3
Large Scale Fermentation of CMP1059
[0329] A P1 lysate was made from strain MD08-97 and used to
transduce CMP722. A colony was selected on LB+chloramphenicol 5
mg/L and named CMP1024. CMP1024 was checked by PCR and sequenced to
demonstrate presence of the proteolytic tag. The chloramphenicol
marker was looped out using pCP20 (Datsenko and Wanner, supra) and
a chloramphenicol sensitive colony was selected and named CMP1034.
Plasmids MCM82 and pCHL243 were electroporated concomitantly into
CMP1034. A colony growing on LB+carbenicilin 50 mg/L and
spectinomycin 50 mg/L was selected and named CMP105.
[0330] Fermentation runs were performed to test certain performance
metrics (cumulative isoprene yield on glucose, isoprene
productivity, peak specific productivity and cell productivity
index) of strain CMP1059 (HMB GI1.2 gltA, ispA_prot_tag, MCM82,
pCHL243) to that of a control strain CMP1043 according to the
following protocol:
[0331] Medium Recipe (Per Liter Fermentation Medium):
[0332] K2HPO4 7.5 g, MgSO4*7H2O 2 g, citric acid monohydrate 2 g,
ferric ammonium citrate 0.3 g, yeast extract 0.5 g, 50% sulphuric
acid 1.6 mL, 1000.times. Modified Trace Metal Solution 1 ml. All of
the components were added together and dissolved in Di H2O. This
solution was heat sterilized (123.degree. C. for 20 minutes). The
pH was adjusted to 7.0 with ammonium hydroxide (28%) and q.s. to
volume. Glucose 10 g, Vitamin Solution 8 mL, and antibiotics were
added after sterilization and pH adjustment.
[0333] 1000.times. Modified Trace Metal Solution (Per Liter):
[0334] Citric Acids*H2O 40 g, MnSO4*H2O 30 g, NaCl 10 g, FeSO4*7H2O
1 g, CoCl2*6H2O 1 g, ZnSO*7H2O 1 g, CuSO4*5H2O 100 mg, H.sub.3BO3
100 mg, NaMoO4*2H2O 100 mg. Each component was dissolved one at a
time in Di H2O, pH was adjusted to 3.0 with HCl/NaOH, and then the
solution was q.s. to volume and filter sterilized with a 0.22
micron filter.
[0335] Vitamin Solution (Per Liter):
[0336] Thiamine hydrochloride 1.0 g, D-(+)-biotin 1.0 g, nicotinic
acid 1.0 g, pyridoxine hydrochloride 4.0 g. Each component was
dissolved one at a time in Di H2O, pH was adjusted to 3.0 with
HCl/NaOH, and then the solution was q.s. to volume and filter
sterilized with 0.22 micron filter.
[0337] Macro Salt Solution (per liter): MgSO4*7H2O 296 g, citric
acid monohydrate 296 g, ferric ammonium citrate 49.6 g. All
components were dissolved in water, q.s. to volume and filter
sterilized with 0.22 micron filter.
[0338] Feed solution (per kilogram): Glucose 0.590 kg, Di H2O 0.393
kg, K2HPO4 7.4 g, and 100% Foamblast882 8.9 g. All components were
mixed together and autoclaved. After autoclaving the feed solution,
nutrient supplements are added to the feed bottle in a sterile
hood. Post sterilization additions to the feed are (per kilogram of
feed solution), Macro Salt Solution 5.54 ml, Vitamin Solution 6.55
ml, 1000.times. Modified Trace Metal Solution 0.82 ml.
[0339] This experiment was carried at pH 7.0 and temperature
34.degree. C. A frozen vial of the E. coli strain was thawed and
inoculated into a flask with tryptone-yeast extract medium and the
appropriate antibiotics. After the inoculum grew to optical density
1.0, measured at 550 nm (OD550), 500 mL was used to inoculate a
15-L bioreactor and bring the initial tank volume to 5 L. The
batched media had glucose batched in at 9.7 g/L. Induction was
achieved by adding isopropyl-beta-D-1-thiogalactopyranoside (IPTG)
at a final concentration of 200 .mu.M when the cells were at an
OD.sub.550 of 6. Once the glucose was consumed by the culture, as
signaled by a rise in pH, the glucose feed solution was fed to meet
metabolic demands at rates less than or equal to 10 g/min. The
fermentation was run long enough to determine the maximum isoprene
mass yield on glucose, a total of 48 to 72 hrs elapsed fermentation
time.
[0340] The isoprene level in the bioreactor off-gas was determined
using an iSCAN (Hamilton Sundstrand) mass spectrometer. The inlet
gas was a custom blend of oxygen and nitrogen (.about.9.3 vol % and
90.7 vol % respectively). The citrate, glucose, acetate, and
mevalonate concentrations in the fermentor broth were determined in
broth samples taken at 4 hour intervals by an HPLC analysis.
Concentration in broth samples were determined by comparison of the
refractive index response versus a previously generated calibration
curve using standard of a known concentration
[0341] Results
[0342] The fermentation with the proteolytic tag on ispA strain
(CMP1059) had an 11% higher cell productivity index over the
control strain (CMP1043) which uses the wild type ispA protein.
Additionally, the fermentation with the proteolytic tag on ispA
strain (CMP1059) had a 14% higher peak isoprene specific
productivity (at 16 hrs EFT) versus the control strain (at 16 hrs
EFT, CMP1043) which uses the wild type ispA protein.
Example 4
Construction of Strain CMP1136 (-PGL)
[0343] A PCR product containing a Kanamycin cassette flanked by FRT
sites and regions homologous to upstream and downstream of pgl
(ybhE) was obtained, using the PCR method described in example 4,
Keio strain JW0750 (Baba et al. 2006. Mol. Syst. Biol. 2:1-11)
which contains a kanamycin cassette in the pgl locus, and primers
pglAmpF (5'-cagcaaatagcaggtgtatccagc-3' (SEQ ID NO:11)) and pglAmpR
(5'-GCA ACC GAC TGT TGA TAG AAC AAC-3' (SEQ ID NO:12)). This PCR
product was used in a recombineering reaction (see protocol
described above) with E. coli CMP1075 (supra). A colony was
selected on LB+kanamycin 10 mg/L and named CMP1125. The kanamycin
marker was removed using the protocol recommended by the
manufacturer (Gene Bridges, Heidelberg, Germany) to form strain
CMP1133.
[0344] CMP1133 was checked by PCR with primers pglAmpF (supra) and
pglRecCheck (5'-GGT TAC AAA ATG ATT GGC GTA CGC-3' (SEQ ID NO:13))
to demonstrate deletion of the pgl gene. Plasmids MCM82 and pCHL243
were electroporated concomitantly into CMP1133. A colony growing on
LB+carbenicilin 50 mg/L and spectinomycin 50 mg/L was selected and
named CMP1136.
Example 5
Large Scale Fermentation of CMP1136
[0345] This experiment was performed to evaluate isoprene
production from E. coli(BL21) expressing introduced genes from the
mevalonate pathway and grown in fed-batch culture at the 15-L
scale. An isoprene producing strain CMP1082 (HMB GI1.2 gltA,
PyddVlspA_GO, truncIspA, pMCM82, pDW72) was run in a standard
isoprene production process, described below. The performance
metrics (cumulative isoprene yield on glucose, instantaneous
isoprene yield on glucose, volumetric productivity of isoprene,
specific productivity and cell productivity index) are compared to
an experimental strain CMP1136 (HMB GI1.2 gltA, PyddVlspA_GO,
truncIspA, pgl-, pMCM82, pDW72) that was run in the same conditions
to see if any yield improvement can be attributed to the deletion
of the pgl gene in CMP1136.
[0346] Medium Recipe (Per Liter Fermentation Medium):
[0347] K2HPO4 7.5 g, MgSO4*7H2O 2 g, citric acid monohydrate 2 g,
ferric ammonium citrate 0.3 g, yeast extract 0.5 g, 50% sulphuric
acid 1.6 mL, 1000.times. Modified Trace Metal Solution 1 ml. All of
the components were added together and dissolved in Di H2O. This
solution was heat sterilized (123.degree. C. for 20 minutes). The
pH was adjusted to 7.0 with ammonium hydroxide (28%) and q.s. to
volume. Glucose 10 g, Vitamin Solution 8 mL, and antibiotics were
added after sterilization and pH adjustment.
[0348] 1000.times. Modified Trace Metal Solution (Per Liter):
[0349] Citric Acids*H2O 40 g, MnSO4*H2O 30 g, NaCl 10 g, FeSO4*7H2O
1 g, CoCl2*6H2O 1 g, ZnSO*7H2O 1 g, CuSO4*5H2O 100 mg, H.sub.3BO3
100 mg, NaMoO4*2H2O 100 mg. Each component was dissolved one at a
time in Di H2O, pH was adjusted to 3.0 with HCl/NaOH, and then the
solution was q.s. to volume and filter sterilized with a 0.22
micron filter.
[0350] Vitamin Solution (Per Liter):
[0351] Thiamine hydrochloride 1.0 g, D-(+)-biotin 1.0 g, nicotinic
acid 1.0 g, pyridoxine hydrochloride 4.0 g. Each component was
dissolved one at a time in Di H2O, pH was adjusted to 3.0 with
HCl/NaOH, and then the solution was q.s. to volume and filter
sterilized with 0.22 micron filter.
[0352] Macro Salt Solution (Per Liter):
[0353] MgSO4*7H2O 296 g, citric acid monohydrate 296 g, ferric
ammonium citrate 49.6 g. All components were dissolved in water,
q.s. to volume and filter sterilized with 0.22 micron filter.
