U.S. patent application number 14/325420 was filed with the patent office on 2014-10-30 for substituted acetyl-coa carboxylase inhibitors.
The applicant listed for this patent is Pfizer Inc.. Invention is credited to Robert Lee Dow, David James Edmonds, David Andrew Griffith, James Alfred Southers, JR..
Application Number | 20140323730 14/325420 |
Document ID | / |
Family ID | 46025823 |
Filed Date | 2014-10-30 |
United States Patent
Application |
20140323730 |
Kind Code |
A1 |
Dow; Robert Lee ; et
al. |
October 30, 2014 |
SUBSTITUTED ACETYL-COA CARBOXYLASE INHIBITORS
Abstract
The invention provides a compound of Formula (I) ##STR00001## or
a pharmaceutically acceptable salt thereof; wherein G is
##STR00002## R.sup.1, R.sup.2 and R.sup.3 are as described herein;
pharmaceutical compositions thereof; and the use thereof in
treating diseases, conditions or disorders modulated by the
inhibition of an acetyl-CoA carboxylase enzyme(s) in an animal.
Inventors: |
Dow; Robert Lee; (Groton,
CT) ; Edmonds; David James; (Arlington, MA) ;
Griffith; David Andrew; (Sudbury, MA) ; Southers,
JR.; James Alfred; (Groton, CT) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Pfizer Inc. |
New York |
NY |
US |
|
|
Family ID: |
46025823 |
Appl. No.: |
14/325420 |
Filed: |
July 8, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13452839 |
Apr 21, 2012 |
8802688 |
|
|
14325420 |
|
|
|
|
61478240 |
Apr 22, 2011 |
|
|
|
Current U.S.
Class: |
546/17 |
Current CPC
Class: |
C07D 471/10 20130101;
C07D 519/00 20130101; A61P 5/48 20180101; A61P 3/00 20180101; A61P
3/04 20180101; A61P 3/10 20180101; A61P 43/00 20180101; A61P 1/16
20180101 |
Class at
Publication: |
546/17 |
International
Class: |
C07D 471/10 20060101
C07D471/10 |
Claims
1. A compound of Formula (I) ##STR00200## or a pharmaceutically
acceptable salt thereof, wherein G is ##STR00201## R.sup.1 is a
(C.sub.1-C.sub.6)alkyl or (C.sub.3-C.sub.7)cycloalkyl; R.sup.2 is
indolyl, indazolyl, pyrrolopyridinyl, pyrazolopyridinyl, quinolinyl
or benzoimidazolyl; wherein each R.sup.2 group is optionally
substituted with one to two substituents independently selected
from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen or (C.sub.1-C.sub.3)alkyl; L is a direct bond or
--X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O or S; R.sup.4
and R.sup.5 are each independently hydrogen,
(C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or four to
seven membered heterocyclyl wherein said (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
is optionally substituted with one to three fluoro or
(C.sub.1-C.sub.3)alkoxy.
Description
FIELD OF THE INVENTION
[0001] This invention relates to substituted pyrazolospiroketone
compounds that act as inhibitors of an acetyl-CoA carboxylase(s)
and their use in treating diseases, conditions or disorders
modulated by the inhibition of acetyl-CoA carboxylase
enzyme(s).
BACKGROUND OF THE INVENTION
[0002] Acetyl-CoA carboxylases (ACC) are a family of enzymes found
in most species and are associated with fatty acid synthesis and
metabolism through catalyzing the production of malonyl-CoA from
acetyl-CoA. In mammals, two isoforms of the ACC enzyme have been
identified. ACC1, which is expressed at high levels in lipogenic
tissues, such as fat and the liver, controls the first committed
step in the biosynthesis of long-chain fatty acids. If acetyl-CoA
is not carboxylated to form malonyl-CoA, it is metabolized through
the Krebs cycle. ACC2, a minor component of hepatic ACC but the
predominant isoform in heart and skeletal muscle, catalyzes the
production of malonyl-CoA at the cytosolic surface of mitochondria,
and regulates how much fatty acid is utilized in .beta.-oxidation
by inhibiting carnitine palmitoyl transferase. Thus, by increasing
fatty acid utilization and by preventing increases in de novo fatty
acid synthesis, chronic administration of an ACC inhibitor (ACC-I)
may also deplete liver and adipose tissue triglyceride (TG) stores
in obese subjects consuming a high or low-fat diet, leading to
selective loss of body fat.
[0003] Studies conducted by Abu-Etheiga, et al., suggest that ACC2
plays an essential role in controlling fatty acid oxidation and, as
such it would provide a target in therapy against obesity and
obesity-related diseases, such as type-2 diabetes. See,
Abu-Etheiga, L., et al., "Acetyl-CoA carboxylase 2 mutant mice are
protected against obesity and diabetes induced by
high-fat/high-carbohydrate diets" PNAS, 100(18) 10207-10212 (2003).
See also, Choi, C. S., et al., "Continuous fat oxidation in
acetyl-CoA carboxylase 2 knockout mice increases total energy
expenditure, reduces fat mass, and improves insulin sensitivity"
PNAS, 104(42) 16480-16485 (2007).
[0004] It is becoming increasingly clear that hepatic lipid
accumulation causes hepatic insulin resistance and contributes to
the pathogenesis of type 2 diabetes. Salvage, et al., demonstrated
that ACC1 and ACC2 are both involved in regulating fat oxidation in
hepatocytes while ACC1, the dominant isoform in rat liver, is the
sole regulator of fatty acid synthesis. Furthermore, in their
model, combined reduction of both isoforms is required to
significantly lower hepatic malonyl-CoA levels, increase fat
oxidation in the fed state, reduce lipid accumulation, and improve
insulin action in vivo. Thus, showing that hepatic ACC1 and ACC2
inhibitors may be useful in the treatment of nonalcoholic fatty
liver disease (NAFLD) and hepatic insulin resistance. See, Savage,
D. B., et al., "Reversal of diet-induced hepatic steatosis and
hepatic insulin resistance by antisense oligonucleotide inhibitors
of acetyl-CoA carboxylases 1 and 2" J Clin Invest doi:
10.1172/JCl27300. See also, Oh, W., et al., "Glucose and fat
metabolism in adipose tissue of acetyl-CoA carboxylase 2 knockout
mice" PNAS, 102(5) 1384-1389 (2005).
[0005] Consequently, there is a need for medicaments containing
ACC1 and/or ACC2 inhibitors to treat obesity and obesity-related
diseases (such as, NAFLD and type-2 diabetes) by inhibiting fatty
acid synthesis and by increasing fatty acid oxidation.
SUMMARY OF THE INVENTION
[0006] A first embodiment of the present invention relates to
compounds having the structure of Formula A compound of Formula
(I)
##STR00003##
or a pharmaceutically acceptable salt thereof; wherein
[0007] G is
##STR00004##
[0008] R.sup.1 is a (C.sub.1-C.sub.6)alkyl or
(C.sub.3-C.sub.7)cycloalkyl; R.sup.2 is indolyl, indazolyl,
pyrrolopyridinyl, pyrazolopyridinyl, quinolinyl or benzoimidazolyl;
wherein each R.sup.2 group is optionally substituted with one to
two substituents independently selected from a cyano,
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5, (C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.3)alkoxy and halo; R.sup.3 is hydrogen or
(C.sub.1-C.sub.3)alkyl; L is a direct bond or
--X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O or S; R.sup.4
and R.sup.5 are each independently hydrogen,
(C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or four to
seven membered heterocyclyl wherein said (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
is optionally substituted with one to three fluoro or
(C.sub.1-C.sub.3)alkoxy.
[0009] A second embodiment of the present invention is the compound
of the first embodiment or a pharmaceutically acceptable salt
thereof wherein R.sup.2 is indolyl, indazolyl, pyrrolopyridinyl,
pyrazolopyridinyl, quinolinyl or benzoimidazolyl substituted with a
cyano, -L-C(O)NR.sup.4R or -L-NR.sup.4R.sup.5.
[0010] A third embodiment of the present invention is the compound
of the second embodiment or a pharmaceutically acceptable salt
thereof wherein R.sup.2 is indolyl, indazolyl, pyrrolopyridinyl,
pyrazolopyridinyl, quinolinyl or benzoimidazolyl substituted with a
-L-C(O)NR.sup.4R.sup.5 or -L-NR.sup.4R.sup.5; and L is a direct
bond.
[0011] A fourth embodiment of the present invention is the compound
of the first embodiment wherein R.sup.1 is isopropyl, t-butyl or
bicycle[1.1.1]pentanyl; or a pharmaceutically acceptable salt
thereof. A fifth embodiment of the present invention is the
compound of any of the preceding embodiments wherein R.sup.3 is
hydrogen; or a pharmaceutically acceptable salt thereof.
[0012] Another embodiment of the present invention is the a
compound of the first embodiment wherein G is
##STR00005##
or a pharmaceutically acceptable salt thereof.
[0013] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00006##
or a pharmaceutically acceptable salt thereof.
[0014] Another embodiment of the present invention is the compound
wherein R.sup.2 is
##STR00007##
wherein each R.sup.2 is substituted with a cyano,
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5; or a pharmaceutically
acceptable salt thereof.
[0015] Yet another embodiment of the present invention is the
compound or the preceding embodiment wherein R.sup.2 is substituted
with a cyano, --C(O)NH.sub.2, --C(O)NHCH.sub.3,
--C(O)NHCH.sub.2CH.sub.3, --C(O)CH.sub.2CF.sub.3,
--OCH.sub.2C(O)NH.sub.2; --NH.sub.2, --NHCH.sub.3 or
--NHC(CH.sub.3).sub.3; or a pharmaceutically acceptable salt
thereof.
[0016] Another embodiment of the present invention is the compound
wherein G is
##STR00008##
R.sup.1 is a (C.sub.1-C.sub.6)alkyl or (C.sub.3-C.sub.7)cycloalkyl;
R.sup.2 is indolyl, indazolyl, pyrrolopyridinyl, pyrazolopyridinyl,
quinolinyl or benzoimidazolyl; wherein each R.sup.2 group is
optionally substituted with one to two substituents independently
selected from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen or (C.sub.1-C.sub.3)alkyl; L is a direct bond or
--X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O or S; and
R.sup.4 and R.sup.5 are each independently hydrogen,
(C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or four to
seven membered heterocyclyl wherein said (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
is optionally substituted with one to three fluoro or
(C.sub.1-C.sub.3)alkoxy; or a pharmaceutically acceptable salt
thereof.
[0017] Another embodiment of the present invention is the compound
wherein G is
##STR00009##
R.sup.1 is a (C.sub.1-C.sub.6)alkyl or (C.sub.3-C.sub.7)cycloalkyl;
R.sup.2 is indolyl, indazolyl, pyrrolopyridinyl, pyrazolopyridinyl,
quinolinyl or benzoimidazolyl; wherein each R.sup.2 group is
optionally substituted with one to two substituents independently
selected from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen; L is a direct bond or --X(C.sub.1-C.sub.3)alkylene; X
is a direct bond, O or S; and R.sup.4 and R.sup.5 are each
independently hydrogen, (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
wherein said (C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or
four to seven membered heterocyclyl is optionally substituted with
one to three fluoro or (C.sub.1-C.sub.3)alkoxy; or a
pharmaceutically acceptable salt thereof.
[0018] Another embodiment of the present invention is the compound
wherein G is
##STR00010##
R.sup.1 is (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00011##
wherein each R.sup.2 is substituted with one substitutent that is
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5, or
(C.sub.1-C.sub.3)alkoxy; R.sup.3 is hydrogen; L is a direct bond or
--X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O or S; and
R.sup.4 and R.sup.5 are each independently hydrogen or
(C.sub.1-C.sub.3)alkyl; or a pharmaceutically acceptable salt
thereof.
[0019] Another embodiment of the present invention is the compound
wherein G is
##STR00012##
R.sup.1 is (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00013##
wherein each R.sup.2 is substituted with one substituent that is
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5, or
(C.sub.1-C.sub.3)alkoxy; L is a direct bond; and R.sup.4 and
R.sup.5 are hydrogen; or a pharmaceutically acceptable salt
thereof.
[0020] Another embodiment of the present invention is the compound
wherein G is
##STR00014##
R.sup.1 is (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00015##
wherein each R.sup.2 is substituted with one substituent that is
-L-NR.sup.4R.sup.5 or (C.sub.1-C.sub.3)alkoxy; L is a direct bond;
and R.sup.4 and R.sup.5 are hydrogen; or a pharmaceutically
acceptable salt thereof.
[0021] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00016##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00017##
optionally substituted with one to two substituents independently
selected from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen or (C.sub.1-C.sub.3)alkyl; L is a direct bond; and
R.sup.4 and R.sup.5 are each independently hydrogen or
(C.sub.1-C.sub.3)alkyl.
[0022] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00018##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00019##
substituted with one substituent selected from
(C.sub.1-C.sub.3)alkoxy; and R.sup.3 is hydrogen.
[0023] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00020##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00021##
optionally substituted with one to two substituents independently
selected from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen or (C.sub.1-C.sub.3)alkyl; L is a direct bond; and
R.sup.4 and R.sup.5 are each independently hydrogen or
(C.sub.1-C.sub.3)alkyl.
[0024] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00022##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00023##
substituted with one substituent selected from -L-NR.sup.4R.sup.5;
R.sup.3 is hydrogen; L is a direct bond; and R.sup.4 and R.sup.5
are each hydrogen.
[0025] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00024##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00025##
optionally substituted with one to two substituents independently
selected from a cyano, -L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5,
(C.sub.1-C.sub.3)alkyl, (C.sub.1-C.sub.3)alkoxy and halo; R.sup.3
is hydrogen or (C.sub.1-C.sub.3)alkyl; L is a direct bond; and
R.sup.4 and R.sup.5 are each independently hydrogen or
(C.sub.1-C.sub.3)alkyl.
[0026] Another embodiment of the present invention is the compound
of the first embodiment wherein G is
##STR00026##
wherein R.sup.1 is a (C.sub.1-C.sub.6)alkyl; R.sup.2 is
##STR00027##
substituted with one substituent selected from
-L-C(O)NR.sup.4R.sup.5; R.sup.3 is hydrogen; L is a direct bond;
and R.sup.4 and R.sup.5 are each hydrogen.
[0027] Another embodiment of the present invention is the compound
of structure
##STR00028##
or a pharmaceutically acceptable salt thereof.
[0028] Another embodiment of the present invention is the compound
of structure
##STR00029##
or a pharmaceutically acceptable salt thereof.
[0029] Another embodiment of the present invention is the compound
of structure
##STR00030##
or a pharmaceutically acceptable salt thereof.
[0030] Another embodiment of the present invention is a compound
selected from the group consisting of
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indole-3-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide;
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indole-2-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indole-3-carboxamide;
1'-[(2-amino-1H-benzimidazol-5-yl)carbonyl]-1-isopropyl-1,4-dihydrospiro[-
indazole-5,4'-piperidin]-7(6H)-one;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-N-methyl-1H-indazole-3-carboxamide;
N-ethyl-5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'--
piperidin]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-N-(2,2,2-trifluoroethyl)-1H-indazole-3-carboxamide;
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-indole-2-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-pyrazolo[3,4-b]pyridine-3-carboxamide;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-2-carboxamide;
1-isopropyl-1'-{[2-(methylamino)-1H-benzimidazol-5-yl]carbonyl}-1,4-dihyd-
rospiro[indazole-5,4'-piperidin]-7(6H)-one;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-1H-benzimidazole-2-carboxamide;
5-[(1-tert-butyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(1-tert-butyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indole-2-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-indole-2-carboxamide;
1'-[(2-amino-1H-benzimidazol-5-yl)carbonyl]-2-tert-butyl-2,4-dihydrospiro-
[indazole-5,4'-piperidin]-7(6H)-one;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-ethyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-methyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-(2,2,2-trifluoroethyl)-1H-indazole-3-carboxamide;
2-tert-butyl-1'-{[2-(methylamino)-1H-benzimidazol-5-yl]carbonyl}-2,4-dihy-
drospiro[indazole-5,4'-piperidin]-7(6H)-one;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide;
6-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indazole-3-carboxamide;
6-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indole-2-carboxamide;
6-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indole-3-carboxamide;
5-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indazole-3-carboxamide;
5-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indole-2-carboxamide;
5-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-indole-3-carboxamide;
5-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-3-carboxamide;
1-[(2-amino-1H-benzimidazol-5-yl)carbonyl]-2'-tert-butyl-2'H-spiro[piperi-
dine-4,5'-pyrano[3,2-c]pyrazol]-7'(6'H)-one;
2'-tert-butyl-1-{[2-(methylamino)-1H-benzimidazol-5-yl]carbonyl}-2'H-spir-
o[piperidine-4,5'-pyrano[3,2-c]pyrazol]-7'(6'H)-one;
6-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-pyran-
o[3,2-c]pyrazol]-1-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide;
and
5-[(2'-tert-butyl-7'-oxo-6',7'-dihydro-1H,2'H-spiro[piperidine-4,5'-p-
yrano[3,2-c]pyrazol]-1-yl)carbonyl]-1H-benzimidazole-2-carboxamide.
or a pharmaceutically acceptable salt thereof.
