U.S. patent application number 14/280324 was filed with the patent office on 2014-12-25 for fibrous protein fusions and use thereof in the formation of advanced organic/inorganic composite materials.
This patent application is currently assigned to TRUSTEES OF TUFTS COLLEGE. The applicant listed for this patent is UNITED STATES OF AMERICAN AS REPRESENTED BY THE SECRETARY OF THE AIR FORCE AFM, TRUSTEES OF TUFTS COLLEGE, UNITED STATES OF AMERICAN AS REPRESENTED BY THE SECRETARY OF THE AIR FORCE AFM, UNIVERSITY OF ILLINOIS AT CHICAGO. Invention is credited to Anne George, Jia Huang, David L. Kaplan, Rajesh Naik, Cheryl Wong Po Foo.
Application Number | 20140379094 14/280324 |
Document ID | / |
Family ID | 36678281 |
Filed Date | 2014-12-25 |
United States Patent
Application |
20140379094 |
Kind Code |
A1 |
Kaplan; David L. ; et
al. |
December 25, 2014 |
FIBROUS PROTEIN FUSIONS AND USE THEREOF IN THE FORMATION OF
ADVANCED ORGANIC/INORGANIC COMPOSITE MATERIALS
Abstract
The claimed invention provides a fusion polypeptide comprising a
fibrous protein domain and a mineralization domain. The fusion is
used to form an organic-inorganic composite. These
organic-inorganic composites can be constructed from the nano- to
the macro-scale depending on the size of the fibrous protein fusion
domain used. In one embodiment, the composites can also be loaded
with other compounds (e.g., dyes, drugs, enzymes) depending on the
goal for the materials, to further enhance function. This can be
achieved during assembly of the material or during the
mineralization step in materials formation.
Inventors: |
Kaplan; David L.; (Concord,
MA) ; Huang; Jia; (Maiden, MA) ; Wong Po Foo;
Cheryl; (Santa Clara, CA) ; Naik; Rajesh;
(Dayton, OH) ; George; Anne; (Chicago,
IL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
TRUSTEES OF TUFTS COLLEGE
UNITED STATES OF AMERICAN AS REPRESENTED BY THE SECRETARY OF THE
AIR FORCE AFM
UNIVERSITY OF ILLINOIS AT CHICAGO |
Medford
Wright Patterson AFB
Chicago |
MA
OH
IL |
US
US
US |
|
|
Assignee: |
TRUSTEES OF TUFTS COLLEGE
Medford
MA
UNITED STATES OF AMERICAN AS REPRESENTED BY THE SECRETARY OF THE
AIR FORCE AFM
Wright Patterson AFB
OH
UNIVERSITY OF ILLINOIS AT CHICAGO
Chicago
IL
|
Family ID: |
36678281 |
Appl. No.: |
14/280324 |
Filed: |
May 16, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13934828 |
Jul 3, 2013 |
8772456 |
|
|
14280324 |
|
|
|
|
13347801 |
Jan 11, 2012 |
8501437 |
|
|
13934828 |
|
|
|
|
13097538 |
Apr 29, 2011 |
8129141 |
|
|
13347801 |
|
|
|
|
11794934 |
Jan 14, 2008 |
7960509 |
|
|
PCT/US06/01536 |
Jan 17, 2006 |
|
|
|
13097538 |
|
|
|
|
60644264 |
Jan 14, 2005 |
|
|
|
Current U.S.
Class: |
623/23.72 ;
424/130.1; 424/422; 514/1.1; 514/20.9; 514/44R; 514/54; 514/8.1;
514/8.2; 514/8.5; 514/8.8; 514/8.9; 514/9.1; 514/9.6 |
Current CPC
Class: |
A61L 2430/00 20130101;
C07K 14/51 20130101; C07K 2319/00 20130101; A61L 27/46 20130101;
A61L 27/48 20130101; A61L 27/54 20130101; A61L 27/446 20130101;
C07K 14/78 20130101; C07K 14/43518 20130101 |
Class at
Publication: |
623/23.72 ;
424/422; 514/1.1; 514/54; 514/20.9; 514/44.R; 424/130.1; 514/8.8;
514/9.6; 514/9.1; 514/8.2; 514/8.5; 514/8.9; 514/8.1 |
International
Class: |
A61L 27/48 20060101
A61L027/48; A61L 27/54 20060101 A61L027/54; A61L 27/44 20060101
A61L027/44; A61L 27/46 20060101 A61L027/46 |
Goverment Interests
GOVERNMENT SUPPORT
[0002] This invention was supported by FA9550041-0363 awarded by
the U.S. Air Force and EB003210-01 awarded by the National
Institutes of Health. The government has certain rights in the
invention.
Claims
1. An organic-inorganic composite material comprising: (i) a fusion
polypeptide comprising a fibrous protein domain and a mineralizing
domain, wherein the mineralizing domain is capable of inducing
mineralization; and (ii) an inorganic material.
2. The organic-inorganic composite material of claim 1, wherein the
fibrous protein domain is obtained from silk, collagens,
coiled-coiled leucine zipper proteins, elastins, keratins, actins,
or tubulins.
3. The organic-inorganic composite material of claim 1, wherein the
fibrous protein domain comprises an amino acid sequence from the
silk protein Spidroin 1.
4. The organic-inorganic composite material of claim 1, wherein the
fibrous protein domain comprises an amino acid sequence as set
forth in SEQ ID NO: 1 or SEQ ID NO: 3.
5. The organic-inorganic composite material of claim 4, wherein the
fibrous protein domain comprises an amino acid sequence as set
forth in SEQ ID NO: 4 or SEQ ID NO: 5.
6. The organic-inorganic composite material of claim 1, wherein the
fusion polypeptide is crystallized.
7. The organic-inorganic composite material of claim 1, wherein the
mineralizing domain induces the formation of hydroxyapatite,
silica, cadmium sulfide or magnetite.
8. The organic-inorganic composite material of claim 7, wherein the
mineralization domain is derived from dentin matrix protein 1
(DMP1), bone sialoprotein (BSP), silaffin-1 (Sil1) protein, or
functional fragments thereof.
9. The organic-inorganic composite material of claim 8, wherein the
mineralization domain comprises an amino acid sequence selected
from the group consisting of SEQ ID NOs: 6, 9, and 17-21.
10. The organic-inorganic composite material of claim 9, wherein
the mineralization domain comprises an amino acid sequence selected
from the group consisting of SEQ ID NOs: 7, 22, and 23.
11. The organic-inorganic composite material of claim 1, wherein
the fusion polypeptide comprises an amino acid sequence selected
from the group consisting of SEQ ID NOs: 9-12, 24, and 25.
12. The organic-inorganic composite material of claim 1, wherein
the inorganic material is hydroxyapatite or silica.
13. The organic-inorganic composite material of claim 1, wherein
the organic-inorganic composite material further comprises an
active agent.
14. The organic-inorganic composite material of claim 13, wherein
the agent is selected from the group consisting of naturally
derived or genetically engineered proteins, polysaccharides,
glycoproteins, lipoproteins, peptides, nucleic acids, PNAs,
aptamers, antibodies, small molecules, and cells.
15. The organic-inorganic composite material of claim 13, wherein
the agent is a therapeutic agent, a cell attachment mediator, a
hormone, a chemoattractant, or a growth factor.
16. The organic-inorganic composite material of claim 15, wherein
the cell attachment mediator comprises an integrin binding amino
acid sequence.
17. The organic-inorganic composite material of claim 15, wherein
the therapeutic agent is selected from the group consisting of
anti-infectives; chemotherapeutic agents; anti-rejection agents;
analgesics and analgesic combinations; and anti-inflammatory
agents.
18. The organic-inorganic composite material of claim 15, wherein
the growth factor is selected from the group consisting of bone
morphogenic proteins, bone morphogenaic-like proteins, epidermal
growth factors, fibroblast growth factors, platelet derived growth
factor (PDGF), insulin like growth factors, transforming growth
factors, and vascular endothelial growth factor (VEGF).
19. The organic-inorganic composite material of claim 1, wherein
the organic-inorganic composite material is in a form selected from
a fiber, a film, a sponge, a gel, a foam, and a micropatterned
foam.
20. A tissue engineered scaffold comprising an organic-inorganic
composite material of claim 1.
Description
CROSS REFERENCED APPLICATIONS
[0001] This application is a continuation of U.S. Ser. No.
13/347,801 filed Jan. 11, 2012, which is a continuation of U.S.
Ser. No. 13/097,538 filed Apr. 29, 2011, now U.S. Pat. No.
8,129,141, issued Mar. 6, 2012, which is a continuation of U.S.
Ser. No. 11/794,934 filed on Jan. 14, 2008, now U.S. Pat. No.
7,960,509, issued Jun. 14, 2011, which is a 371 National Phase
Entry Application of International Application No.
PCT/US2006/01536, filed Jan. 17, 2006, which designates the U.S.,
and which claims the benefit under 35 U.S.C. .sctn.119(e) of U.S.
Provisional Patent Application No. 60/644,264, filed Jan. 14, 2005,
the contents of all of which are incorporated herein by reference
in their entireties.
BACKGROUND OF THE INVENTION
[0003] Many biomedical procedures require the provision of healthy
tissue to counteract the disease process or trauma being treated.
This work is often hampered by the tremendous shortage of tissues
available for transplantation and/or grafting. Tissue engineering
may ultimately provide alternatives to whole organ or tissue
transplantation. In order to generate engineered tissues, various
combinations of biomaterials and living cells are currently being
investigated. Although attention is often focused on the cellular
aspects of the engineering process, the design characteristics of
the biomaterials also constitute a major challenge in this
field.
[0004] In recent years, the ability to regenerate tissues and to
control the properties of the regenerated tissue have been
investigated by trying to specifically tune the mechanical or
chemical properties of the biomaterial scaffold (Kim et al., 1997;
Kohn et al. 1997). The majority of work has involved the
incorporation of chemical factors into the material during
processing, or the tuning of mechanical properties by altering the
constituents of the material.
[0005] The foregoing methods have been used in an attempt to
utilize chemical or mechanical signaling to affect changes in the
proliferation and/or differentiation of cells during tissue
regeneration. Despite such efforts there remains in the art a need
for improved biomaterials, including composite materials,
particularly those with a better capacity to support complex tissue
growth in vitro (in cell culture) and in vivo (upon
implantation).
SUMMARY OF THE INVENTION
[0006] The claimed invention provides a fusion polypeptide
comprising a fibrous protein domain and a mineralization
domain.
[0007] In one embodiment the fibrous protein domain is obtained
from silk, collagens, coiled-coiled leucine zipper proteins,
elastins, keratins, actins, and tubulins.
[0008] For example, in one preferred embodiment, the fibrous
protein domain comprises an amino acid sequence from the silk
protein Spidroin 1, such as the fibrous protein domains indicated
by (SEQ ID NO: 1) or (SEQ ID NO: 3), which are derived from
Spiroidin 1 of Nephila clavipes. A recombinant fibrous protein
domain can be generated, which has multiple repeats of a fibrous
protein domain.
[0009] In one embodiment, the fibrous domain sequence of (SEQ ID
NO: 1) is repeated 15 times throughout the fibrous protein domain,
which is used in the fusion proteins of the invention, i.e., the
fibrous protein domain sequence indicated by (SEQ ID NO: 4),
referred to herein as 15mer.
[0010] In one embodiment, a fibrous domain sequence of (SEQ ID NO:
1) is repeated 15 times throughout the fibrous protein domain that
is used in the fusion proteins of the invention and has a CRGD4
(SEQ ID NO: 2) linker sequence, i.e. the fibrous protein domain
sequence indicated by (SEQ ID NO: 5), referred to herein as
CRGD-15mer.
[0011] In one embodiment, the fusion polypeptide of the invention
has a mineralizing domain that is capable of inducing the formation
of hydroxyapatite, silica, cadmium sulfide or magnetite.
[0012] In one embodiment, the mineralization domain is obtained
from dentin matrix protein 1 (DMP1), bone sialoprotein (BSP), or
silaffin-1 (Sil1) protein.
[0013] In one embodiment, the mineralization domain is derived from
dentin matrix protein 1 (DMP1) and is (SEQ ID NO: 6) or (SEQ ID NO:
7).
[0014] In one embodiment, the mineralization domain is derived from
bone sialoprotein (BSP) and is (SEQ ID NO: 8).
[0015] In one embodiment, the mineralizing domain is selected from
the group consisting of the 19 amino-acid R5 peptide of the Sil1
protein (SEQ ID NO: 17), the R2 peptide of the Sil1 protein (SEQ ID
NO: 18), the 19 amino-acid R3 peptide of the Sil1 protein (SEQ ID
NO: 19), the 19 amino-acid R6 peptide of the Sil1 protein (SEQ ID
NO: 20) and the 15 amino-acid R1 peptide of the Sil1 protein (SEQ
ID NO: 21).
[0016] The invention also provides for the following fusion
polypeptides that comprise a fibrous protein domain and a
mineralization domain: the fusion polypeptide (SEQ ID NO: 9), the
fusion polypeptide (SEQ ID NO: 10), the fusion polypeptide (SEQ ID
NO: 11), the fusion polypeptide (SEQ ID NO: 12), a fusion
polypeptide comprising a fusion of the 15 mer silk fibrous protein
domain (SEQ ID NO: 4) and the R5 peptide of the Sil1 protein (SEQ
ID NO: 17) and a fusion polypeptide comprising a fusion of the
CRGD-15 mer silk fibrous protein domain (SEQ ID NO: 5) and the R5
peptide of the Sil1 protein (SEQ ID NO: 17).
[0017] A method for forming a fibrous protein inorganic-composite
material is also provided. The method comprises (a) contacting the
fusion proteins of the invention with an inorganic material capable
of mineralizing for a sufficient period of time to allow
mineralization of the inorganic material.
[0018] In one preferred embodiment, the fusion proteins of the
invention are formed into a silk film, foam or sponge prior to
deposition of inorganic material (mineralization).
[0019] In one embodiment, the inorganic material is capable of
forming hydroxyapatite or silica.
[0020] In one embodiment, the fiber, film, or sponge further
comprises an agent.
[0021] In one embodiment, the inorganic coating formed on the
fibrous protein comprises an agent.
[0022] In one embodiment, the agent is selected from the group
consisting of a protein, peptide, nucleic acid, PNA, aptamer,
antibody or a small molecule.
[0023] The claimed invention also provides for biomaterial products
produced by the methods of the invention.
BRIEF DESCRIPTION OF FIGURES
[0024] FIGS. 1A and 1B show diagrammatic illustrations of fibrous
protein domain-mineralization domain fusion proteins. FIG. 1A shows
three claimed fusion proteins composed of a spider silk fibrous
protein domain ((CRGD-15mer) (See (SEQ ID NO: 5)) and a dentin
matrix protein 1 (DMP 1) mineralization domain. The fusion proteins
contain a mineralization domain of either 1) the full length amino
acid sequence of DMP 1 (See (SEQ ID NO: 7)), 2) the C-terminal end
of DMP1, (See (SEQ ID NO: 6)) or a composite sequence based on
DMP1, which contains the collagen binding domain 1 (CD 1) of DMP1,
two acidic clusters in DMP1 that are responsible for hydroxyapatite
nucleation (pA and pB) and the collagen binding domain 2 (CD2) of
DMP1. FIG. 1B shows a diagram of two fusion proteins, 1) fusion of
a spider silk fibrous protein domain (CRGD-15mer (See (SEQ ID NO:
5)) and a bone sialoprotein mineralizing domain (BSP) (See (SEQ ID
NO: 8)) and 2) fusion of a spider silk fibrous protein domain
15-mer (without CRGD linker) (See (SEQ ID NO: 4)) and a bone
sialoprotein mineralizing domain (BSP) (See SEQ ID NO: 8).
[0025] FIG. 2 shows the sequence of the fusion protein
CRGD-15mer-CDMP1 (SEQ ID NO: 9). CRGD-15mer-CDMP1 is a fusion
protein of a spider silk fibrous protein domain ((CRGD-15mer) (See,
SEQ ID NO: 5), which is indicated by a dark grey highlight, and the
C-terminal end of DMP1 mineralizing domain (See, SEQ ID NO: 6),
which is indicated with light grey highlight.