[0354] Feed Solution (Per Kilogram):
[0355] Glucose 0.590 kg, Di H2O 0.393 kg, K2HPO4 7.4 g, and 100%
Foamblast882 8.9 g. All components were mixed together and
autoclaved. After autoclaving the feed solution, nutrient
supplements are added to the feed bottle in a sterile hood. Post
sterilization additions to the feed are (per kilogram of feed
solution), Macro Salt Solution 5.54 ml, Vitamin Solution 6.55 ml,
1000.times. Modified Trace Metal Solution 0.82 ml.
[0356] This experiment was carried out to monitor isoprene
formation from glucose at the desired fermentation pH (7.0) and
temperature (34.degree. C.). A frozen vial of the E. coli strain
was thawed and inoculated into a flask with tryptone-yeast extract
medium and the appropriate antibiotics. After the inoculum grew to
optical density 1.0, measured at 550 nm (OD.sub.550), 500 mL was
used to inoculate a 15-L bioreactor and bring the initial tank
volume to 5 L.
[0357] The batched media had glucose batched in at 9.7 g/L.
Induction was achieved by adding
isopropyl-beta-D-1-thiogalactopyranoside (IPTG). IPTG was added to
the tank to bring the concentration to 200 uM when the cells were
at an OD.sub.550 of 6. Once the glucose was consumed by the
culture, as signaled by a rise in pH, the glucose feed solution was
fed to meet metabolic demands at rates less than or equal to 10
g/min. The fermentation was run long enough to determine the
maximum isoprene mass yield on glucose, a total of 68 to 72 hrs
elapsed fermentation time.
Results
[0358] The pgl- strain (CMP1136) achieved a higher % yield of
isoprene on glucose than the pgl+strain (CMP1082). See Table 3 and
FIG. 14. The pgl- strain (CMP1136) achieved a higher instantaneous
% yield of isoprene on glucose than the pgl+strain (CMP1082) and
was able to maintain this high productivity for a longer period of
time (.about.24 hrs at max for pgl- versus .about.12 hrs at max for
pgl+). See Table 3 and FIG. 15. The pgl- strain (CMP1136) achieved
a higher cell productivity index than the pgl+strain (CMP1082). At
the end of fermentation 68 to 72 hrs, the pgl-strain had a much
higher CPI. Also, at the time of maximum cumulative yield of
isoprene on glucose (44 hrs for the pgl+strain and 56 hrs for the
pgl- strain) the CPI is higher in the pgl- strain. See Table 3 and
FIG. 16. The pgl- strain (CMP1136) achieved about the same overall
volumetric productivity as the pgl+strain (CMP1082). See Table 3
and FIG. 17. The pgl- strain (CMP1136) achieved about the same peak
specific productivity as the pgl+strain (CMP1082). However, the
pgl- strain (CMP1136) was able to maintain this high productivity
for a longer period of time than the pgl+strain (CMP1082) and was
notably better late in the fermentation. See Table 3 and FIG.
18.
TABLE-US-00005 TABLE 3 Isoprene productivity metrics Overall
Isoprene Volumetric CPI Peak Productivity Max (g Isoprene/ Peak
instantaneous (g/L/hr) at Overall % g DCW) at Specific Oxygen %
yield of time of max Yield of time of max Productivity Strain inlet
isoprene on overall Isoprene overall (mg description/ Conc. glucose
isoprene on glucose isoprene isoprene/ Run Number (vol %) (g/g %)
Yield (g/g) yield L/hr/OD) CMP1082/ 9.3% 20.1 1.91 16.3 1.81 30.31
20111110 CMP1136/ 9.3% 22.3 1.82 17.2 2.73 28.61 20111225
Example 6
Large Scale Fermentation of DW719
[0359] This experiment was to evaluate isoprene production from E.
coli (BL21) expressing introduced genes from the mevalonate pathway
and grown in fed-batch culture at the 15-L scale. Previously,
isoprene producing strain CMP1043 (HMB GI1.2 gltA pMCM82, pDW72)
was observed to achieve different peak cumulative yields of
isoprene depending on the concentration of oxygen in the inlet gas
(5.0, 7.7, 9.3 and 20.9 vol %, in respective runs), with 5.0, 7.7
and 9.3 vol % oxygen achieving higher isoprene yields. In this
example, the oxygen concentration was kept fixed (8.7 vol %
oxygen), but the rate of inlet gas delivery to the tank was
modified. Process conditions are summarized in the methods section
below. The performance metrics (cumulative isoprene yield on
glucose, instantaneous isoprene yield on glucose, volumetric
isoprene productivity, specific productivity and cell productivity
index) are compared to highlight any differences. The tested strain
is described in Table 4.
TABLE-US-00006 TABLE 4 List of strains. Host/yddV promoter Strain
modifica- Run Name tion upper plasmid lower plasmid numbers DW719
BL21 t pgl, Ptrc-P. alba IspS E. gallinarum 20120484 (Control)
GI1.2gltA (MEA variant)- upper, 20120521 pgl-, mMVK, Spec50 ppm
20120522 yhfSFRTPy Carb50 ppm (pMCM1225) ddVIspAyhf (pDW240) S
thiFRTtruncI spA
[0360] Methods
[0361] Medium Recipe (Per Liter Fermentation Medium):
[0362] K2HPO4 7.5 g, MgSO4*7H2O 2 g, citric acid monohydrate 2 g,
ferric ammonium citrate 0.3 g, yeast extract 0.5 g, 50% sulphuric
acid 1.6 mL, 1000.times. Modified Trace Metal Solution 1 ml. All of
the components were added together and dissolved in Di H2O. This
solution was heat sterilized (123.degree. C. for 20 minutes). The
pH was adjusted to 7.0 with ammonium hydroxide (28%) and q.s. to
volume. Glucose 10 g, Vitamin Solution 8 mL, and antibiotics were
added after sterilization and pH adjustment.
[0363] 1000.times. Modified Trace Metal Solution (Per Liter):
[0364] Citric Acids*H2O 40 g, MnSO4*H2O 30 g, NaCl 10 g, FeSO4*7H2O
1 g, CoCl2*6H2O 1 g, ZnSO*7H2O 1 g, CuSO4*5H2O 100 mg, H.sub.3BO3
100 mg, NaMoO4*2H2O 100 mg. Each component was dissolved one at a
time in Di H2O, pH was adjusted to 3.0 with HCl/NaOH, and then the
solution was q.s. to volume and filter sterilized with a 0.22
micron filter.
[0365] Vitamin Solution (Per Liter):
[0366] Thiamine hydrochloride 1.0 g, D-(+)-biotin 1.0 g, nicotinic
acid 1.0 g, pyridoxine hydrochloride 4.0 g. Each component was
dissolved one at a time in Di H2O, pH was adjusted to 3.0 with
HCl/NaOH, and then the solution was q.s. to volume and filter
sterilized with 0.22 micron filter.
[0367] Macro Salt Solution (Per Liter):
[0368] MgSO4*7H2O 296 g, citric acid monohydrate 296 g, ferric
ammonium citrate 49.6 g. All components were dissolved in water,
q.s. to volume and filter sterilized with 0.22 micron filter.
[0369] Feed Solution (Per Kilogram):
[0370] Glucose 0.590 kg, Di H2O 0.393 kg, K2HPO4 7.4 g, and 100%
Foamblast882 8.9 g. All components were mixed together and
autoclaved. After autoclaving the feed solution, nutrient
supplements are added to the feed bottle in a sterile hood. Post
sterilization additions to the feed are (per kilogram of feed
solution): Macro Salt Solution 5.54 mL, Vitamin Solution 6.55 mL,
1000.times. Modified Trace Metal Solution 0.82 mL, 10 mg/mL IPTG
solution (1.86 mL).
[0371] This example was carried out to monitor isoprene production
from glucose at the desired fermentation pH (7.0) and temperature
(34.degree. C.). To start, the appropriate frozen vial of the E.
coli (BL21) strain was thawed and inoculated into a flask with
tryptone-yeast extract (LB) medium and the appropriate antibiotics.
After the inoculum grew to an optical density of approximately 1.0,
measured at 550 nm (OD.sub.550), 500 mL was used to inoculate a
15-L bioreactor and bring the initial tank volume to 5 L.
[0372] The inlet gas using to maintain bioreactor backpressure at
0.7 bar gauge and to provide the oxygen to the production organisms
was supplied by in-house facilities that dilute the inlet gas to a
known concentration (.about.9 vol % oxygen). The inlet rate varied
by fermenter as follows:
[0373] Experiment number 20120484: inlet rate of 8.0 standard liter
per minute;
[0374] Experiment number 20120522: inlet rate of 10.0 standard
liter per minute;
[0375] Experiment number 20120521: inlet rate of 14.0 standard
liter per minute.
[0376] The batched media had glucose batched in at 9.7 g/L.
Induction was achieved by adding IPTG. A shot of IPTG was added to
the tank to bring the concentration to a specified level when the
cells were at an OD.sub.550 of 6. Once the glucose was consumed by
the culture, as signaled by a rise in pH, the glucose feed solution
was fed to meet metabolic demands at rates less than or equal to 10
g/min. The fermentation was run long enough to determine the
maximum cumulative isoprene mass yield on glucose, a total of 56 to
64 hrs of elapsed fermentation time.
[0377] Oxygen, nitrogen, and carbon dioxide levels in the offgas
were determined independently using the mass spectrometers iSCAN
(Hamilton Sundstrand) and a Hiden HPR20 (Hiden Analytical) mass
spectrometer.
[0378] Dissolved oxygen in the fermentation broth is measured by a
sanitary, sterilizable probe with an optical sensor provided by
Hamilton Company.
[0379] The citrate, glucose, acetate, and mevalonate concentrations
in the fermentor broth were determined in broth samples taken at 4
hour intervals by HPLC analysis. Concentrations in broth samples
were determined by comparison of the refractive index response
versus a previously generated calibration curve using a standard of
a known concentration.