[0031] Yet another embodiment of the present invention is a
compound selected from the group consisting of
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carbonitrile;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-3-carbonitrile;
1'-[(2-aminoquinolin-6-yl)carbonyl]-2-tert-butyl-2,4-dihydrospiro[indazol-
e-5,4'-piperidin]-7(6H)-one;
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-N-methyl-1H-indole-3-carboxamide;
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl)carbonyl]-N-methyl-1H-indole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-cyclopropyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-isopropyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-propyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-(2-methoxyethyl)-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-cyclobutyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-oxetan-3-yl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-Ncyclopropyl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-methyl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-ethyl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-(2-methoxyethyl)-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-isopropyl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-propyl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-cyclopropyl-1H-indole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-cyclobutyl-1H-indazole-3-carboxamide;
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-oxetan-3-yl-1H-indazole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-(2-methoxyethyl)-1H-indole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-methyl-1H-indole-3-carboxamide;
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-ethyl-1H-indole-3-carboxamide; and
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperid-
in]-1'-yl)carbonyl]-N-cyclopropyl-1H-indole-3-carboxamide; or a
pharmaceutically acceptable salt thereof.
[0032] Another aspect of the present invention is a pharmaceutical
composition comprising an amount of a compound of Formula (I) as
described in any of the embodiments; or a pharmaceutically
acceptable salt thereof and a pharmaceutically acceptable
excipient, diluent, or carrier. Preferably, the composition
comprises a therapeutically effective amount of a compound of the
present invention. The composition may also contain at least one
additional pharmaceutical agent. Preferred agents include
anti-diabetic agents and/or anti-obesity agents.
[0033] In yet another aspect of the present invention is a method
for treating a disease, condition, or disorder mediated by the
inhibition of acetyl-CoA carboxylase enzyme(s) in a mammal that
includes the step of administering to a mammal, preferably a human,
in need of such treatment a therapeutically effective amount of a
compound of the present invention, or a pharmaceutically acceptable
salt thereof or a pharmaceutical composition thereof.
[0034] Diseases, disorders, or conditions mediated by inhibitors of
acetyl-CoA carboxylases include Type II diabetes and
diabetes-related diseases, such as nonalcoholic fatty liver disease
(NAFLD), hepatic insulin resistance, hyperglycemia, metabolic
syndrome, impaired glucose tolerance, diabetic neuropathy, diabetic
nephropathy, diabetic retinopathy, obesity, dyslipidemia,
hypertension, hyperinsulinemia, and insulin resistance syndrome.
Preferred diseases, disorders, or conditions include Type II
diabetes, nonalcoholic fatty liver disease (NAFLD), hepatic insulin
resistance, hyperglycemia, impaired glucose tolerance, obesity, and
insulin resistance syndrome. More preferred are Type II diabetes,
nonalcoholic fatty liver disease (NAFLD), hepatic insulin
resistance, hyperglycemia, and obesity. Most preferred is Type II
diabetes.
[0035] A preferred embodiment is a method for treating (e.g.
delaying the progression or onset of) Type 2 diabetes and
diabetes-related disorders in animals comprising the step of
administering to an animal in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutically acceptable salt thereof or a
composition thereof.
[0036] A more preferred embodiment is a method for treating, or
delaying the progression or onset of, Type 2 diabetes and
diabetes-related disorders in a human comprising the step of
administering to the human in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutically acceptable salt thereof or a
composition thereof.
[0037] A most preferred embodiment is a method for treating, or
delaying the progression or onset of, Type 2 diabetes in a human
comprising the step of administering to the human in need of such
treatment a therapeutically effective amount of a compound of the
present invention or a pharmaceutically acceptable salt thereof or
a composition thereof.
[0038] Another preferred embodiment is a method for treating
obesity and obesity-related disorders in animals comprising the
step of administering to an animal in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutically acceptable salt thereof or a
composition thereof.
[0039] Another preferred embodiment is a method for treating
obesity and obesity-related disorders in a human comprising the
step of administering to the human in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutically acceptable salt thereof or a
composition thereof.
[0040] Yet another preferred embodiment is a method for treating
nonalcoholic fatty liver disease (NAFLD) or hepatic insulin
resistance in animals comprising the step of administering to an
animal, in particular a human, in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutically acceptable salt thereof or a
composition thereof.
[0041] Yet another preferred embodiment is a method for treating
nonalcoholic fatty liver disease (NAFLD) or hepatic insulin
resistance in a human comprising the step of administering to the
human in need of such treatment a therapeutically effective amount
of a compound of the present invention or a pharmaceutically
acceptable salt thereof or a composition thereof.
[0042] Compounds of the present invention may be administered in
combination with other pharmaceutical agents (in particular,
anti-obesity and anti-diabetic agents described herein below). The
combination therapy may be administered as (a) a single
pharmaceutical composition which comprises a compound of the
present invention, at least one additional pharmaceutical agent
described herein and a pharmaceutically acceptable excipient,
diluent, or carrier; or (b) two separate pharmaceutical
compositions comprising (i) a first composition comprising a
compound of the present invention and a pharmaceutically acceptable
excipient, diluent, or carrier, and (ii) a second composition
comprising at least one additional pharmaceutical agent described
herein and a pharmaceutically acceptable excipient, diluent, or
carrier. The pharmaceutical compositions may be administered
simultaneously or sequentially and in any order.
[0043] Another embodiment is the use of a compound of the present
invention in the manufacture of a medicament for treating a
disease, condition or disorder that is modulated by the inhibition
of acetyl-CoA carboxylase enzyme(s).
[0044] Another embodiment is the use of a compound of the present
invention in the manufacture of a medicament for treating a
disease, condition or disorder that is modulated by the inhibition
of acetyl-CoA carboxylase enzyme(s) wherein the disease, condition,
or disorder is Type 2 diabetes, diabetes-related disorders,
nonalcoholic fatty liver disease (NAFLD) or hepatic insulin
resistance.
[0045] Another embodiment is the use of a compound of the present
invention in the manufacture of a medicament for treating a
disease, condition or disorder that is modulated by the inhibition
of acetyl-CoA carboxylase enzyme(s) wherein the disease, condition,
or disorder is Type 2 diabetes.
[0046] Another embodiment is the use the compound of Example 6, 14,
or 25 in the manufacture of a medicament for treating a disease,
condition or disorder that is modulated by the inhibition of
acetyl-CoA carboxylase enzyme(s) wherein the disease, condition, or
disorder is Type 2 diabetes, diabetes-related disorders,
nonalcoholic fatty liver disease (NAFLD) or hepatic insulin
resistance.
[0047] Another embodiment is the use of the compound of Example 6,
14, or 25 in the manufacture of a medicament for treating a
disease, condition or disorder that is modulated by the inhibition
of acetyl-CoA carboxylase enzyme(s) wherein the disease, condition,
or disorder is Type 2 diabetes.
[0048] Another embodiment is the use of the compound of Example 6
in the manufacture of a medicament for treating a disease,
condition or disorder that is modulated by the inhibition of
acetyl-CoA carboxylase enzyme(s) wherein the disease, condition, or
disorder is Type 2 diabetes.
[0049] Another embodiment is the use of the compound of Example 14
in the manufacture of a medicament for treating a disease,
condition or disorder that is modulated by the inhibition of
acetyl-CoA carboxylase enzyme(s) wherein the disease, condition, or
disorder is Type 2 diabetes.
[0050] Another embodiment is the use of the compound of Example 25
in the manufacture of a medicament for treating a disease,
condition or disorder that is modulated by the inhibition of
acetyl-CoA carboxylase enzyme(s) wherein the disease, condition, or
disorder is Type 2 diabetes.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0051] The phrase "therapeutically effective amount" means an
amount of a compound of the present invention or a pharmaceutically
acceptable salt thereof that: (i) treats or prevents the particular
disease, condition, or disorder, (ii) attenuates, ameliorates, or
eliminates one or more symptoms of the particular disease,
condition, or disorder, or (iii) prevents or delays the onset of
one or more symptoms of the particular disease, condition, or
disorder described herein.
[0052] The term "animal" refers to humans (male or female),
companion animals (e.g., dogs, cats and horses), food-source
animals, zoo animals, marine animals, birds and other similar
animal species. "Edible animals" refers to food-source animals such
as cows, pigs, sheep and poultry.
[0053] The phrase "pharmaceutically acceptable" indicates that the
substance or composition must be compatible chemically and/or
toxicologically, with the other ingredients comprising a
formulation, and/or the mammal being treated therewith.
[0054] The terms "treating", "treat", or "treatment" embrace both
preventative, i.e., prophylactic, and palliative treatment.
[0055] The terms "modulated" or "modulating", or "modulate(s)", as
used herein, unless otherwise indicated, refers to the inhibition
of the Acetyl-CoA carboxylases (ACC) enzyme(s) with compounds of
the present invention.
[0056] The terms "mediated" or "mediating" or "mediate(s)", as used
herein, unless otherwise indicated, refers to the (i) treatment or
prevention the particular disease, condition, or disorder, (ii)
attenuation, amelioration, or elimination of one or more symptoms
of the particular disease, condition, or disorder, or (iii)
prevention or delay of the onset of one or more symptoms of the
particular disease, condition, or disorder described herein, by
inhibiting the Acetyl-CoA carboxylases (ACC) enzyme(s).
[0057] The term "compounds of the present invention" (unless
specifically identified otherwise) refer to compounds of Formula
(I) and any pharmaceutically acceptable salts of the compounds, as
well as, all stereoisomers (including diastereoisomers and
enantiomers), tautomers, conformational isomers, and isotopically
labeled compounds. Hydrates and solvates of the compounds of the
present invention are considered compositions of the present
invention, wherein the compound is in association with water or
solvent, respectively.
[0058] The terms "(C.sub.1-C.sub.6)alkyl" and
"(C.sub.1-C.sub.3)alkyl" are alkyl groups of the specified number
of carbons, from one to six or one to three carbons, respectively,
which can be either straight chain or branched. For example, the
term "(C.sub.1-C.sub.3)alkyl" has from one to three carbons and
consists of methyl, ethyl, n-propyl and isopropyl. Alkoxy groups
with a specified number of carbons are named in an analogous
manner.
[0059] The term "(C.sub.1-C.sub.3)alkylene" are diradical
(C.sub.1-C.sub.3)alkyl groups of from one to three carbons which
can be either straight chain or branched. Representative examples
of the term "(C.sub.1-C.sub.3)alkylene" include, but are not
limited to, --CH.sub.2--, --CH.sub.2CH.sub.2--,
--CH(CH.sub.3)CH.sub.2--, --CH.sub.2CH.sub.2(CH.sub.3)--, or
--CH.sub.2CH.sub.2CH.sub.2--.
[0060] The term "(C.sub.3-C.sub.7)cycloalkyl" means a cycloalkyl
group with three to seven carbon atoms and consists of cyclopropyl,
cyclobutyl, cyclopentyl, cyclohexyl and cycloheptyl or can be a
bicyclo ring system such as bicycle[1.1.1.]pentanyl. The term
"halo" means fluoro, chloro, bromo or iodo.
[0061] The term "four to seven membered heterocyclyl" means a
radical of a four to seven membered non-aromatic heterocycle. The
point of attachment can be either through a carbon atom or a
nitrogen atom. Non-limiting examples of these include oxetanyl,
tetrahydrofuranyl, morpholinyl, azetidinyl, pyrrolodinyl,
piperidinyl, piperazinyl and the like.
[0062] The terms indolyl, indazolyl, pyrrolopyridinyl,
pyrazolopyridinyl, quinolinyl or benzoimidazolyl are radicals of
the groups shown below and the point of attachment is on a carbon
atom of that group.
##STR00031##
[0063] In one embodiment, the compound of Formula (I) is a N1 ACC
inhibitor compound having the following structure:
[0064] Compounds of the present invention may be synthesized by
synthetic routes that include processes analogous to those
well-known in the chemical arts, particularly in light of the
description contained herein. The starting materials are generally
available from commercial sources such as Aldrich Chemicals
(Milwaukee, Wis.) or are readily prepared using methods well known
to those skilled in the art (e.g., prepared by methods generally
described in Louis F. Fieser and Mary Fieser, Reagents for Organic
Synthesis, v. 1-19, Wiley, New York (1967-1999 ed.), or Beilsteins
Handbuch der organischen Chemie, 4, Aufl. ed. Springer-Verlag,
Berlin, including supplements (also available via the Beilstein
online database)).
[0065] For illustrative purposes, the reaction schemes depicted
below provide potential routes for synthesizing the compounds of
the present invention as well as key intermediates. For a more
detailed description of the individual reaction steps, see the
Examples section below. Those skilled in the art will appreciate
that other synthetic routes may be used to synthesize the inventive
compounds. Although specific starting materials and reagents are
depicted in the schemes and discussed below, other starting
materials and reagents can be easily substituted to provide a
variety of derivatives and/or reaction conditions. In addition,
many of the compounds prepared by the methods described below can
be further modified in light of this disclosure using conventional
chemistry well known to those skilled in the art.
[0066] In the preparation of compounds of the present invention,
protection of remote functionality (e.g., primary or secondary
amine) of intermediates may be necessary. The need for such
protection will vary depending on the nature of the remote
functionality and the conditions of the preparation methods.
Suitable amino-protecting groups (NH-Pg) include acetyl,
trifluoroacetyl, t-butoxycarbonyl (BOC), benzyloxycarbonyl (CBz)
and 9-fluorenylmethyleneoxycarbonyl (Fmoc). Similarly, a
"hydroxy-protecting group" refers to a substituent of a hydroxy
group that blocks or protects the hydroxy functionality. Suitable
hydroxyl-protecting groups (O-Pg) include for example, allyl,
acetyl, silyl, benzyl, para-methoxybenzyl, trityl, and the like.
The need for such protection is readily determined by one skilled
in the art. For a general description of protecting groups and
their use, see T. W. Greene, Protective Groups in Organic
Synthesis, John Wiley & Sons, New York, 1991.
[0067] The following reaction schemes, Reaction Schemes I through
Reaction Scheme III, provide representative procedures that are
used to prepare the compounds of Formula (I). It is to be
understood that these reaction schemes are to be construed in a
non-limiting manner and that reasonable variations of the depicted
methods can be used to prepare the compounds of Formula (I).
[0068] Reaction Scheme I outlines the general procedures one could
use to provide N1 ACC inhibitor compounds of the present invention
having Formula Ia, which is a compound of Formula (I) in which
R.sup.1 is a (C.sub.1-C.sub.6)alkyl or (C.sub.3-C.sub.7)cycloalkyl
and R.sup.2 is indolyl, indazolyl, pyrrolopyridinyl,
pyrazolopyridinyl, quinolinyl or benzoimidazolyl; wherein each
R.sup.2 group is optionally substituted with one to two
substituents independently selected from a cyano,
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5, (C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.3)alkoxy and halo; R.sup.3 is hydrogen; L is a
direct bond or --X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O
or S; and R.sup.4 and R.sup.5 are each independently hydrogen,
(C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or four to
seven membered heterocyclyl wherein said (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
is optionally substituted with one to three fluoro or
(C.sub.1-C.sub.3)alkoxy.
##STR00032## ##STR00033##
[0069] According to Scheme I, the compound of Vila can be formed by
reacting the compound of formula Villa wherein Pg represents an
appropriate amine protecting group with tris(dimethylamino)methane
in an appropriate solvent. The reaction can be carried out in an
appropriate solvent such as toluene at an elevated temperature,
such as reflux, for a period of 1 to 24 hours to provide the
compound of formula Vila. The compound of formula Via can be formed
by reacting the compound of formula Vila with an appropriate alkyl
or cycloalkyl hydrazine (R.sub.1NHNH.sub.2, such as t-butyl
hydrazine, isopropyl hydrazine or bicycle[1.1.1]pentanyl hydrazine)
in an appropriate solvent such as ethanol. For example, the
compound of formula Via can be formed by reacting Vila with an
appropriate alkyl hydrazine (R.sub.1NHNH.sub.2,) optionally in the
presence of a base such as potassium carbonate ("K.sub.2CO.sub.3")
in refluxing ethanol to provide the desired cyclized compound, at a
temperature of about 20.degree. C. to about 80.degree. C. for about
2 to 24 hours.
[0070] The compound of formula Va can be formed by converting the
compound of formula Via to the corresponding hydroxy bromide
derivative by reaction with an appropriate brominating reagent and
water in an appropriate solvent. For example, the compound of
formula Va can be formed by reacting the compound of formula Vla
with N-bromosuccinimide (NBS) and water in tetrahydrofuran at room
temperature for 1 hour to provide the corresponding hydroxy bromo
derivative of formula Va. The compound of formula IVa can then be
formed by oxidation of the compound of formula Va with an
appropriate oxidizing agent in an appropriate solvent. For example,
the compound of formula Va can be oxidized by treatment with Jones
reagent in acetone at 0.degree. C. to room temperature for a period
of 15 minutes to 4 hours followed by extractive workup. The
compound of formula IVa can then be debrominated by treatment with
aqueous ammonium chloride and zinc metal in an appropriate solvent
such as tetrahydrofuran for 15 minutes to 4 hours, typically at
room temperature.
[0071] The compound of formula IIIa can then be deprotected to
provide the free spiropiperidine derivative of formula IIa using
standard methods which depend on which protecting group Pg has been
employed. For example, when Pg represents BOC, standard strong acid
deprotection conditions, such as 4N hydrochloric acid in dioxane or
trifluoroacetic acid in an appropriate solvent such as
dichloromethane, can be used to remove the BOO group. When Pg
represents Cbz, hydrogenation over palladium on carbon in ethanol
or treatment with a hydrogen source such as ammonium formate or
1-methyl-1,4-cyclohexadiene in the presence of palladium on carbon
in ethanol or ethyl acetate can be employed to carry out the
deprotection.