[0026] FIG. 3 shows the sequence of the fusion protein
CRGD-15mer-DMP1 (SEQ ID NO: 10). CRGD-15mer-DMP1 is a fusion
protein of spider silk fibrous protein domain ((CRGD-15mer) (See,
SEQ ID NO: 5), which is indicated by a dark grey highlight, and the
full length sequence of DMP1 mineralizing domain (See, SEQ ID NO:
7), which is indicated with light grey highlight.
[0027] FIG. 4 shows the sequence of the fusion protein 15mer-BSP
(SEQ ID NO: 11). 15mer-BSP is a fusion protein of spider silk
fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is
indicated by light grey highlight, and a mineralizing domain of
bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with
dark grey highlight.
[0028] FIG. 5 shows the sequence of the fusion protein
CRGD-15mer-BSP (SEQ ID NO: 12). CRGD-15mer-BSP a fusion protein of
spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO:
5), which is indicated by light grey highlight, and a mineralizing
domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is
indicated with dark grey highlight. A linker sequence between the
two domains is also present.
[0029] FIGS. 6A to 6C show scanning electron microscope (SEM)
images of recombinant silk film made from CRGD-15mer-CDMP1, See
Example 1. FIG. 6A, image of silk film morphology prior to
mineralization (HFIP+MeOH). FIG. 6B, image of silk film morphology
after one round of mineralization. FIG. 6C, image of silk film
morphology after three rounds of mineralization.
[0030] FIGS. 7A to 7B show the sequence of the fusion proteins
CRGD15mer-R5 (SEQ ID NO: 25) and 15mer-R5 (SEQ ID NO: 25) as
described in Example II. The underlined sequence represents the
monomeric repeat unit selected and used in the design of the
recombinant proteins based on the consensus sequence of spidroin1
(Maspl) native sequence of Nephila clavipes (Accession
#P19837).
[0031] FIG. 8 shows a grid of SEM of untreated and methanol treated
silk films formed from the four different genetically engineered
silk proteins CRGD15mer, 15mer, CRGD15mer-R5, and 15mer-R5 as
described in Example 2. Images of the control films and the films
that underwent silicification reactions are shown.
[0032] FIGS. 9A to 9E show SEM images of untreated and methanol
treated electropun CRGD15mer-R5 silk fibers before, during and
after silicification reactions, as described in Example 2. FIG. 9A,
untreated electrospun CRGD15mer-R5 silk fibers. FIG. 9B,
electrospun CRGD15mer-R5 silk fibers methanol treated before
silification. FIGS. 9C, 9D and 9E, electrospun CRGD15mer-R5 silk
fibers during silification at 20 um and 2 um scale.
[0033] FIGS. 10A to 10B show XPS analysis, as described in Example
2, of CRGD15mer-R5 and silicified CRGD15mer-R5 on A1 foil and on
silicon chip at the characteristic binding energies of (FIG. 10A)
153 eV and (FIG. 10B) 102 eV for electrons found in the 2s and 2p3
electron shells of the silicon atom respectively.
[0034] FIG. 11 shows Fourier transform infared spectroscopy (FTIR)
analysis of the structure of CRGD-15mer-CDMP1 before and after Ca
ion binding, as described in Example 1.
[0035] FIG. 12 shows FTIR analysis of structure of CRGD-15mer-CDMP1
before and after treatment with methanol, as described in Example
1.
[0036] FIGS. 13(A1) to 13(A5) and 13(B1) to 13(B5) show Scanning
Electron Microscopy (SEM) surface morphologies of recombinant
spider silk films after soaking in 1.5.times.SBF for various
periods of time, as described in Example 1. FIG. 13(A1)-FIG.
13(A5), SS15m-CDMP1 soaked in 1.5.times.SBF for 0, 3, 7, 14 and 21
days: FIG. 13(A1)-FIG. 13(A5) respectively. FIG. 13(B1)-FIG.
13(B5), SS15m soaked in 1.5.times.SBF for 0, 3,7,14 and 21 days:
FIG. 13(B1)-FIG. 13(B5) respectively. Scale bars are 2 .mu.m.
[0037] FIGS. 14A to 14C show Transmission Electron Microscopy (TEM)
images of crystals grown on CRGD-15mer-CDMP1 after soaking in
1.5.times.SBF for 21 days, as described in Example 1. (FIG. 14A)
image of flake-like apatite; (FIG. 14B) electron diffraction
pattern; (FIG. 14C) high-resolution image of apatite crystal.
DESCRIPTION OF THE INVENTION
[0038] Fibrous proteins represent an important category of proteins
in biology, forming native structural entities both internally in
organisms (e.g., collagens) and externally (such as spun silk
fibers for webs and cocoons). As an example, silk proteins from
spiders and insects provide a number of valuable materials
features. When combined with functional domains, then the materials
properties available from silks become significantly expanded. In
accordance with the present invention, various domains from biology
known to promote the formation of inorganic structures, e.g.,
promote formation of minerals, have been combined with a fibrous
protein domain. Thus, these new fusion (composite) materials offer
the benefits of the fibrous protein material features (e.g, silks)
plus the benefit of the inorganic mineralization domains (e.g.,
hardness).
[0039] In one embodiment, the present invention provides a fusion
polypeptide comprising a fibrous protein domain and a
mineralization domain. The fusion is used to form an
organic-inorganic composite. These organic-inorganic composites can
be constructed from the nano- to the macro-scale depending on the
size of the fibrous protein fusion domain used. In one embodiment,
the composites can also be loaded with other compounds (e.g., dyes,
drugs, enzymes) depending on the goal for the materials, to further
enhance function. This can be achieved during assembly of the
material or during the mineralization step in materials
formation.
[0040] The fusion polypeptides of the present invention can be used
for production of silk biomaterials, e.g., fibers, films, foams and
mats. See, WO 03/022909. An all-aqueous process may be used. See,
WO 03/022909.
[0041] In another embodiment, the invention provides a method for
forming a composite material. The method comprises contacting a
template formed from a fusion polypeptide of the invention with a
suitable inorganic material for a sufficient period of time to
allow mineralization of the inorganic material thus forming an
inorganic coating on the template.
[0042] In one embodiment the template is in the form of a fiber,
film, or sponge.
[0043] In an additional embodiment, growth factors, biological
components or others agents, including therapeutic agents, are
incorporated into the inorganic coating. The growth factors,
biological components or other agents, can be incorporated during
the formation of the template or during the crystallization
process. Such composites can be used to deliver such components to
cells and tissues. The ability to incorporate growth factors,
biological regulators, enzymes, therapeutics, or cells in the
construct of the present invention provides for stabilization of
these components for long term release and stability, as well as
better control of activity and release.
[0044] The products produced by these methods offer new options in
the formation of scaffolds for biomaterials, tissue engineering
applications and drug delivery. While the templates are useful in
and of themselves, the ability to form inorganic coatings with
controlled thickness leads to control of mechanical properties
(e.g., stiffness) and biological interactions, such as for bone
formation. Furthermore, the ability to control these processes
allows one to match structural and functional performance of
scaffolds for specific tissue targets and needs.
[0045] In another embodiment, the underlying template (e.g., fusion
polypeptide formed into a film etc.) can be removed or etched away
to generate porous networks, tubes, or lamellar sheets of inorganic
material. These materials are useful directly as biomaterial
scaffolds, for control of cell and tissue growth (e.g., as nerve
conduits, bone conduits) and for nonbiological applications (e.g.,
filtration and separation media, catalysis, decontamination
(directly or if filled with appropriate chemical or enzymes), radar
chaff, coatings in general, and many related needs, for example,
inorganic fillers to toughen materials that can also be filled with
a second component.
[0046] The fusion polypeptides may be created, for example, by
chemical synthesis, or by creating and translation a polynucleotide
in which the peptide regions are encoded in the desired
relationship.
[0047] It is to be understood that while the invention has been
described in conjunction with the preferred specific embodiments
thereof that the foregoing description as well as the examples that
follow are intended to illustrate and not limit the scope of the
invention. Other aspects, advantages and modifications within the
scope of the invention will be apparent to those skilled in the art
to which the invention pertains.
Fibrous Protein Domains
[0048] Silks are unique in their self-assembly, formation of robust
materials in the form of fibers, films and 3D matrices, and are
polymorphic (the structure can be controlled among many assembly
states). For example, silk fibers are the strongest known fibers
and rival even high performance fibers. They are also effective in
resisting compression. In 3D porous matrices the compressive
resistance exceeds other commonly used organic polymers as
biomaterial matrices. Inorganic domains, including silica and
hydroxyapatite are prominent in biological systems as key inorganic
components found associated with proteins. These mineral phases
dominate skeletal components of most systems.
[0049] The fibrous protein domain can include short to long
versions, with the size in part influencing the scale of the
composite from the nano to the macro level. For example, the size
can range from a single sized hydrophobic block of 50 amino acids,
up to multiple blocks as large as desired including up to proteins
of sizes in the 100,000s of Daltons. In addition, the fibrous
protein fusion domain could include other proteins such as
collagens, coiled-coiled leucine zipper proteins, elastins,
keratins, actins, and tubulins.
[0050] The silk protein suitable for use in the present invention
is preferably fibroin or related proteins (i.e., silks from
spiders). The silkworm silk is obtained, for example, from Bombyx
mori. Spider silk may be obtained from Nephila clavipes See, for
example, WO 97/08315 and U.S. Pat. No. 5,245,012.
Inorganic Domains/Mineralizing Domains
[0051] Mineralizing domains include those that can induce the
formation of hydroxyapatite (Example 1), silica (Example 2),
cadmium sulfide, and magnetite. In one embodiment, a mineralizing
domain that can induce hydroxyapatite nucleation is obtained from
dentin matrix protein 1 or bone sialoprotein (G. He, T. Dahl, A.
Veis and A. George. Connective Tissue Res. 2003, 44 (Suppl. 1):
240-245; and G. He, T. Dahl, A. Veis and A. George. Nature
materials. 2003, 2(8): 552-558; Stubbs et al. J Bone Miner Res.
1997 August; 12(8):1210-22). The full molecule or a minimum portion
that can induce mineralization can be used, for example, a 37 amino
acid segment from DMP (C-terminus) will induce controlled
mineralization of hydroxyapatite. In one example, the
mineralization domains were fused to a sequence derived from spider
silk having the following silk fibrous domain repeated 15 times
(SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT) (SEQ ID NO: 1) in order to
generate functional recombinant silks that possess both robust
mechanical properties of the spider silk and the ability to promote
mineralization. The recombinant proteins were cloned in pET21a(+)
vector and expressed in E. coli. As demonstrated below, the
identities of these recombinant silks were confirmed by amino acid
composition analysis and the mineralization study was carried out
on the surfaces of the cast functional recombinant silk films using
recombinant protein containing only spider silk sequence as
control. It was demonstrated that the functional recombinant silks
exhibit an ability to promote the nucleation of hydroxyapatite. The
functional recombinant silks (silk fusion proteins) of the present
invention have potential application in biomaterials, tissue
engineering, advanced material composites and biosensors.
[0052] Preferably, the mineralizing domain is capable of inducing
the formation of hydroxyapatite, silica, cadmium sulfide, magnetite
and other metal salts pending choice of peptide domain
utilized.
[0053] Preferred mineralizing domains include, for example, dentin
matrix protein 1 (DMP1), bone sialoprotein, and fragments of these
proteins, and the 19 amino-acid R5 peptide of the Sil1 protein.
[0054] Alternative fibrous proteins and mineralizing domains can
also be included in this system using the template provided. For
example, peptides identified from other native proteins or
identified by combinatorial screening methods can be used.
Screening methods can involve any mineralization assay known in the
art, for example the hydroxyapatite and silicification assays
described herein.
Preparation of Fusion Proteins; Vectors, Host Cells and
Expression
[0055] The fusion proteins containing a mineralization domain and a
fibrous protein domain can be made using standard molecular biology
methods well known to those skilled in the art (See for example,
Sambrook et al., Molecular Biology: A laboratory Approach, Cold
Spring Harbor, N.Y. 1989; Ausubel, et al., Current protocols in
Molecular Biology, Greene Publishing, Y, 1995).
[0056] In some embodiments, the fusion proteins of the invention
are made using linker sequences. As used herein, the term "linker
sequence" refers to a short (e.g., about 1-20 amino acids) sequence
of amino acids that is not part of the sequence of either of two
polypeptides being joined. For example, a linker sequence is
attached on its amino-terminal end to one polypeptide or
polypeptide domain and on its carboxyl-terminal end to another
polypeptide or polypeptide domain.
[0057] The manipulation of nucleic acids that encode the protein
domains in the present invention is typically carried out in
recombinant vectors. Herein, both phagemid and non-phagemid vectors
can be used. As used herein, vector refers to a discrete element
that is used to introduce heterologous DNA into cells for the
expression and/or replication thereof. Methods by which to select
or construct and, subsequently, use such vectors are well known to
one of skill in the art. Numerous vectors are publicly available,
including bacterial plasmids, bacteriophage, artificial
chromosomes, episomal vectors and gene expression vectors. A vector
of use according to the invention may be selected to accommodate a
polypeptide coding sequence of a desired size. A suitable host cell
is transformed with the vector after in vitro cloning
manipulations. Host cells may be prokaryotic, such as any of a
number of bacterial strains, or may be eukaryotic, such as yeast or
other fungal cells, insect or amphibian cells, or mammalian cells
including, for example, rodent, simian or human cells. Each vector
contains various functional components, which generally include a
cloning (or "polylinker") site, an origin of replication and at
least one selectable marker gene. If given vector is an expression
vector, it additionally possesses one or more of the following:
enhancer element, promoter, transcription termination and signal
sequences, each positioned in the vicinity of the cloning site,
such that they are operatively linked to the gene encoding a
polypeptide repertoire member according to the invention.
[0058] Both cloning and expression vectors generally contain
nucleic acid sequences that enable the vector to replicate in one
or more selected host cells. Typically in cloning vectors, this
sequence is one that enables the vector to replicate independently
of the host chromosomal DNA and includes origins of replication or
autonomously replicating sequences. Such sequences are well known
for a variety of bacteria, yeast and viruses. For example, the
origin of replication from the plasmid pBR322 is suitable for most
Gram-negative bacteria, the 2 micron plasmid origin is suitable for
yeast, and various viral origins (e.g. SV 40, adenovirus) are
useful for cloning vectors in mammalian cells. Generally, the
origin of replication is not needed for mammalian expression
vectors unless these are used in mammalian cells able to replicate
high levels of DNA, such as COS cells.
[0059] Advantageously, a cloning or expression vector may contain a
selection gene also referred to as a selectable marker. This gene
encodes a protein necessary for the survival or growth of
transformed host cells grown in a selective culture medium. Host
cells not transformed with the vector containing the selection gene
will therefore not survive in the culture medium. Typical selection
genes encode proteins that confer resistance to antibiotics and
other toxins, e.g. ampicillin, neomycin, methotrexate or
tetracycline, complement auxotrophic deficiencies, or supply
critical nutrients not available in the growth media.
[0060] Since the replication of vectors according to the present
invention is most conveniently performed in E. coli (e.g., strain
TB1 or TG1), an E. coli-selectable marker, for example, the
.beta.-lactamase gene that confers resistance to the antibiotic
ampicillin, is of use. These can be obtained from E. coli plasmids,
such as pBR322 or a pUC plasmid such as pUC18 or pUC19, or
pUC119.
[0061] Expression vectors usually contain a promoter that is
recognized by the host organism and is operably linked to the
coding sequence of interest. Such a promoter may be inducible or
constitutive. The term "operably linked" refers to a juxtaposition
wherein the components described are in a relationship permitting
them to function in their intended manner. A control sequence
"operably linked" to a coding sequence is ligated in such a way
that expression of the coding sequence is achieved under conditions
compatible with the control sequences.