HPLC Information
System: Waters Alliance 2695
[0380] Column: BioRad-Aminex HPX-87H Ion Exclusion Column, 300
mm.times.7.8 mm, Catalog #125-0140
Column Temperature: 50.degree. C.
[0381] Guard column: BioRad-Microguard Cation H refill, 30
mm.times.4.6 mm, Catalog #125-0129 Running buffer:
0.01NH.sub.2SO.sub.4 Running buffer flow rate: 0.6 mL/min
Approximate running pressure: 1100-1200 psi Injection volume: 20
.mu.L
Detector: Refractive Index (Knauer K-2301)
[0382] Runtime: 26 minutes
[0383] Results
[0384] The isoprene productivity metrics are presented in Table 5
and FIGS. 19-23. This example provides that even with a fixed
oxygen concentration in the gas inlet, an increased rate may be
achieved by increasing the total flow of gas into the tank. Without
being bound to any particular theory, it is believed that the
increase in total flow of gas to the tank effectively increases the
number of moles of oxygen delivered to the tank per unit time.
TABLE-US-00007 TABLE 5 Isoprene productivity metrics. Overall
Isoprene CPI Volumetric (g Isoprene/ Strain Max Peak Productivity
Peak gDCW) at Peak Name/ Overall % instantaneous (g/L/hr) at Oxygen
time of Specific Run Inlet Yield of % yield of time of max Uptake
max Productivity Number/ Oxygen Isoprene on isoprene on overall
Rate overall (mg Inlet flow Conc. glucose glucose isoprene (mmol/
isoprene isoprene/ rate (vol %) (g/g %) (g/g %) yield L/hr) yield
L/hr/OD) DW719/ 8.69 17.23 19.13 2.83 292 2.26 41.5 20120521/
(+/-1.29) 14 slpm DW719/ 8.69 17.87 19.79 2.59 252 2.45 40.6
20120522/ (+/-0.68) 10 slpm DW719/ 8.70 17.18 19.02 2.20 213 2.44
41.3 20120484/ (+/-0.63) 8 slpm
TABLE-US-00008 SEQUENCES
MTDVRFRIIGTGAYVPERIVSNDEVGAPAGVDDDWITRKTGIRQRRWAADDQATSDLATAAGRAALKAAGITPE-
QLTVIAVATSTPDRPQPPTAAYVQH
HLGATGTAAFDVNAVCSGTVFALSSVAGTLVYRGGYALVIGADLYSRILNPADRKTVVLFGDGAGAMVLGPTST-
GTGPIVRRVALHTFGGLTDLIRVPA
GGSRQPLDTDGLDAGLQYFAMDGREVRRFVTEHLPQLIKGFLHEAGVDAADISHFVPHQANGVMLDEVFGELHL-
PRATMHRTVETYGNTGAASIPITMD AAVRAGSFRPGELVLLAGFGGGMAASFALIEW. (SEQ ID
NO: 1)
atggttaaagacattgtaataattgatgccctccgtactcccatcggtaagtaccgcggtcagctctcaaagat-
gacggcggtggaattgggaaccgcag
ttacaaaggctctgttcgagaagaacgaccaggtcaaagaccatgtagaacaagtcatttttggcaacgtttta-
caggcagggaacggccagaatcccgc
ccgtcagatcgcccttaattctggcctgtccgcagagataccggcttcgactattaaccaggtgtgtggttctg-
gcctgaaagcaataagcatggcgcgc
caacagatcctactcggagaagcggaagtaatagtagcaggaggtatcgaatccatgacgaatgcgccgagtat-
tacatattataataaagaagaagaca
ccctctcaaagcctgttcctacgatgaccttcgatggtctgaccgacgcgtttagcggaaagattatgggttta-
acagccgaaaatgttgccgaacagta
cggcgtatcacgtgaggcccaggacgcctttgcgtatggatcgcagatgaaagcagcaaaggcccaagaacagg-
gcattttcgcagctgaaatactgcct
cttgaaataggggacgaagttattactcaggacgagggggttcgtcaagagaccaccctcgaaaaattaagtct-
gcttcggaccatttttaaagaagatg
gtactgttacagcgggcaacgcctcaacgatcaatgatggcgcctcagccgtgatcattgcatcaaaggagttt-
gctgagacaaaccagattccctacct
tgcgatcgtacatgatattacagagataggcattgatccatcaataatgggcattgctcccgtgagtgcgatca-
ataaactgatcgatcgtaaccaaatt
agcatggaagaaatcgatctctttgaaattaatgaggcatttgcagcatcctcggtggtagttcaaaaagagtt-
aagcattcccgatgaaaagatcaata
ttggcggttccggtattgcactaggccatcctcttggcgccacaggagcgcgcattgtaaccaccctagcgcac-
cagttgaaacgtacacacggacgcta
tggtattgcctccctgtgcattggcggtggccttggcctagcaatattaatagaagtgcctcaggaagatcagc-
cggttaaaaaattttatcaattggcc
cgtgaggaccgtctggctagacttcaggagcaagccgtgatcagcccagctacaaaacatgtactggcagaaat-
gacacttcctgaagatattgccgaca
atctgatcgaaaatcaaatatctgaaatggaaatccctcttggtgtggattgaatctgagggtcaatgataaga-
gttataccatcccactagcaactgag
gaaccgagtgtaatcgctgcctgtaataatggtgcaaaaatggcaaaccacctgggcggttttcagtcagaatt-
aaaagatggtttcctgcgtgggcaaa
ttgtacttatgaacgtcaaagaacccgcaactatcgagcatacgatcacggcagagaaagcggcaatttttcgt-
gccgcagcgcagtcacatccatcgat
tgtgaaacgaggtgggggtctaaaagagatagtagtgcgtacgttcgatgatgatccgacgttcctgtctattg-
atctgatagttgatactaaagacgca
atgggcgctaacatcattaacaccattctcgagggtgtagccggctttctgagggaaatccttaccgaagaaat-
tctgttctctattttatctaattacg
caaccgaatcaattgtgaccgccagctgtcgcataccttacgaagcactgagtaaaaaaggtgatggtaaacga-
atcgctgaaaaagtggctgctgcatc
taaatttgcccagttagatccttatcgagctgcaacccacaacaaaggtattatgaatggtattgaggccgtcg-
ttttggcctcaggaaatgacacacgg
gcggtcgcggcagccgcacatgcgtatgatcacgcgatcagcactatcggggcttaagccagtggcaggttgca-
gaaggcgcgttacacggggagatcag
tctaccacttgcactcggcagcgttggcggtgcaattgaggtcttgcctaaagcgaaggcggcattcgaaatca-
tggggatcacagaggcgaaggagctg
gcagaagtcacagctgcggtagggctggcgcaaaacctggcggcgttaagagcgcttgttagtgaaggaataca-
gcaaggtcacatgtcgctccaggctc
gctctcttgcattatcggtaggtgctacaggcaaggaagttgaaatcctggccgaaaaattacagggctctcgt-
atgaatcaggcgaacgctcagaccat actcgcagagatcagatcgcaaaaagttgaattgtga
SEQ ID NO: 2
atgaccatgaacgttggaatcgataaaatgtcattctttgttccaccttactttgtggacatgactgatctggc-
agtagcacgggatgtcgatcccaata
agtttctgattggtattggccaggaccagatggcagttaatccgaaaacgcaggatattgtgacatttgccaca-
aatgctgccaaaaacatactgtcagc
tgaggaccttgataaaattgatatggtcatagtcggcaccgagagtggaatcgatgaatccaaagcgagtgccg-
tagtgatcacaggttgctcggtatcc
agaagtttgctcgctcattgaaatcaaagaagcctgttatgggggtaccgcggctttacagttcgctgtaaacc-
acattaggaatcatcctgaatcaaag
gttcttgtagttgcatcagatatcgcgaaatacggcctggcttctggaggtgaaccaacgcaaggtgcaggcgc-
tgtggctatgctcgtctcaactgacc
ctaagatcattgctttcaacgacgatagcctcgcgcttacacaagatatctatgacttctggcgaccagttgga-
catgactatcctatggtcgacgggcc
tcttagtacagagacctacatccagtcatttcagaccgtatggcaggaatacacaaaacggtcgcagcatgcac-
tggcagactttgctgcccttagcttt
catatcccgtatactaaaatgggcaaaaaggcgctgcttgcaatccttgaaggcgaatcagaggaggctcagaa-
ccgtatactagcaaaatatgaaaaga
gtatagcctactccagaaaggcgggtaacctgtataccggtagcctgtatctaggacttatttcacttctggaa-
aatgcagaagaccttaaagctggtga
tttaataggcctcttttcttacggttccggtgctgttgcggagtttttctcaggaaggctggttgaggactatc-
aggaacagctacttaaaacaaaacat
gccgaacagctggcccatagaaagcaactgacaatcgaggagtacgaaacgatgttctccgatcgcttggacgt-
ggacaaagacgccgaatacgaagaca
cattagcttatagcatttcgtcagtccgaaacaccgtacgtgagtacaggagttga SEQ ID NO:
3
atgaaagaagtggttatgattgatgcggctcgcacacccattgggaaatacagaggtagtcttagtcatttaca-
gcggtggagctggggacactggtcac
gaaagggctgctggataaaacaaagcttaagaaagacaagatagaccaagtgatattcggcaatgtgcttcagg-
caggaaacggacaaaacgttgcaaga
caaatagccctgaacagtggcttaccagttgacgtgccggcgatgactattaacgaagtttgcgggtccggaat-