[0072] The spiropiperidine derivative of formula IIa can then be
acylated by employing standard methods to provide the compound of
formula Ia. For example, the compound (Ia) may then be formed using
a standard peptide coupling reaction with the desired carboxylic
acid (R.sup.2CO.sub.2H). For example, the spiropiperidine
intermediate (IIa) and carboxylic acid (R.sup.2CO.sub.2H) may be
coupled by forming an activated carboxylic acid ester, such as by
contacting the carboxylic acid (R.sup.2CO.sub.2H) with a peptide
coupling reagent, such as
O-(7-azabenzotriazol-1-yl)-N,N,N',N'-tetramethyluronium
hexafluorophosphate ("HATU") or
1-ethyl-3-(3-dimethyllaminopropyl)carbodiimide hydrochloride
("EDC.HCl"), in the presence or absence of an activating agent,
such as hydroxybenzotriazole ("HOBt") and in the presence of a
suitable base, such as N,N-diisopropylethylamine ("DIEA"),
triethylamine or N-methylmorpholine ("NMM"), in a suitable solvent
such as THF and/or DMF, dimethylacetamide ("DMA") or
dichloromethane and then contacting the activated carboxylic acid
ester with the spiropiperidine derivative IIa to form a compound of
formula Ia.
[0073] Reaction Scheme II outlines the general procedures one could
use to provide N2 ACC inhibitor compounds of the present invention
having Formula Ib, in which R.sup.1 is a (C.sub.1-C.sub.6)alkyl or
(C.sub.3-C.sub.7)cycloalkyl and R.sup.2 is indolyl, indazolyl,
pyrrolopyridinyl, pyrazolopyridinyl, quinolinyl or benzoimidazolyl;
wherein each R.sup.2 group is optionally substituted with one to
two substituents independently selected from a cyano,
-L-C(O)NR.sup.4R.sup.5, -L-NR.sup.4R.sup.5, (C.sub.1-C.sub.3)alkyl,
(C.sub.1-C.sub.3)alkoxy and halo; R.sup.3 is hydrogen; L is a
direct bond or --X(C.sub.1-C.sub.3)alkylene; X is a direct bond, O
or S; and R.sup.4 and R.sup.5 are each independently hydrogen,
(C.sub.1-C.sub.3)alkyl, (C.sub.3-C.sub.7)cycloalkyl or four to
seven membered heterocyclyl wherein said (C.sub.1-C.sub.3)alkyl,
(C.sub.3-C.sub.7)cycloalkyl or four to seven membered heterocyclyl
is optionally substituted with one to three fluoro or
(C.sub.1-C.sub.3)alkoxy.
##STR00034## ##STR00035##
[0074] According to Scheme II, reaction of the compound of formula
VIIb with an appropriate hydrazine derivative R.sup.1--NHNH.sup.2
provides the compound of formula VIb. The reaction is typically
carried out in an appropriate solvent such as ethanol at an
elevated temperature such as 60.degree. C. to reflux for a period
of about 1 to 48 hours to provide the compound of formula VIb. When
the hydrazine derivative R.sup.1--NHNH.sup.2 employed is in the
form of its corresponding acid addition salt, such as a
hydrochloride salt, it is to be appreciated that the compound of
formula VIb formed may also exist as a salt. When the compound of
formula VIb exists as the salt form, it is typically treated with
an appropriate base, such as sodium bicarbonate, in an appropriate
solvent, such as dichloromethane, for 15 minutes to 4 hours at
ambient temperature prior to conversion to the compound of formula
Vb. The compound of formula Vb is formed by first reacting
phosphorous oxychloride with dimethylformamide at 0.degree. C. then
adding the compound of formula VIb and cyclizing it at an elevated
temperature, such as 80.degree. C. for a period of 1 to 24 hours.
The compound of formula Vb is then converted to the corresponding
methoxy bromo derivative of formula IVb by reaction with an
appropriate brominating agent and methanol in an appropriate
solvent such as tetrahydrofuran. For example, reaction of the
compound Vb with N-bromosuccinimide in 20% methanol/tetrahydrofuran
for 30 minutes to 4 hours at ambient temperature can provide the
compound of formula IVb. Treatment of the compound of formula IVb
with an appropriate base, such as potassium t-butoxide, in an
appropriate solvent such as tetrahydrofuran for 15 minutes to 2
hours followed by acidification with an appropriate acid, such as
2N hydrochloric acid, can provide the compound of formula IIIb.
Deprotection of the compound of formula IIIb, followed by coupling
with the acid R2CO2H in the manner described previously in Reaction
Scheme I provides the compound of formula Ib.
[0075] Reaction Scheme III outlines the general procedures one
could use to provide N2 ACC inhibitor compounds of the present
invention having Formula Ic, in which R.sup.1 and R.sup.2 are as
previously and R3 is an alkyl group.
##STR00036##
[0076] The compound of formula IIIc may be formed by palladium
catalyzed cross-coupling of the bromide of formula IVc with an
alkyl or alkenyl tributylstannane such as methyl tri-nbutylstannane
or vinyl tri-nbutylstannane or allyl tri-nbutylstannane or a
trialkyl boroxine such as trimethyl boroxine or trivinyl boroxine
in the presence of a palladium catalyst such as
tetrakis(triphenylphosphine) palladium(0) or a precatalyst and
ligand combination such as palladium(II)acetate and
2-dicyclohexylphosphino-2',6'-dimethoxybiphenyl ("SPhos") and in
the presence or absence of a base such as potassium carbonate in a
protic solvent such as ethanol or t-amyl alcohol or an aprotic
solvent such as tetrahydrofuran or dimethylformamide at a
temperature of about 20.degree. C. to about 100.degree. C. for
about 2 hours to about 18 hours or at a temperature of about
100.degree. C. to about 150.degree. C. for about 5 minutes to about
60 minutes under microwave heating. If a alkenyl trialkylstannane
or alkenyl boroxine is utilized to install the R.sup.3 group,
reduction of the resulting olefin may be affected by hydrogenation
over palladium on carbon in ethanol or treatment with a hydrogen
source such as ammonium formate or 1-methyl-1,4-cyclohexadiene in
the presence of palladium on carbon in ethanol or ethyl
acetate.
[0077] The compound of formula IIIc may then be deprotected to
provide the free spiropiperidine derivative of formula IIc using
standard methods which depend on which protecting group Pg has been
employed. For example, when Pg represents BOC, standard strong acid
deprotection conditions. such as 4N hydrochloric acid in dioxane or
trifluoroacetic acid in an appropriate solvent such as
dichloromethane, can be used to remove the BOC group. When Pg
represents Cbz, hydrogenation over palladium on carbon in ethanol
or treatment with a hydrogen source such as ammonium formate or
1-methyl-1,4-cyclohexadiene in the presence of palladium on carbon
in ethanol or ethyl acetate may be employed to carry out the
deprotection.
[0078] The spiropiperidine derivative of formula IIc may then be
acylated by employing standard methods to provide the compound of
Formula Ic. For example, the compound Ic may then be formed using a
standard peptide coupling reaction with the desired carboxylic acid
(R.sup.2CO.sub.2H). For example, the spiropiperidine intermediate
Ilc and carboxylic acid (R.sup.2CO.sub.2H) may be coupled by
forming an activated carboxylic acid ester, such as by contacting
the carboxylic acid (R.sup.2CO.sub.2H) with a peptide coupling
reagent, such as HATU or EDC.HCl, in the presence or absence of an
activating agent, such as HOBt and in the presence of a suitable
base, such as DIEA, triethylamine or NMM, in a suitable solvent
such as THF and/or DMF, DMA or dichloromethane and then contacting
the activated carboxylic acid ester with the spiropiperidine
derivative IIc to form a compound of Formula Ic. Similar
methodology can be employed to prepare the corresponding N1
analogues (where R.sup.1 is on N1 of the pyrazole ring rather than
on N2 as shown in Reaction Scheme III).
[0079] The compounds of the present invention may be isolated and
used per se or in the form of their pharmaceutically acceptable
salts. In accordance with the present invention, compounds with
multiple basic nitrogen atoms can form salts with varying number of
equivalents ("eq.") of acid. It will be understood by practitioners
that all such salts are within the scope of the present
invention.
[0080] Pharmaceutically acceptable salts, as used herein in
relation to compounds of the present invention, include
pharmaceutically acceptable inorganic and organic salts of the
compound. These salts can be prepared in situ during the final
isolation and purification of a compound, or by separately reacting
the compound thereof, with a suitable organic or inorganic acid and
isolating the salt thus formed. Representative salts include, but
are not limited to, the hydrobromide, hydrochloride, hydroiodide,
sulfate, bisulfate, nitrate, acetate, trifluoroacetate, oxalate,
besylate, palmitate, pamoate, malonate, stearate, laurate, malate,
borate, benzoate, lactate, phosphate, hexafluorophosphate, benzene
sulfonate, tosylate, formate, citrate, maleate, fumarate,
succinate, tartrate, naphthylate, mesylate, glucoheptonate,
lactobionate and laurylsulphonate salts, and the like. These may
also include cations based on the alkali and alkaline earth metals,
such as sodium, lithium, potassium, calcium, magnesium, and the
like, as well as non-toxic ammonium, quaternary ammonium, and amine
cations including, but not limited to, ammonium,
tetramethylammonium, tetraethylammonium, methylammonium,
dimethylammonium, trimethylammonium, triethylammonium,
ethylammonium, and the like. For additional examples see, for
example, Berge, et al., J. Pharm. Sci., 66, 1-19 (1977).
[0081] Compounds of the present invention may exist in more than
one crystal form. Polymorphs of compounds of Formula (I) and salts
thereof (including solvates and hydrates) form part of this
invention and may be prepared by crystallization of a compound of
the present invention under different conditions. For example,
using different solvents or different solvent mixtures for
recrystallization; crystallization at different temperatures;
various modes of cooling, ranging from very fast to very slow
cooling during crystallization. Polymorphs may also be obtained by
heating or melting a compound of the present invention followed by
gradual or fast cooling. The presence of polymorphs may be
determined by solid probe nuclear magnetic resonance (NMR)
spectroscopy, infrared (IR) spectroscopy, differential scanning
calorimetry, powder X-ray diffraction or such other techniques.
[0082] This invention also includes isotopically-labeled compounds,
which are identical to those described by Formula (I), but for the
fact that one or more atoms are replaced by an atom having an
atomic mass or mass number different from the atomic mass or mass
number usually found in nature. Examples of isotopes that can be
incorporated into compounds of the invention include isotopes of
hydrogen, carbon, nitrogen, oxygen, sulfur and fluorine, such as
.sup.2H, .sup.3H, .sup.13C, .sup.14C, .sup.15N, .sup.18O, .sup.17O,
.sup.35S, .sup.36Cl, .sup.125I, .sup.129I, and .sup.18F
respectively. Certain isotopically-labeled compounds of the present
invention, for example those into which radioactive isotopes such
as .sup.3H and .sup.14C are incorporated, are useful in drug and/or
substrate tissue distribution assays. Tritiated (i.e., .sup.3H),
and carbon-14 (i.e., .sup.14C), isotopes are particularly preferred
for their ease of preparation and detectability. Further,
substitution with heavier isotopes such as deuterium (i.e.,
.sup.2H), can afford certain therapeutic advantages resulting from
greater metabolic stability, for example increased in vivo
half-life or reduced dosage requirements and, hence, may be
preferred in some circumstances. Isotopically labeled compounds of
the present invention can generally be prepared by carrying out the
procedures disclosed in the schemes and/or in the Examples below,
by substituting a readily available isotopically labeled reagent
for a non-isotopically labeled reagent.
[0083] The compounds of the present invention may contain
stereogenic centers. These compounds may exist as mixtures of
enantiomers or as pure enantiomers. Wherein a compound includes a
stereogenic center, the compounds may be resolved into the pure
enantiomers by methods known to those skilled in the art, for
example by formation of diastereoisomeric salts which may be
separated, for example, by crystallization; formation of
stereoisomeric derivatives or complexes which may be separated, for
example, by crystallization, gas-liquid or liquid chromatography;
selective reaction of one enantiomer with an enantiomer-specific
reagent, for example enzymatic esterification; or gas-liquid or
liquid chromatography in a chiral environment, for example on a
chiral support for example silica with a bound chiral ligand or in
the presence of a chiral solvent. It will be appreciated that where
the desired stereoisomer is converted into another chemical entity
by one of the separation procedures described above, a further step
is required to liberate the desired enantiomeric form.
Alternatively, the specific stereoisomers may be synthesized by
using an optically active starting material, by asymmetric
synthesis using optically active reagents, substrates, catalysts or
solvents, or by converting one stereoisomer into the other by
asymmetric transformation.
[0084] Compounds of the present invention may exist in different
stable conformational forms which may be separable. Torsional
asymmetry due to restricted rotation about an asymmetric single
bond, for example because of steric hindrance or ring strain, may
permit separation of different conformers. The compounds of the
present invention further include each conformational isomer of
compounds of Formula (I) and mixtures thereof.
[0085] Compounds of the present invention are useful for treating
diseases, conditions and/or disorders modulated by the inhibition
of the acetyl-CoA carboxylases enzyme(s) (in particular, ACC1 and
ACC2). Another embodiment of the present invention is a
pharmaceutical composition comprising a therapeutically effective
amount of a compound of the present invention and a
pharmaceutically acceptable excipient, diluent or carrier. The
compounds of the present invention (including the compositions and
processes used therein) may also be used in the manufacture of a
medicament for the therapeutic applications described herein.
[0086] A typical formulation is prepared by mixing a compound of
the present invention and a carrier, diluent or excipient. Suitable
carriers, diluents and excipients are well known to those skilled
in the art and include materials such as carbohydrates, waxes,
water soluble and/or swellable polymers, hydrophilic or hydrophobic
materials, gelatin, oils, solvents, water, and the like. The
particular carrier, diluent or excipient used will depend upon the
means and purpose for which the compound of the present invention
is being applied. Solvents are generally selected based on solvents
recognized by persons skilled in the art as safe (GRAS) to be
administered to a mammal. In general, safe solvents are non-toxic
aqueous solvents such as water and other non-toxic solvents that
are soluble or miscible in water. Suitable aqueous solvents include
water, ethanol, propylene glycol, polyethylene glycols (e.g.,
PEG400, PEG300), etc. and mixtures thereof. The formulations may
also include one or more buffers, stabilizing agents, surfactants,
wetting agents, lubricating agents, emulsifiers, suspending agents,
preservatives, antioxidants, opaquing agents, glidants, processing
aids, colorants, sweeteners, perfuming agents, flavoring agents and
other known additives to provide an elegant presentation of the
drug (i.e., a compound of the present invention or pharmaceutical
composition thereof) or aid in the manufacturing of the
pharmaceutical product (i.e., for use in the preparing a
medicament).
[0087] The formulations may be prepared using conventional
dissolution and mixing procedures. For example, the bulk drug
substance (i.e., compound of the present invention or stabilized
form of the compound (e.g., complex with a cyclodextrin derivative
or other known complexation agent)) is dissolved in a suitable
solvent in the presence of one or more of the excipients described
above. The dissolution rate of poorly water-soluble compounds may
be enhanced by the use of a spray-dried dispersion, such as those
described by Takeuchi, H., et al. in "Enhancement of the
dissolution rate of a poorly water-soluble drug (tolbutamide) by a
spray-drying solvent deposition method and disintegrants" J. Pharm.
Pharmacol., 39, 769-773 (1987); and EP0901786 B1 (US2002/009494),
incorporated herein by reference. The compound of the present
invention is typically formulated into pharmaceutical dosage forms
to provide an easily controllable dosage of the drug and to give
the patient an elegant and easily handleable product.
[0088] The pharmaceutical compositions also include solvates and
hydrates of the compounds of the present invention. The term
"solvate" refers to a molecular complex of a compound represented
by Formula (I) (including pharmaceutically acceptable salts
thereof) with one or more solvent molecules. Such solvent molecules
are those commonly used in the pharmaceutical art, which are known
to be innocuous to the recipient, e.g., water, ethanol, ethylene
glycol, and the like, The term "hydrate" refers to the complex
where the solvent molecule is water. The solvates and/or hydrates
preferably exist in crystalline form. Other solvents may be used as
intermediate solvates in the preparation of more desirable
solvates, such as methanol, methyl t-butyl ether, ethyl acetate,
methyl acetate, (S)-propylene glycol, (R)-propylene glycol,
1,4-butyne-diol, and the like.
[0089] The pharmaceutical composition (or formulation) for
application may be packaged in a variety of ways depending upon the
method used for administering the drug. Generally, an article for
distribution includes a container having deposited therein the
pharmaceutical formulation in an appropriate form. Suitable
containers are well-known to those skilled in the art and include
materials such as bottles (plastic and glass), sachets, ampoules,
plastic bags, metal cylinders, and the like. The container may also
include a tamper-proof assemblage to prevent indiscreet access to
the contents of the package. In addition, the container has
deposited thereon a label that describes the contents of the
container. The label may also include appropriate warnings.