[0062] Promoters suitable for use with prokaryotic hosts include,
for example, the .beta.-lactamase and lactose promoter systems,
alkaline phosphatase, the tryptophan (trp) promoter system and
hybrid promoters such as the tac promoter. Promoters for use in
bacterial systems will also generally contain a Shine-Delgarno
sequence operably linked to the coding sequence. Preferred
promoters for use in the present invention are the
isopropylthiogalactoside (IPTG)-regulatable promoters.
[0063] In one preferred embodiment of the invention, the fusion
protein of the invention further comprises a tag, e.g. Flag, His,
Myc, HA, VSV, or V5, to aid in purification of the protein by
standard means. After purification, the fusion protein can be
lyophilized or suspended in aqueous solution for preparation of
silk materials, such as films, foams or fibers.
Formation of Silk Fibers, Films, Foams and Gels Using the Silk
Fusion Protein of the Invention.
[0064] The silk fusion proteins of the invention can be processed
into films, foams or fibers. As used herein, "silk fibroin" or
"silk protein" refers to a silk fusion protein of the
invention.
[0065] Fibers can be formed by electrospinning Electrospinning can
be performed by any means known in the art (see, for example, U.S.
Pat. No. 6,110,590). Preferably, a steel capillary tube with a 1.0
mm internal diameter tip is mounted on an adjustable, electrically
insulated stand. Preferably, the capillary tube is maintained at a
high electric potential and mounted in the parallel plate geometry.
The capillary tube is preferably connected to a syringe filled with
silk/biocompatible polymer solution. Preferably, a constant volume
flow rate is maintained using a syringe pump, set to keep the
solution at the tip of the tube without dripping. The electric
potential, solution flow rate, and the distance between the
capillary tip and the collection screen are adjusted so that a
stable jet is obtained. Dry or wet fibers are collected by varying
the distance between the capillary tip and the collection
screen.
[0066] A collection screen suitable for collecting silk fibers can
be a wire mesh, a polymeric mesh, or a water bath. Alternatively
and preferably, the collection screen is an aluminum foil. The
aluminum foil can be coated with Teflon fluid to make peeling off
the silk fibers easier. One skilled in the art will be able to
readily select other means of collecting the fiber solution as it
travels through the electric field. As is described in more detail
in the Examples section below, the electric potential difference
between the capillary tip and the aluminum foil counter electrode
is, preferably, gradually increased to about 12 kV, however, one
skilled in the art should be able to adjust the electric potential
to achieve suitable jet stream.
[0067] The process of the present invention may further comprise
steps of immersing the spun fiber into an alcohol/water solution to
induce crystallization of silk. The composition of alcohol/water
solution is preferably 90/10 (v/v). The alcohol is preferably
methanol, ethanol, isopropyl alcohol (2-propanol) or n-butanol.
Methanol is most preferred. Additionally, the process may further
comprise the step of washing the fibroin fiber in water.
[0068] In another embodiment, the biomaterial is a film. The
process for forming the film comprises, for example, the steps of
(a) preparing an aqueous silk fibroin solution comprising silk
protein; (b) adding a biocompatible polymer to the aqueous
solution; (c) drying the mixture; and (d) contacting the dried
mixture with an alcohol (preferred alcohols are listed above) and
water solution to crystallize a silk blend film. Preferably, the
biocompatible polymer is poly(ethylene oxide) (PEO). The process
for producing the film may further include step (e) of drawing or
mono-axially stretching the resulting silk blend film to alter or
enhance its mechanical properties. The stretching of a silk blend
film induces molecular alignment in the fiber structure of the film
and thereby improves the mechanical properties of the film.
[0069] In a further embodiment, the biomaterial is a foam. Foams
may be made from methods known in the art, including, for example,
freeze-drying and gas foaming in which water is the solvent or
nitrogen or other gas is the blowing agent, respectively.
[0070] In one embodiment, the foam is a micropatterned foam.
Micropatterned foams can be prepared using, for example, the method
set forth in U.S. Pat. No. 6,423,252, the disclosure of which is
incorporated herein by reference.
Formation of Organic-Inorganic Composites
[0071] The claimed invention provides a method for forming an
organic-inorganic composite material. The method comprises
contacting a template (such as recombinant silk films, sponges or
fibers) formed from a fusion polypeptide of the invention with a
suitable inorganic material for a sufficient period of time to
allow mineralization of the inorganic material. Mineralized
material is deposited onto the silk forming an inorganic coating on
the template.
[0072] The procedure for mineralization of the coating is dependent
upon the mineralization domain that is part of the fusion
polypeptide of the invention. For example, the mineralizing domain
of dentin matrix protein 1 (DMP1), an acidic phosphoprotein
secreted into the extracellular matrix during the formation and
mineralization of bone and dentin, is involved in the precipitation
of hydroxyapatite, the main inorganic component in calcified hard
tissue such as bone and teeth of vertebrates (Koutsopoulos, S. J
Biomed Mater Res. 2002, 62: 600-612). Further, the mineralizing
domain of Silaffin protein is involved in the precipitation of
silica.
[0073] Those in the art are skilled to select the appropriate
buffer for precipitation of inorganic material. The formation of
inorganic coatings is further described in Examples 1 and 2.
[0074] The biomaterial products produced by the processes of the
present invention may be used in a variety of medical applications
such as wound closure systems, including vascular wound repair
devices, hemostatic dressings, patches and glues, sutures, drug
delivery and in tissue engineering applications, such as, for
example, scaffolding, ligament prosthetic devices and in products
for long-term or bio-degradable implantation into the human body. A
preferred tissue engineered scaffold is a non-woven network of
electrospun fibers.
[0075] Additionally, these biomaterials can be used for organ
repair replacement or regeneration strategies that may benefit from
these unique scaffolds, including but are not limited to, spine
disc, cranial tissue, dura, nerve tissue, liver, pancreas, kidney,
bladder, spleen, cardiac muscle, skeletal muscle, tendons,
ligaments and breast tissues.
[0076] In another embodiment of the present invention, silk
biomaterials can contain therapeutic agents. To form these
materials, the polymer would be mixed with a therapeutic agent
prior to forming the material or loaded into the material after it
is formed. In addition, the agent can be incorporated into the
inorganic coating formed by the silk fusion protein mineralization
domain by mixing it with the mineralization solution. The variety
of different therapeutic agents that can be used in conjunction
with the biomaterials of the present invention is vast. In general,
therapeutic agents which may be administered via the pharmaceutical
compositions of the invention include, without limitation:
antiinfectives such as antibiotics and antiviral agents;
chemotherapeutic agents (i.e. anticancer agents); anti-rejection
agents; analgesics and analgesic combinations; anti-inflammatory
agents; hormones such as steroids; growth factors (bone morphogenic
proteins (i.e. BMP's 1-7), bone morphogenic-like proteins (i.e.
GFD-5, GFD-7 and GFD-8), epidermal growth factor (EGF), fibroblast
growth factor (i.e. FGF 1-9), platelet derived growth factor
(PDGF), insulin like growth factor (IGF-I and IGF-II), transforming
growth factors (i.e. TGF-.beta.I-III), vascular endothelial growth
factor (VEGF)); and other naturally derived or genetically
engineered proteins, polysaccharides, glycoproteins, or
lipoproteins. These growth factors are described in The Cellular
and Molecular Basis of Bone Formation and Repair by Vicki Rosen and
R. Scott Thies, published by R. G. Landes Company hereby
incorporated herein by reference.
[0077] Silk biomaterials containing bioactive materials may be
formulated by mixing one or more therapeutic agents with the
polymer used to make the material. Alternatively, a therapeutic
agent could be coated on to the material preferably with a
pharmaceutically acceptable carrier. Any pharmaceutical carrier can
be used that does not dissolve the foam. The therapeutic agents,
may be present as a liquid, a finely divided solid, or any other
appropriate physical form. Typically, but optionally, the matrix
will include one or more additives, such as diluents, carriers,
excipients, stabilizers or the like.
[0078] The amount of therapeutic agent will depend on the
particular drug being employed and medical condition being treated.
Typically, the amount of drug represents about 0.001 percent to
about 70 percent, more typically about 0.001 percent to about 50
percent, most typically about 0.001 percent to about 20 percent by
weight of the material. Upon contact with body fluids the drug will
be released.
[0079] The biocompatible polymer may be extracted from the
biomaterial prior to use. This is particularly desirable for tissue
engineering applications. Extraction of the biocompatible polymer
may be accomplished, for example, by soaking the biomaterial in
water prior to use.
[0080] The tissue engineering scaffolds biomaterials can be further
modified after fabrication. For example, the scaffolds can be
coated with bioactive substances that function as receptors or
chemoattractors for a desired population of cells. The coating can
be applied through absorption or chemical bonding.
[0081] Additives suitable for use with the present invention
include biologically or pharmaceutically active compounds. Examples
of biologically active compounds include cell attachment mediators,
such as the peptide containing variations of the "RGD" integrin
binding sequence known to affect cellular attachment, biologically
active ligands, and substances that enhance or exclude particular
varieties of cellular or tissue ingrowth. Such substances include,
for example, osteoinductive substances, such as bone morphogenic
proteins (BMP), epidermal growth factor (EGF), fibroblast growth
factor (FGF), platelet-derived growth factor (PDGF), vascular
endothelial growth factor (VEGF), insulin-like growth factor (IGF-I
and II), TGF-and the like.
[0082] The scaffolds are shaped into articles for tissue
engineering and tissue guided regeneration applications, including
reconstructive surgery. The structure of the scaffold allows
generous cellular ingrowth, eliminating the need for cellular
preseeding. The scaffolds may also be molded to form external
scaffolding for the support of in vitro culturing of cells for the
creation of external support organs.
[0083] The scaffold functions to mimic the extracellular matrices
(ECM) of the body. The scaffold serves as both a physical support
and an adhesive substrate for isolated cells during in vitro
culture and subsequent implantation. As the transplanted cell
populations grow and the cells function normally, they begin to
secrete their own ECM support.
[0084] In the reconstruction of structural tissues like cartilage
and bone, tissue shape is integral to function, requiring the
molding of the scaffold into articles of varying thickness and
shape. Any crevices, apertures or refinements desired in the
three-dimensional structure can be created by removing portions of
the matrix with scissors, a scalpel, a laser beam or any other
cutting instrument. Scaffold applications include the regeneration
of tissues such as nervous, musculoskeletal, cartilaginous,
tendenous, hepatic, pancreatic, ocular, integumenary,
arteriovenous, urinary or any other tissue forming solid or hollow
organs.
[0085] The scaffold may also be used in transplantation as a matrix
for dissociated cells, e.g., chondrocytes or hepatocytes, to create
a three-dimensional tissue or organ. Any type of cell can be added
to the scaffold for culturing and possible implantation, including
cells of the muscular and skeletal systems, such as chondrocytes,
fibroblasts, muscle cells and osteocytes, parenchymal cells such as
hepatocytes, pancreatic cells (including Islet cells), cells of
intestinal origin, and other cells such as nerve cells, bone marrow
cells, skin cells and stem cells, and combination thereof, either
as obtained from donors, from established cell culture lines, or
even before or after genetic engineering. Pieces of tissue can also
be used, which may provide a number of different cell types in the
same structure.
[0086] The cells are obtained from a suitable donor, or the patient
into which they are to be implanted, dissociated using standard
techniques and seeded onto and into the scaffold. In vitro
culturing optionally may be performed prior to implantation.
Alternatively, the scaffold is implanted, allowed to vascularize,
then cells are injected into the scaffold. Methods and reagents for
culturing cells in vitro and implantation of a tissue scaffold are
known to those skilled in the art.
[0087] The biomaterials of the claimed invention may be sterilized
using conventional sterilization process such as radiation based
sterilization (i.e. gamma-ray), chemical based sterilization
(ethylene oxide) or other appropriate procedures. Preferably the
sterilization process will be with ethylene oxide at a temperature
between 52-55.degree. C. for a time of 8 hours or less. After
sterilization the biomaterials may be packaged in an appropriate
sterilize moisture resistant package for shipment and use in
hospitals and other health care facilities.
[0088] The invention will be further characterized by the following
examples which are intended to be exemplary of the invention.
EXAMPLES
Example 1
Formation of Hydroxyapatite Silk Fusions
[0089] Hydroxyapatite (HAP, Ca.sub.5(PO.sub.4).sub.3(OH)) is the
most stable calcium phosphate salt at normal temperature and pH
between 4 and 12 (Aaron, S. Posner Physiological review, 1969,
49(4): 760-792). Hydroxyapatite is the main inorganic component in
calcified hard tissue such as bone and teeth of vertebrates
(Koutsopoulos, S. J Biomed Mater Res. 2002, 62: 600-612). In
addition, hydroxyapatite also has many applications in protein
chromatography, water treatment processes, fertilizer and
pharmaceutical products (Bailliez, S.; Nzihou, A.; Beche, E.;
Flamant, G. Process Safety and Environmental Protection, 2004,
82(B2): 175-180). For calcified hard tissue, hydroxyapatite
contributes to its stiffness, while organic matrix contributes to
its plasticity (Landis, W. J. Bone, 16(5): 533-544). The inherent
strength and other mechanical properties of the skeletal system are
thought to depend on an interaction between its organic and
inorganic matrix strength, here hydroxyapatite. One example is the
composite formed between the normal mineral salt, hydroxyapatite,
and collagen, the principal organic component of the vertebrate
skeleton, able to resist a wide range of compressive or tensile
forces whereas either material alone can not (Chen, Q. Z.; Wong, C.
T.; Lu, W. W.; Cheung, K. M. C.; Leong, J. C. Y. and Luk, K. D. K.
Biomaterials, 2004, 25: 4243-4254). In the present disclosure, we
demonstrate a proof of concept with dental matrix protein
(DMP).
[0090] Dentin matrix protein 1 (DMP1) is an acidic phosphoprotein
secreted into the extracellular matrix during the formation and
mineralization of bone and dentin, therefore, it is believed that
DMP 1 plays an important role in the initiation of mineralization
(J. Q. Feng, H. Huang, Y. Lu, L. Ye, Y. Xie, T. w. Tsutsui, T.
Kunieda, T. Castranio, G. Scott, L. B. Bonewald, and Y. Mishina. J
Dent Res. 2003, 82(10): 776-780; W. T. Butler, H. Ritchie. Int J
Dev Biol, 1995, 39: 169-179; George, B. Sabsay, P.A.L. Simonian,
and A. Veis. J Biol Chem, 1993, 268(17):12624-12630). It has been
reported that DMP1 nucleates the formation of hydroxyapatite in
vitro (G. He, T. Dahl, A. Veis and A. George. Connective Tissue
Res. 2003, 44 (Suppl. 1): 240-245; and G. He, T. Dahl, A. Veis and
A. George. Nature materials. 2003, 2(8): 552-558) by binding
calcium ions and initiating mineral deposition. It has also been
reported that DMP 1 binds to the N-telopeptide region of type I
collagen and the collagen-binding domains involved in this
interaction have been identified (G. He and A. George. J Biol.
Chem. 2004, 279(12): 11649-11656).
[0091] We generated various fibrous protein domain-mineralizing
domain fusion proteins. See for example FIGS. 1-5. FIG. 2 shows the
sequence of CRGD-15mer-CDMP1, a fusion protein of a spider silk
fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO: 5), which is
indicated by a dark grey highlight, and the C-terminal end of DMP 1
mineralizing domain (See, SEQ ID NO: 6), which is indicated with
light grey highlight.
[0092] FIG. 3 shows the sequence of the fusion protein
CRGD-15mer-DMP1 (SEQ ID NO: 10). CRGD-15mer-DMP1 is a fusion
protein of spider silk fibrous protein domain ((CRGD-15mer) (See,
SEQ ID NO: 5), which is indicated by a dark grey highlight, and the
full length sequence of DMP1 mineralizing domain (See, SEQ ID NO:
7), which is indicated with light grey highlight.