gaaagcggtgattttagcccgccagt
taatacagttaggggaggcagagttggtcattgcagggggtacggagtcaatgtcacaagcacccatgctgaaa-
ccttaccagtcagagaccaacgaata
cggagagccgatatcatcaatggttaatgacgggctgacggatgcgttttccaatgctcacatgggtcttactg-
ccgaaaaggtggcgacccagttttca
gtgtcgcgcgaggaacaagaccggtacgcattgtccagccaattgaaagcagcgcacgcggttgaagccggggt-
gttctcagaagagattattccggtta
agattagcgacgaggatgtcttgagtgaagacgaggcagtaagaggcaacagcactttggaaaaactgggcacc-
ttgcggacggtgttttctgaagaggg
cacggttaccgctggcaatgcttcaccgctgaatgacggcgctagtgtcgtgattcttgcatcaaaagaatacg-
cggaaaacaataatctgccttacctg
gcgacgataaaggaggttgcggaagttggtatcgatccttctatcatgggtattgccccaataaaggccattca-
aaagttaacagatcggtcgggcatga
acctgtccacgattgatctgttcgaaattaatgaagcattcgcggcatctagcattgttgtttctcaagagctg-
caattggacgaagaaaaagtgaatat
ctatggcggggcgatagctttaggccatccaatcggcgcaagcggagcccggatactgacaaccttagcatacg-
gcctcctgcgtgagcaaaagcgttat
ggtattgcgtcattatgtatcggcggtggtcttggtctggccgtgctgttagaagctaatatggagcagaccca-
caaagacgttcagaagaaaaagtttt
accagcttaccccctccgagcggagatcgcagcttatcgagaagaacgttctgactcaagaaacggcacttatt-
ttccaggagcagacgttgtccgaaga
actgtccgatcacatgattgagaatcaggtctccgaagtggaaattccaatgggaattgcacaaaattttcaga-
ttaatggcaagaaaaaatggattcct
atggcgactgaagaaccttcagtaatagcggcagcatcgaacggcgccaaaatctgcgggaacatttgcgcgga-
aacgcctcagcggcttatgcgcgggc
agattgtcctgtctggcaaatcagaatatcaagccgtgataaatgccgtgaatcatcgcaaagaagaactgatt-
ctttgcgcaaacgagtcgtacccgag
tattgttaaacgcgggggaggtgttcaggatatttctacgcgggagtttatgggttcttttcacgcgtatttat-
caatcgactttctggtggacgtcaag
gacgcaatgggggcaaacatgatcaactctattctcgaaagcgttgcaaataaactgcgtgaatggttcccgga-
agaggaaatactgttctccatcctgt
caaacttcgctacggagtccctggcatctgcatgttgcgagattccttttgaaagacttggtcgtaacaaagaa-
attggtgaacagatcgccaagaaaat
tcaacaggcaggggaatatgctaagcttgacccttaccgcgcggcaacccataacaaggggattatgaacggta-
tcgaagccgtcgttgccgcaacggga
aacgacacacgggctgtttccgcttctattcacgcatacgccgcccgtaatggcttgtaccaaggtttaacgga-
ttggcagatcaagggcgataaactgg
ttggtaaattaacagtcccactggctgtggcgactgtcggtggcgcgtcgaacatattaccaaaagccaaagct-
tccctcgccatgctggatattgattc
cgcaaaagaactggcccaagtgatcgccgcggtaggtttagcacagaatctggcggcgttacgtgcattagtga-
cagaaggcattcagaaaggacacatg
ggcttgcaagcacgttctttagcgatttcgataggtgccatcggtgaggagatagagcaagtcgcgaaaaaact-
gcgtgaagctgaaaaaatgaatcagc
aaacggcaatacagattttagaaaaaattcgcgagaaatga SEQ ID NO: 4
atgaaaatcggtattgaccgtctgtccttcttcatcccgaatttgtatttggacatgactgagctggcagaatc-
acgcggggatgatccagctaaatatc
atattggaatcggacaagatcagatggcagtgaatcgcgcaaacgaggacatcataacactgggtgcaaacgct-
gcgagtaagatcgtgacagagaaaga
ccgcgagttgattgatatggtaatcgttggcacggaatcaggaattgaccactccaaagcaagcgccgtgatta-
ttcaccatctccttaaaattcagtcg
ttcgcccgttctttcgaggtaaaagaagcttgctatggcggaactgctgccctgcacatggcgaaggagtatgt-
caaaaatcatccggagcgtaaggtct
tggtaattgcgtcagacatcgcgcgttatggtttggccagcggaggagaagttactcaaggcgtgggggccgta-
gccatgatgattacacaaaacccccg
gattctttcgattgaagacgatagtgtttttctcacagaggatatctatgatttctggcggcctgattactccg-
agttccctgtagtggacgggcccctt
tcaaactcaacgtatatagagagttttcagaaagtttggaaccggcacaaggaattgtccggaagagggctgga-
agattatcaagctattgcttttcaca
taccctatacgaagatgggtaagaaagcgctccagagtgttttagaccaaaccgatgaagataaccaggagcgc-
ttaatggctagatatgaggagtctat
tcgctatagccggagaattggtaacctgtacacaggcagcttgtaccttggtcttacaagcttgttggaaaact-
ctaaaagtttacaaccgggagatcgg
atcggcctcttttcctatggcagtggtgcggtgtccgagttctttaccgggtatttagaagaaaattaccaaga-
gtacctgttcgctcaaagccatcaag
aaatgctggatagccggactcggattacggtcgatgaatacgagaccatcttttcagagactctgccagaacat-
ggtgaatgcgccgaatatacgagcga
cgtccccttttctataaccaagattgagaacgacattcgttattataaaatctga SEQ ID NO:
5
atggaagaagtggtaattatagatgcacgtcggactccgattggtaaatatcacgggtcgttgaagaagttttc-
agcggtggcgctggggacggccgtgg
ctaaagacatgttcgaacgcaaccagaaaatcaaagaggagatcgcgcaggtcataattggtaatgtcttgcag-
gcaggaaatggccagaaccccgcgcg
gcaagttgctcttcaatcagggttgtccgttgacattcccgcttctacaattaacgaggtttgtgggtctggtt-
tgaaagctatcttgatgggcatggaa
caaatccaactcggcaaagcgcaagtagtgctggcaggcggcattgaatcaatgacaaatgcgccaagcctgtc-
ccactataacaaggcggaggatacgt
atagtgtcccagtgtcgagcatgacactggatggtctgacagacgcattttctagtaaacctatgggattaaca-
gcggaaaacgtcgcacagcgctacgg
tatctcccgtgaggcgcaagatcaattcgcatatcaatctcagatgaaagcagcaaaagcgcaggcagaaaaca-
aattcgctaaggaaattgtgccactg
gcgggtgaaactaaaaccatcacagctgacgaagggatcagatcccaaacaacgatggagaaactggcaagtct-
caaacctgtttttaaaaccgatggca
ctgtaaccgcagggaatgctagcaccattaatgacggggccgcccttgtgctgcttgctagcaaaacttactgc-
gaaactaatgacataccgtaccttgc
gacaatcaaagaaattgttgaagttggaatcgatccggagattatgggcatctctccgataaaagcgatacaaa-
cattgttacaaaatcaaaaagttagc
ctcgaagatattggagtttttgaaataaatgaagcctttgccgcaagtagcatagtggttgaatctgagttggg-
attagatccggctaaagttaaccgtt
atgggggtggtatatccttaggtcatgcaattggggcaaccggcgctcgcctggccacttcactggtgtatcaa-
atgcaggagatacaagcacgttatgg
tattgcgagcctgtgcgttggtggtggacttggactggcaatgcttttagaacgtccaactattgagaaggcta-
aaccgacagacaaaaagttctatgaa
ttgtcaccagctgaacggttgcaagagctggaaaatcaacagaaaatcagttctgaaactaaacagcagttatc-
tcagatgatgcttgccgaggacactg
caaaccatttgatagaaaatcaaatatcagagattgaactcccaatgggcgtcgggatgaacctgaaggttgat-
gggaaagcctatgttgtgccaatggc
gacggaagagccgtccgtcatcgcggccatgtctaatggtgccaaaatggccggcgaaattcacactcagtcga-
aagaacggctgctcagaggtcagatt
gttttcagcgcgaagaatccgaatgaaatcgaacagagaatagctgagaaccaagctttgattttcgaacgtgc-
cgaacagtcctatccttccattgtga
aaagagagggaggtctccgccgcattgcacttcgtcattttcctgccgattctcagcaggagtctgcggaccag-
tccacatttttatcagtggacctttt
tgtagatgtgaaagacgcgatgggggcaaatatcataaatgcaatacttgagggcgtcgcagccctgtttcgcg-
aatggttccccaatgaggaaattctt
ttttctattctctcgaacttggctacggagagcttagtcacggctgtttgtgaagtcccatttagtgcacttag-
caagagaggtggtgcaacggtggccc
agaaaattgtgcaggcgtcgctcttcgcaaagacagacccataccgcgcagtgacccacaacaaagggattatg-
aacggtgtagaggctgttatgcttgc
cacaggcaacgacacgcgcgcagtctcagccgcttgtcatggatacgcagcgcgcaccggtagctatcagggtc-
tgactaactggacgattgagtcggat
cgcctggtaggcgagataacactgccgctggccatcgctacagttggaggcgctaccaaagtgttgcccaaagc-
tcaagcggcactggagattagtgatg
ttcactcttctcaagagcttgcagccttagcggcgtcagtaggtttagtacaaaatctcgcggccctgcgcgca-
ctggtttccgaaggtatacaaaaagg
gcacatgtccatgcaagcccggtctctcgcaatcgcggtcggtgctgaaaaagccgagatcgagcaggtcgccg-
aaaagttgcggcagaacccgccaatg
aatcagcagcaggcgctccgttttcttggcgagatccgcgaacaatga SEQ ID NO: 6