[0090] The present invention further provides a method of treating
diseases, conditions and/or disorders modulated by the inhibition
of the acetyl-CoA carboxylases enzyme(s) in an animal that includes
administering to an animal in need of such treatment a
therapeutically effective amount of a compound of the present
invention or a pharmaceutical composition comprising an effective
amount of a compound of the present invention and a
pharmaceutically acceptable excipient, diluent, or carrier. The
method is particularly useful for treating diseases, conditions
and/or disorders that benefit from the inhibition of acetyl-CoA
carboxylases enzyme(s).
[0091] One aspect of the present invention is the treatment of
obesity, and obesity-related disorders (e.g., overweight, weight
gain, or weight maintenance).
[0092] Obesity and overweight are generally defined by body mass
index (BMI), which is correlated with total body fat and estimates
the relative risk of disease. BMI is calculated by weight in
kilograms divided by height in meters squared (kg/m.sup.2).
Overweight is typically defined as a BMI of 25-29.9 kg/m.sup.2, and
obesity is typically defined as a BMI of 30 kg/m.sup.2. See, e.g.,
National Heart, Lung, and Blood Institute, Clinical Guidelines on
the Identification, Evaluation, and Treatment of Overweight and
Obesity in Adults, The Evidence Report, Washington, D.C.: U.S.
Department of Health and Human Services, NIH publication no.
98-4083 (1998).
[0093] Another aspect of the present invention is for the treatment
(e.g., delaying the progression or onset) of diabetes or
diabetes-related disorders including Type 1 (insulin-dependent
diabetes mellitus, also referred to as "IDDM") and Type 2
(noninsulin-dependent diabetes mellitus, also referred to as
"NIDDM") diabetes, impaired glucose tolerance, insulin resistance,
hyperglycemia, and diabetic complications (such as atherosclerosis,
coronary heart disease, stroke, peripheral vascular disease,
nephropathy, hypertension, neuropathy, and retinopathy).
[0094] In yet another aspect of the present invention is the
treatment of obesity co-morbidities, such as metabolic syndrome.
Metabolic syndrome includes diseases, conditions or disorders such
as dyslipidemia, hypertension, insulin resistance, diabetes (e.g.,
Type 2 diabetes), coronary artery disease and heart failure. For
more detailed information on Metabolic Syndrome, see, e.g., Zimmet,
P. Z., et al., "The Metabolic Syndrome: Perhaps an Etiologic
Mystery but Far From a Myth--Where Does the International Diabetes
Federation Stand?," Diabetes & Endocrinology, 7(2), (2005); and
Alberti, K. G., et al., "The Metabolic Syndrome--A New Worldwide
Definition," Lancet, 366, 1059-62 (2005). Preferably,
administration of the compounds of the present invention provides a
statistically significant (p<0.05) reduction in at least one
cardiovascular disease risk factor, such as lowering of plasma
leptin, C-reactive protein (CRP) and/or cholesterol, as compared to
a vehicle control containing no drug. The administration of
compounds of the present invention may also provide a statistically
significant (p<0.05) reduction in glucose serum levels.
[0095] In yet another aspect of the invention is the treatment of
nonalcoholic fatty liver disease (NAFLD) and hepatic insulin
resistance.
[0096] For a normal adult human having a body weight of about 100
kg, a dosage in the range of from about 0.001 mg to about 10 mg per
kilogram body weight is typically sufficient, preferably from about
0.01 mg/kg to about 5.0 mg/kg, more preferably from about 0.01
mg/kg to about 1 mg/kg. However, some variability in the general
dosage range may be required depending upon the age and weight of
the subject being treated, the intended route of administration,
the particular compound being administered and the like. The
determination of dosage ranges and optimal dosages for a particular
patient is well within the ability of one of ordinary skill in the
art having the benefit of the instant disclosure. It is also noted
that the compounds of the present invention can be used in
sustained release, controlled release, and delayed release
formulations, which forms are also well known to one of ordinary
skill in the art.
[0097] The compounds of this invention may also be used in
conjunction with other pharmaceutical agents for the treatment of
the diseases, conditions and/or disorders described herein.
Therefore, methods of treatment that include administering
compounds of the present invention in combination with other
pharmaceutical agents are also provided. Suitable pharmaceutical
agents that may be used in combination with the compounds of the
present invention include anti-obesity agents (including appetite
suppressants), anti-diabetic agents, anti-hyperglycemic agents,
lipid lowering agents, and anti-hypertensive agents.
[0098] Suitable lipid lowering agents that can be combined with the
compounds of the present invention include, for example, those
described at page 30, line 20 through page 31, line 30 of WO
2011005611. The lipid lowering agents include bile acid
sequestrants, HMG-CoA reductase inhibitors, HMG-CoA synthase
inhibitors, cholesterol absorption inhibitors, acyl coenzyme
A-cholesterol acyl transferase (ACAT) inhibitors, CETP inhibitors,
squalene synthetase inhibitors, PPAR a agonists, FXR receptor
modulators, LXR receptor modulators, lipoprotein synthesis
inhibitors, rennin angiotensisn system inhibitors, PPAR d partial
agonists, bile acid reabsorption inhibitors, PPAR .gamma. agonists,
triglyceride synthesis inhibitors, microsomal triglyceride
transport inhibitors, transcription modulators, squalene epoxidase
inhibitors, low density lipoprotein receptor inducers, platelet
aggregation inhibitors, 5-LO or FLAP inhibitors, niacin bound
chromium and other agents that affect lipid composition.
[0099] Suitable anti-hypertensive agents that can be combined with
the compounds of the present invention include, for example, those
described at page 31, line 31 through page 32, line 18 of WO
2011005611. The anti-hypertensive agents include diuretics,
beta-adrenergic blockers, calcium channel blockers, angiotensin
converting enzyme (ACE) inhibitors, neutral endopeptidase
inhibitors, endothelin antagonists, vasodilators, angiotensin II
receptor antagonists, .alpha./.beta. adrenergic blockers, alpha 1
blockers, alpha 2 agonists, aldosterone inhibitors,
mineraocorticoid receptor inhibitors, renin inhibitors and
angiopoietin-2-binding agents.
[0100] Suitable anti-diabetic agents include an acetyl-CoA
carboxylase--(ACC) inhibitor such as those described in
WO2009144554, WO2003072197, WO2009144555 and WO2008065508, a
diacylglycerol O-acyltransferase 1 (DGAT-1) inhibitor, such as
those described in WO09016462 or WO2010086820, AZD7687 or LCQ908,
diacylglycerol O-acyltransferase 2 (DGAT-2) inhibitor,
monoacylglycerol O-acyltransferase inhibitors, a phosphodiesterase
(PDE)-10 inhibitor, an AMPK activator, a sulfonylurea (e.g.,
acetohexamide, chlorpropamide, diabinese, glibenclamide, glipizide,
glyburide, glimepiride, gliclazide, glipentide, gliquidone,
glisolamide, tolazamide, and tolbutamide), a meglitinide, an
.alpha.-amylase inhibitor (e.g., tendamistat, trestatin and
AL-3688), an .alpha.-glucoside hydrolase inhibitor (e.g.,
acarbose), an .alpha.-glucosidase inhibitor (e.g., adiposine,
camiglibose, emiglitate, miglitol, voglibose, pradimicin-Q, and
salbostatin), a PPAR.gamma. agonist (e.g., balaglitazone,
ciglitazone, darglitazone, englitazone, isaglitazone, pioglitazone,
rosiglitazone and troglitazone), a PPAR .alpha./.gamma. agonist
(e.g., CLX-0940, GW-1536, GW-1929, GW-2433, KRP-297, L-796449,
LR-90, MK-0767 and SB-219994), a biguanide (e.g., metformin), a
glucagon-like peptide 1 (GLP-1) modulator such as an agonist (e.g.,
exendin-3 and exendin-4), liraglutide, albiglutide, exenatide
(Byetta.RTM.), albiglutide, taspoglutide, lixisenatide,
dulaglutide, semaglutide, NN-9924, TTP-054, a protein tyrosine
phosphatase-1B (PTP-1B) inhibitor (e.g., trodusquemine, hyrtiosal
extract, and compounds disclosed by Zhang, S., et al., Drug
Discovery Today, 12(9/10), 373-381 (2007)), SIRT-1 inhibitor (e.g.,
resveratrol, GSK2245840 or GSK184072), a dipeptidyl peptidease IV
(DPP-IV) inhibitor (e.g., those in WO2005116014, sitagliptin,
vildagliptin, alogliptin, dutogliptin, linagliptin and
saxagliptin), an insulin secreatagogue, a fatty acid oxidation
inhibitor, an A2 antagonist, a c-jun amino-terminal kinase (JNK)
inhibitor, glucokinase activators (GKa) such as those described in
WO2010103437, WO2010103438, WO2010013161, WO2007122482, TTP-399,
TTP-355, TTP-547, AZD1656, ARRY403, MK-0599, TAK-329, AZD5658 or
GKM-001, insulin, an insulin mimetic, a glycogen phosphorylase
inhibitor (e.g. GSK1362885), a VPAC2 receptor agonist, SGLT2
inhibitors, such as those described in E. C. Chao et al. Nature
Reviews Drug Discovery 9, 551-559 (July 2010) including
dapagliflozin, canagliflozin, BI-10733, tofogliflozin (CSG452),
ASP-1941, THR1474, TS-071, ISIS388626 and LX4211 as well as those
in WO2010023594, a glucagon receptor modulator such as those
described in Demong, D. E. et al. Annual Reports in Medicinal
Chemistry 2008, 43, 119-137, GPR119 modulators, particularly
agonists, such as those described in WO2010140092, WO2010128425,
WO2010128414, WO2010106457, Jones, R. M. et al. in Medicinal
Chemistry 2009, 44, 149-170 (e.g. MBX-2982, GSK1292263, APD597 and
PSN821), FGF21 derivatives or analogs such as those described in
Kharitonenkov, A. et al. et al., Current Opinion in Investigational
Drugs 2009, 10(4)359-364, TGR5 (also termed GPBAR1) receptor
modulators, particularly agonists, such as those described in
Zhong, M., Current Topics in Medicinal Chemistry, 2010, 10(4),
386-396 and INT777, GPR40 agonists, such as those described in
Medina, J. C., Annual Reports in Medicinal Chemistry, 2008, 43,
75-85, including but not limited to TAK-875, GPR120 modulators,
particularly agonists, high affinity nicotinic acid receptor
(HM74A) activators, and SGLT1 inhibitors, such as GSK1614235. A
further representative listing of anti-diabetic agents that can be
combined with the compounds of the present invention can be found,
for example, at page 28, line 35 through page 30, line 19 of
WO2011005611. Preferred anti-diabetic agents are metformin and
DPP-IV inhibitors (e.g., sitagliptin, vildagliptin, alogliptin,
dutogliptin, linagliptin and saxagliptin). Other antidiabetic
agents could include inhibitors or modulators of carnitine
palmitoyl transferase enzymes, inhibitors of fructose
1,6-diphosphatase, inhibitors of aldose reductase,
mineralocorticoid receptor inhibitors, inhibitors of TORC2,
inhibitors of CCR2 and/or CCR5, inhibitors of PKC isoforms (e.g.
PKCa, PKCb, PKCg), inhibitors of fatty acid synthetase, inhibitors
of serine palmitoyl transferase, modulators of GPR81, GPR39, GPR43,
GPR41, GPR105, Kv1.3, retinol binding protein 4, glucocorticoid
receptor, somatostain receptors (e.g. SSTR1, SSTR2, SSTR3 and
SSTR5), inhibitors or modulators of PDHK2 or PDHK4, inhibitors of
MAP4K4, modulators of IL1 family including IL1beta, modulators of
RXRalpha. In addition suitable anti-diabetic agents include
mechanisms listed by Carpino, P. A., Goodwin, B. Expert Opin. Ther.
Pat, 2010, 20(12), 1627-51.
[0101] Suitable anti-obesity agents (some of which may also act as
anti-diabetic agents as well) include 11.beta.-hydroxy steroid
dehydrogenase-1 (11.beta.-HSD type 1) inhibitors, stearoyl-CoA
desaturase-1 (SCD-1) inhibitor, MCR-4 agonists, cholecystokinin-A
(CCK-A) agonists, monoamine reuptake inhibitors (such as
sibutramine), sympathomimetic agents, .beta..sub.3 adrenergic
agonists, dopamine agonists (such as bromocriptine),
melanocyte-stimulating hormone analogs, 5HT2c agonists, melanin
concentrating hormone antagonists, leptin (the OB protein), leptin
analogs, leptin agonists, galanin antagonists, lipase inhibitors
(such as tetrahydrolipstatin, i.e. orlistat), anorectic agents
(such as a bombesin agonist), neuropeptide-Y antagonists (e.g., NPY
Y5 antagonists such as velneperit), PYY.sub.3-36 (including analogs
thereof), BRS3 modulator, mixed antagonists of opiod receptor
subtypes, thyromimetic agents, dehydroepiandrosterone or an analog
thereof, glucocorticoid agonists or antagonists, orexin
antagonists, glucagon-like peptide-1 agonists, ciliary neurotrophic
factors (such as Axokine.TM. available from Regeneron
Pharmaceuticals, Inc., Tarrytown, N.Y. and Procter & Gamble
Company, Cincinnati, Ohio), human agouti-related protein (AGRP)
inhibitors, histamine 3 antagonists or inverse agonists, neuromedin
U agonists, MTP/ApoB inhibitors (e.g., gut-selective MTP
inhibitors, such as dirlotapide, JTT130, Usistapide, SLx4090),
opioid antagonist, mu opioid receptor modulators, including but not
limited to GSK1521498, MetAp2 inhibitors, including but not limited
to ZGN-433, agents with mixed modulatory activity at 2 or more of
glucagon, GIP and GLP1 receptors, such as MAR-701 or ZP2929,
norepinephrine transporter inhibitors, cannabinoid-1-receptor
antagonist/inverse agonists, ghrelin agonists/antagonists,
oxyntomodulin and analogs, monoamine uptake inhibitors, such as but
not limited to tesofensine, an orexin antagonist, combination
agents (such as bupropion plus zonisamide, pramlintide plus
metreleptin, bupropion plus naltrexone, phentermine plus
topiramate), and the like.
[0102] Preferred anti-obesity agents for use in the combination
aspects of the present invention include gut-selective MTP
inhibitors (e.g., dirlotapide, mitratapide and implitapide, R56918
(CAS No. 403987) and CAS No. 913541-47-6), CCKa agonists (e.g.,
N-benzyl-2-[4-(1H-indol-3-ylmethyl)-5-oxo-1-phenyl-4,5-dihydro-2,3,6,10b--
tetraaza-benzo[e]azulen-6-yl]-N-isopropyl-acetamide described in
PCT Publication No. WO 2005/116034 or US Publication No.
2005-0267100 A1), 5HT2c agonists (e.g., lorcaserin), MCR4 agonist
(e.g., compounds described in U.S. Pat. No. 6,818,658), lipase
inhibitor (e.g., Cetilistat), PYY.sub.3-36 (as used herein
"PYY.sub.3-36" includes analogs, such as peglated PYY.sub.3-36
e.g., those described in US Publication 2006/0178501), opioid
antagonists (e.g., naltrexone), oleoyl-estrone (CAS No.
180003-17-2), obinepitide (TM30338), pramlintide (Symlin.RTM.),
tesofensine (NS2330), leptin, bromocriptine, orlistat, AOD-9604
(CAS No. 221231-10-3) and sibutramine. Preferably, compounds of the
present invention and combination therapies are administered in
conjunction with exercise and a sensible diet.
[0103] All of the recited U.S. patents and publications (including
all technical bulletins referenced in the Examples) are
incorporated herein by reference in their entireties.
[0104] The Examples set forth herein below are for illustrative
purposes only. The compositions, methods, and various parameters
reflected herein are intended only to exemplify various aspects and
embodiments of the invention, and are not intended to limit the
scope of the claimed invention in any way.
EXAMPLES
[0105] The compounds and intermediates described below were named
using the naming convention provided with Chemdraw Ultra, Version
11.0.1 (CambridgeSoft Corp., Cambridge Mass.). The naming
convention provided with Chemdraw Ultra, Version 11.0.1 are well
known by those skilled in the art and it is believed that the
naming convention provided with Chemdraw Ultra, Version 11.0.1
generally comports with the IUPAC (International Union for Pure and
Applied Chemistry) recommendations on Nomenclature of Organic
Chemistry and the CAS Index rules. Unless noted otherwise, all
reactants were obtained commercially. All of the references cited
herein below are incorporated by reference.
[0106] Flash chromatography was performed according to the method
described by Still et al., J. Org. Chem., 1978, 43, 2923.
[0107] All Biotage.RTM. purifications, discussed herein, were
performed using Biotage.RTM. SNAP columns containing KP-SIL silica
(40-63 .mu.M, 60 Angstroms) (Biotage AB; Uppsala, Sweden).
[0108] All Combiflash.RTM. purifications, discussed herein, were
performed using a CombiFlash.RTM. Companion system (Teledyne Isco;
Lincoln, Nebr.) utilizing packed RediSep.RTM. silica columns
[0109] Mass Spectra were recorded on a Waters (Waters Corp.;
Milford, Mass.) Micromass Platform II spectrometer. Unless
otherwise specified, mass spectra were recorded on a Waters
(Milford, Mass.) Micromass Platform II spectrometer.
[0110] Proton NMR chemical shifts are given in parts per million
downfield from tetramethylsilane and were recorded on a Varian
Unity 300, 400 or 500 MHz (megaHertz) spectrometer (Varian Inc.;
Palo Alto, Calif.). NMR chemical shifts are given in parts per
million downfield from tetramethylsilane (for proton) or
fluorotrichloromethane (for fluorine).