[0093] FIG. 4 shows the sequence of the fusion protein 15mer-BSP
(SEQ ID NO: 11). 15mer-BSP is a fusion protein of spider silk
fibrous protein domain ((15mer) (See, SEQ ID NO: 4), which is
indicated by light grey highlight, and a mineralizing domain of
bone sialoprotein (BSP) (SEQ ID NO: 8), which is indicated with
dark grey highlight.
[0094] FIG. 5 shows the sequence of the fusion protein
CRGD-15mer-BSP (SEQ ID NO: 12). CRGD-15mer-BSP a fusion protein of
spider silk fibrous protein domain ((CRGD-15mer) (See, SEQ ID NO:
5), which is indicated by light grey highlight, and a mineralizing
domain of bone sialoprotein (BSP) (SEQ ID NO: 8), which is
indicated with dark grey highlight.
[0095] Construction of Expression Vector for Recombinant Spider
Silks:
[0096] The consensus repeat unit of spider silk
(-SGRGGLGGQGAGAAAAAGGAGQGGY GGLGSQGT-) (SEQ ID NO: 1) was derived
from the native sequence of the spidroin 1 of N. clavipes
(accession P19837). The construction of the expression vector
pET30a (+) containing 15 repeats of the silk was previously
described (Bini et al., 2005) and was termed pET30a (+)-15mer.
Plasmid containing the rat dentin matrix protein 1 cDNA (pGEX-DMP1)
was previously described (Feng et al., J. Dent. Res. 2003,
82(10):776-780). Primers with BamHI and XhoI restriction enzyme
sites were designed in order to copy the C-terminal portion of rat
DMP 1 from pGEX-DMP 1 by PCR: BamH I site, C-DMP1f:
5'-CAGGATCCAGGGGTGACAACCCAGAT-3' (SEQ ID NO: 26) and Xho I site,
C-DMP1r: 5'-GCCTCGAGGTAGCCATCTTGGCAATC-3' (SEQ ID NO: 27).
[0097] PCR products were double digested with BamHI and XhoI before
running on a 1% agarose gel. The band of C-terminal DMP1 DNA were
cut from gel and purified using a MinElute gel extraction kit.
Expression vector pET21a (+) was also double digested with BamHI
and XhoI before running on a 0.8% agarose gel. The band of
linearized pET21a (+) was purified using a QIAquick gel extraction
kit. After determining the DNA concentration of the vector pET21a
(+) and insert of C-terminal DMP1 based on intensities of 1 .mu.l
of each in a 1% gel against 1 .mu.l of high mass DNA ladder, the
ligation reactions were performed using a Quick ligation Kit.TM.
based on an insert to vector molar ratio of 5:1. Fifty .mu.l of one
Shot.RTM. Mach1.TM. T1 phage-resistant cells were transformed with
1 .mu.l of ligation reaction. The correct clone of vector pET21a
(+) containing C-terminal DMP 1, named as pET21a (+)-CDMP 1 was
determined by DNA sequencing with forward and reverse T7 primers.
pET21a (+)-CDMP1 was digested with BamHI and dephosphorylated with
CIP before running on 0.8% agarose gel. The linearized vector was
purified using a QIAquick gel extraction kit. pET30a (+)-15mer was
digested with BamHI before running on 1% agarose gel and the DNA
encoding the repeat unit of spider silk was purified using a
MinElute gel extraction kit. The DNA concentrations of the vector
pET21a (+)-CDMP1 and the insert: spider silk 15 mer were determined
using the same method as described above. The spider silk 15 mer
was then inserted into pET21a (+)-CDMP1 at the BamHI site by
ligation reaction and the resulting vector was named as pET21a
(+)-SS15m-CDMP1. DNA sequencing with forward and reverse T7 primers
was performed to check the sequences of the vector.
[0098] Protein Expression and Purification:
[0099] Expression plasmid pET21a (+)-SS15m-CDMP1 was transformed
into Escherichia coli RY-3041 strain, kindly provided by Professor
Ry Young (Texas A&M University, College Station, Tex.). High
cell density cultivation using a 1.25 liter jar fermentor (Bioflo
3000; New Brunswick Scientific Co., Edison, N.J.) was performed as
described previously (Butler et al. Int. J. Dev. Biol. 1995, 39:
169-179). Expression was induced by adding
isopropyl-.beta.-D-thiogalactoside to a final concentration of 2 mM
at the early log phase when A.sub.600 was about 30. Cells were
harvested after 3 h of induction by centrifuging the culture at
4.degree. C., 6000.times.g, for 10 min. The cells were then
sonicated on ice using sonicator equipped with a microtip. Ten
second burst at 100 W with a 10 second cooling period between each
burst was applied. The lysate was centrifuged at 10,000.times.g for
30 min at 4.degree. C. to pellet the cellular debris. The
recombinant silk protein was purified using Ni-NTA agarose resin
from supernatant at 4.degree. C. The purification fractions that
contain the target protein were dialyzed against distilled water
for 2 days and dry proteins were prepared by lyophilizing the
aqueous solution. Dialyzed purification fractions were also
concentrated and desalted by using Centricon plus 70 (NMW=10
kDa).
[0100] Protein Characterization:
[0101] SDS-PAGE was performed to analyze purification fractions and
Western blot was performed using His-tag monoclonal antibody to
further confirm the expression of the target proteins. Western blot
analysis of CRGD-15mer-CDMP1 showed expression of the protein (data
not shown). The target protein bands on 4-12% Bis-Tris PAGE gel
were analyzed at the Yale University W. M. Keck Biotechnology
Resource Laboratory to determine amino acid compositions. A Bruker
Proflex.TM. mass spectrometer (Bruker, Billerica, Mass.) was used
for molecular weight determination.
[0102] Change of Protein Secondary Structure by Calcium Ion
Binding:
[0103] 0.2 mg/mL protein aqueous solution was prepared by the
method described in protein expression and purification. Calcium
chloride solution (1M) was added such that a molar ratio of protein
to Ca ion was maintained at 1:1000. Protein secondary structures
before and after adding Ca ion were studied by Fourier Transform
Infrared Spectroscopy (FTIR). FTIR studies were performed using a
Bruker Tensor 27 FTIR spectrometer with a BioATR accessory.
[0104] Film Formation:
[0105] Recombinant proteins were dissolved in hexafluoroisopropanol
(HFIP) to a final concentration of 2% w/v. One-hundred .mu.l of
silk HFIP solution was loaded onto a silica wafer and dried in
hood. Dried silk film was treated with 90% methanol to induce the
transition of secondary structure from random coil to beta sheet.
Concentrated silk aqueous solution was then loaded onto silk film
and incubated at 37.degree. C. overnight to dry.
[0106] In vitro Mineralization:
[0107] The silk films formed on silica wafer were then incubated in
1.5.times. simulated body fluid (SBF). 1.5.times.SBF was prepared
as described previously (3) by dissolving reagent grade CaCl.sub.2,
KH.sub.2PO.sub.4, NaCl, KCl, MgCl.sub.2.6H.sub.2O, NaHCO.sub.3,
Na.sub.2SO.sub.4 in distilled water and buffering at pH 7.3 with
tris-hydroxymethyl aminomethane and hydrochloric acid (HCl). A
1.5.times.SBF solution contains 1.5 times higher ion concentration
than the SBF solution with ion concentrations close to human blood
plasma. Fresh 1.5.times.SBF was prepared daily to replace the
1.5.times.SBF. After the silk coated silica wafers were soaked in
1.5.times.SBF for 3, 7, 14 and 21 days, they were removed, gently
rinsed with distilled water and dried at room temperature.
[0108] Scanning Electron Microscopy:
[0109] Morphological investigation of the dried films before and
after incubating in 1.5.times.SBF was performed using LEO 982 Field
Emission Scanning Electron Microscope (SEM) (LEO Electron
Microscopy, Inc., Thornwood, N.Y.) at 3.0 kV. The sample was
sputter coated with gold prior to examination.
[0110] Transmission Electron Microscopy:
[0111] Samples for transmission electron microscopy (TEM) analysis
were prepared by ultrasonicating of the silk films after incubation
in 1.5.times.SBF in 200 .mu.L of absolute ethanol for 10 min and
then depositing a few drops of the suspension onto a standard TEM
copper grid with a holey carbon support film. TEM images were
obtained with a JOEL 2100 TEM operating at 200 kV with a LaB.sub.6
filament and recorded with a slow scan CCD camera. The diffraction
patterns were obtained at calibrated camera lengths using a
NiO.sub.x test specimen as a reference.
Results
[0112] Protein Expression and Purification:
[0113] CRGD-15mer, molecular weight of which is 48.56 kDa, migrated
to the right position on SDS-PAGE gel, while the apparent molecular
weight of CRGD-15mer-CDMP1 indicated by SDS-PAGE electrophoresis
was higher than the calculated molecular weight, which is 58.89
kDa. This is due to high content of acidic amino acids such as
aspartic acid and glutamic acid in CRGD-15mer-CDMP1. Western blot
analysis of CRGD-15mer-CDMP1 and CRGD-15mer-CDMP1 was detected
based on the His tag (data not shown).
[0114] Amino Acid Composition Analysis:
[0115] Amino acid composition analysis confirmed the correct
composition for the purified CRGD-15mer-CDMP1.
[0116] Functional Change of Protein Secondary Structure by Calcium
Ion Binding:
[0117] CRGD-15mer-CDMP1 was unordered random coil in water before
adding CaCl.sub.2, indicated by amide I peak at 1649 cm.sup.-1 and
amide II peak at 1548 cm.sup.-1. After Ca ion binding, a helix and
.beta. sheet structures showed up, demonstrated by amide I peak at
1659 cm.sup.-1 (.alpha. helix) and 1632 cm.sup.-1 (.beta. sheet)
(FIG. 11).
[0118] Film Formation:
[0119] Silk secondary structure changed from random coil to 13
sheet after treated with 90% methanol (FIG. 12) so that the film
was more robust in solution.
Functional Assessments of the Fusion Proteins
[0120] The apatite nucleation ability of the functional recombinant
silks was studied using the method of alternate soaking process.
Silk films of the recombinant fusion proteins were cast using
standard methods. Lyophilized fusion proteins were dissolved in
HFIP solvent at a concentration of 2.5% w/v overnight at 4.degree.
C. The silk-HFIP solutions were then pipetted into 24-well culture
plates and left in the hood for about 3 hours for the silk films to
form and dry out. The silk films were then treated with 90% v/v
methanol to induce .beta.-sheet formation and prevent
resolubilization of the films in aqueous solutions.
[0121] Scanning Electron Microscopy:
[0122] To asses the ability for mineralization, the cast
recombinant silk film was first soaked in 200 mM aqueous calcium
chloride solution buffered with tris(hydroxymethyl) aminomethane
and HCl (pH 7.4) (Ca solution) for 1 hr at 37.degree. C., then Ca
solution was aspirated and the film was washed with abundant
distilled water to wash way any unbound Ca.sup.2+, then 120 mM
aqueous disodium hydrogenphosphate (P solution) was added to
immerse the silk film for 1 hr at 37.degree. C. After soaking in P
solution for 1 hr, the film was washed again by distilled water.
This is one round of mineralization. Three rounds of the soaking
were carried out. The film surface was then observed by SEM. See
FIGS. 6A-6C, which show mineral deposition on silk film cast using
CRGD-15mer-CDMP1. Deposition began to occur as in round one (FIG.
6B) and continued through round three (FIG. 6C). Control films made
from CRGD-15mer and 15mer showed no deposition (data not shown).
The SEM images indicate that the functional fusion silk proteins
are capable of inducing apatite nucleation and growth, while silk
proteins that so not contain mineralizing domains do not promote
apatite nucleation.
[0123] In addition, scanning electron microscopy (SEM) surface
morphologies of recombinant spider silk films after soaking in
1.5.times.SBF for various periods of time were assessed see FIG.
13. FIG. 13(A1)-FIG. 13(A5), SS15m-CDMP1 soaked in 1.5.times.SBF
for 0, 3, 7, 14 and 21 days: FIG. 13(A1)-FIG. 13(A5) respectively.
FIG. 13(B1)-FIG. 13(B5), SS15m soaked in 1.5.times.SBF for 0,3,7,14
and 21 days: FIG. 13(B1)-FIG. 13(B5) respectively.
[0124] The surfaces of the films made of CRGD-15mer-CDMP1 and
CRGD-15mer were smooth after casting and there was no big
difference between two films (FIG. 13A1 and FIG. 13B1). However,
after immersing in 1.5.times.SBF for 3 days, the surface
morphologies of the films were different (FIG. 13A2 and FIG.
13B2).
[0125] Transmission Electron Microscopy:
[0126] The high-magnification image of the crystals grew on
CRGD-15mer-CDMP1 (FIG. 14A) showed that the apatite, which appeared
flake-like in the SEM, is composed of aggregates of nanocrystals
with need shapes 100-200 nm in length. The electron diffraction
pattern of the nanocrystals (FIG. 14B) showed diffraction rings.
The spacings of the rings agreed with the characteristic x-ray
diffraction spacing of hydroxyapatite (JCPDS 09-0432). The rings
could be assigned to the (002), (211) planes. In addition, a
high-resolution TEM image (FIG. 14C) showed the lattice fringes of
apatite nanocrystals. The average distance between fringes is 0.82
nm, which is consistent with the value of teh (100) inerplanar
spacing in the apatite structure (0.817 nm).
Example 2
Formation of Silica Silk Fusions
Introduction
[0127] Silica is widespread in biological systems and serves
different functions, among which the most essential ones include
support and protection in single-celled organisms, such as diatoms,
to higher plants and animals. Despite its widespread occurrence and
importance of function, little is known about biosilica and the
mechanisms used to produce controlled microscopic and macroscopic
silica structures with such nanoscale precision and symmetry. The
remarkable control in vivo of the morphology of these beautiful
intricate patterns at small length scales are species-specific and
has attracted a great deal of interest in recent years as these
features exceed the capabilities of present-day synthetic and
technological approaches to materials engineering in vitro.
[0128] Silaffins.sup.1;2;3;4;5 form part of three families of
proteins identified to date in the organic matrix of the cell wall
of the diatom Cylindrotheca fusiformis. Silaffins are highly
post-translationally modified peptides and have received the most
attention because of their ability to induce and regulate silica
precipitation at ambient temperature and pressure. Silaffins are
low-molecular weight polypeptides: natSil-1A (6.5 kDa).sup.4,
natSil-1B (10 kDa).sup.5, and natSil-2 (40 kDa).sup.5, isolated by
treating the diatom cell wall with ammonium fluoride. A gene sil 1
has been isolated from a C. fusiformis genomic library and it
encodes a polypeptide of 265 amino acids. Seven repeated sequences
were identified in this sequence and named R1 to R7.sup.1. R1
corresponds to the precursor of Silaffin-1B, while R3 to R7 and R2
correspond to the precursors of the Silaffin-1A1 and Silaffin-1A2,
respectively.
[0129] Controlled formation of biosilica structures by different
proteins and peptides under various physical reaction environments
has also been reported.sup.6;7;8;9. The 19 amino-acid R5 peptide of
the Sil1 protein was utilized to obtain silica nanostructures with
different morphologies including spheres, arch-shaped morphologies
and even elongated fibers'. These results suggest that through
careful manipulation of the environmental conditions and the
application of a linear shear force, distinct morphologies can be
attained. These opportunities for control of materials outcomes in
biosilica morphology establish important links to device
fabrication from these materials with regularity in process and
outcomes to achieve technological relevance in the future, such as
for silica based micro- and nano-devices.
[0130] Applicants have genetically cloned the R5 peptide unit of
Sil1 protein to a 15mer spider silk clone of the consensus sequence
of the golden orb spider Nephila clavipes, expressed the fusion
protein and performed the same silicification reactions on silk
films made from the expressed protein. The purpose of fusing this
silicification-inducing peptide unit to our genetically engineered
silk is to combine the properties of our silk whether in the form
of films or other such as spun fibers to the silica precipitating
properties of R5 under ambient conditions to produce biomaterials
with controlled silica morphologies on the surface. These
biomaterials are especially useful in such fields as controlled
drug delivery.