atgaacgtcggcattgacaaaattaattttttcgttccaccgtattatctggatatggtcgacctggcccacgc-
acgcgaagtggacccgaacaaattta
caattggaattggacaggatcagatggctgtgagcaaaaagacgcacgatatcgtaacattcgcggctagtgcc-
gcgaaggaaattttagaacctgagga
cttgcaagctatagacatggttatagttggtaccgaatcgggcattgacgagagcaaagcatccgcggtcgttt-
tacatcgtttgttgggcgtacaacct
ttcgctcgcagttttgaaattaaagaagcctgttacggggcaaccgcaggcattcagtttgccaagactcatat-
acaagcgaacccggagagcaaggtcc
tggtaattgcaagcgatatagctcggtatggtcttcggtcaggtggagagcccacacaaggcgcaggggcagtt-
gctatgcttctcacggcaaatcccag
aatcctgaccttcgaaaacgacaatctgatgttaacgcaggatatttatgacttctggagaccacttggtcacg-
cttaccctatggtagatggccacctt
tccaatcaagtctatattgacagttttaagaaggtctggcaagcacattgcgaacgcaatcaagcttctatatc-
cgactatgccgcgattagttttcata
ttccgtatacaaaaatgggtaagaaagccctgctcgctgtttttgcagatgaagtggaaactgaacaggaacgc-
gttatggcacggtatgaagagtctat
cgtatattcacgccggatcggcaacttgtatacgggatcattgtacctggggctgatatccttattggaaaaca-
gttctcacctgtcggcgggcgaccgg
ataggattgtttagttatgggagtggcgctgtcagcgaatttttctccggtcgtttagtggcaggctatgaaaa-
tcaattgaacaaagaggcgcataccc
agctcctggatcagcgtcagaagctttccatcgaagagtatgaggcgatttttacagattccttagaaattgat-
caggatgcagcgttctcggatgacct
gccatattccatccgcgagataaaaaacacgattcggtactataaggagagctga SEQ ID NO:
7
atggaagaagttgtcatcattgacgcactgcgtactccaataggaaagtaccacggttcgctgaaagattacac-
agctgttgaactggggacagtagcag
caaaggcgttgctggcacgaaatcagcaagcaaaagaacacatagcgcaagttattattggcaacgtcctgcaa-
gccggaagtgggcagaatccaggccg
acaagtcagtttacagtcaggattgtcttctgatatccccgctagcacgatcaatgaagtgtgtggctcgggta-
tgaaagcgattctgatgggtatggag
caaattcagctgaacaaagcctctgtggtcttaacaggcggaattgaaagcatgaccaacgcgccgctgtttag-
ttattacaacaaggctgaggatcaat
attcggcgccggttagcacaatgatgcacgatggtctaacagatgctttcagttccaaaccaatgggcttaacc-
gcagagaccgtcgctgagagatatgg
aattacgcgtaaggaacaagatgaatttgcttatcactctcaaatgaaggcggccaaagcccaggcggcgaaaa-
agtttgatcaggaaattgtacccctg
acggaaaaatccggaacggttctccaggacgaaggcatcagagccgcgacaacagtcgagaagctagctgagct-
taaaacggtgttcaaaaaagacggaa
cagttacagcgggtaacgcctctacgataaatgatggcgctgctatggtattaatagcatcaaaatcttattgc-
gaagaacaccagattccttatctggc
cgttataaaggagatcgttgaggtgggttttgcccccgaaataatgggtatttcccccattaaggctatagaca-
ccctgctgaaaaatcaagcactgacc
atagaggatataggaatatttgagattaatgaagcctttgctgcgagttcgattgtggtagaacgcgagttggg-
cctggaccccaaaaaagttaatcgct
atggcggtggtatatcactcggccacgcaattggggcgacgggagctcgcattgcgacgaccgttgcttatcag-
ctgaaagatacccaggagcgctacgg
tatagcttccttatgcgttggtgggggtcttggattggcgatgcttctggaaaacccatcggccactgcctcac-
aaactaattttgatgaggaatctgct
tccgaaaaaactgagaagaagaagttttatgcgctagctcctaacgaacgcttagcgtttttggaagcccaagg-
cgctattaccgctgctgaaaccctgg
tcttccaggagatgaccttaaacaaagagacagccaatcacttaatcgaaaaccaaatcagcgaagttgaaatt-
cctttaggcgtgggcctgaacttaca
ggtgaatgggaaagcgtataatgttcctctggccacggaggaaccgtccgttatcgctgcgatgtcgaatggcg-
ccaaaatggctggtcctattacaaca
acaagtcaggagaggctgttacggggtcagattgtcttcatggacgtacaggacccagaagcaatattagcgaa-
agttgaatccgagcaagctaccattt
tcgcggtggcaaatgaaacatacccgtctatcgtgaaaagaggaggaggtctgcgtagagtcattggcaggaat-
ttcagtccggccgaaagtgacttagc
cacggcgtatgtatcaattgacctgatggtagatgttaaggatgcaatgggtgctaatatcatcaatagtatcc-
tagaaggtgttgcggaattgtttaga
aaatggttcccagaagaagaaatcctgttctcaattctctccaatctcgcgacagaaagtctggtaacggcgac-
gtgctcagttccgtttgataaattgt
ccaaaactgggaatggtcgacaagtagctggtaaaatagtgcacgcggcggactttgctaagatagatccatac-
agagctgccacacacaataaaggtat
tatgaatggcgttgaagcgttaatcttagccaccggtaatgacacccgtgcggtgtcggctgcatgccacggtt-
acgcggcacgcaatgggcgaatgcaa
gggcttacctcttggacgattatcgaagatcggctgataggctctatcacattacctttggctattgcgacagt-
ggggggtgccacaaaaatcttgccaa
aagcacaggccgccctggcgctaactggcgttgagacggcgtcggaactggccagcctggcggcgagtgtggga-
ttagttcaaaatttggccgctttacg
agcactagtgagcgagggcattcagcaagggcacatgagtatgcaagctagatccctggccattagcgtaggtg-
cgaaaggtactgaaatagagcaacta
gctgcgaagctgagggcagcgacgcaaatgaatcaggagcaggctcgtaaatttctgaccgaaataagaaatta-
a SEQ ID NO: 8
atgaacgttggaattgataaaatcaattttttcgttccgccctatttcattgatatggtggatctcgctcatgc-
aagagaagttgaccccaacaagttca
ctataggaataggccaagatcagatggcagtaaacaagaaaacgcaagatatcgtaacgttcgcgatgcacgcc-
gcgaaggatattctgactaaggaaga
tttacaggccatagatatggtaatagtggggactgagtctgggatcgacgagagcaaggcaagtgctgtcgtat-
tgcatcggcttttaggtattcagcct
tttgcgcgctcctttgaaattaaggaggcatgctatggggccactgccggccttcagtttgcaaaagctcatgt-
gcaggctaatccccagagcaaggtcc
tggtggtagcttccgatatagcacgctacggactggcatccggaggagaaccgactcaaggtgtaggtgctgtg-
gcaatgttgatttccgctgatccagc
tatcttgcagttagaaaatgataatctcatgttgacccaagatatatacgatttttggcgcccggtcgggcatc-
aatatcctatggtagacggccatctg
tctaatgccgtctatatagacagctttaaacaagtctggcaagcacattgcgagaaaaaccaacggactgctaa-
agattatgctgcattgtcgttccata
ttccgtacacgaaaatgggtaagaaagctctgttagcggtttttgcggaggaagatgagacagaacaaaagcgg-
ttaatggcacgttatgaagaatcaat
tgtatacagtcgtcggactggaaatctgtatactggctcactctatctgggcctgatttccttactggagaata-
gtagcagtttacaggcgaacgatcgc
ataggtctgtttagctatggttcaggggccgttgcggaatttttcagtggcctcttggtaccgggttacgagaa-
acaattagcgcaagctgcccatcaag
ctcttctggacgaccggcaaaaactgactatcgcagagtacgaagccatgtttaatgaaaccattgatattgat-
caggaccagtcatttgaggatgactt
actgtactccatcagagagatcaaaaacactattcgctactataacgaggagaatgaataa SEQ
ID NO: 9
Sequence CWU 1
1
131329PRTArtificial SequenceSynthetic Construct 1Met Thr Asp Val
Arg Phe Arg Ile Ile Gly Thr Gly Ala Tyr Val Pro1 5 10 15 Glu Arg
Ile Val Ser Asn Asp Glu Val Gly Ala Pro Ala Gly Val Asp 20 25 30
Asp Asp Trp Ile Thr Arg Lys Thr Gly Ile Arg Gln Arg Arg Trp Ala 35
40 45 Ala Asp Asp Gln Ala Thr Ser Asp Leu Ala Thr Ala Ala Gly Arg
Ala 50 55 60 Ala Leu Lys Ala Ala Gly Ile Thr Pro Glu Gln Leu Thr
Val Ile Ala65 70 75 80 Val Ala Thr Ser Thr Pro Asp Arg Pro Gln Pro
Pro Thr Ala Ala Tyr 85 90 95 Val Gln His His Leu Gly Ala Thr Gly
Thr Ala Ala Phe Asp Val Asn 100 105 110 Ala Val Cys Ser Gly Thr Val
Phe Ala Leu Ser Ser Val Ala Gly Thr 115 120 125 Leu Val Tyr Arg Gly
Gly Tyr Ala Leu Val Ile Gly Ala Asp Leu Tyr 130 135 140 Ser Arg Ile
Leu Asn Pro Ala Asp Arg Lys Thr Val Val Leu Phe Gly145 150 155 160
Asp Gly Ala Gly Ala Met Val Leu Gly Pro Thr Ser Thr Gly Thr Gly 165
170 175 Pro Ile Val Arg Arg Val Ala Leu His Thr Phe Gly Gly Leu Thr
Asp 180 185 190 Leu Ile Arg Val Pro Ala Gly Gly Ser Arg Gln Pro Leu