[0111] HPLC retention times were measured using the following
methods: Method A: column: Waters Atlantis dC18 4.6.times.50 mm, 5
.mu.m; mobile phase A: 0.05% TFA in water (v/v); mobile phase B:
0.05% TFA in acetonitrile (v/v); gradient: 95% A/5% B linear to 5%
A/95% B in 4.0 minutes, hold at 5% N95% B for 5.0 minutes; flow
rate: 2.0 mL/minute.
[0112] The preparations described below were used in the synthesis
of compounds exemplified in the following examples.
[0113] The following starting materials are available from the
corresponding sources [0114]
6-bromo-1H-indole-3-carbonitrile--Indofine Chemical Company, Inc.
(Hillsborough, N.J., USA) [0115]
5-bromo-1H-indole-3-carbonitrile--Indofine Chemical Company, Inc.
(Hillsborough, N.J., USA) [0116]
6-bromo-1H-indole-2-carboxamide--Aurora Fine Chemicals LLC (San
Diego, Calif., USA) [0117] methyl
3-iodo-1H-indazole-5-carboxylate--Anichem LLC (North Brunswick,
N.J., USA) [0118] 1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid--ACS
Scientific Inc. (Metuchen, N.J., USA) [0119] methyl
1H-pyrrolo[3,2-b]pyridine-6-carboxylate--ACS Scientific Inc.
(Metuchen, N.J., USA) [0120] methyl
1H-pyrrolo[2,3-b]pyridine-5-carboxylate--Anichem LLC (North
Brunswick, N.J., USA) [0121]
5-(methoxycarbonyl)-1H-indole-2-carboxylic acid--Bepharm Ltd.
(Shanghai, China) [0122] methyl
3-bromo-1H-pyrazolo[3,4-b]pyridine-5-carboxylate--MolBridge
(Plainsboro, N.J., USA) [0123] ethyl
2-bromo-1H-pyrrolo[2,3-b]pyridine-5-carboxylate--American Custom
Chemicals Corp. (San Diego, Calif., USA) [0124]
5-bromo-1H-indazole-3-carboxylic acid--Anichem LLC (North
Brunswick, N.J., USA) [0125] 6-methoxyquinoline-3-carboxylic
acid--BioBlocks, Inc. (San Diego, Calif., USA); prepared as
described by A. Hanna-Elias et al. Austr. J. Chem. 2009, 62,
150-156 [0126] 2-aminoquinoline-6-carboxylic acid--Princeton
Biomolecular Research Inc. (Monmouth Junction, N.J., USA) [0127]
5-bromo-2-nitrobenzaldehyde--Oakwood Products, Inc. (West Columbia,
S.C., USA) [0128] ethyl quinoline-7-carboxylate--ASW MedChem, Inc.
(New Brunswick, N.J., USA)
Preparation of Intermediates and Starting Materials
Intermediate 1:
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one,
shown below, was prepared as follows
##STR00037##
[0129] Step 1. tert-butyl
9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate
##STR00038##
[0131] Methyl vinyl ketone (146 mL, 1.78 mol) was added to a
solution of tert-butyl 4-formylpiperidine-1-carboxylate (375 g,
1.76 mol) in tetrahydrofuran (18 L). The reaction mixture was
cooled to -5.degree. C. and a solution of potassium hydroxide in
ethanol (3N, 0.243 L) was added dropwise over 10 minutes. The
reaction mixture was allowed to warm to room temperature and
stirred for 16 hours. Cyclohexane (10 L) was added and the solution
was washed with saturated sodium chloride (3.times.10 L). The
organic layer was concentrated to an oil. This oil was dissolved in
2 L of 80:20 cyclohexane/ethyl acetate and filtered through
Celite.RTM. to remove the insoluble material. The filtrate was
purified via flash column chromatography (30% ethyl
acetate/hexanes) to afford the product as an oil. The oil was
triturated in hexanes to afford the title compound as a colorless
solid (131 g, 28%).
Step 2.
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
[0132] A solution of tert-butyl
9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate (250 g) and
tris(dimethylaminomethane) (325 mL) in toluene (1.9 L) was heated
at reflux for 4 hours. The mixture was distilled and concentrated
to a minimum stirring volume (110.degree. C.) and then toluene (1.9
L) was added. The reaction was redistilled to a minimum stirring
volume and cooled to room temperature. Toluene (1.8 L) and
isopropyl hydrazine hydrochloride (135 g) were added and the
solution was heated to reflux for 5 hours. The reaction was cooled
to room temperature and was washed with citric acid (10% aqueous,
2.times.150 mL) and water (200 mL). The organic layer was then
distilled to a minimum stirring volume. Methanol (2 L) was added
and distilled to a minimum stirring volume. This was repeated with
methanol (2 L). The solution was redissolved in methanol (2.5 L)
and N-bromosuccinimide (176 g) was added in one portion. The
solution was stirred at 23.degree. C. for 2 hours. Aqueous sodium
thiosulfate solution (5 wt %, 0.5 L) was added and the mixture was
stirred for 15 minutes. The reaction mixture was concentrated via
distillation (45.degree. C., 210 mm Hg) to .about.0.5 L and then
2-methyl tetrahydrofuran (2.5 L) was added. After stirring for 15
minutes the aqueous layer was discarded. The organic layer was
concentrated to -0.2 L and tetrahydrofuran (0.5 L) was added. To
the mixture was added a potassium tert-butoxide solution in
tetrahydrofuran (1.9 L, 1 M solution). The solution was heated to
60.degree. C. and stirred for 1 hour. After cooling to room
temperature, aqueous hydrochloric acid (1 N, 2.2 L) was added over
20 minutes. The mixture was stirred at room temperature for 20
minutes, and then the layers were allowed to separate. The aqueous
layer was removed and back extracted with ethyl acetate (1.75 L).
The combined organic layers were washed with water (1 L) and
concentrated via distillation (4 L solvent removed). Ethyl acetate
(1.8 L) was added and the solution was concentrated to a minimum
stirring volume. Ethyl acetate (3 L) and methanol (0.8 L) were
added and the solution was cooled to 0.degree. C. Acetyl chloride
(401 mL) was added dropwise over 20 minutes and the solution was
stirred at 0.degree. C. for 4 hours. The precipitate was collected
by filtration under nitrogen. The filtrate was washed with ethyl
acetate (0.5 L) and dried in a vacuum oven at 40.degree. C. to
afford the title compound as an off-white solid (241 g). +ESI (M+H)
248.4; .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 7.43 (s, 1H),
5.32-5.42 (m, 1H), 3.15-3.25 (m, 4H), 2.89 (s, 2H), 2.64 (s, 2H),
1.69-1.90 (m, 4H), 1.37-1.45 (m, 6H).
Intermediate 2:
2-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
hydrochloride salt, shown below, was prepared as follows
##STR00039##
[0133] Step 1. benzyl
9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate
##STR00040##
[0135] To a benzene (700 mL) solution of benzyl
4-formylpiperidine-1-carboxylate (90.0 g, 364 mmol) in a 2 L 3-neck
flask fitted with a Dean-Stark trap was added p-toluenesulfonic
acid (6.92 g, 36.4 mmol) with stirring. The reaction was heated to
70.degree. C., and 3-buten-2-one (61.8 mL, 753 mmol) was added. The
mixture was heated at reflux for 24 hours collecting expelled water
in the trap. The reaction was cooled to room temperature and washed
with 500 mL saturated aqueous sodium bicarbonate. The organic phase
was dried over sodium sulfate, filtered and concentrated. The
resultant dark brown oil was taken up in 200 mL dichloromethane and
filtered through a silica pad (600 mL silica), eluting with 2 L
heptane followed by 3 L 50% ethyl acetate/heptane and then 3 L
ethyl acetate. Fractions containing clean product were combined and
concentrated to yield 68.1 g of the title compound as a thick brown
oil. The fractions containing impure product were combined and
concentrated and purified by flash column chromatography (10-80%
ethyl acetate/heptanes) to yield an additional 23.6 g of the title
compound as a thick brown oil. A combined yield of 91.7 g, (94.1%)
was realized. .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.27-7.43
(m, 5H), 6.79 (d, J=10.3 Hz, 1H), 5.95 (d, J=10.3 Hz, 1H), 5.13 (s,
2H), 3.56-3.71 (m, 2H), 3.39-3.55 (m, 2H), 2.38-2.50 (m, 2H), 1.96
(t, J=6.7 Hz, 2H), 1.52-1.70 (m, 4H).
Step 2. (E)-benzyl
9-(2-tert-butylhydrazono)-3-azaspiro[5.5]undec-7-ene-3-carboxylate
hydrochloride salt
##STR00041##
[0137] Benzyl 9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate (4.89
g, 16.3 mmol) was dissolved in ethanol (60 mL) and
tert-butylhydrazine hydrochloride (2.44 g, 19.6 mmol) was added.
The mixture was heated at reflux for 4 hours and then stirred at
60.degree. C. for 48 hours. The reaction was cooled to room
temperature and concentrated under reduced pressure to give a tan
oil which solidified upon standing to yield 6.60 g (99%) of the
title compound as a tan solid. +ESI (M+H) 370.3; .sup.1H NMR (400
MHz, CDCl.sub.3, .delta.): 7.26-7.42 (m, 5H), 6.46 (d, J=10.0 Hz,
1H), 6.26 (br. s., 1H), 5.08-5.16 (m, 2H), 3.43-3.58 (m, 4H), 3.19
(s, 2H), 1.78 (s, 2H), 1.44-1.63 (m, 4H), 1.17-1.30 (m, 9H).
Step 3. benzyl
2-tert-butyl-2,4-dihydrospiro[indazole-5,4'-piperidine]-1'-carboxylate
##STR00042##
[0139] (E)-benzyl
9-(2-tert-butylhydrazono)-3-azaspiro[5.5]undec-7-ene-3-carboxylate
hydrochloride salt (8.00 g, 19.7 mmol) was dissolved in
dichloromethane (100 mL) and treated with sodium bicarbonate (1.70
g, 19.7 mmol). The solution was stirred for 30 minutes and was then
filtered and concentrated under reduced pressure to yield
(E)-benzyl
9-(2-tert-butylhydrazono)-3-azaspiro[5.5]undec-7-ene-3-carboxylate.
A 250 mL round bottom flask was charged with dimethylformamide (80
mL) and cooled to 0.degree. C. Phosphorous oxychloride (5.51 mL,
59.1 mmol) was added dropwise over 2 minutes, and the solution was
stirred for 30 minutes at 0.degree. C. To this solution was added
the (E)-benzyl
9-(2-tert-butylhydrazono)-3-azaspiro[5.5]undec-7-ene-3-carboxylate
in dimethylformamide (15 mL) and the reaction was heated at
80.degree. C. for 18 hours. The reaction was cooled to room
temperature and concentrated under reduced pressure. The resultant
oil was dissolved in ethyl acetate (500 mL) and washed with brine
(2.times.150 mL). The aqueous layer was extracted with an
additional 100 mL ethyl acetate. The combined organic layers were
dried over sodium sulfate, filtered and concentrated. The resultant
oil was purified by flash column chromatography (10-80% ethyl
acetate/heptane) to yield 4.89 g (65%) of the title compound as a
pale yellow oil. +ESI (M+H) 380.0; .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 7.25-7.36 (m, 5H), 7.18 (s, 1H), 6.57 (d,
J=10.0 Hz, 1H), 5.86 (d, J=10.0 Hz, 1H), 5.12 (s, 2H), 3.51-3.69
(m, 2H), 3.36-3.53 (m, 2H), 2.58 (s, 2H), 1.59-1.74 (m, 2H),
1.52-1.58 (m, 9H), 1.41-1.53 (m, 2H).
Step 4. benzyl
6-bromo-2-tert-butyl-7-methoxy-2,4,6,7-tetrahydrospiro[indazole-5,4'-pipe-
ridine]-1'-carboxylate
##STR00043##
[0141] Benzyl
2-tert-butyl-2,4-dihydrospiro[indazole-5,4'-piperidine]-1'-carboxylate
(560 mg, 1.48 mmol) was dissolved in a 20% methanol/tetrahydrofuran
mixture (25 mL). N-bromosuccinimide (315 mg, 1.77 mmol) was added
and the mixture was stirred for 30 minutes. The mixture was
concentrated under reduced pressure. The resultant oil was
partitioned between ethyl acetate (50 mL) and water (50 mL). The
organic phase was dried over sodium sulfate, filtered and
concentrated. The resultant oil was purified by flash column
chromatography (10-80% ethyl acetate/heptane) to yield 538 mg (73%)
of the title compound as a colorless oil. .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 7.27-7.43 (m, 6H), 5.12 (s, 2H), 4.74 (d,
J=2.7 Hz, 1H), 4.41 (d, J=2.5 Hz, 1H), 3.60-3.84 (m, 2H), 3.54-3.61
(m, 3H), 3.14-3.39 (m, 2H), 2.59 (s, 2H), 1.86 (br. s., 1H), 1.69
(br. s., 3H), 1.51-1.60 (m, 9H).
Step 5. benzyl
2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1'-c-
arboxylate
##STR00044##
[0143] Benzyl
6-bromo-2-tert-butyl-7-methoxy-2,4,6,7-tetrahydrospiro[indazole-5,4'-pipe-
ridine]-1'-carboxylate (150 mg, 0.31 mmol) was dissolved in 5 mL
tetrahydrofuran and treated with potassium tert-butoxide (0.61 mL,
0.61 mmol, 1 M tetrahydrofuran) and stirred for 30 minutes. Aqueous
2 N HCl (5 mL) was added and the mixture was stirred for 15 minutes
at room temperature. The mixture was then diluted with 50 mL water
and extracted with ethyl acetate (50 mL). The organic layer was
dried over sodium sulfate, filtered and concentrated. The residue
was purified by flash column chromatography (10-80% ethyl
acetate/heptanes) to yield 86 mg (71%) of the title compound as a
clear oil. +ESI (M+H) 396.5; .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 7.38 (s, 1H), 7.27-7.35 (m, 5H), 5.11 (s, 2H), 3.48 (t,
J=5.8 Hz, 4H), 2.71 (s, 2H), 2.57 (s, 2H), 1.57-1.66 (m, 9H),
1.47-1.59 (m, 4H).
Step 6.
2-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
hydrochloride salt
[0144] Benzyl
2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1'-c-
arboxylate (441 mg, 1.12 mmol) was dissolved in methanol (15 mL)
and treated with ammonium formate (217 mg, 3.34 mmol) and palladium
on carbon (50 mg, 10% Pd, 50% H.sub.2O). The reaction was stirred 2
hours at room temperature and the catalyst then removed by
filtration. The filtrate was concentrated under reduced pressure.
The resultant colorless solid was taken up in ethyl acetate (20 mL)
and treated with 0.5 M HCl in diethyl ether (1 mL). The mixture was
stirred for 30 minutes and concentrated under reduced pressure. The
resultant colorless solid was triturated with heptane (20 mL) to
yield 265 mg (80%) of the title compound as a colorless solid. +ESI
(M+H) 262.1; .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 7.74 (s,
1H), 3.20 (t, J=6.1 Hz, 4H), 2.88 (s, 2H), 2.64 (s, 2H), 1.67-1.91
(m, 4H), 1.55-1.63 (m, 9H).
Intermediate 3:
2-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piperidin]-7-
(2H)-one, shown below, was prepared as follows
##STR00045##
[0145] Step 1: di-tert-butyl
1-(bicyclo[1.1.1]pentan-1-yl)hydrazine-1,2-dicarboxylate
##STR00046##
[0147] Tris(2,2,6,6-tetramethyl-3,5-heptanedionato)manganese(III)
(281 mg, 0.460 mmol) was dissolved in 2-propanol (100 mL) in a 1 L
3-necked flask equipped with addition funnel, gas inlet, and
thermometer. The solution was cooled to -15.degree. C. under
nitrogen. Di-tert-butyl azodicarboxylate (8.11 g, 34.5 mmol) and
phenylsilane (2.9 mL, 23 mmol) were dissolved in dichloromethane
(100 mL) and this resulting orange solution was added to the above
cooled solution dropwise over 10 minutes, maintaining the internal
temperature at approximately -10.degree. C. A solution of
[1.1.1]propellane (Journal of the American Chemical Society (2001),
123(15), 3484-3492) (50 mL, 23 mmol, 0.46 M in pentane) was added
to the reaction mixture in one portion at -15.degree. C. The
reaction was stirred at -15.degree. C. for 30 minutes. The cold
bath was removed and the reaction was allowed to warm to room
temperature and stir for 4 hours. The reaction was concentrated and
purification by flash column chromatography (5-20% ethyl
acetate/heptanes) gave the title compound (6.38 g, 93%) as a clear
oil which solidified upon standing. -ESI (M-H) 297.4; .sup.1H NMR
(400 MHz, CDCl.sub.3, .delta.): 6.26 (br. s., 1H), 2.37 (s, 1H),
2.02 (s, 6H), 1.45 (s, 18H).
Step 2: bicyclo[1.1.1]pentan-1-ylhydrazine hydrochloride
##STR00047##
[0149] To a solution of di-tert-butyl
1-(bicyclo[1.1.1]pentan-1-yl)hydrazine-1,2-dicarboxylate (6.38 g,
21.4 mmol) in ethyl acetate (20 mL) was added 4 N hydrochloric acid
in 1,4-dioxane (53.5 mL, 214 mmol). The reaction was stirred at
room temperature for 18 hours. The reaction was concentrated and
the solid triturated with heptanes to yield the title compound
(3.24 g, 89%) as a white solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6,
.delta.): 2.42 (s, 1H), 1.80 (s, 6H).