Materials and Methods
Design and Cloning of Spider Silk Sequences
[0131] The repeat unit was selected used in the design of the 15mer
and CRGD15mer was based on the consensus sequence of spidroin1
native sequence of Nephila clavipes (accession P19837)
(-SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT-) (SEQ ID NO: 1). Multimers
encoding the repeat were cloned through the transfer of cloned
inserts between two shuttle vectors based on pUC19 and pCR-Script
(Novagen, Wis.), which were ampicillin and chloramphenicol
resistant respectively.sup.10;11.
[0132] The expression vector pET-30a (Novagen, Madison, Wis.) was
modified with a linker carrying the SpeI site flanked by sequences
encoding the amino acids CRGD (SEQ ID NO: 2) to obtain pET30-link.
The two complementary oligonucleotide sequences for the linker
were: GGATCCTGTCGCGGTGACACTAGTCGCGGTGACTGTG (SEQ ID NO: 13) and
GGATCCACAGTCACCGCGACTAGTGTCACCGCGACAG (SEQ ID NO: 14). The
restriction sites of BamHI and SpeI are underlined. The 15mer
sequence obtained by multimerization was inserted into pET30-link
to generate pET30-CRGD15mer. For the production of a spider silk
protein without CRGD (SEQ ID NO: 2), the construct pET30-15mer was
obtained by subcloning the NcoI-NotI fragment of pCR-15 into
pET-30a vector.
[0133] To construct the fusion protein CRGD15mer-R5, the polylinker
of pET-21a(+) shuttle vector was redesigned to contain a His-Tag
and the CRGD15mer was digested with the restriction enzyme BamHI
from pET-30a vector and inserted into the pET-21a(+)-link vector.
Two complementary oligonucleotide sequences for the R5 peptide were
designed with EcoRI and NotI sites at the 5' and 3' ends
respectively:
TABLE-US-00001 (SEQ ID NO: 15) 5'
aattcagcagcaaaaaaagcggcagctattcgggcagcaaaggca gcaaacgccgcatcctcgc
3' and (SEQ ID NO: 16) 3'
gtcgtcgtttttttcgccgtcgataagcccgtcgtttccgtcgtt tgcggcgtaggagcgccgg
5'
[0134] These synthetic oligonucleotides were annealed and ligated
into the pET-21a(+)-link vector right next to the CRGD15mer clone
to create the fusion protein with the His-Tag at the
C-terminus.
[0135] To construct the fusion protein 15mer-R5, the synthetic
oligonucleotides were ligated into the NotI and XhoI restriction
sites of pET-21a(+) vector right next to the 15mer clone. This
fusion protein has a His-Tag at the N-terminus. The amino acid
sequence of the R5 peptide of Sil1 protein is: SSKKSGSYSGSKGSKRRIL
(SEQ ID NO: 17). Use of other Sil1 protein sequences are also
contemplated, for example, the R2 peptide SSKKSGSYSGYSTKKSGSRRIL
(SEQ ID NO: 18), the R3 peptide SSKKSGSYSGYSKGSKRRIL (SEQ ID NO:
19), the R4/R6 peptide SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20), the R1
peptide SSKKSGSYYSYGTKK (SEQ ID NO:21).
Protein Expression and Purification
[0136] The constructs pET-21(a)+-15mer-R5 and pET-30a-CRGD15mer-R5
were used to transform the E. coli host strains RY-3041, a mutant
strain defective in the expression of SlyD protein, for
expression.sup.12;13. Cells were cultivated in LB broth at
37.degree. C. Protein expression was induced by the addition of 1
mM IPTG (Fisher Scientific, Hampton, N.H.) when the OD.sub.600 was
between 0.6 and 0.8. After approximately 6 hours of protein
expression, the cells were harvested by centrifugation at 9500 rpm.
For large scale expression, E. coli was grown in a fermentor
(Bioflo 3000, New Brunswick Scientific Co., Edison, N.J.) in
minimal medium supplemented with 1% yeast extract. Ammonia was used
as the base to maintain the pH at 6.8. When the pH exceeded 6.88,
as a result of glucose exhaustion in the culture, a feed solution
(50% glucose, 10% Yeast Extract, 2% MgSO.sub.4.7H.sub.2O) was
added. Pure O.sub.2 was also provided to the culture to sustain the
level of dissolved oxygen above 40%. All culture media contained
kanamycin (50 .mu.g/ml) or ampicillin (100 .mu.g/ml) for
selectivity. For the fermentor grown cells, expression was induced
when the absorbance was between 25 and 30 at OD.sub.600.
[0137] The cell pellets were resuspended by adding denaturing
buffer (100 mM NaH.sub.2PO.sub.4, 10 mM Tris HCl, 8 M urea, pH 8.0)
containing 10 mM imidazole. The cells were lysed by stirring for 30
min and were then centrifuged at 9500 rpm at 4.degree. C. for 30
min. His-tag purification of the proteins was performed by addition
of Ni-NTA agarose resin (Qiagen, Valencia, Calif.) to the
supernatant (batch purification) under denaturing conditions. After
washing the column with denaturing buffer at pH 6.3, the proteins
were eluted with denaturing buffer at pH 4.5 (without
imidazole).
[0138] SDS-polyacrylamide gel electrophoresis (PAGE) was performed
using 4-12% precast NuPage Bis-Tris gels (Invitrogen, Carlsbad,
Calif.). Electrophoresis was performed in MOPS buffer for 50 min at
200V. Purified samples were extensively dialyzed against several
changes of H.sub.2O. For dialysis, Snake Skin membranes (Pierce,
Rockford, Ill.) with MWCO of 7000 or lower were used. The dialyzed
samples were lyophilized using a LabConco lyophilizer. For
determination of the amino acid composition, the samples were
submitted to the W. M. Keck Foundation Biotechnology Resource
Laboratory (Yale University, New Haven, Conn.). The samples were
analyzed from bands of interest cut out from the gel or lyophilized
powder after purification and dialysis. Determination of protein
concentration was performed by BCA assay (Pierce, Rockford, Ill.)
or the molar absorptivity at 280 nm. FIGS. 7A and 7B show the
sequence of CRGD15mer-R5 (FIG. 7A) and 15mer-R5 (FIG. 7B)
Silicification Reactions
[0139] The lyophilized fusion proteins were then dissolved in HFIP
solvent at a concentration of 2.5% w/v overnight at 4.degree. C.
The silk-HFIP solutions were then pipetted into 24-well culture
plates and left in the hood for about 3 hours for the silk films to
form and dry out. The silk films were then either left as is or
treated with 90% v/v methanol to induce .beta.-sheet formation and
prevent resolubilization of the films in aqueous solutions. 100 mM
phosphate buffer at pH 5.5 was added to the silk films and leave to
sit for about 30 minutes before 1M tetramethoxysilane (TMOS)
dissolved in 1 mM hydrochloric acid was added to the mixture for
about 10 minutes. The films were then washed with MilliQ water
three times and left to dry overnight in the fume hood. These films
were then analyzed using a LEO 982 Scanning Electron Microscope at
the CIMS facility at Harvard University.
SEM Results
[0140] In order to exploit the self-assembling properties of silk
in developing silk-silica nanocomposites, experiments were
performed using TMOS alone as the precursor. Four genetically
engineered variants of the spider silk protein (two controls, one
with and one without RGD but both without R5, two chimeric versions
of the controls but with R5) were cast into films that were either
left untreated or were treated with methanol to induce a structural
transition to .beta.-sheet and thus decrease film solubility in
aqueous buffer. Silicification reactions were performed on the
films yielding spherical silica structures with diameters ranging
from .about.0.5 to 2.0 um only when the silica precipitating
domain, R5 peptide, was fused to the C-terminus of the silk
proteins (FIG. 8). The silk proteins that did not contain R5,
CRGD15mer and 15mer, did not yield significant changes in surface
morphology of the films upon exposure to the silicification
reactions.
[0141] Fusion proteins were assembled into fibers by
electrospinning. SEM images of the electropun fibers formed from
the chimeric proteins (FIGS. 9A-9D), and the morphological
characteristics observed when the fibers were treated with
methanol, were similar to those we observed previously for
electrospun silk fibroin with polyethylene oxide.sup.15. Upon
silicification on electrospun mats formed from the chimeric protein
CRGD15mer+R5 without methanol treatment, similar spherical silica
structures were observed as in the reactions on the cast films.
However, the dimensions of the silica spheres were slightly
smaller, ranging from 200 to 400 nm (FIG. 9). When the electrospun
fibers consisting of the chimera CRGD15mer+R5 were not treated with
methanol, the fibers fused together on the surface. Without the
.beta.-sheet inducing methanol treatment, the fibers are prone to
partially solubilize on the surface yielding a thin film upon which
the mineralization reaction takes place. However, upon treatment of
the chimera CRGD15mer+R5 electrospun mats with methanol before
silicification, a thin film formed from the solubilized and then
fused fibers at the surface and silica nanospheres did not form as
in the sample above. Instead, the fibers fused with each other as
expected.sup.15 and although mineralization occurred as confirmed
by XPS, silica deposited around the fibers providing a non-uniform
coating instead of the spheres (FIG. 9). When the chimera
CRGD15mer+R5 was electrospun during the silica polymerization
process (concurrent processing), silica deposition was induced in
and on the fibers and elliptically shaped silica particles fused to
the fibers were observed (FIG. 9). XPS analysis of the resulting
fibers confirmed the presence of elemental silicon (FIG. 10). Thus,
the concurrent processing approach, fiber spinning and
silicification reactions, resulted in a different morphology of the
silica in terms of location within the fibers and shape, compared
to the silicification reactions conducted post electrospinning.
SEQUENCES
[0142] Fibrous protein domain sequence derived from Spidroin1 (the
native sequence of the goldon orb spider Nephilia clavipes)<
TABLE-US-00002 (SEQ ID NO: 1) SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT
[0143] A linker sequence CRGD (SEQ ID NO: 2)
[0144] The consensus fibrous protein domain sequence derived from
Spidroin1 (the native sequence of the goldon orb spider Nephilia
clavipes) with CRGD linker
TABLE-US-00003 (SEQ ID NO: 3)
CRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT
[0145] 15 mer: An amino acid sequence that contains a repeat of a
fibrous protein domain sequence derived from Spidroin1 (the native
sequence of the goldon orb spider Nephilia clavipes) The fibrous
protein domain sequence is repeated 15 times.
TABLE-US-00004 (SEQ ID NO: 4)
MASMTGGQQMGRGSAMASGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQG
TSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA
AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQ
GTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA
AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGS
QGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA
AAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG
SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG
AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL
GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGA
GAAAAAGGAGQGGYGGLGSQGTSHHHHH
[0146] CRGD-15mer: an amino acid sequence that contains a repeat of
a fibrous protein domain sequence derived from Spidroin1 (the
native sequence of the goldon orb spider Nephilia clavipes) The
fibrous protein domain sequence is repeated 15 times with a CRGD
linking sequence
TABLE-US-00005 (SEQ ID NO: 5)
MASMTGGQQMGRGSCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGS
QGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA
AAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG
SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG
AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL
GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGA
GAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG
LGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQG
AGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYG
GLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ
GAGAAAAAGGAGQGGYGGLGSQGTSRGDCGSHHHHHH
[0147] CDMP1, the C-Terminal Sequence of DMP1, a Mineralizing
domain
TABLE-US-00006 (SEQ ID NO: 6)
RGDNPDNTSQTGDQRDSESSEEDRLNTFSSSESQSTEEQGDSESNESLS
LSEESQESAQDEDSSSQEGLQSQSASRESRSQESQSEEDSRSEENRDSD
SQDSSRSKEESNSTGSTSSSEEDNHPKNIEADNRKLIVDAYHNKPIGDQ DDNDCQDGY
[0148] DMP1, the full length sequence of DMP1, a Mineralizing
domain
TABLE-US-00007 (SEQ ID NO: 7)
LPVARYQNTESESSEERTGNLAQSPPPPMANSDHTDSSESGEELGSDR
SQYRPAGGLSKSAGMDADKEEDEDDSGDDTFGDEDNGPGPEERQWGGP
SRLDSDEDSADTTQSSEDSTSQENSAQDTPSDSKDHHSDEADSRPEAG
DSTQDSESEEYRVGGGSEGESSHGDGSEFDDEGMQSDDPGSTRSDRGH
TRMSSADISSEESKGDHEPTSTQDSDDSQDVEFSSRKSFRRSRVSEED
DRGELADSNSRETQSVSTEDFRSKEESRSETQEDTAETQSQEDSPEGQ
DPSSESSEEAGEPSQESSSESQEGVASESRGDNPDNTSQTGDQRDSES
SEEDRLNTFSSSESQSTEEQGDSESNESLSLSEESQESAQDEDSSSQE
GLQSQSASRESRSQESQSEEDSRSEENRDSDSQDSSRSKEESNSTGST
SSSEEDNHPKNIEADNRKLIVDAYHNKPIGDQDDNDCQDGY
[0149] BSP: Bone sialoprotein, a Mineralizing domain
TABLE-US-00008 (SEQ ID NO: 8)
SEFPVQSSSDSSEENGNGDSSEEEEEEEENSNEEENNEENED SDGNED
[0150] CRGD-15mer-CDMP1: (SEQ ID NO: 9): a fusion protein of (SEQ
ID NO: 5) and (SEQ ID NO: 6)<
TABLE-US-00009 (SEQ ID NO: 9)
MASMTGGQQMGRCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG
SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ
GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ
GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG
RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA
AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL
GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGG
QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG
QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS
GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA
AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG
LGSQGTSRGDCGSRGDNPDNTSQTGDQRDSESSEEDRLNTFSSSES
QSTEEQGDSESNESLSLSEESQESAQDEDSSSQEGLQSQSASRESR
SQESQSEEDSRSEENRDSDSQDSSRSKEESNSTGSTSSSEEDNHPK
NIEADNRKLIVDAYHNKPIGDQDDNDCQDGY
[0151] CRGD-15mer-DMP1 (SEQ ID NO: 10): a fusion protein of (SEQ ID
NO: 5) and SEQ ID NO: 7)<
TABLE-US-00010 (SEQ ID NO: 10)
MASMTGGQQMGRCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGGLG
SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ
GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ
GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG
RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA
AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL
GGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGLGSQGTSGRGGLGG
QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG
QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS
GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA
AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG
LGSQGTSRGDCGSLPVARYQNTESESSEERTGNLAQSPPPPMANSD
HTDSSESGEELGSDRSQYRPAGGLSKSAGMDADKEEDEDDSGDDTF
GDEDNGPGPEERQWGGPSRLDSDEDSADTTQSSEDSTSQENSAQDT
PSDSKDHHSDEADSRPEAGDSTQDSESEEYRVGGGSEGESSHGDGS
EFDDEGMQSDDPGSTRSDRGHTRMSSADISSEESKGDHEPTSTQDS
DDSQDVEFSSRKSFRRSRVSEEDDRGELADSNSRETQSVSTEDFRS
KEESRSETQEDTAETQSQEDSPEGQDPSSESSEEAGEPSQESSSES
QEGVASESRGDNPDNTSQTGDQRDSESSEEDRLNTFSSSESQSTEE
QGDSESNESLSLSEESQESAQDEDSSSQEGLQSQSASRESRSQESQ
SEEDSRSEENRDSDSQDSSRSKEESNSTGSTSSSEEDNHPKNIEAD
NRKLIVDAYHNKPIGDQDDNDCQDGY
[0152] 15mer-BSP (SEQ ID NO: 11): a fusion protein of (SEQ ID NO:
4) and (SEQ ID NO: 8)
TABLE-US-00011 (SEQ ID NO: 11)
MASMTGGQQMGRGSAMASGRGGLGGQGAGAAAAAGGAGQGGYGGLG
SQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQ
GAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQ
GGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSG
RGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAA
AAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGL
GSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGG
QGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAG
QGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTS
GRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAA
AAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGG
LGSQGTSEFPVQSSSDSSEENGNGDSSEEEEEEEENSNEEENNEEN EDSDGNEDKLHHHHHH
[0153] CRGD-15mer-BSP (SEQ ID NO: 12): a fusion protein of (SEQ ID
NO: 5) and (SEQ ID NO: 8) with linker
TABLE-US-00012 (SEQ ID NO: 12)
MASMTGGQQMGRGSCRGDTSGRGGLGGQGAGAAAAAGGAGQGGYGG
LGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLG
GQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGA
GQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGT
SGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGA
AAAAGGAGQGGYGGLGSQGTSGRGGLGGOGAGAAAAAGGAGOGGYG
GTGSOGTSGRGGTGGOGAGAAAAAGGAGOGGYGGLGSQGTSGRGGL
GGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGG
AGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQG
TSGRGGLGGQGAGAAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAG
AAAAAGGAGQGGYGGLGSQGTSGRGGLGGQGAGAAAAAGGAGQGGY
GGLGSQGTSRGDCGSESEFPVQSSSDSSEENGNGDSSEEEEEEEEN
SNEEENNEENEDSDGNEDKLHHHHHH
[0154] One of two complementary oligonucleotide sequences for the
linker carrying the SpeI site flanked by sequences encoding the
amino acids CRGD to obtain pET30-link
TABLE-US-00013 (SEQ ID NO: 13)
GGATCCTGTCGCGGTGACACTAGTCGCGGTGACTGTG
[0155] One of two complementary oligonucleotide sequences for the
linker carrying the SpeI site flanked by sequences encoding the
amino acids CRGD to obtain pET30-link
TABLE-US-00014 (SEQ ID NO: 14)
GGATCCACAGTCACCGCGACTAGTGTCACCGCGACAG
[0156] One of two complementary oligonucleotide sequences for the
R5 peptide (contains the 19 amino-acid R5 peptide of the Sil1
protein) which were designed with EcoRI and NotI sites at the 5'
and 3' ends respectively
TABLE-US-00015 (SEQ ID NO: 15) 5'
aattcagcagcaaaaaaagcggcagctattcgggcagcaaaggca gcaaacgccgcatcctcgc
3'
[0157] One of two complementary oligonucleotide sequences for the
R5 peptide (contains the 19 amino-acid R5 peptide of the Sil1
protein) which were designed with EcoRI and NotI sites at the 5'
and 3' ends respectively.