Asp Thr Asp 195 200 205 Gly Leu Asp Ala Gly Leu Gln Tyr Phe Ala Met
Asp Gly Arg Glu Val 210 215 220 Arg Arg Phe Val Thr Glu His Leu Pro
Gln Leu Ile Lys Gly Phe Leu225 230 235 240 His Glu Ala Gly Val Asp
Ala Ala Asp Ile Ser His Phe Val Pro His 245 250 255 Gln Ala Asn Gly
Val Met Leu Asp Glu Val Phe Gly Glu Leu His Leu 260 265 270 Pro Arg
Ala Thr Met His Arg Thr Val Glu Thr Tyr Gly Asn Thr Gly 275 280 285
Ala Ala Ser Ile Pro Ile Thr Met Asp Ala Ala Val Arg Ala Gly Ser 290
295 300 Phe Arg Pro Gly Glu Leu Val Leu Leu Ala Gly Phe Gly Gly Gly
Met305 310 315 320 Ala Ala Ser Phe Ala Leu Ile Glu Trp 325
22439DNAListeria grayi DMS 20601 2atggttaaag acattgtaat aattgatgcc
ctccgtactc ccatcggtaa gtaccgcggt 60cagctctcaa agatgacggc ggtggaattg
ggaaccgcag ttacaaaggc tctgttcgag 120aagaacgacc aggtcaaaga
ccatgtagaa caagtcattt ttggcaacgt tttacaggca 180gggaacggcc
agaatcccgc ccgtcagatc gcccttaatt ctggcctgtc cgcagagata
240ccggcttcga ctattaacca ggtgtgtggt tctggcctga aagcaataag
catggcgcgc 300caacagatcc tactcggaga agcggaagta atagtagcag
gaggtatcga atccatgacg 360aatgcgccga gtattacata ttataataaa
gaagaagaca ccctctcaaa gcctgttcct 420acgatgacct tcgatggtct
gaccgacgcg tttagcggaa agattatggg tttaacagcc 480gaaaatgttg
ccgaacagta cggcgtatca cgtgaggccc aggacgcctt tgcgtatgga
540tcgcagatga aagcagcaaa ggcccaagaa cagggcattt tcgcagctga
aatactgcct 600cttgaaatag gggacgaagt tattactcag gacgaggggg
ttcgtcaaga gaccaccctc 660gaaaaattaa gtctgcttcg gaccattttt
aaagaagatg gtactgttac agcgggcaac 720gcctcaacga tcaatgatgg
cgcctcagcc gtgatcattg catcaaagga gtttgctgag 780acaaaccaga
ttccctacct tgcgatcgta catgatatta cagagatagg cattgatcca
840tcaataatgg gcattgctcc cgtgagtgcg atcaataaac tgatcgatcg
taaccaaatt 900agcatggaag aaatcgatct ctttgaaatt aatgaggcat
ttgcagcatc ctcggtggta 960gttcaaaaag agttaagcat tcccgatgaa
aagatcaata ttggcggttc cggtattgca 1020ctaggccatc ctcttggcgc
cacaggagcg cgcattgtaa ccaccctagc gcaccagttg 1080aaacgtacac
acggacgcta tggtattgcc tccctgtgca ttggcggtgg ccttggccta
1140gcaatattaa tagaagtgcc tcaggaagat cagccggtta aaaaatttta
tcaattggcc 1200cgtgaggacc gtctggctag acttcaggag caagccgtga
tcagcccagc tacaaaacat 1260gtactggcag aaatgacact tcctgaagat
attgccgaca atctgatcga aaatcaaata 1320tctgaaatgg aaatccctct
tggtgtggct ttgaatctga gggtcaatga taagagttat 1380accatcccac
tagcaactga ggaaccgagt gtaatcgctg cctgtaataa tggtgcaaaa
1440atggcaaacc acctgggcgg ttttcagtca gaattaaaag atggtttcct
gcgtgggcaa 1500attgtactta tgaacgtcaa agaacccgca actatcgagc
atacgatcac ggcagagaaa 1560gcggcaattt ttcgtgccgc agcgcagtca
catccatcga ttgtgaaacg aggtgggggt 1620ctaaaagaga tagtagtgcg
tacgttcgat gatgatccga cgttcctgtc tattgatctg 1680atagttgata
ctaaagacgc aatgggcgct aacatcatta acaccattct cgagggtgta
1740gccggctttc tgagggaaat ccttaccgaa gaaattctgt tctctatttt
atctaattac 1800gcaaccgaat caattgtgac cgccagctgt cgcatacctt
acgaagcact gagtaaaaaa 1860ggtgatggta aacgaatcgc tgaaaaagtg
gctgctgcat ctaaatttgc ccagttagat 1920ccttatcgag ctgcaaccca
caacaaaggt attatgaatg gtattgaggc cgtcgttttg 1980gcctcaggaa
atgacacacg ggcggtcgcg gcagccgcac atgcgtatgc ttcacgcgat
2040cagcactatc ggggcttaag ccagtggcag gttgcagaag gcgcgttaca
cggggagatc 2100agtctaccac ttgcactcgg cagcgttggc ggtgcaattg
aggtcttgcc taaagcgaag 2160gcggcattcg aaatcatggg gatcacagag
gcgaaggagc tggcagaagt cacagctgcg 2220gtagggctgg cgcaaaacct
ggcggcgtta agagcgcttg ttagtgaagg aatacagcaa 2280ggtcacatgt
cgctccaggc tcgctctctt gcattatcgg taggtgctac aggcaaggaa
2340gttgaaatcc tggccgaaaa attacagggc tctcgtatga atcaggcgaa
cgctcagacc 2400atactcgcag agatcagatc gcaaaaagtt gaattgtga
243931158DNAEnterococcus faecium mvaE 3atgaccatga acgttggaat
cgataaaatg tcattctttg ttccacctta ctttgtggac 60atgactgatc tggcagtagc
acgggatgtc gatcccaata agtttctgat tggtattggc 120caggaccaga
tggcagttaa tccgaaaacg caggatattg tgacatttgc cacaaatgct
180gccaaaaaca tactgtcagc tgaggacctt gataaaattg atatggtcat
agtcggcacc 240gagagtggaa tcgatgaatc caaagcgagt gccgtagtgc
ttcacaggtt gctcggtatc 300cagaagtttg ctcgctcctt tgaaatcaaa
gaagcctgtt atgggggtac cgcggcttta 360cagttcgctg taaaccacat
taggaatcat cctgaatcaa aggttcttgt agttgcatca 420gatatcgcga
aatacggcct ggcttctgga ggtgaaccaa cgcaaggtgc aggcgctgtg
480gctatgctcg tctcaactga ccctaagatc attgctttca acgacgatag
cctcgcgctt 540acacaagata tctatgactt ctggcgacca gttggacatg
actatcctat ggtcgacggg 600cctcttagta cagagaccta catccagtca
tttcagaccg tatggcagga atacacaaaa 660cggtcgcagc atgcactggc
agactttgct gcccttagct ttcatatccc gtatactaaa 720atgggcaaaa
aggcgctgct tgcaatcctt gaaggcgaat cagaggaggc tcagaaccgt
780atactagcaa aatatgaaaa gagtatagcc tactccagaa aggcgggtaa
cctgtatacc 840ggtagcctgt atctaggact tatttcactt ctggaaaatg
cagaagacct taaagctggt 900gatttaatag gcctcttttc ttacggttcc
ggtgctgttg cggagttttt ctcaggaagg 960ctggttgagg actatcagga
acagctactt aaaacaaaac atgccgaaca gctggcccat 1020agaaagcaac
tgacaatcga ggagtacgaa acgatgttct ccgatcgctt ggacgtggac
1080aaagacgccg aatacgaaga cacattagct tatagcattt cgtcagtccg
aaacaccgta 1140cgtgagtaca ggagttga 115842442DNAEnterococcus
gallinarum EG2 mvaE 4atgaaagaag tggttatgat tgatgcggct cgcacaccca
ttgggaaata cagaggtagt 60cttagtcctt ttacagcggt ggagctgggg acactggtca
cgaaagggct gctggataaa 120acaaagctta agaaagacaa gatagaccaa
gtgatattcg gcaatgtgct tcaggcagga 180aacggacaaa acgttgcaag
acaaatagcc ctgaacagtg gcttaccagt tgacgtgccg 240gcgatgacta
ttaacgaagt ttgcgggtcc ggaatgaaag cggtgatttt agcccgccag
300ttaatacagt taggggaggc agagttggtc attgcagggg gtacggagtc
aatgtcacaa 360gcacccatgc tgaaacctta ccagtcagag accaacgaat
acggagagcc gatatcatca 420atggttaatg acgggctgac ggatgcgttt
tccaatgctc acatgggtct tactgccgaa 480aaggtggcga cccagttttc
agtgtcgcgc gaggaacaag accggtacgc attgtccagc 540caattgaaag
cagcgcacgc ggttgaagcc ggggtgttct cagaagagat tattccggtt
600aagattagcg acgaggatgt cttgagtgaa gacgaggcag taagaggcaa
cagcactttg 660gaaaaactgg gcaccttgcg gacggtgttt tctgaagagg
gcacggttac cgctggcaat 720gcttcaccgc tgaatgacgg cgctagtgtc
gtgattcttg catcaaaaga atacgcggaa 780aacaataatc tgccttacct
ggcgacgata aaggaggttg cggaagttgg tatcgatcct 840tctatcatgg
gtattgcccc aataaaggcc attcaaaagt taacagatcg gtcgggcatg
900aacctgtcca cgattgatct gttcgaaatt aatgaagcat tcgcggcatc
tagcattgtt 960gtttctcaag agctgcaatt ggacgaagaa aaagtgaata