Step 3: benzyl
2-(bicyclo[1.1.1]pentan-1-yl)-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-
-piperidine]-1'-carboxylate
##STR00048##
[0151] The title compound was prepared by a method analogous to
that described in Steps 1-5 of Intermediate 2, using
bicyclo[1.1.1]pentan-1-ylhydrazine hydrochloride in Step 2. +ESI
(M+H) 406.1; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.28-7.36
(m, 5H), 7.27 (s, 1H), 5.10 (s, 2H), 3.44-3.50 (m, 4H), 2.70 (s,
2H), 2.62 (s, 1H), 2.56 (s, 2H), 2.31 (s, 6H), 1.53 (d, J=2.5 Hz,
4H).
Step 4:
2-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piper-
idin]-7(2H)-one
[0152] To a solution of benzyl
2-(bicyclo[1.1.1]pentan-1-yl)-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-
-piperidine]-1'-carboxylate (150 mg, 0.37 mmol) in ethyl acetate
(10 mL) was added 10% palladium on carbon (1 mg) and
1-methylcyclohexane-1,4-diene (0.1 mL, 0.9 mmol). The reaction was
heated to 80.degree. C. and stirred for 2 hours. The reaction was
cooled to room temperature and filtered through Celite. The
filtrate was concentrated to give the title compound (100 mg, 100%)
as an oil. +ESI (M+H) 272.4; .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 7.26 (s, 1H), 2.82 (dd, J=6.63, 4.49 Hz, 4H), 2.69 (s,
2H), 2.60 (s, 1H), 2.56 (s, 2H), 2.30 (s, 6H), 1.47-1.55 (m,
4H).
Intermediate 4:
1-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one,
shown below, was prepared as follows
##STR00049##
[0153] Step 1. benzyl
10-((dimethylamino)methylene)-9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxyl-
ate
##STR00050##
[0155] Benzyl 9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate (15.2
g, 51 mmol) was dissolved in toluene (180 mL) and
tris(dimethylamino)methane (22.2 g, 27 mmol) was added. The
reaction was heated to reflux for 5 hours and then allowed to cool
to room temperature and stir overnight. The reaction solution was
concentrated in vacuo to provide the title compound (18.0 g, 100%).
+APCl (M+H) 354.6; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.49
(s, 1H), 7.28-7.40 (m, 5H), 6.59 (d, J=10.16 Hz, 1H), 6.01 (d,
J=9.97 Hz, 1H), 5.13 (s, 2H), 3.52-3.66 (m, 2H), 3.39-3.52 (m, 2H),
3.07 (s, 6H), 2.74 (s, 2H), 1.58-1.73 (m, 2H), 1.41-1.58 (m,
2H).
Step 2. benzyl
1-tert-butyl-1,4-dihydrospiro[indazole-5,4'-piperidine]-1'-carboxylate
##STR00051##
[0157] Benzyl
10-((dimethylamino)methylene)-9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxyl-
ate (59.2 g, 167 mmol) was dissolved in ethanol (835 mL). To the
solution was added acetic acid (20 mL, 345 mmol) and
tert-butylhydrazine hydrochloride (29.1 g, 234 mmol). The reaction
was heated to reflux for 1 hour. The reaction was cooled to room
temperature and concentrated to an orange oil. Purification by
flash column chromatography (20-40% ethyl acetate/heptanes)
afforded the title compound (50 g, 79%) as a pale yellow solid.
+ESI (M+H) 380.5; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.):
7.26-7.40 (m, 5H), 7.17 (s, 1H), 6.66 (d, J=9.95 Hz, 1H), 5.77 (d,
J=10.15 Hz, 1H), 5.12 (s, 2H), 3.38-3.64 (m, 4H), 2.58 (s, 2H),
1.60 (s, 12H), 1.50 (br. s., 1H).
Step 3. benzyl
6-bromo-1-tert-butyl-7-hydroxy-1,4,6,7-tetrahydrospiro[indazole-5,4'-pipe-
ridine]-1'-carboxylate
##STR00052##
[0159] Benzyl
1-tert-butyl-1,4-dihydrospiro[indazole-5,4'-piperidine]-1'-carboxylate
(50 g, 132 mmol) was dissolved in tetrahydrofuran (1 L). To the
reaction was added N-bromosuccinimide (24.6 g, 138 mmol) and water
(250 mL). The reaction was stirred for 1 hour at room temperature.
The reaction was partitioned between ethyl acetate and water. The
phases were separated and the organic phase was washed 2 times with
water and once with saturated aqueous sodium chloride. The organic
phase was dried over magnesium sulfate, filtered, and concentrated
in vacuo. The residue was crystallized from diethylether to afford
the title compound (60.7 g, 97%) as a cream-colored solid. +ESI
(M+H) 476.5; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.28-7.36
(m, 5H), 7.27 (s, 1H), 5.23 (t, J=4.68 Hz, 1H), 5.12 (s, 2H), 4.24
(d, J=4.49 Hz, 1H), 3.87 (br. s., 2H), 3.12 (br. s., 2H), 2.79 (d,
J=16.00 Hz, 2H), 2.59 (d, J=15.80 Hz, 2H), 1.95 (br. s., 1H), 1.66
(s, 11H), 1.58 (br. s., 1H).
Step 4. benzyl
6-bromo-1-tert-butyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidi-
ne]-1'-carboxylate
##STR00053##
[0161] Benzyl
6-bromo-1-tert-butyl-7-hydroxy-1,4,6,7-tetrahydrospiro[indazole-5,4'-pipe-
ridine]-1'-carboxylate (57.9 g, 122 mmol) was dissolved in acetone
(1 L) and cooled to 0.degree. C. in an ice bath. To the solution
was added Jones Reagent (122 mL) (Fillion, E. Tetrahedron Letters
2004, 46, 1091-1094). The ice bath was removed and the reaction was
allowed to warm to room temperature and stir for 45 minutes.
Saturated aqueous sodium bicarbonate was added until gas evolution
ceased and the pH reached 7. The resulting mixture was filtered
through a pad of Celite.RTM., rinsing with ethyl acetate. The
filtrate layers were separated and the aqueous layer was extracted
with ethyl acetate. The combined organic extracts were washed twice
with water, once with saturated aqueous sodium chloride, dried over
magnesium sulfate, filtered and concentrated. The residue was
crystallized from ethyl acetate/heptanes to afford the title
compound (50.4 g, 87%). +ESI (M+H) 474.5; .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 7.32 (d, J=9.38 Hz, 6H), 5.11 (s, 2H), 4.24
(5, 1H), 3.58-3.84 (m, 2H), 3.16-3.41 (m, 2H), 2.67-2.91 (m, 2H),
1.80 (br. s., 1H), 1.61-1.76 (m, 11H), 1.52-1.61 (m, 1H).
Step 5. benzyl
1-tert-butyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1'-c-
arboxylate
##STR00054##
[0163] To a solution of benzyl
6-bromo-1-tert-butyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidi-
ne]-1'-carboxylate (50.4 g, 106 mmol) in tetrahydrofuran (600 mL),
was added saturated aqueous ammonium chloride (600 mL) and zinc
powder (20.8 g, 319 mmol). The reaction was stirred for 30 minutes
at room temperature. The reaction was filtered through Celite.RTM..
The phases of the filtrate were separated and the organic phase was
washed with water and saturated aqueous sodium chloride. The
organics were dried over magnesium sulfate, filtered, and
concentrated to provide a foam. The foam was triturated once with
ethyl acetate/heptanes and once with diethylether to afford the
title compound (40.4 g, 96%) as a white solid. +ESI (M+H) 396.5;
.sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.24-7.38 (m, 6H), 5.11
(s, 2H), 3.36-3.61 (m, 4H), 2.74 (s, 2H), 2.54 (s, 2H), 1.64 (s,
9H), 1.51 (br. s., 4H).
Step 6.
1-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
[0164] A solution of benzyl
1-tert-butyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1.su-
p.1-carboxylate (46.6 g, 118 mmol) in ethanol (730 mL) was added to
10% palladium on carbon (9.4 g). To this mixture was added
1-methyl-1,4-cyclohexadiene (90 mL, 769 mmol). The reaction was
stirred at reflux for 2 hours. The reaction was cooled to room
temperature and filtered through Celite.RTM.. The filtrate was
concentrated in vacuo to give a gray solid. The solid was dissolved
in ethyl acetate (150 mL) and to this solution was added 4 M
hydrochloric acid in 1,4-dioxane (35 mL). The resulting precipitate
was collected by filtration and dried under vacuum to afford the
title compound (34 g, 97%) as a white solid. +ESI (M+H) 262.5;
.sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 7.34 (s, 1H) 3.12-3.25
(m, 4H) 2.90 (s, 2H) 2.66 (s, 2H) 1.67-1.85 (m, 4H) 1.62 (s,
9H).
Intermediate 5:
1-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piperidin]-7-
(1H)-one hydrochloride, shown below, was prepared as follows
##STR00055##
[0165] Step 1: benzyl
1-(bicyclo[1.1.1]pentan-1-yl)-1,4-dihydrospiro[indazole-5,4'-piperidine]--
1'-carboxylate
##STR00056##
[0167] To a solution of benzyl
9-oxo-3-azaspiro[5.5]undec-7-ene-3-carboxylate (543 mg, 1.81 mmol)
in toluene (15 mL) was added tris(dimethylamino)methane (0.47 mL,
2.7 mmol). The reaction was heated to reflux and stirred for 4
hours. The reaction was cooled to room temperature, diluted with
ethyl acetate (50 mL), and washed with water (50 mL). The organic
layer was dried over sodium sulfate, filtered, and concentrated.
The resulting yellow oil was taken up in toluene (15 mL) and
bicyclo[1.1.1]pentan-1-ylhydrazine hydrochloride (310 mg, 1.81
mmol) was added. The mixture was heated to reflux and stirred for
18 hours. The reaction was cooled to room temperature, diluted with
ethyl acetate (50 mL), washed with water (50 mL) and 1 M aqueous
citric acid (50 mL). The organic layer was dried over sodium
sulfate, filtered, and concentrated. Purification by flash column
chromatography gave 2 regioisomeric products.
[0168] benzyl
1-(bicyclo[1.1.1]pentan-1-yl)-1,4-dihydrospiro[indazole-5,4'-piperidine]--
1'-carboxylate (365 mg, 52%): +APCl (M+H) 390.5; .sup.1H NMR (400
MHz, CDCl.sub.3, .delta.): 7.33-7.36 (m, 5H), 7.22 (s, 1H), 6.51
(d, J=10.1 Hz, 1H), 5.81 (d, J=9.9 Hz, 1H), 5.12 (s, 2H), 3.42-3.59
(m, 4H), 2.59 (s, 3H), 2.35 (s, 6H), 1.43-1.68 (m, 4H).
[0169] benzyl
2-(bicyclo[1.1.1]pentan-1-yl)-2,4-dihydrospiro[indazole-5,4'-piperidine]--
1'-carboxylate (85 mg, 12%): +APCl (M+H) 390.5; .sup.1H NMR (400
MHz, CDCl.sub.3, .delta.): 7.33-7.36 (m, 5H), 7.08 (d, J=0.8 Hz,
1H), 6.56 (d, J=10.0 Hz, 1H), 5.91 (d, J=10.0 Hz, 1H), 5.12 (s,
2H), 3.40-3.62 (m, 4H), 2.57 (s, 3H), 2.26 (s, 6H), 1.41-1.68 (m,
4H).
Step 2: benzyl
1-(bicyclo[1.1.1]pentan-1-yl)-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-
-piperidine]-1'-carboxylate
##STR00057##
[0171] To a solution of benzyl
1-(bicyclo[1.1.1]pentan-1-yl)-1,4-dihydrospiro[indazole-5,4'-piperidine]--
1'-carboxylate (340 mg, 0.87 mmol) in 3:1 tetrahydrofuran: water
(10 mL) was added N-bromosuccinimide (155 mg, 0.87 mmol). The
reaction was stirred at room temperature for 45 minutes. The
reaction was diluted with ethyl acetate (50 mL), washed with 0.5 N
aqueous sodium hydroxide (25 mL) and saturated aqueous sodium
thiosulfate (25 mL). The organic layer was dried over sodium
sulfate, filtered, and concentrated. The resulting oil was taken up
in dichloromethane (5 mL) and treated with activated 4 A molecular
sieves (500 mg) and tetrapropylammonium perruthenate (16 mg, 0.04
mmol). The slurry was treated with N-methylmorpholine-N-oxide (243
mg, 1.75 mmol) in acetonitrile (5 mL). The reaction was stirred at
room temperature for 2 hours. The reaction was filtered through
Celite and the filtrate was concentrated. The residue was purified
by flash column chromatography (7-60% ethyl acetate/heptanes) to
yield a clear oil. The oil was taken up in tetrahydrofuran (5 mL)
and treated with saturated aqueous ammonium chloride (5 mL) and
zinc dust (171 mg, 2.62 mmol). The mixture was stirred at room
temperature for 30 minutes. The reaction was diluted with water (50
mL) and extracted with ethyl acetate (2.times.30 mL). The combined
organics were washed with brine, dried over sodium sulfate,
filtered, and concentrated. Purification by flash column
chromatography (7-60% ethyl acetate/heptanes) gave the title
compound (148 mg, 42%) as a white solid. .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 7.34 (m, 6H), 5.13 (s, 2H), 3.51 (m, 4H),
2.75 (s, 2H), 2.59 (s, 1H), 2.54 (s, 2H), 2.41 (s, 6H), 1.56 (m,
4H).
Step 3:
1-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piper-
idin]-7(1H)-one hydrochloride
[0172] The title compound was prepared by a method analogous to
that described in Step 6 of Intermediate 4.
Intermediate 6: 3-carbamoyl-1H-indazole-6-carboxylic acid, shown
below, was prepared as follows
##STR00058##
[0173] Step 1. methyl 1H-indazole-6-carboxylate
##STR00059##
[0175] To a solution of 1H-indazole-6-carboxylic acid (3.00 g, 18.5
mmol) in N,N-dimethylformamide (46 mL) was added sodium carbonate
(2.06 g, 19.4 mmol), followed by iodomethane (2.75 g, 1.21 mL, 19.4
mmol) dropwise. The mixture was stirred at room temperature
overnight. The mixture was poured into half saturated sodium
bicarbonate and extracted with ethyl acetate three times. The
combined organic layers were washed with brine, dried over sodium
sulfate, filtered and concentrated in vacuo to afford a brown oil.
This residue was purified by flash column chromatography (12-100%
ethyl acetate/heptanes) to afford methyl 1H-indazole-6-carboxylate
as a yellow solid (2.95 g, 90%). .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 10.40 (br. s., 1H), 8.26 (s, 1H), 8.13 (s, 1H), 7.84 (d,
J=8.4 Hz, 1H), 7.79 (d, J=8.4 Hz, 1H), 3.96 (s, 3H).
Step 2. methyl 3-iodo-1H-indazole-6-carboxylate
##STR00060##
[0177] To a solution of methyl 1H-indazole-6-carboxylate (865 mg,
4.91 mmol) in N,N-dimethylformamide (12 mL) was added potassium
hydroxide (840 mg, 3.05 mmol) followed by iodine (1.54 g, 5.9
mmol). The mixture was stirred at room temperature for 3 hours.
Sodium bisulfate (30 mL of 5% aqueous) was added and the mixture
was extracted with ethyl acetate twice. The combined organic layers
were washed with brine, dried over sodium sulfate, filtered and
concentrated in vacuo. The residue was purified via flash column
chromatography (5-65% ethyl acetate/heptanes) to afford methyl
3-iodo-1H-indazole-6-carboxylate as a colorless solid (1.16 g,
78%). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 13.84 (s, 1H),
8.13 (s, 1H), 7.72 (d, J=8.4 Hz, 1H), 7.54 (d, J=8.6 Hz, 1H), 3.87
(s, 3H).
Step 3. methyl 3-cyano-1H-indazole-6-carboxylate
##STR00061##
[0179] A mixture of methyl 3-iodo-1H-indazole-6-carboxylate (3.0 g,
9.9 mmol), zinc dust (400 mg, 6.11 mmol), zinc cyanide (2.0 g, 17.0
mmol),
[1,1'-bis(diphenylphosphino)ferrocene]-dichloropalladium(II),
complex with dichloromethane (1.15 g, 1.41 mmol), and copper (I)
iodide (1.90 g, 9.97 mmol) in dimethylacetamide (55 mL) was purged
with nitrogen for 15 minutes. The mixture was stirred at
120.degree. C. for 15 hours. The reaction mixture was cooled,
diluted with ethyl acetate (250 mL), and filtered through Celite,
rinsing with ethyl acetate (100 mL). To the filtrate was added
.about.400 mL of a solution of saturated aqueous ammonium chloride
and concentrated ammonium hydroxide (prepared by adding ammonium
hydroxide to a saturated aqueous solution of ammonium chloride
until pH=8). The mixture was stirred for 1 hour. The layers were
then separated. The organic layer was washed with water and brine,
dried over sodium sulfate, filtered and concentrated in vacuo. To
the residue was added methanol (40 mL) and the mixture was stirred
overnight. The mixture was filtered and the solid was dried in
vacuo to give methyl 3-cyano-1H-indazole-6-carboxylate as a tan
solid (1.47 g, 73%). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.):
13.40 (br. s., 1H), 8.25 (s, 1H), 7.94 (d, J=8.6 Hz, 1H), 7.83 (d,
J=8.4 Hz, 1H), 3.88 (s, 3H).