TABLE-US-00016 (SEQ ID NO: 16) 3'
gtcgtcgtttttttcgccgtcgataagcccgtcgtttccgtcgttt gcggcgtaggagcgccgg
5'
[0158] The amino acid sequence of the R5 peptide of Sil1 protein
from C. fusiformis is: SSKKSGSYSGSKGSKRRIL (SEQ ID NO: 17)
[0159] The amino acid sequence of the R2 peptide of Sil1 protein
from C. fusiformis is: SSKKSGSYSGYSTKKSGSRRIL (SEQ ID NO: 18),
[0160] The amino acid sequence of the R3 peptide of Sil1 protein
from C. fusiformis is: SSKKSGSYSGYSKGSKRRIL (SEQ ID NO: 19),
[0161] The amino acid sequence of the R4/R6 peptide of Sil1 protein
from C. fusiformis is: SSKKSGSYSGYSKGSKRRNL (SEQ ID NO: 20).
[0162] The amino acid sequence of the R1 peptide of Sil1 protein
from C. fusiformis is: SSKKSGSYYSYGTKK (SEQ ID NO:21).
[0163] Bone Sialoprotein Precursor [Homo sapiens] Accession
AAC95490 is:
TABLE-US-00017 (SEQ ID NO: 22) MKTALILLSI LGMACAFSMK NLHRRVKIED
SEENGVFKYR PRYYLYKHAY FYPHLKRFPV QGSSDSSEEN GDDSSEEEEE EEETSNEGEN
NEESNEDEDS EAENTTLSAT TLGYGEDATP GTGYTGLAAI QLPKKAGDIT NKATKEKESD
EEEEEEEEGN ENEESEAEVD ENEQGINGTS TNSTEAENGN GSSGGDNGEE GEEESVTGAN
AEGTTETGGQ GKGTSKTTTS PNGGFEPTTP PQVYRTTSPP FGKTTTVEYE GEYEYTGVNE
YDNGYEIYES ENGEPRGDNY RAYEDEYSYF KGQGYDGYDG QNYYHHQ
[0164] Silaffin 1 precursor (natSil-1) [Contains: Silaffin-1B;
Silaffin-1A2; Silaffin-1A1] Accession Q9SE35: MKLTAIFPLL FTAVGYCAAQ
SIADLAAANL STEDSKSAQL ISADSSDDAS DSSVESVDAA SSDVSGSSVE SVDVSGSSLE
SVDVSGSSLE SVDDSSEDSE EEELRILSSK KSGSYYSYGT KKSGSYSGYS TKKSASRRIL
SSKKSGSYSG YSTKKSGSRR ILSSKKSGSY SGSKGSKRR1 LSSKKSGSYS GSKGSKRRNL
SSKKSGSYSG SKGSKRRILS SKKSGSYSGS KGSKRRNLSS KKSGSYSGSK GSKRRILSGG
LRGSM (SEQ ID NO: 23)
[0165] CRGD15mer-R5: Sequence of fusion protein; fusion of
CRGD15mer to the amino acid sequence of the R5 peptide of Sil1
protein from C. fusiformis.
TABLE-US-00018 (SEQ ID NO: 24) MASMTGGQQM GRGSCRGDTS GRGGLGGQGA
GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG
LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG
TSGRGGLGGQ GAGAAAAAGG AGQGGYGGLG SQGTSGRGGL GGQGAGAAAA AGGAGQGGYG
GLGSQGTSGR GGLGGQGAGA AAAAGGAGQG GYGGLGSQGT SGRGGLGGQG AGAAAAAGGA
GQGGYGGLGS QGTSGRGGLG GQGAGAAAAA GGAGQGGYGG LGSQGTSGRG GLGGQGAGAA
AAAGGAGQGG YGGLGSQGTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG
QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG
RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSGRGGLGGQ GAGAAAAAGG AGQGGYGGLG
SQGTSRGDCG SEFSSKKSGS YSGSKGSKRR ILCGRHHHHH H
[0166] 15mer-R5: Sequence of fusion protein; fusion of 15mer to the
amino acid sequence of the R5 peptide of Sil1 protein from C.
fusiformis. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMASGRG
GLGGQGAGAA AAAGGAGQGG YGGLGSQGTS GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ
GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY
GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ GGYGGLGSQG TSGRGGLGGQ GAGAAAAAGG
AGQGGYGGLG SQGTSGRGGL GGQGAGAAAA AGGAGQGGYG GLGSQGTSGR GGLGGQGAGA
AAAAGGAGQG GYGGLGSQGT SGRGGLGGQG AGAAAAAGGA GQGGYGGLGS QGTSGRGGLG
GQGAGAAAAA GGAGQGGYGG LGSQGTSGRG GLGGQGAGAA AAAGGAGQGG YGGLGSQGTS
GRGGLGGQGA GAAAAAGGAG QGGYGGLGSQ GTSGRGGLGG QGAGAAAAAG GAGQGGYGGL
GSQGTSGRGG LGGQGAGAAA AAGGAGQGGY GGLGSQGTSG RGGLGGQGAG AAAAAGGAGQ
GGYGGLGSQG TSSSKKSGSY SGSKGSKRRI L (SEQ ID NO: 25)
[0167] PCR PRIMER BamH I site, C-DMPlf:
5'-CAGGATCCAGGGGTGACAACCCAGAT-3' (SEQ ID NO: 26)
[0168] PCR PRIMER Xho I site, C-DMP1r: 5'
GCCTCGAGGTAGCCATCTTGGCAATC-3' (SEQ ID NO: 27).
[0169] The references cited herein and throughout the application
are incorporated by reference.
REFERENCES
[0170] 1. Kroger, N., Deutzmann, R. & Sumper, M. (1999).
Polycationic peptides from diatom biosilica that direct silica
nanosphere formation. Science 286, 1129-32. [0171] 2. Kroger, N.,
Deutzmann, R. & Sumper, M. (2001). Silica-precipitating
peptides from diatoms. The chemical structure of silaffin-A from
Cylindrotheca fusiformis. J Biol Chem 276, 26066-70. [0172] 3.
Kroger, N., Deutzmann, R., Bergsdorf, C. & Sumper, M. (2000).
Species-specific polyamines from diatoms control silica morphology.
Proc Natl Acad Sci USA 97, 14133-8. [0173] 4. Kroger, N., Lorenz,
S., Brunner, E. & Sumper, M. (2002). Self-assembly of highly
phosphorylated silaffins and their function in biosilica
morphogenesis. Science 298, 584-6. [0174] 5. Poulsen, N., Sumper,
M. & Kroger, N. (2003). Biosilica formation in diatoms:
characterization of native silaffin-2 and its role in silica
morphogenesis. Proc Natl Acad Sci USA 100, 12075-80. [0175] 6.
Rodriguez, F., Glawe, D. D., Naik, R. R., Hallinan, K. P. &
Stone, M. O. (2004). Study of the chemical and physical influences
upon in vitro peptide-mediated silica formation. Biomacromolecules
5, 261-5. [0176] 7. Naik, R. R., Whitlock, P. W., Rodriguez, F.,
Brott, L. L., Glawe, D. D., Clarson, S. J. & Stone, M. O.
(2003). Controlled formation of biosilica structures in vitro. Chem
Commun (Camb), 238-9. [0177] 8. Patwardhan, S. V. & Clarson, S.
J. (2002). Silicification and biosilicification. Part 4. Effect of
template size on the formation of silica. Journal of Inorganic and
Organometallic Polymers 12, 109-116. [0178] 9. Patwardhan, S. V.
& Clarson, S. J. (2003). Silicification and biosilicification:
Part 5. An investigation of the silica structures formed at weakly
acidic pH and neutral pH as facilitated by cationically charged
macromolecules. Materials Science and Engineering C 23, 495-499.
[0179] 10. Prince, J. T., McGrath, K. P., DiGirolamo, C. M. &
Kaplan, D. L. (1995). Construction, cloning, and expression of
synthetic genes encoding spider dragline silk. Biochemistry 34,
10879-85. [0180] 11. Winkler, S., Wilson, D. & Kaplan, D. L.
(2000). Controlling beta-sheet assembly in genetically engineered
silk by enzymatic Phosphorylation/Dephosphorylation, by.
Biochemistry 39, 14002. [0181] 12. Yan, S. Z., Beeler, J. A., Chen,
Y., Shelton, R. K. & Tang, W. J. (2001). The regulation of type
7 adenylyl cyclase by its C1b region and Escherichia coli
peptidylprolyl isomerase, SlyD. J Biol Chem 276, 8500-6. [0182] 13.
Huang, J., Valluzzi, R., Bini, E., Vernaglia, B. & Kaplan, D.
L. (2003). Cloning, expression, and assembly of sericin-like
protein. J Biol Chem 278, 46117-23. [0183] 14. Sumper, M. &
Kroger, N. (2004). Silica formation in diatoms: the function of
long-chain polyamines and silaffins. J Mater Chem 14, 2059-2065.
[0184] 15. Jin, H. J., Fridrikh, S. V., Rutledge, G. C. &
Kaplan, D. L. (2002). Electrospinning Bombyx mori silk with
poly(ethylene oxide). Biomacromolecules 3, 1233-1239.