tctatggcgg ggcgatagct 1020ttaggccatc caatcggcgc aagcggagcc
cggatactga caaccttagc atacggcctc 1080ctgcgtgagc aaaagcgtta
tggtattgcg tcattatgta tcggcggtgg tcttggtctg 1140gccgtgctgt
tagaagctaa tatggagcag acccacaaag acgttcagaa gaaaaagttt
1200taccagctta ccccctccga gcggagatcg cagcttatcg agaagaacgt
tctgactcaa 1260gaaacggcac ttattttcca ggagcagacg ttgtccgaag
aactgtccga tcacatgatt 1320gagaatcagg tctccgaagt ggaaattcca
atgggaattg cacaaaattt tcagattaat 1380ggcaagaaaa aatggattcc
tatggcgact gaagaacctt cagtaatagc ggcagcatcg 1440aacggcgcca
aaatctgcgg gaacatttgc gcggaaacgc ctcagcggct tatgcgcggg
1500cagattgtcc tgtctggcaa atcagaatat caagccgtga taaatgccgt
gaatcatcgc 1560aaagaagaac tgattctttg cgcaaacgag tcgtacccga
gtattgttaa acgcggggga 1620ggtgttcagg atatttctac gcgggagttt
atgggttctt ttcacgcgta tttatcaatc 1680gactttctgg tggacgtcaa
ggacgcaatg ggggcaaaca tgatcaactc tattctcgaa 1740agcgttgcaa
ataaactgcg tgaatggttc ccggaagagg aaatactgtt ctccatcctg
1800tcaaacttcg ctacggagtc cctggcatct gcatgttgcg agattccttt
tgaaagactt 1860ggtcgtaaca aagaaattgg tgaacagatc gccaagaaaa
ttcaacaggc aggggaatat 1920gctaagcttg acccttaccg cgcggcaacc
cataacaagg ggattatgaa cggtatcgaa 1980gccgtcgttg ccgcaacggg
aaacgacaca cgggctgttt ccgcttctat tcacgcatac 2040gccgcccgta
atggcttgta ccaaggttta acggattggc agatcaaggg cgataaactg
2100gttggtaaat taacagtccc actggctgtg gcgactgtcg gtggcgcgtc
gaacatatta 2160ccaaaagcca aagcttccct cgccatgctg gatattgatt
ccgcaaaaga actggcccaa 2220gtgatcgccg cggtaggttt agcacagaat
ctggcggcgt tacgtgcatt agtgacagaa 2280ggcattcaga aaggacacat
gggcttgcaa gcacgttctt tagcgatttc gataggtgcc 2340atcggtgagg
agatagagca agtcgcgaaa aaactgcgtg aagctgaaaa aatgaatcag
2400caaacggcaa tacagatttt agaaaaaatt cgcgagaaat ga
244251155DNAEnterococcus casseliflavus mvaE 5atgaaaatcg gtattgaccg
tctgtccttc ttcatcccga atttgtattt ggacatgact 60gagctggcag aatcacgcgg
ggatgatcca gctaaatatc atattggaat cggacaagat 120cagatggcag
tgaatcgcgc aaacgaggac atcataacac tgggtgcaaa cgctgcgagt
180aagatcgtga cagagaaaga ccgcgagttg attgatatgg taatcgttgg
cacggaatca 240ggaattgacc actccaaagc aagcgccgtg attattcacc
atctccttaa aattcagtcg 300ttcgcccgtt ctttcgaggt aaaagaagct
tgctatggcg gaactgctgc cctgcacatg 360gcgaaggagt atgtcaaaaa
tcatccggag cgtaaggtct tggtaattgc gtcagacatc 420gcgcgttatg
gtttggccag cggaggagaa gttactcaag gcgtgggggc cgtagccatg
480atgattacac aaaacccccg gattctttcg attgaagacg atagtgtttt
tctcacagag 540gatatctatg atttctggcg gcctgattac tccgagttcc
ctgtagtgga cgggcccctt 600tcaaactcaa cgtatataga gagttttcag
aaagtttgga accggcacaa ggaattgtcc 660ggaagagggc tggaagatta
tcaagctatt gcttttcaca taccctatac gaagatgggt 720aagaaagcgc
tccagagtgt tttagaccaa accgatgaag ataaccagga gcgcttaatg
780gctagatatg aggagtctat tcgctatagc cggagaattg gtaacctgta
cacaggcagc 840ttgtaccttg gtcttacaag cttgttggaa aactctaaaa
gtttacaacc gggagatcgg 900atcggcctct tttcctatgg cagtggtgcg
gtgtccgagt tctttaccgg gtatttagaa 960gaaaattacc aagagtacct
gttcgctcaa agccatcaag aaatgctgga tagccggact 1020cggattacgg
tcgatgaata cgagaccatc ttttcagaga ctctgccaga acatggtgaa
1080tgcgccgaat atacgagcga cgtccccttt tctataacca agattgagaa
cgacattcgt 1140tattataaaa tctga 115562448DNAListeria grayi DSM
20601 6atggaagaag tggtaattat agatgcacgt cggactccga ttggtaaata
tcacgggtcg 60ttgaagaagt tttcagcggt ggcgctgggg acggccgtgg ctaaagacat
gttcgaacgc 120aaccagaaaa tcaaagagga gatcgcgcag gtcataattg
gtaatgtctt gcaggcagga 180aatggccaga accccgcgcg gcaagttgct
cttcaatcag ggttgtccgt tgacattccc 240gcttctacaa ttaacgaggt
ttgtgggtct ggtttgaaag ctatcttgat gggcatggaa 300caaatccaac
tcggcaaagc gcaagtagtg ctggcaggcg gcattgaatc aatgacaaat
360gcgccaagcc tgtcccacta taacaaggcg gaggatacgt atagtgtccc
agtgtcgagc 420atgacactgg atggtctgac agacgcattt tctagtaaac
ctatgggatt aacagcggaa 480aacgtcgcac agcgctacgg tatctcccgt
gaggcgcaag atcaattcgc atatcaatct 540cagatgaaag cagcaaaagc
gcaggcagaa aacaaattcg ctaaggaaat tgtgccactg 600gcgggtgaaa
ctaaaaccat cacagctgac gaagggatca gatcccaaac aacgatggag
660aaactggcaa gtctcaaacc tgtttttaaa accgatggca ctgtaaccgc
agggaatgct 720agcaccatta atgacggggc cgcccttgtg ctgcttgcta
gcaaaactta ctgcgaaact 780aatgacatac cgtaccttgc gacaatcaaa
gaaattgttg aagttggaat cgatccggag 840attatgggca tctctccgat
aaaagcgata caaacattgt tacaaaatca aaaagttagc 900ctcgaagata
ttggagtttt tgaaataaat gaagcctttg ccgcaagtag catagtggtt
960gaatctgagt tgggattaga tccggctaaa gttaaccgtt atgggggtgg
tatatcctta 1020ggtcatgcaa ttggggcaac cggcgctcgc ctggccactt
cactggtgta tcaaatgcag 1080gagatacaag cacgttatgg tattgcgagc
ctgtgcgttg gtggtggact tggactggca 1140atgcttttag aacgtccaac
tattgagaag gctaaaccga cagacaaaaa gttctatgaa 1200ttgtcaccag
ctgaacggtt gcaagagctg gaaaatcaac agaaaatcag ttctgaaact
1260aaacagcagt tatctcagat gatgcttgcc gaggacactg caaaccattt
gatagaaaat 1320caaatatcag agattgaact cccaatgggc gtcgggatga
acctgaaggt tgatgggaaa 1380gcctatgttg tgccaatggc gacggaagag
ccgtccgtca tcgcggccat gtctaatggt 1440gccaaaatgg ccggcgaaat
tcacactcag tcgaaagaac ggctgctcag aggtcagatt 1500gttttcagcg
cgaagaatcc gaatgaaatc gaacagagaa tagctgagaa ccaagctttg
1560attttcgaac gtgccgaaca gtcctatcct tccattgtga aaagagaggg
aggtctccgc 1620cgcattgcac ttcgtcattt tcctgccgat tctcagcagg
agtctgcgga ccagtccaca 1680tttttatcag tggacctttt tgtagatgtg
aaagacgcga tgggggcaaa tatcataaat 1740gcaatacttg agggcgtcgc
agccctgttt cgcgaatggt tccccaatga ggaaattctt 1800ttttctattc
tctcgaactt ggctacggag agcttagtca cggctgtttg tgaagtccca
1860tttagtgcac ttagcaagag aggtggtgca acggtggccc agaaaattgt
gcaggcgtcg 1920ctcttcgcaa agacagaccc ataccgcgca gtgacccaca
acaaagggat tatgaacggt 1980gtagaggctg ttatgcttgc cacaggcaac
gacacgcgcg cagtctcagc cgcttgtcat 2040ggatacgcag cgcgcaccgg
tagctatcag ggtctgacta actggacgat tgagtcggat 2100cgcctggtag
gcgagataac actgccgctg gccatcgcta cagttggagg cgctaccaaa
2160gtgttgccca aagctcaagc ggcactggag attagtgatg ttcactcttc
tcaagagctt 2220gcagccttag cggcgtcagt aggtttagta caaaatctcg
cggccctgcg cgcactggtt 2280tccgaaggta tacaaaaagg gcacatgtcc
atgcaagccc ggtctctcgc aatcgcggtc 2340ggtgctgaaa aagccgagat
cgagcaggtc gccgaaaagt tgcggcagaa cccgccaatg 2400aatcagcagc
aggcgctccg ttttcttggc gagatccgcg aacaatga 244871155DNAEnterococcus
faecium mvaS 7atgaacgtcg gcattgacaa aattaatttt ttcgttccac