Step 4. 3-carbamoyl-1H-indazole-6-carboxylic acid
[0180] To a solution of methyl 3-cyano-1H-indazole-6-carboxylate
(254 mg, 1.26 mmol) in methanol (12 mL) at 0.degree. C. was added a
cold solution of urea hydrogen peroxide (1.22 g, 12.6 mmol) in
sodium hydroxide (12.6 mL 1M in water, 12.6 mmol). The yellow
solution was stirred at room temperature overnight. The mixture was
concentrated in vacuo to remove methanol. The pH of the resulting
residue was adjusted to .about.4 with 1N hydrochloric acid. A
precipitate formed. The mixture was filtered and the solid was
dried to afford 3-carbamoyl-1H-indazole-6-carboxylic acid as a
brown solid (82 mg, 32%). 1H NMR (400 MHz, DMSO-d.sub.6, .delta.):
13.84 (s, 1H), 13.04 (br. s., 1H), 8.20 (d, J=8.4 Hz, 1H),
8.13-8.16 (m, 1H), 7.77 (br. s., 1H), 7.74 (dd, J=8.6, 1.4 Hz, 1H),
7.38 (br. s., 1H).
Intermediate 7: 3-carbamoyl-1H-indole-6-carboxylic acid, shown
below, was prepared as follows
##STR00062##
[0181] Step 1. 3-cyano-1H-indole-6-carboxylic acid ethyl ester
##STR00063##
[0183] To a solution of 6-bromo-1H-indole-3-carbonitrile (328 mg,
1.48 mmol) in ethanol (5 mL) in a 500 mL Parr bottle was added
sodium acetate (370 mg, 4.47 mmol) and
[1,1'-bis(diphenylphosphino)ferrocene]dichloropalladium(II),
complex with dichloromethane (242 mg, 0.297 mmol). The reaction
vessel was purged with nitrogen and evacuated three times and then
was filled with 30 psi carbon monoxide. The reaction mixture was
heated to 70.degree. C., increasing the pressure within the vessel
to 45 psi. The reaction was agitated at 70.degree. C. for 24 hours.
The reaction mixture was cooled to room temperature. The mixture
was filtered through Celite, rinsing with ethanol. The filtrate was
concentrated under reduced pressure and diluted with
dichloromethane. The remaining solids were filtered off and the
filtrate was concentrated. The residue was purified by flash column
chromatography (20-80% ethyl acetate/heptanes) to give
3-cyano-1H-indole-6-carboxylic acid ethyl ester (142 mg, 45%).
-APCl (M-H) 213.4; .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.):
12.50 (br. s., 1H), 8.45 (s, 1H), 8.16 (s, 1H), 7.82 (dd, J=8.4,
1.4 Hz, 1H), 7.73 (d, J=8.4 Hz, 1H), 4.32 (q, J=7.0 Hz, 2H), 1.33
(t, J=7.0 Hz, 3H).
Step 2. 3-carbamoyl-1H-indole-6-carboxylic acid
[0184] A suspension of 3-cyano-1H-indole-6-carboxylic acid ethyl
ester (100 mg, 1.4 mmol) in methanol (1.12 mL) was added to a
solution of urea hydrogen peroxide (453 mg, 4.67 mmol) in 2.5 M
sodium hydroxide (1.12 mL, 2.80 mmol) at 0.degree. C. The
suspension was allowed to warm to room temperature and was stirred
overnight. The reaction was concentrated under reduced pressure.
Water was added and the solution was acidified with 3 N aqueous
hydrochloric acid to pH=2. A precipitate formed. The reaction
mixture was stirred for 1 minute at room temperature and was then
filtered to give an orange solid. Additional urea hydrogen peroxide
(453 mg) in 2.5 M sodium hydroxide and methanol was added and the
mixture was stirred for 2 hours. The reaction was concentrated,
diluted with water, acidified to pH=3 and filtered. The solid was
washed with water and heptanes and was dried in a vacuum oven to
give 3-carbamoyl-1H-indole-6-carboxylic acid as a solid (66.5 mg,
70%). -ESI (M-1) 203.1; .sup.1H NMR (400 MHz, DMSO-d.sub.6,
.delta.): 12.45 (br. s., 1H), 11.78 (br. s., 1H), 8.83 (d, J=1.6
Hz, 1H), 8.09 (d, J=2.9 Hz, 1H), 7.73 (dd, J=8.6, 1.8 Hz, 1H), 7.51
(br. s., 1H), 7.45 (d, J=8.4 Hz, 1H), 6.89 (br. s., 1H).
Intermediate 8: 3-carbamoyl-1H-indazole-5-carboxylic acid, shown
below, was prepared as follows
##STR00064##
[0185] Step 1. methyl 3-cyano-1H-indazole-5-carboxylate
##STR00065##
[0187] Methyl 3-iodo-1H-indazole-5-carboxylate (30.7 g, 102 mmol),
zinc cyanide (20.3 g, 173 mmol), zinc dust (4.05 g, 61.9 mmol),
[1,1'-bis(diphenylphosphino)ferrocene]-dichloropalladium(II),
complex with dichloromethane (12 g, 15 mmol), and copper (I) iodide
(19.7 g, 103 mmol) were combined in a 1 L round bottom flask.
N,N-dimethylacetamide (500 mL) was added and the reaction mixture
was purged with nitrogen for 10 minutes. The reaction was heated to
120.degree. C. for 1 hour. The reaction was cooled to room
temperature and was diluted with ethyl acetate (1 L), and allowed
to stir for 20 minutes. The reaction mixture was filtered through a
plug of Celite, rinsing with 500 mL ethyl acetate. The filtrate was
added to a solution of saturated ammonium chloride and concentrated
ammonium hydroxide (2 L) (prepared by adding ammonium hydroxide to
a saturated aqueous solution of ammonium chloride until pH=8) and
the biphasic solution was stirred vigorously for 1 hour. The
resulting emulsion was filtered through a small pad of Celite. The
layers were separated and the aqueous was extracted two additional
times with ethyl acetate (1.1 L), each time filtering the resulting
emulsion through Celite. The combined organic layers were washed
with water (2.times.900 mL) and brine (900 mL), dried over sodium
sulfate, filtered and concentrated. To the crude was added methanol
(100 mL) and the mixture was stirred for 20 minutes. The resulting
precipitate was filtered off and washed with methanol (10 mL). The
filtrate was concentrated to give the title compound (13.2 g, 65%)
as a solid. -ESI (M-H) 200.0; .sup.1H NMR (400 MHz, DMSO-d.sub.6,
.delta.): 8.43-8.45 (m, 1H), 8.05 (dd, J=8.8, 1.6 Hz, 1H), 7.85
(dd, J=8.9, 0.9 Hz, 1H), 3.88 (s, 3H).
Step 2. 3-carbamoyl-1H-indazole-5-carboxylic acid
[0188] A suspension of methyl 3-cyano-1H-indazole-5-carboxylate
(50.0 g, 249 mmol) in methanol (1 L) was cooled to 10.degree. C. A
solution of urea hydrogen peroxide (241 g, 2.49 mol) in sodium
hydroxide (1 L of 2.5 N) and water (100 mL) was added dropwise,
maintaining an internal temperature below 25.degree. C. When the
addition was complete, the ice bath was removed and the reaction
was allowed to stir at room temperature for 16 hours. A small
amount of unreacted starting material was observed by HPLC. The
reaction was cooled to 15.degree. C. and additional urea hydrogen
peroxide (50 g) was added portionwise. Vigorous bubbling was noted.
The reaction was allowed to stir for another 2 hours. The crude
reaction was filtered to remove the solids present and the filtrate
was concentrated to remove the methanol. The remaining solution was
cooled in an ice bath and 6 N hydrochloric acid (420 mL) was added
dropwise to adjust the pH to 4. The solution was stirred for 20
minutes and the resulting tan solid was collected by filtration and
dried to give 57.2 g of crude product. To the crude was added
acetonitrile (700 mL) and dichloromethane (700 mL) and the mixture
was stirred at room temperature for 1 hour. The solid was collected
by filtration, washed with 1:1 acetonitrile: dichloromethane (400
mL) and dried to give the title compound (39.5 g, 77%) as a tan
solid. +ESI (M+H) 206.1; .sup.1H NMR (DMSO-d.sub.6, .delta.): 13.81
(s, 1H), 12.85 (br. s., 1H), 8.82 (d, J=0.8 Hz, 1H), 7.93 (dd,
J=8.8, 1.6 Hz, 1H), 7.79-7.85 (m, 1H), 7.64 (d, J=8.6 Hz, 1H), 7.44
(s, 1H).
Intermediate 9: 3-carbamoyl-1H-pyrrolo[3,2-b]pyridine-6-carboxylic
acid, shown below, was prepared as follows
##STR00066##
[0189] Step 1. benzyl 1H-pyrrolo[3,2-b]pyridine-6-carboxylate
##STR00067##
[0191] To a solution of 1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid
(1.37 g, 8.45 mmol) in N,N-dimethylformamide (55 mL) was added
cesium carbonate (2.79 g, 8.56 mmol) and benzyl bromide (1.05 mL,
8.64 mmol). The reaction was allowed to stir at room temperature
for 17 hours. Additional cesium carbonate (500 mg, 1.54 mmol) and
benzyl bromide (0.186 mL, 1.53 mmol) were added, and the reaction
was stirred for another 4 hours. The reaction was then quenched
with water and diluted with ethyl acetate. The layers were
separated and the aqueous was extracted with ethyl acetate three
times. The combined organics were washed with water and brine,
dried over sodium sulfate, filtered, and concentrated. Purification
by flash column chromatography (0-100% ethyl acetate/heptanes) gave
the title compound (1.42 g, 67%). +ESI (M+H) 253.3; .sup.1H NMR
(400 MHz, DMSO-d.sub.6, .delta.): 11.68 (br. s., 1H), 8.93 (d,
J=2.0 Hz, 1H), 8.33 (dd, J=2.0, 1.0 Hz, 1H), 7.93 (t, J=3.0 Hz,
1H), 7.51 (m, 2H), 7.41 (m, 3H), 6.68 (ddd, J=3.1, 2.0, 1.0 Hz,
1H), 5.40 (s, 2H).
Step 2. benzyl 3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylate
##STR00068##
[0193] To a 0.degree. C. solution of benzyl
1H-pyrrolo[3,2-b]pyridine-6-carboxylate (830 mg, 3.29 mmol) in
N,N-dimethylformamide (19 mL) was added N-bromosuccinimide (609 mg,
3.42 mmol). The reaction was allowed to gradually warm to room
temperature and stir over the weekend. The reaction was diluted
with ethyl acetate and washed successively with saturated aqueous
sodium thiosulfate, saturated aqueous sodium bicarbonate, water,
and brine. The organics were dried over sodium sulfate, filtered,
and concentrated to give the title compound (1.08 g, quantitative).
+ESI (M+1+H) 333.0; .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.):
12.06 (br. s., 1H), 8.99 (d, J=1.8 Hz, 1H), 8.37 (d, J=2.0 Hz, 1H),
8.14 (d, J=2.9 Hz, 1H), 7.52 (m, 2H), 7.41 (m, 3H), 5.41 (s,
2H).
Step 3. 3-carbamoyl-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid
[0194] The title compound was prepared by a method analogous to
that described in Steps 3-4 for Intermediate 6, using benzyl
3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylate. +ESI (M+H) 206.2;
.sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.76 (br. s., 1H),
8.92 (d, J=1.6 Hz, 1H), 8.54-8.64 (m, 2H), 8.17 (br. s., 1H), 7.51
(br. s., 1H).
Intermediate 10: 3-carbamoyl-1H-pyrrolo[2,3-b]pyridine-5-carboxylic
acid, shown below, was prepared as follows
##STR00069##
[0195] Step 1. methyl
3-iodo-1H-pyrrolo[2,3-b]pyridine-5-carboxylate
##STR00070##
[0197] To a solution of methyl
1H-pyrrolo[2,3-b]pyridine-5-carboxylate (2.97 g, 14.0 mmol) in
N,N-dimethylformamide (30 mL) was added potassium carbonate (5.79
g, 41.9 mmol). Iodine (3.90 g, 15.4 mmol) in N,N-dimethylformamide
(5.0 mL) was then added dropwise and the reaction was allowed to
stir at room temperature for 2 hours. Water (150 mL) was then added
to the reaction mixture, resulting in the formation of a
precipitate. A solution of sodium bisulfite (5.79 g, 41.9 mmol) in
water (50 mL) was slowly added, and the mixture was allowed to stir
for 1 hour. The resulting solid was filtered and dried under vacuum
to give the title compound (3.07 g, 73%). +ESI (M+H) 303.0; .sup.1H
NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.53 (br. s., 1H), 8.79 (d,
J=2.0 Hz, 1H), 8.15 (d, J=2.0 Hz, 1H), 7.86 (s, 1H), 3.88 (s,
3H).
Step 2. 1-tert-butyl 5-methyl
3-iodo-1H-pyrrolo[2,3-b]pyridine-1,5-dicarboxylate
##STR00071##
[0199] To a mixture of methyl
3-iodo-1H-pyrrolo[2,3-b]pyridine-5-carboxylate (700 mg, 2.32 mmol)
in dichloromethane (10 mL) and tetrahydrofuran (10 mL) was added
N,N-diisopropylethylamine (1.21 mL, 6.95 mmol),
di-tert-butyldicarbonate (607 mg, 2.78 mmol), and
4-dimethylaminopyridine (28 mg, 23 mmol). The reaction was allowed
to stir at room temperature for 16 hours. The reaction was
concentrated and purification by flash column chromatography (0-50%
ethyl acetate/heptanes) gave the title compound (760 mg, 82%) as a
solid. +APCl (M+H) 403.3; .sup.1H NMR (400 MHz, DMSO-d.sub.6,
.delta.): 8.93 (d, J=2.0 Hz, 1H), 8.16 (d, J=2.0 Hz, 1H), 8.14 (s,
1H), 3.91 (s, 3H), 1.59 (s, 9H).
Step 3. 3-carbamoyl-1H-pyrrolo[2,3-b]pyridine-5-carboxylic acid
[0200] The title compound was prepared by a method analogous to
that described in Steps 3-4 for Intermediate 6, using 1-tert-butyl
5-methyl 3-iodo-1H-pyrrolo[2,3-b]pyridine-1,5-dicarboxylate. -APCl
(M-H) 204.4.
Intermediate 11: 2-carbamoyl-1H-indole-5-carboxylic acid, shown
below, was prepared as follows
##STR00072##
[0201] Step 1. methyl 2-carbamoyl-1H-indole-5-carboxylate
##STR00073##
[0203] To a solution of 5-(methoxycarbonyl)-1H-indole-2-carboxylic
acid (2.50 g, 11.4 mmol) in tetrahydrofuran (20 mL) was added
1,1-carbonyldiimidazole (3.70 g, 22.8 mmol). The yellow suspension
was stirred for 2 hours. Then concentrated ammonium hydroxide (20
mL) was added and the mixture was stirred at room temperature for 5
hours. The pale green suspension was filtered, washed with water
and 5 mL of methanol, and air dried to give methyl
2-carbamoyl-1H-indole-5-carboxylate (2.04 g, 82%) as a colorless
solid. .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 11.93 (br. s.,
1H), 8.32 (d, J=1.2 Hz, 1H), 8.06 (br. s., 1H), 7.79 (dd, J=8.6,
1.6 Hz, 1H), 7.48 (d, J=8.6 Hz, 1H), 7.45 (br. s., 1H), 7.27 (s,
1H), 3.32 (s, 3H).
Step 2. 2-carbamoyl-1H-indole-5-carboxylic acid
[0204] To a suspension of methyl
2-carbamoyl-1H-indole-5-carboxylate (300 mg, 1.38 mmol) in
tetrahydrofuran (4.5 mL) and ethylene glycol (4.5 mL) was added
potassium hydroxide (3.16 g, 56.4 mmol). The mixture was heated to
reflux and stirred for 2 hours. The reaction was cooled to room
temperature and diluted with water. The tetrahydrofuran was removed
under reduced pressure. The solids were filtered off and the
filtrate was acidified to pH 4 with concentrated hydrochloric acid.
The resulting precipitate was collected by filtration and dried
under vacuum to give 2-carbamoyl-1H-indole-5-carboxylic acid (230
mg, 82%). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.53 (br.
s., 1H), 11.88 (br. s., 1H), 8.28 (s, 1H), 8.04 (br. s., 1H), 7.77
(d, J=8.6 Hz, 1H), 7.46 (m, J=8.6 Hz, 2H), 7.25 (s, 1H).
Intermediate 12: 3-carbamoyl-1H-indole-5-carboxylic acid, shown
below, was prepared as follows
##STR00074##
[0205] Step 1. ethyl 3-cyano-1H-indole-5-carboxylate
##STR00075##
[0207] To a solution of 5-bromo-1H-indole-3-carbonitrile (2.61 g,
11.8 mmol) in ethanol (50 mL) in a 500 mL Parr bottle was added
sodium acetate (2.90 g, 35.6 mmol) and
1,1'-bis(diphenylphosphino)ferrocene-palladium (II) dichloride
dichloromethane complex (1.93 g, 2.36 mmol). The reaction mixture
was evacuated and back filled with nitrogen three times. The
reaction vessel was then pressurized with 25 psi carbon monoxide.