Sequence CWU 1
1
27133PRTNephila clavipes 1Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala Ala 1 5 10 15 Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly Leu Gly Ser Gln Gly 20 25 30 Thr 24PRTArtificial
SequenceDescription of Artificial Sequence Synthetic linker peptide
2Cys Arg Gly Asp 1 338PRTNephila clavipes 3Cys Arg Gly Asp Thr Ser
Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala 1 5 10 15 Gly Ala Ala Ala
Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 20 25 30 Leu Gly
Ser Gln Gly Thr 35 4518PRTNephila clavipes 4Met Ala Ser Met Thr Gly
Gly Gln Gln Met Gly Arg Gly Ser Ala Met 1 5 10 15 Ala Ser Gly Arg
Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala 20 25 30 Ala Ala
Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln 35 40 45
Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala 50
55 60 Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly
Ser 65 70 75 80Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala 85 90 95 Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly Leu Gly 100 105 110 Ser Gln Gly Thr Ser Gly Arg Gly Gly
Leu Gly Gly Gln Gly Ala Gly 115 120 125 Ala Ala Ala Ala Ala Gly Gly
Ala Gly Gln Gly Gly Tyr Gly Gly Leu 130 135 140 Gly Ser Gln Gly Thr
Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala 145 150 155 160Gly Ala
Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 165 170 175
Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly 180
185 190 Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr
Gly 195 200 205 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu
Gly Gly Gln 210 215 220 Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala
Gly Gln Gly Gly Tyr 225 230 235 240Gly Gly Leu Gly Ser Gln Gly Thr
Ser Gly Arg Gly Gly Leu Gly Gly 245 250 255 Gln Gly Ala Gly Ala Ala
Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly 260 265 270 Tyr Gly Gly Leu
Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly 275 280 285 Gly Gln
Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly 290 295 300
Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu 305
310 315 320Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala
Gly Gln 325 330 335 Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser
Gly Arg Gly Gly 340 345 350 Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala
Ala Ala Gly Gly Ala Gly 355 360 365 Gln Gly Gly Tyr Gly Gly Leu Gly
Ser Gln Gly Thr Ser Gly Arg Gly 370 375 380 Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala 385 390 395 400Gly Gln Gly
Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg 405 410 415 Gly
Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly 420 425
430 Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly
435 440 445 Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala
Ala Gly 450 455 460 Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser
Gln Gly Thr Ser 465 470 475 480Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala Ala Ala 485 490 495 Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly Leu Gly Ser Gln Gly Thr 500 505 510 Ser His His His His
His 515 5527PRTNephila clavipes 5Met Ala Ser Met Thr Gly Gly Gln
Gln Met Gly Arg Gly Ser Cys Arg 1 5 10 15 Gly Asp Thr Ser Gly Arg
Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala 20 25 30 Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly 35 40 45 Ser Gln
Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly 50 55 60
Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu 65
70 75 80Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala 85 90 95 Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly 100 105 110 Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly
Leu Gly Gly Gln Gly 115 120 125 Ala Gly Ala Ala Ala Ala Ala Gly Gly
Ala Gly Gln Gly Gly Tyr Gly 130 135 140 Gly Leu Gly Ser Gln Gly Thr
Ser Gly Arg Gly Gly Leu Gly Gly Gln 145 150 155 160Gly Ala Gly Ala
Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr 165 170 175 Gly Gly
Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly 180 185 190
Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly 195
200 205 Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu
Gly 210 215 220 Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala
Gly Gln Gly 225 230 235 240Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr
Ser Gly Arg Gly Gly Leu 245 250 255 Gly Gly Gln Gly Ala Gly Ala Ala
Ala Ala Ala Gly Gly Ala Gly Gln 260 265 270 Gly Gly Tyr Gly Gly Leu
Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly 275 280 285 Leu Gly Gly Gln
Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly 290 295 300 Gln Gly
Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly 305 310 315
320Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala
325 330 335 Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser
Gly Arg 340 345 350 Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala
Ala Ala Gly Gly 355 360 365 Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly
Ser Gln Gly Thr Ser Gly 370 375 380 Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala Ala Ala Gly 385 390 395 400Gly Ala Gly Gln Gly
Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser 405 410 415 Gly Arg Gly
Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala 420 425 430 Gly
Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr 435 440
445 Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala
450 455 460 Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser
Gln Gly 465 470 475 480Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala 485 490 495 Ala Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly Leu Gly Ser Gln 500 505 510 Gly Thr Ser Arg Gly Asp Cys
Gly Ser His His His His His His 515 520 525 6156PRTRattus
norvegicus 6Arg Gly Asp Asn Pro Asp Asn Thr Ser Gln Thr Gly Asp Gln
Arg Asp 1 5 10 15 Ser Glu Ser Ser Glu Glu Asp Arg Leu Asn Thr Phe
Ser Ser Ser Glu 20 25 30 Ser Gln Ser Thr Glu Glu Gln Gly Asp Ser
Glu Ser Asn Glu Ser Leu 35 40 45 Ser Leu Ser Glu Glu Ser Gln Glu
Ser Ala Gln Asp Glu Asp Ser Ser 50 55 60 Ser Gln Glu Gly Leu Gln
Ser Gln Ser Ala Ser Arg Glu Ser Arg Ser 65 70 75 80Gln Glu Ser Gln
Ser Glu Glu Asp Ser Arg Ser Glu Glu Asn Arg Asp 85 90 95 Ser Asp
Ser Gln Asp Ser Ser Arg Ser Lys Glu Glu Ser Asn Ser Thr 100 105 110
Gly Ser Thr Ser Ser Ser Glu Glu Asp Asn His Pro Lys Asn Ile Glu 115
120 125 Ala Asp Asn Arg Lys Leu Ile Val Asp Ala Tyr His Asn Lys Pro
Ile 130 135 140 Gly Asp Gln Asp Asp Asn Asp Cys Gln Asp Gly Tyr 145
150 155 7473PRTRattus norvegicus 7Leu Pro Val Ala Arg Tyr Gln Asn
Thr Glu Ser Glu Ser Ser Glu Glu 1 5 10 15 Arg Thr Gly Asn Leu Ala
Gln Ser Pro Pro Pro Pro Met Ala Asn Ser 20 25 30 Asp His Thr Asp
Ser Ser Glu Ser Gly Glu Glu Leu Gly Ser Asp Arg 35 40 45 Ser Gln
Tyr Arg Pro Ala Gly Gly Leu Ser Lys Ser Ala Gly Met Asp 50 55 60
Ala Asp Lys Glu Glu Asp Glu Asp Asp Ser Gly Asp Asp Thr Phe Gly 65
70 75 80Asp Glu Asp Asn Gly Pro Gly Pro Glu Glu Arg Gln Trp Gly Gly
Pro 85 90 95 Ser Arg Leu Asp Ser Asp Glu Asp Ser Ala Asp Thr Thr
Gln Ser Ser 100 105 110 Glu Asp Ser Thr Ser Gln Glu Asn Ser Ala Gln
Asp Thr Pro Ser Asp 115 120 125 Ser Lys Asp His His Ser Asp Glu Ala
Asp Ser Arg Pro Glu Ala Gly 130 135 140 Asp Ser Thr Gln Asp Ser Glu
Ser Glu Glu Tyr Arg Val Gly Gly Gly 145 150 155 160Ser Glu Gly Glu
Ser Ser His Gly Asp Gly Ser Glu Phe Asp Asp Glu 165 170 175 Gly Met
Gln Ser Asp Asp Pro Gly Ser Thr Arg Ser Asp Arg Gly His 180 185 190
Thr Arg Met Ser Ser Ala Asp Ile Ser Ser Glu Glu Ser Lys Gly Asp 195
200 205 His Glu Pro Thr Ser Thr Gln Asp Ser Asp Asp Ser Gln Asp Val
Glu 210 215 220 Phe Ser Ser Arg Lys Ser Phe Arg Arg Ser Arg Val Ser
Glu Glu Asp 225 230 235 240Asp Arg Gly Glu Leu Ala Asp Ser Asn Ser
Arg Glu Thr Gln Ser Val 245 250 255 Ser Thr Glu Asp Phe Arg Ser Lys
Glu Glu Ser Arg Ser Glu Thr Gln 260 265 270 Glu Asp Thr Ala Glu Thr
Gln Ser Gln Glu Asp Ser Pro Glu Gly Gln 275 280 285 Asp Pro Ser Ser
Glu Ser Ser Glu Glu Ala Gly Glu Pro Ser Gln Glu 290 295 300 Ser Ser
Ser Glu Ser Gln Glu Gly Val Ala Ser Glu Ser Arg Gly Asp 305 310 315
320Asn Pro Asp Asn Thr Ser Gln Thr Gly Asp Gln Arg Asp Ser Glu Ser
325 330 335 Ser Glu Glu Asp Arg Leu Asn Thr Phe Ser Ser Ser Glu Ser
Gln Ser 340 345 350 Thr Glu Glu Gln Gly Asp Ser Glu Ser Asn Glu Ser
Leu Ser Leu Ser 355 360 365 Glu Glu Ser Gln Glu Ser Ala Gln Asp Glu
Asp Ser Ser Ser Gln Glu 370 375 380 Gly Leu Gln Ser Gln Ser Ala Ser
Arg Glu Ser Arg Ser Gln Glu Ser 385 390 395 400Gln Ser Glu Glu Asp
Ser Arg Ser Glu Glu Asn Arg Asp Ser Asp Ser 405 410 415 Gln Asp Ser
Ser Arg Ser Lys Glu Glu Ser Asn Ser Thr Gly Ser Thr 420 425 430 Ser
Ser Ser Glu Glu Asp Asn His Pro Lys Asn Ile Glu Ala Asp Asn 435 440
445 Arg Lys Leu Ile Val Asp Ala Tyr His Asn Lys Pro Ile Gly Asp Gln
450 455 460 Asp Asp Asn Asp Cys Gln Asp Gly Tyr 465 470
848PRTUnknownDescription of Unknown Unknown bone sialoprotein
sequence of mammal origin 8Ser Glu Phe Pro Val Gln Ser Ser Ser Asp
Ser Ser Glu Glu Asn Gly 1 5 10 15 Asn Gly Asp Ser Ser Glu Glu Glu
Glu Glu Glu Glu Glu Asn Ser Asn 20 25 30 Glu Glu Glu Asn Asn Glu
Glu Asn Glu Asp Ser Asp Gly Asn Glu Asp 35 40 45 9675PRTArtificial
SequenceDescription of Artificial Sequence Synthetic fusion protein
9Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Cys Arg Gly Asp 1
5 10 15 Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala
Ala 20 25 30 Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu
Gly Ser Gln 35 40 45 Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln
Gly Ala Gly Ala Ala 50 55 60 Ala Ala Ala Gly Gly Ala Gly Gln Gly
Gly Tyr Gly Gly Leu Gly Ser 65 70 75 80Gln Gly Thr Ser Gly Arg Gly
Gly Leu Gly Gly Gln Gly Ala Gly Ala 85 90 95 Ala Ala Ala Ala Gly
Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly 100 105 110 Ser Gln Gly
Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly 115 120 125 Ala
Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu 130 135
140 Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala
145 150 155 160Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly 165 170 175 Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly
Leu Gly Gly Gln Gly 180 185 190 Ala Gly Ala Ala Ala Ala Ala Gly Gly
Ala Gly Gln Gly Gly Tyr Gly 195 200 205 Gly Leu Gly Ser Gln Gly Thr
Ser Gly Arg Gly Gly Leu Gly Gly Gln 210 215 220 Gly Ala Gly Ala Ala
Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr 225 230 235 240Gly Gly
Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly 245 250 255
Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly 260
265 270 Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu
Gly 275 280 285 Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala
Gly Gln Gly 290 295 300 Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser
Gly Arg Gly Gly Leu 305 310 315 320Gly Gly Gln Gly Ala Gly Ala Ala
Ala Ala Ala Gly Gly Ala Gly Gln 325 330 335 Gly Gly Tyr Gly Gly Leu
Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly 340 345 350 Leu Gly Gly Gln
Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly 355 360 365 Gln Gly
Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly 370 375 380
Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala 385
390 395 400Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser
Gly Arg 405 410 415 Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala
Ala Ala Gly
Gly 420 425 430 Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser Gly 435 440 445 Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala
Ala Ala Ala Ala Gly 450 455 460 Gly Ala Gly Gln Gly Gly Tyr Gly Gly
Leu Gly Ser Gln Gly Thr Ser 465 470 475 480Gly Arg Gly Gly Leu Gly
Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala 485 490 495 Gly Gly Ala Gly
Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr 500 505 510 Ser Arg
Gly Asp Cys Gly Ser Arg Gly Asp Asn Pro Asp Asn Thr Ser 515 520 525
Gln Thr Gly Asp Gln Arg Asp Ser Glu Ser Ser Glu Glu Asp Arg Leu 530
535 540 Asn Thr Phe Ser Ser Ser Glu Ser Gln Ser Thr Glu Glu Gln Gly
Asp 545 550 555 560Ser Glu Ser Asn Glu Ser Leu Ser Leu Ser Glu Glu
Ser Gln Glu Ser 565 570 575 Ala Gln Asp Glu Asp Ser Ser Ser Gln Glu
Gly Leu Gln Ser Gln Ser 580 585 590 Ala Ser Arg Glu Ser Arg Ser Gln
Glu Ser Gln Ser Glu Glu Asp Ser 595 600 605 Arg Ser Glu Glu Asn Arg
Asp Ser Asp Ser Gln Asp Ser Ser Arg Ser 610 615 620 Lys Glu Glu Ser
Asn Ser Thr Gly Ser Thr Ser Ser Ser Glu Glu Asp 625 630 635 640Asn
His Pro Lys Asn Ile Glu Ala Asp Asn Arg Lys Leu Ile Val Asp 645 650
655 Ala Tyr His Asn Lys Pro Ile Gly Asp Gln Asp Asp Asn Asp Cys Gln
660 665 670 Asp Gly Tyr 67510992PRTArtificial SequenceDescription
of Artificial Sequence Synthetic fusion protein 10Met Ala Ser Met
Thr Gly Gly Gln Gln Met Gly Arg Cys Arg Gly Asp 1 5 10 15 Thr Ser
Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala 20 25 30
Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln 35
40 45 Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala
Ala 50 55 60 Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly
Leu Gly Ser 65 70 75 80Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly
Gln Gly Ala Gly Ala 85 90 95 Ala Ala Ala Ala Gly Gly Ala Gly Gln
Gly Gly Tyr Gly Gly Leu Gly 100 105 110 Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly Gln Gly Ala Gly 115 120 125 Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu 130 135 140 Gly Ser Gln
Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala 145 150 155
160Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly
165 170 175 Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly
Gln Gly 180 185 190 Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
Gly Gly Tyr Gly 195 200 205 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly Gln 210 215 220 Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly Tyr 225 230 235 240Gly Gly Leu Gly Ser
Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly 245 250 255 Gln Gly Ala
Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly 260 265 270 Tyr
Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly 275 280
285 Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly
290 295 300 Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly
Gly Leu 305 310 315 320Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln 325 330 335 Gly Gly Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly Arg Gly Gly 340 345 350 Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala Gly 355 360 365 Gln Gly Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly 370 375 380 Gly Leu Gly
Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala 385 390 395
400Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
405 410 415 Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly 420 425 430 Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly 435 440 445 Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly 450 455 460 Gly Ala Gly Gln Gly Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr Ser 465 470 475 480Gly Arg Gly Gly Leu
Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala 485 490 495 Gly Gly Ala
Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr 500 505 510 Ser
Arg Gly Asp Cys Gly Ser Leu Pro Val Ala Arg Tyr Gln Asn Thr 515 520
525 Glu Ser Glu Ser Ser Glu Glu Arg Thr Gly Asn Leu Ala Gln Ser Pro
530 535 540 Pro Pro Pro Met Ala Asn Ser Asp His Thr Asp Ser Ser Glu
Ser Gly 545 550 555 560Glu Glu Leu Gly Ser Asp Arg Ser Gln Tyr Arg
Pro Ala Gly Gly Leu 565 570 575 Ser Lys Ser Ala Gly Met Asp Ala Asp
Lys Glu Glu Asp Glu Asp Asp 580 585 590 Ser Gly Asp Asp Thr Phe Gly
Asp Glu Asp Asn Gly Pro Gly Pro Glu 595 600 605 Glu Arg Gln Trp Gly
Gly Pro Ser Arg Leu Asp Ser Asp Glu Asp Ser 610 615 620 Ala Asp Thr
Thr Gln Ser Ser Glu Asp Ser Thr Ser Gln Glu Asn Ser 625 630 635
640Ala Gln Asp Thr Pro Ser Asp Ser Lys Asp His His Ser Asp Glu Ala
645 650 655 Asp Ser Arg Pro Glu Ala Gly Asp Ser Thr Gln Asp Ser Glu
Ser Glu 660 665 670 Glu Tyr Arg Val Gly Gly Gly Ser Glu Gly Glu Ser
Ser His Gly Asp 675 680 685 Gly Ser Glu Phe Asp Asp Glu Gly Met Gln
Ser Asp Asp Pro Gly Ser 690 695 700 Thr Arg Ser Asp Arg Gly His Thr
Arg Met Ser Ser Ala Asp Ile Ser 705 710 715 720Ser Glu Glu Ser Lys
Gly Asp His Glu Pro Thr Ser Thr Gln Asp Ser 725 730 735 Asp Asp Ser
Gln Asp Val Glu Phe Ser Ser Arg Lys Ser Phe Arg Arg 740 745 750 Ser
Arg Val Ser Glu Glu Asp Asp Arg Gly Glu Leu Ala Asp Ser Asn 755 760
765 Ser Arg Glu Thr Gln Ser Val Ser Thr Glu Asp Phe Arg Ser Lys Glu
770 775 780 Glu Ser Arg Ser Glu Thr Gln Glu Asp Thr Ala Glu Thr Gln
Ser Gln 785 790 795 800Glu Asp Ser Pro Glu Gly Gln Asp Pro Ser Ser