cgtattatct ggatatggtc 60gacctggccc acgcacgcga agtggacccg aacaaattta
caattggaat tggacaggat 120cagatggctg tgagcaaaaa gacgcacgat
atcgtaacat tcgcggctag tgccgcgaag 180gaaattttag aacctgagga
cttgcaagct atagacatgg ttatagttgg taccgaatcg 240ggcattgacg
agagcaaagc atccgcggtc gttttacatc gtttgttggg cgtacaacct
300ttcgctcgca gttttgaaat taaagaagcc tgttacgggg caaccgcagg
cattcagttt 360gccaagactc atatacaagc gaacccggag agcaaggtcc
tggtaattgc aagcgatata 420gctcggtatg gtcttcggtc aggtggagag
cccacacaag gcgcaggggc agttgctatg 480cttctcacgg caaatcccag
aatcctgacc ttcgaaaacg acaatctgat gttaacgcag 540gatatttatg
acttctggag accacttggt cacgcttacc ctatggtaga tggccacctt
600tccaatcaag tctatattga cagttttaag aaggtctggc aagcacattg
cgaacgcaat 660caagcttcta tatccgacta tgccgcgatt agttttcata
ttccgtatac aaaaatgggt 720aagaaagccc tgctcgctgt ttttgcagat
gaagtggaaa ctgaacagga acgcgttatg 780gcacggtatg aagagtctat
cgtatattca cgccggatcg gcaacttgta tacgggatca 840ttgtacctgg
ggctgatatc cttattggaa aacagttctc acctgtcggc gggcgaccgg
900ataggattgt ttagttatgg gagtggcgct gtcagcgaat ttttctccgg
tcgtttagtg 960gcaggctatg aaaatcaatt gaacaaagag gcgcataccc
agctcctgga tcagcgtcag 1020aagctttcca tcgaagagta tgaggcgatt
tttacagatt ccttagaaat tgatcaggat 1080gcagcgttct cggatgacct
gccatattcc atccgcgaga taaaaaacac gattcggtac 1140tataaggaga gctga
115582475DNAEnterococcus gallinarum EG2 mvaS 8atggaagaag ttgtcatcat
tgacgcactg cgtactccaa taggaaagta ccacggttcg 60ctgaaagatt acacagctgt
tgaactgggg acagtagcag caaaggcgtt gctggcacga 120aatcagcaag
caaaagaaca catagcgcaa gttattattg gcaacgtcct gcaagccgga
180agtgggcaga atccaggccg acaagtcagt ttacagtcag gattgtcttc
tgatatcccc 240gctagcacga tcaatgaagt gtgtggctcg ggtatgaaag
cgattctgat gggtatggag 300caaattcagc tgaacaaagc ctctgtggtc
ttaacaggcg gaattgaaag catgaccaac 360gcgccgctgt ttagttatta
caacaaggct gaggatcaat attcggcgcc ggttagcaca 420atgatgcacg
atggtctaac agatgctttc agttccaaac caatgggctt aaccgcagag
480accgtcgctg agagatatgg aattacgcgt aaggaacaag atgaatttgc
ttatcactct 540caaatgaagg cggccaaagc ccaggcggcg aaaaagtttg
atcaggaaat tgtacccctg 600acggaaaaat ccggaacggt tctccaggac
gaaggcatca gagccgcgac aacagtcgag 660aagctagctg agcttaaaac
ggtgttcaaa aaagacggaa cagttacagc gggtaacgcc 720tctacgataa
atgatggcgc tgctatggta ttaatagcat caaaatctta ttgcgaagaa
780caccagattc cttatctggc cgttataaag gagatcgttg aggtgggttt
tgcccccgaa 840ataatgggta tttcccccat taaggctata gacaccctgc
tgaaaaatca agcactgacc 900atagaggata taggaatatt tgagattaat
gaagcctttg ctgcgagttc gattgtggta 960gaacgcgagt tgggcctgga
ccccaaaaaa gttaatcgct atggcggtgg tatatcactc 1020ggccacgcaa
ttggggcgac gggagctcgc attgcgacga ccgttgctta tcagctgaaa
1080gatacccagg agcgctacgg tatagcttcc ttatgcgttg gtgggggtct
tggattggcg 1140atgcttctgg aaaacccatc ggccactgcc tcacaaacta
attttgatga ggaatctgct 1200tccgaaaaaa ctgagaagaa gaagttttat
gcgctagctc ctaacgaacg cttagcgttt 1260ttggaagccc aaggcgctat
taccgctgct gaaaccctgg tcttccagga gatgacctta 1320aacaaagaga
cagccaatca cttaatcgaa aaccaaatca gcgaagttga aattccttta
1380ggcgtgggcc tgaacttaca ggtgaatggg aaagcgtata atgttcctct
ggccacggag 1440gaaccgtccg ttatcgctgc gatgtcgaat ggcgccaaaa
tggctggtcc tattacaaca 1500acaagtcagg agaggctgtt acggggtcag
attgtcttca tggacgtaca ggacccagaa 1560gcaatattag cgaaagttga
atccgagcaa gctaccattt tcgcggtggc aaatgaaaca 1620tacccgtcta
tcgtgaaaag aggaggaggt ctgcgtagag
tcattggcag gaatttcagt 1680ccggccgaaa gtgacttagc cacggcgtat
gtatcaattg acctgatggt agatgttaag 1740gatgcaatgg gtgctaatat
catcaatagt atcctagaag gtgttgcgga attgtttaga 1800aaatggttcc
cagaagaaga aatcctgttc tcaattctct ccaatctcgc gacagaaagt
1860ctggtaacgg cgacgtgctc agttccgttt gataaattgt ccaaaactgg
gaatggtcga 1920caagtagctg gtaaaatagt gcacgcggcg gactttgcta
agatagatcc atacagagct 1980gccacacaca ataaaggtat tatgaatggc
gttgaagcgt taatcttagc caccggtaat 2040gacacccgtg cggtgtcggc
tgcatgccac ggttacgcgg cacgcaatgg gcgaatgcaa 2100gggcttacct
cttggacgat tatcgaagat cggctgatag gctctatcac attacctttg
2160gctattgcga cagtgggggg tgccacaaaa atcttgccaa aagcacaggc
cgccctggcg 2220ctaactggcg ttgagacggc gtcggaactg gccagcctgg
cggcgagtgt gggattagtt 2280caaaatttgg ccgctttacg agcactagtg
agcgagggca ttcagcaagg gcacatgagt 2340atgcaagcta gatccctggc
cattagcgta ggtgcgaaag gtactgaaat agagcaacta 2400gctgcgaagc
tgagggcagc gacgcaaatg aatcaggagc aggctcgtaa atttctgacc
2460gaaataagaa attaa 247591161DNAEnterococcus casseliflavus mvaS
9atgaacgttg gaattgataa aatcaatttt ttcgttccgc cctatttcat tgatatggtg
60gatctcgctc atgcaagaga agttgacccc aacaagttca ctataggaat aggccaagat
120cagatggcag taaacaagaa aacgcaagat atcgtaacgt tcgcgatgca
cgccgcgaag 180gatattctga ctaaggaaga tttacaggcc atagatatgg
taatagtggg gactgagtct 240gggatcgacg agagcaaggc aagtgctgtc
gtattgcatc ggcttttagg tattcagcct 300tttgcgcgct cctttgaaat
taaggaggca tgctatgggg ccactgccgg ccttcagttt 360gcaaaagctc
atgtgcaggc taatccccag agcaaggtcc tggtggtagc ttccgatata
420gcacgctacg gactggcatc cggaggagaa ccgactcaag gtgtaggtgc
tgtggcaatg 480ttgatttccg ctgatccagc tatcttgcag ttagaaaatg
ataatctcat gttgacccaa 540gatatatacg atttttggcg cccggtcggg
catcaatatc ctatggtaga cggccatctg 600tctaatgccg tctatataga
cagctttaaa caagtctggc aagcacattg cgagaaaaac 660caacggactg
ctaaagatta tgctgcattg tcgttccata ttccgtacac gaaaatgggt
720aagaaagctc tgttagcggt ttttgcggag gaagatgaga cagaacaaaa
gcggttaatg 780gcacgttatg aagaatcaat tgtatacagt cgtcggactg
gaaatctgta tactggctca 840ctctatctgg gcctgatttc cttactggag
aatagtagca gtttacaggc gaacgatcgc 900ataggtctgt ttagctatgg
ttcaggggcc gttgcggaat ttttcagtgg cctcttggta 960ccgggttacg
agaaacaatt agcgcaagct gcccatcaag ctcttctgga cgaccggcaa
1020aaactgacta tcgcagagta cgaagccatg tttaatgaaa ccattgatat
tgatcaggac 1080cagtcatttg aggatgactt actgtactcc atcagagaga
tcaaaaacac tattcgctac 1140tataacgagg agaatgaata a
116110125DNAEnterobacteria phage lambda 10aattcatata aaaaacatac
agataaccat ctgcggtgat aaattatctc tggcggtgtt 60gacataaata ccactggcgg
tgatactgag cacatcagca ggacgcactg accaccatga 120aggtg
1251124DNAArtificial SequenceSynthetic Construct 11cagcaaatag
caggtgtatc cagc 241224DNAArtificial SequenceSynthetic Construct
12gcaaccgact gttgatagaa caac 241324DNAArtificial SequenceSynthetic
Construct 13ggttacaaaa tgattggcgt acgc 24
* * * * *