Glu Ser Ser Glu Glu 805 810 815 Ala Gly Glu Pro Ser Gln Glu Ser Ser
Ser Glu Ser Gln Glu Gly Val 820 825 830 Ala Ser Glu Ser Arg Gly Asp
Asn Pro Asp Asn Thr Ser Gln Thr Gly 835 840 845 Asp Gln Arg Asp Ser
Glu Ser Ser Glu Glu Asp Arg Leu Asn Thr Phe 850 855 860 Ser Ser Ser
Glu Ser Gln Ser Thr Glu Glu Gln Gly Asp Ser Glu Ser 865 870 875
880Asn Glu Ser Leu Ser Leu Ser Glu Glu Ser Gln Glu Ser Ala Gln Asp
885 890 895 Glu Asp Ser Ser Ser Gln Glu Gly Leu Gln Ser Gln Ser Ala
Ser Arg 900 905 910 Glu Ser Arg Ser Gln Glu Ser Gln Ser Glu Glu Asp
Ser Arg Ser Glu 915 920 925 Glu Asn Arg Asp Ser Asp Ser Gln Asp Ser
Ser Arg Ser Lys Glu Glu 930 935 940 Ser Asn Ser Thr Gly Ser Thr Ser
Ser Ser Glu Glu Asp Asn His Pro 945 950 955 960Lys Asn Ile Glu Ala
Asp Asn Arg Lys Leu Ile Val Asp Ala Tyr His 965 970 975 Asn Lys Pro
Ile Gly Asp Gln Asp Asp Asn Asp Cys Gln Asp Gly Tyr 980 985 990
11568PRTArtificial SequenceDescription of Artificial Sequence
Synthetic fusion protein 11Met Ala Ser Met Thr Gly Gly Gln Gln Met
Gly Arg Gly Ser Ala Met 1 5 10 15 Ala Ser Gly Arg Gly Gly Leu Gly
Gly Gln Gly Ala Gly Ala Ala Ala 20 25 30 Ala Ala Gly Gly Ala Gly
Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln 35 40 45 Gly Thr Ser Gly
Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala 50 55 60 Ala Ala
Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser 65 70 75
80Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala
85 90 95 Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly
Leu Gly 100 105 110 Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly
Gln Gly Ala Gly 115 120 125 Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
Gly Gly Tyr Gly Gly Leu 130 135 140 Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly Gln Gly Ala 145 150 155 160Gly Ala Ala Ala Ala
Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 165 170 175 Leu Gly Ser
Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly 180 185 190 Ala
Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly 195 200
205 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln
210 215 220 Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly
Gly Tyr 225 230 235 240Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly 245 250 255 Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly 260 265 270 Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly Arg Gly Gly Leu Gly 275 280 285 Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly 290 295 300 Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu 305 310 315
320Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
325 330 335 Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly 340 345 350 Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly 355 360 365 Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly Arg Gly 370 375 380 Gly Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala 385 390 395 400Gly Gln Gly Gly Tyr
Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg 405 410 415 Gly Gly Leu
Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly 420 425 430 Ala
Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly 435 440
445 Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly
450 455 460 Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser 465 470 475 480Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala 485 490 495 Gly Gly Ala Gly Gln Gly Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr 500 505 510 Ser Glu Phe Pro Val Gln Ser
Ser Ser Asp Ser Ser Glu Glu Asn Gly 515 520 525 Asn Gly Asp Ser Ser
Glu Glu Glu Glu Glu Glu Glu Glu Asn Ser Asn 530 535 540 Glu Glu Glu
Asn Asn Glu Glu Asn Glu Asp Ser Asp Gly Asn Glu Asp 545 550 555
560Lys Leu His His His His His His 565 12578PRTArtificial
SequenceDescription of Artificial Sequence Synthetic fusion protein
12Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Gly Ser Cys Arg 1
5 10 15 Gly Asp Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly
Ala 20 25 30 Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly
Gly Leu Gly 35 40 45 Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly
Gly Gln Gly Ala Gly 50 55 60 Ala Ala Ala Ala Ala Gly Gly Ala Gly
Gln Gly Gly Tyr Gly Gly Leu 65 70 75 80Gly Ser Gln Gly Thr Ser Gly
Arg Gly Gly Leu Gly Gly Gln Gly Ala 85 90 95 Gly Ala Ala Ala Ala
Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 100 105 110 Leu Gly Ser
Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly 115 120 125 Ala
Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly 130 135
140 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln
145 150 155 160Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
Gly Gly Tyr 165 170 175 Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly 180 185 190 Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly 195 200 205 Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly Arg Gly Gly Leu Gly 210 215 220 Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly 225 230 235 240Gly Tyr
Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu 245 250 255
Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln 260
265 270 Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly
Gly 275 280 285 Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly
Gly Ala Gly 290 295 300 Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser Gly Arg Gly 305 310 315 320Gly Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala 325 330 335 Gly Gln Gly Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg 340 345 350 Gly Gly Leu Gly
Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly 355 360 365 Ala Gly
Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly 370 375 380
Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly 385
390 395 400Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser 405 410 415 Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala
Ala Ala Ala Ala 420 425 430 Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly
Leu Gly Ser Gln Gly Thr 435 440
445 Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala
450 455 460 Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser
Gln Gly 465 470 475 480Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly
Ala Gly Ala Ala Ala 485 490 495 Ala Ala Gly Gly Ala Gly Gln Gly Gly
Tyr Gly Gly Leu Gly Ser Gln 500 505 510 Gly Thr Ser Arg Gly Asp Cys
Gly Ser Glu Ser Glu Phe Pro Val Gln 515 520 525 Ser Ser Ser Asp Ser
Ser Glu Glu Asn Gly Asn Gly Asp Ser Ser Glu 530 535 540 Glu Glu Glu
Glu Glu Glu Glu Asn Ser Asn Glu Glu Glu Asn Asn Glu 545 550 555
560Glu Asn Glu Asp Ser Asp Gly Asn Glu Asp Lys Leu His His His His
565 570 575 His His 1337DNAArtificial SequenceDescription of
Artificial Sequence Synthetic oligonucleotide 13ggatcctgtc
gcggtgacac tagtcgcggt gactgtg 371437DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 14ggatccacag tcaccgcgac tagtgtcacc gcgacag
371564DNAArtificial SequenceDescription of Artificial Sequence
Synthetic oligonucleotide 15aattcagcag caaaaaaagc ggcagctatt
cgggcagcaa aggcagcaaa cgccgcatcc 60tcgc 641664DNAArtificial
SequenceDescription of Artificial Sequence Synthetic
oligonucleotide 16gtcgtcgttt ttttcgccgt cgataagccc gtcgtttccg
tcgtttgcgg cgtaggagcg 60ccgg 641719PRTCylindrotheca fusiformis
17Ser Ser Lys Lys Ser Gly Ser Tyr Ser Gly Ser Lys Gly Ser Lys Arg 1
5 10 15 Arg Ile Leu 1822PRTCylindrotheca fusiformis 18Ser Ser Lys
Lys Ser Gly Ser Tyr Ser Gly Tyr Ser Thr Lys Lys Ser 1 5 10 15 Gly
Ser Arg Arg Ile Leu 20 1920PRTCylindrotheca fusiformis 19Ser Ser
Lys Lys Ser Gly Ser Tyr Ser Gly Tyr Ser Lys Gly Ser Lys 1 5 10 15
Arg Arg Ile Leu 202020PRTCylindrotheca fusiformis 20Ser Ser Lys Lys
Ser Gly Ser Tyr Ser Gly Tyr Ser Lys Gly Ser Lys 1 5 10 15 Arg Arg
Asn Leu 202115PRTCylindrotheca fusiformis 21Ser Ser Lys Lys Ser Gly
Ser Tyr Tyr Ser Tyr Gly Thr Lys Lys 1 5 10 1522317PRTHomo sapiens
22Met Lys Thr Ala Leu Ile Leu Leu Ser Ile Leu Gly Met Ala Cys Ala 1
5 10 15 Phe Ser Met Lys Asn Leu His Arg Arg Val Lys Ile Glu Asp Ser
Glu 20 25 30 Glu Asn Gly Val Phe Lys Tyr Arg Pro Arg Tyr Tyr Leu
Tyr Lys His 35 40 45 Ala Tyr Phe Tyr Pro His Leu Lys Arg Phe Pro
Val Gln Gly Ser Ser 50 55 60 Asp Ser Ser Glu Glu Asn Gly Asp Asp
Ser Ser Glu Glu Glu Glu Glu 65 70 75 80Glu Glu Glu Thr Ser Asn Glu
Gly Glu Asn Asn Glu Glu Ser Asn Glu 85 90 95 Asp Glu Asp Ser Glu
Ala Glu Asn Thr Thr Leu Ser Ala Thr Thr Leu 100 105 110 Gly Tyr Gly
Glu Asp Ala Thr Pro Gly Thr Gly Tyr Thr Gly Leu Ala 115 120 125 Ala
Ile Gln Leu Pro Lys Lys Ala Gly Asp Ile Thr Asn Lys Ala Thr 130 135
140 Lys Glu Lys Glu Ser Asp Glu Glu Glu Glu Glu Glu Glu Glu Gly Asn
145 150 155 160Glu Asn Glu Glu Ser Glu Ala Glu Val Asp Glu Asn Glu
Gln Gly Ile 165 170 175 Asn Gly Thr Ser Thr Asn Ser Thr Glu Ala Glu
Asn Gly Asn Gly Ser 180 185 190 Ser Gly Gly Asp Asn Gly Glu Glu Gly
Glu Glu Glu Ser Val Thr Gly 195 200 205 Ala Asn Ala Glu Gly Thr Thr
Glu Thr Gly Gly Gln Gly Lys Gly Thr 210 215 220 Ser Lys Thr Thr Thr
Ser Pro Asn Gly Gly Phe Glu Pro Thr Thr Pro 225 230 235 240Pro Gln
Val Tyr Arg Thr Thr Ser Pro Pro Phe Gly Lys Thr Thr Thr 245 250 255
Val Glu Tyr Glu Gly Glu Tyr Glu Tyr Thr Gly Val Asn Glu Tyr Asp 260
265 270 Asn Gly Tyr Glu Ile Tyr Glu Ser Glu Asn Gly Glu Pro Arg Gly
Asp 275 280 285 Asn Tyr Arg Ala Tyr Glu Asp Glu Tyr Ser Tyr Phe Lys
Gly Gln Gly 290 295 300 Tyr Asp Gly Tyr Asp Gly Gln Asn Tyr Tyr His
His Gln 305 310 315 23265PRTCylindrotheca fusiformis 23Met Lys Leu
Thr Ala Ile Phe Pro Leu Leu Phe Thr Ala Val Gly Tyr 1 5 10 15 Cys
Ala Ala Gln Ser Ile Ala Asp Leu Ala Ala Ala Asn Leu Ser Thr 20 25
30 Glu Asp Ser Lys Ser Ala Gln Leu Ile Ser Ala Asp Ser Ser Asp Asp
35 40 45 Ala Ser Asp Ser Ser Val Glu Ser Val Asp Ala Ala Ser Ser
Asp Val 50 55 60 Ser Gly Ser Ser Val Glu Ser Val Asp Val Ser Gly
Ser Ser Leu Glu 65 70 75 80Ser Val Asp Val Ser Gly Ser Ser Leu Glu
Ser Val Asp Asp Ser Ser 85 90 95 Glu Asp Ser Glu Glu Glu Glu Leu
Arg Ile Leu Ser Ser Lys Lys Ser 100 105 110 Gly Ser Tyr Tyr Ser Tyr
Gly Thr Lys Lys Ser Gly Ser Tyr Ser Gly 115 120 125 Tyr Ser Thr Lys
Lys Ser Ala Ser Arg Arg Ile Leu Ser Ser Lys Lys 130 135 140 Ser Gly
Ser Tyr Ser Gly Tyr Ser Thr Lys Lys Ser Gly Ser Arg Arg 145 150 155
160Ile Leu Ser Ser Lys Lys Ser Gly Ser Tyr Ser Gly Ser Lys Gly Ser
165 170 175 Lys Arg Arg Ile Leu Ser Ser Lys Lys Ser Gly Ser Tyr Ser
Gly Ser 180 185 190 Lys Gly Ser Lys Arg Arg Asn Leu Ser Ser Lys Lys
Ser Gly Ser Tyr 195 200 205 Ser Gly Ser Lys Gly Ser Lys Arg Arg Ile
Leu Ser Ser Lys Lys Ser 210 215 220 Gly Ser Tyr Ser Gly Ser Lys Gly
Ser Lys Arg Arg Asn Leu Ser Ser 225 230 235 240Lys Lys Ser Gly Ser
Tyr Ser Gly Ser Lys Gly Ser Lys Arg Arg Ile 245 250 255 Leu Ser Gly
Gly Leu Arg Gly Ser Met 260 26524551PRTCylindrotheca fusiformis
24Met Ala Ser Met Thr Gly Gly Gln Gln Met Gly Arg Gly Ser Cys Arg 1
5 10 15 Gly Asp Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly
Ala 20 25 30 Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly
Gly Leu Gly 35 40 45 Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly
Gly Gln Gly Ala Gly 50 55 60 Ala Ala Ala Ala Ala Gly Gly Ala Gly
Gln Gly Gly Tyr Gly Gly Leu 65 70 75 80Gly Ser Gln Gly Thr Ser Gly
Arg Gly Gly Leu Gly Gly Gln Gly Ala 85 90 95 Gly Ala Ala Ala Ala
Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 100 105 110 Leu Gly Ser
Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly 115 120 125 Ala
Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly 130 135
140 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln
145 150 155 160Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
Gly Gly Tyr 165 170 175 Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly Leu Gly Gly 180 185 190 Gln Gly Ala Gly Ala Ala Ala Ala Ala
Gly Gly Ala Gly Gln Gly Gly 195 200 205 Tyr Gly Gly Leu Gly Ser Gln
Gly Thr Ser Gly Arg Gly Gly Leu Gly 210 215 220 Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly 225 230 235 240Gly Tyr
Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu 245 250 255
Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln 260
265 270 Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly
Gly 275 280 285 Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly
Gly Ala Gly 290 295 300 Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser Gly Arg Gly 305 310 315 320Gly Leu Gly Gly Gln Gly Ala Gly
Ala Ala Ala Ala Ala Gly Gly Ala 325 330 335 Gly Gln Gly Gly Tyr Gly
Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg 340 345 350 Gly Gly Leu Gly
Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly 355 360 365 Ala Gly
Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly 370 375 380
Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly 385
390 395 400Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly
Thr Ser 405 410 415 Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala
Ala Ala Ala Ala 420 425 430 Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly
Leu Gly Ser Gln Gly Thr 435 440 445 Ser Gly Arg Gly Gly Leu Gly Gly
Gln Gly Ala Gly Ala Ala Ala Ala 450 455 460 Ala Gly Gly Ala Gly Gln
Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly 465 470 475 480Thr Ser Gly
Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala 485 490 495 Ala
Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln 500 505
510 Gly Thr Ser Arg Gly Asp Cys Gly Ser Glu Phe Ser Ser Lys Lys Ser
515 520 525 Gly Ser Tyr Ser Gly Ser Lys Gly Ser Lys Arg Arg Ile Leu
Cys Gly 530 535 540 Arg His His His His His His 545 550
25561PRTCylindrotheca fusiformis 25Met His His His His His His Ser
Ser Gly Leu Val Pro Arg Gly Ser 1 5 10 15 Gly Met Lys Glu Thr Ala
Ala Ala Lys Phe Glu Arg Gln His Met Asp 20 25 30 Ser Pro Asp Leu
Gly Thr Asp Asp Asp Asp Lys Ala Met Ala Ser Gly 35 40 45 Arg Gly
Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly 50 55 60
Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser 65
70 75 80Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala
Ala 85 90 95 Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser
Gln Gly Thr 100 105 110 Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala
Gly Ala Ala Ala Ala 115 120 125 Ala Gly Gly Ala Gly Gln Gly Gly Tyr
Gly Gly Leu Gly Ser Gln Gly 130 135 140 Thr Ser Gly Arg Gly Gly Leu
Gly Gly Gln Gly Ala Gly Ala Ala Ala 145 150 155 160Ala Ala Gly Gly
Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser Gln 165 170 175 Gly Thr
Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly Ala Ala 180 185 190
Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly Leu Gly Ser 195
200 205 Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala Gly
Ala 210 215 220 Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly
Gly Leu Gly 225 230 235 240Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu
Gly Gly Gln Gly Ala Gly 245 250 255 Ala Ala Ala Ala Ala Gly Gly Ala
Gly Gln Gly Gly Tyr Gly Gly Leu 260 265 270 Gly Ser Gln Gly Thr Ser
Gly Arg Gly Gly Leu Gly Gly Gln Gly Ala 275 280 285 Gly Ala Ala Ala
Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly Gly 290 295 300 Leu Gly
Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly Gly Gln Gly 305 310 315
320Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly Gly Tyr Gly
325 330 335 Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly
Gly Gln 340 345 350 Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly
Gln Gly Gly Tyr 355 360 365 Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly
Arg Gly Gly Leu Gly Gly 370 375 380 Gln Gly Ala Gly Ala Ala Ala Ala
Ala Gly Gly Ala Gly Gln Gly Gly 385 390 395 400Tyr Gly Gly Leu Gly
Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu Gly 405 410 415 Gly Gln Gly
Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln Gly 420 425 430 Gly
Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg Gly Gly Leu 435 440
445 Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala Ala Gly Gly Ala Gly Gln
450 455 460 Gly Gly Tyr Gly Gly Leu Gly Ser Gln Gly Thr Ser Gly Arg
Gly Gly 465 470 475 480Leu Gly Gly Gln Gly Ala Gly Ala Ala Ala Ala
Ala Gly Gly Ala Gly 485 490 495 Gln Gly Gly Tyr Gly Gly Leu Gly Ser
Gln Gly Thr Ser Gly Arg Gly 500 505 510 Gly Leu Gly Gly Gln Gly Ala
Gly Ala Ala Ala Ala Ala Gly Gly Ala 515 520 525 Gly Gln Gly Gly Tyr
Gly Gly Leu Gly Ser Gln Gly Thr Ser Ser Ser 530 535 540 Lys Lys Ser
Gly Ser Tyr Ser Gly Ser Lys Gly Ser Lys Arg Arg Ile 545 550 555
560Leu 2626DNAArtificial SequenceDescription of Artificial Sequence
Synthetic primer 26caggatccag gggtgacaac ccagat 262726DNAArtificial
SequenceDescription of Artificial Sequence Synthetic primer
27gcctcgaggt agccatcttg gcaatc 26
* * * * *