The reaction was heated to 70.degree. C. and when the desired
temperature was reached the pressure of the vessel was increased to
40 psi. The reaction was agitated at 70.degree. C. for 24 hours.
The mixture was filtered through Celite, rinsing with ethanol. The
filtrate was concentrated under reduced pressure and then diluted
with dichloromethane. The mixture was filtered to remove the
insoluble solids. The filtrate was concentrated and purified by
flash column chromatography (20-80% ethyl acetate/heptanes). The
resulting solid was triturated with dichloromethane and a small
amount of heptanes to give ethyl 3-cyano-1H-indole-5-carboxylate
(1.05 g, 41%).sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.54
(br. s., 1H), 8.41 (d, J=2.7 Hz, 1H), 8.25 (d, J=1.6 Hz, 1H), 7.89
(dd, J=8.6, 1.6 Hz, 1H), 7.66 (dd, J=8.6, 0.6 Hz, 1H), 4.34 (q,
J=7.0 Hz, 2H), 1.35 (t, J=7.1 Hz, 3H).
Step 2. 3-carbamoyl-1H-indole-5-carboxylic acid
[0208] A solution of ethyl 3-cyano-1H-indole-5-carboxylate (1.05 g,
4.89 mmol) in methanol (12 mL) was added to a 0.degree. C. solution
of urea hydrogen peroxide (4.74 g, 48.9 mmol) and sodium hydroxide
(11.7 mL of a 2.5 M solution in water, 29.3 mmol). The mixture was
allowed to warm to room temperature and stir overnight. An
additional 2 mL of a 2.5 M solution of sodium hydroxide was added
and the reaction was left stirring 4 hours. The mixture was
concentrated and acidified to pH 2 using 6 M hydrochloric acid. The
resulting precipitate was filtered off and dried under vacuum at
60.degree. C. to give the title compound (915 mg, 92%). .sup.1H NMR
(400 MHz, DMSO-d.sub.6, .delta.): 12.46 (br. s., 1H), 11.84 (s,
1H), 8.85 (s, 1H), 8.12 (d, J=2.5 Hz, 1H), 7.75 (dd, J=8.6, 1.6 Hz,
1H), 7.50-7.63 (m, 1H), 7.47 (d, J=8.6 Hz, 1H), 6.88 (br. s.,
1H).
Intermediate 13: 2-carbamoyl-1H-indole-6-carboxylic acid, shown
below, was prepared as follows
##STR00076##
[0209] Step 1. ethyl 2-carbamoyl-1H-indole-6-carboxylate
##STR00077##
[0211] The title compound was prepared by a method analogous to
that described in Step 1 for Intermediate 12, using
6-bromo-1H-indole-2-carboxamide. +ESI (M+H) 233.2; .sup.1H NMR
(DMSO-d.sub.6, .delta.): 11.92 (s, 1H), 8.07 (s, 2H), 7.65-7.71 (m,
1H), 7.57-7.63 (m, 1H), 7.49 (br. s., 1H), 7.17 (dd, J=2.1, 1.0 Hz,
1H), 4.30 (q, J=7.1 Hz, 2H), 1.31 (t, J=7.1 Hz, 3H).
Step 2. 2-carbamoyl-1H-indole-6-carboxylic acid
[0212] To a solution of ethyl 2-carbamoyl-1H-indole-6-carboxylate
(3.3 g, 14 mmol) in methanol (50 mL) was added 1 N aqueous sodium
hydroxide (71 mL, 71 mmol). The reaction was stirred at room
temperature for 17 hours. Then the reaction was acidified to pH 2-3
using 6 N aqueous hydrochloric acid. The resulting precipitate was
collected by filtration and dried under vacuum to afford the title
compound (2.97 g, 100%). -APCl (M-H) 203.4.
Intermediate 14: 2-amino-1H-benzo[d]imidazole-5-carboxylic acid,
shown below, was prepared as follows
##STR00078##
[0214] A solution of cyanogen bromide (5.0 mL, 5 M in acetonitrile,
25 mmol) was added to a mixture of methyl 3,4-diaminobenzoate (3.0
g, 18 mmol) in water (50 mL). The reaction was stirred at room
temperature overnight. Aqueous ammonia (20 mL) and ethyl acetate
(100 mL) were added to the reaction mixture and the layers were
separated. The organics were dried over sodium sulfate, filtered,
and concentrated. To the crude residue was added 2 N aqueous
hydrochloric acid (18 mL, 36.0 mmol) and the mixture was heated at
reflux overnight. The reaction was concentrated to give the title
compound (2.90 g, 97%). .sup.1H NMR (400 MHz, DMSO-d.sub.6,
.delta.): 8.75 (s, 2H), 7.84 (s, 1H), 7.77 (dd, J=1.2 Hz, J=8.4 Hz,
1H), 7.38 (d, J=8.4 Hz, 1H).
Intermediate 15: 3-(methylcarbamoyl)-1H-indazole-5-carboxylic acid,
shown below, was prepared as follows
##STR00079##
[0215] Step 1. 5-bromo-N-methyl-1H-indazole-3-carboxamide
##STR00080##
[0217] To a solution of 5-bromo-1H-indazole-3-carboxylic acid (1.2
g, 5.0 mmol) in N,N-dimethylformamide (20 mL) was added methyl
amine (5 mL, 2 M in tetrahydrofuran, 10 mmol), 1,
(3-dimethylaminopropyl)-3-ethyl carbodiimide hydrochloride (1.4 g,
7.5 mmol), 1-hydroxybenzotriazole hydrate (1.2 g, 7.5 mmol), and
N-methylmorpholine (1.0 g, 10 mmol). The reaction was stirred at
room temperature overnight. The reaction was concentrated and
purification by flash column chromatography gave the title compound
(0.71 g, 56%) as a colorless solid. .sup.1H NMR (400 MHz,
DMSO-d.sub.6, .delta.): 13.8 (br. s., 1H), 8.41 (m, 1H), 8.31 (5,
1H), 7.60 (d, J=8.8 Hz, 1H), 7.51-7.54 (m, 1H), 2.80 (d, J=4.8 Hz,
3H).
Step 2. methyl 3-(methylcarbamoyl)-1H-indazole-5-carboxylate
##STR00081##
[0219] To a solution of 5-bromo-N-methyl-1H-indazole-3-carboxamide
(710 mg, 2.8 mmol) in anhydrous methanol (20 mL) was added
1,1'-bis(diphenylphosphino)ferrocene-palladium (II) dichloride
dichloromethane complex (400 mg, 0.56 mmol) and N-methylmorpholine
(565 mg, 5.60 mmol). The reaction vessel was evacuated and back
filled with nitrogen three times. The vessel was then filled with
30 psi carbon monoxide. The reaction mixture was heated to
70.degree. C., increasing the pressure within the vessel to 45 psi.
The reaction was agitated at 70.degree. C. for 24 hours. The
reaction mixture was cooled to room temperature and was filtered
through Celite, rinsing with methanol. The filtrate was
concentrated and purification by flash column chromatography gave
the title compound (410 mg, 61%) as a brown solid. .sup.1H NMR (400
MHz, DMSO-d6, .delta.): 13.9 (s, 1H), 8.88 (s, 1H), 8.49 (d, J=4.8,
1H), 7.95-7.98 (m, 1H), 7.68-7.70 (m, 1H), 3.88 (s, 3H), 2.82 (d,
J=4.8 Hz, 3H).
Step 3. 3-(methylcarbamoyl)-1H-indazole-5-carboxylic acid
[0220] To a solution of methyl
3-(methylcarbamoyl)-1H-indazole-5-carboxylate (400 mg, 1.7 mmol) in
methanol (10 mL) and water (10 mL), was added lithium hydroxide
monohydrate (0.36 g, 8.5 mmol). The reaction was heated to
60.degree. C. and was stirred overnight. The methanol was removed
under reduced pressure and the remaining residue was acidified to
pH=4 with 1 N aqueous hydrochloric acid. The resulting precipitate
was collected by filtration and dried under vacuum to give the
title compound (350 mg, 94%) as a yellow solid. .sup.1H NMR (400
MHz, DMSO-d.sub.6, .delta.): 13.99 (s, 1H), 8.85 (s, 1H), 8.47-8.48
(m, 1H), 7.94-7.96 (m, 1H), 7.65-7.68 (m, 1H), 2.82 (d, J=4.4 Hz,
3H).
Intermediate 16: 3-(ethylcarbamoyl)-1H-indazole-5-carboxylic acid,
shown below, was prepared as follows
##STR00082##
[0221] Step 1. 5-bromo-N-ethyl-1H-indazole-3-carboxamide
##STR00083##
[0223] To a solution of 5-bromo-1H-indazole-3-carboxylic acid (1.2
g, 5.0 mmol) in dichloromethane (20 mL) was added oxalyl chloride
(1.26 g, 10 mmol) and 1 drop of N,N-dimethylformamide. The mixture
was stirred at room temperature under a nitrogen atmosphere
overnight. The reaction was concentrated and the residue was
dissolved in dichloromethane (20 mL). Ethylamine (1.1 g, 25 mmol)
was added dropwise. The reaction was allowed to stir at room
temperature for 4 hours. The reaction mixture was concentrated to
provide the title compound (1.27 g). +ESI (M+H+1) 270.9.
Step 2. ethyl 3-(ethylcarbamoyl)-1H-indazole-5-carboxylate
##STR00084##
[0225] To a solution of 5-bromo-N-ethyl-1H-indazole-3-carboxamide
(1.1 g, 4.1 mmol) in ethanol (50 mL), was added triethylamine (1.24
g, 12.3 mmol) and 1,1'-bis(diphenylphosphino)ferrocene-palladium
(II) dichloride dichloromethane complex (300 mg, 0.41 mmol). The
reaction vessel was evacuated and back filled with nitrogen three
times. The vessel was filled with 50 psi carbon monoxide, heated to
80.degree. C., and was agitated for 24 hours. The reaction was
cooled to room temperature and filtered on Celite. The filtrate was
concentrated to a brown residue. The residue was diluted with ethyl
acetate (100 mL) and was washed successively with 1 N hydrochloric
acid, saturated aqueous sodium bicarbonate, and brine. The organics
were dried over sodium sulfate, filtered, and concentrated to give
the title compound (0.88 g, 82%) as a brown solid. .sup.1H NMR (400
MHz, DMSO-d.sub.6, .delta.): 13.87 (s, 1H), 8.88 (s, 1H), 8.54-8.57
(m, 1H), 7.96-7.98 (m, 1H), 7.68-7.70 (m, 1H), 4.32-4.37 (m, 2H),
3.33-3.37 (m, 2H), 1.35 (t, 3H), 1.22 (t, 3H).
Step 3. 3-(ethylcarbamoyl)-1H-indazole-5-carboxylic acid
[0226] The title compound was prepared by a method analagous to
that described in Step 3 of Intermediate 15. .sup.1H NMR (400 MHz,
DMSO-d.sub.6, .delta.): 13.83 (s, 1H), 12.91 (br. s., 1H), 8.86 (s,
1H), 8.51-8.54 (m, 1H), 7.95-7.97 (m, 1H), 7.65-7.68 (m, 1H),
3.30-3.36 (m, 2H), 1.12-1.16 (t, 3H).
Intermediate 17:
3-(2,2,2-trifluoroethylcarbamoyl)-1H-indazole-5-carboxylic acid,
shown below, was prepared as follows
##STR00085##
[0228] The title compound was prepared by a method analogous to
that described for Intermediate 16, using 2,2,2-trifluroethylamine
in Step 1. .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 14.04 (s,
1H), 13.0 (br. s., 1H), 9.12-9.15 (m, 1H), 8.83 (s, 1H), 7.97-7.99
(m, 1H), 7.69-7.72 (m, 1H), 4.04-4.13 (m, 2H).
Intermediate 18: 2-(methylamino)-1H-benzo[d]imidazole-5-carboxylic
acid, shown below, was prepared as follows
##STR00086##
[0229] Step 1. methyl
2-(methylamino)-1H-benzo[d]imidazole-5-carboxylate
##STR00087##
[0231] A mixture of 3,4-diaminobenzoic acid (15 g, 0.09 mol) and
isothiocyanatomethane (6.6 g, 0.09 mol) was dissolved in
tetrahydrofuran (90 mL). The reaction was heated at reflux for 3
hours and was then concentrated. The residue was poured into ice
water. The resulting precipitate was filtered, washed with water,
and dried under vacuum to give methyl
4-amino-3-(3-methylthioureido)benzoate (12.0 g, 56%).
[0232] To the solid (12 g, 0.05 mol) was added ethanol (200 mL),
followed by methyl iodide (35.5 g, 0.25 mol). The reaction was
heated to reflux and stirred overnight. The reaction was
concentrated and the residue was basified with ammonium hydroxide.
The solids were collected by filtration and washed with water.
Purification by column chromatography (9-25% ethyl
acetate/petroleum ether) gave the title compound (2.9 g, 28%) as a
yellow solid. .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 8.37 (s,
1H), 7.92-7.96 (m, 1H), 7.51 (d, J=8.4 Hz, 1H), 3.93 (s, 3H), 2.81
(s, 3H).
Step 2. 2-(methylamino)-1H-benzo[d]imidazole-5-carboxylic acid
[0233] 3 N Aqueous hydrochloric acid (14 mL, 42 mmol) was added to
methyl 2-(methylamino)-1H-benzo[d]imidazole-5-carboxylate (2.9 g,
14 mmol) and the reaction was stirred at reflux overnight. The
reaction was concentrated to give the title compound (2.4 g, 90%)
as a yellow solid. .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.):
7.96-8.00 (m, 2H), 7.40 (d, J=8.4 Hz, 1H), 3.10 (s, 3H).
Intermediate 19: 3-cyano-1H-indazole-6-carboxylic acid, shown
below, was prepared as follows
##STR00088##
[0234] Step 1: methyl 1H-indazole-6-carboxylate
##STR00089##
[0236] To a solution of 1H-indazole-6-carboxylic acid (3.00 g, 18.5
mmol) in N,N-dimethylformamide (46 mL) was added sodium carbonate
(2.06 g, 19.4 mmol), followed by iodomethane (2.75 g, 1.21 mL, 19.4
mmol) dropwise. The mixture was stirred at room temperature
overnight. The mixture was poured into half saturated sodium
bicarbonate and extracted with ethyl acetate three times. The
combined organic layers were washed with brine, dried over sodium
sulfate, filtered and concentrated in vacuo to afford a brown oil.
This residue was purified by flash column chromatography (12-100%
ethyl acetate/heptanes) to afford methyl 1H-indazole-6-carboxylate
as a yellow solid (2.95 g, 90%). .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 10.40 (br. s., 1H), 8.26 (s, 1H), 8.13 (s, 1H), 7.84 (d,
J=8.4 Hz, 1H), 7.79 (d, J=8.4 Hz, 1H), 3.96 (s, 3H).
Step 2: methyl 3-iodo-1H-indazole-6-carboxylate
##STR00090##
[0238] To a solution of methyl 1H-indazole-6-carboxylate (865 mg,
4.91 mmol) in N,N-dimethylformamide (12 mL) was added potassium
hydroxide (840 mg, 3.05 mmol) followed by iodine (1.54 g, 5.9
mmol). The mixture was stirred at room temperature for 3 hours.
Sodium bisulfate (30 mL of 5% aqueous) was added and the mixture
was extracted with ethyl acetate twice. The combined organic layers
were washed with brine, dried over sodium sulfate, filtered and
concentrated in vacuo. The residue was purified via flash column
chromatography (5-65% ethyl acetate/heptanes) to afford methyl
3-iodo-1H-indazole-6-carboxylate as a colorless solid (1.16 g,
78%). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 13.84 (s, 1H),
8.13 (s, 1H), 7.72 (d, J=8.4 Hz, 1H), 7.54 (d, J=8.6 Hz, 1H), 3.87
(s, 3H).
Step 3: methyl 3-cyano-1H-indazole-6-carboxylate
##STR00091##
[0240] A mixture of methyl 3-iodo-1H-indazole-6-carboxylate (3.0 g,
9.9 mmol), zinc dust (400 mg, 6.11 mmol), zinc cyanide (2.0 g, 17.0
mmol),
[1,1'-bis(diphenylphosphino)ferrocene]-dichloropalladium(II),
complex with dichloromethane (1.15 g, 1.41 mmol), and copper (I)
iodide (1.90 g, 9.97 mmol) in dimethylacetamide (55 mL) was purged
with nitrogen for 15 minutes. The mixture was stirred at
120.degree. C. for 15 hours. The reaction mixture was cooled,
diluted with ethyl acetate (250 mL), and filtered through Celite,
rinsing with ethyl acetate (100 mL). To the filtrate was added
.about.400 mL of a solution of saturated aqueous ammonium chloride
and concentrated ammonium hydroxide (prepared by adding ammonium
hydroxide to a saturated aqueous solution of ammonium chloride
until pH=8). The mixture was stirred for 1 hour. The layers were
then separated. The organic layer was washed with water and brine,
dried over sodium sulfate, filtered and concentrated in vacuo. To
the residue was added methanol (40 mL) and the mixture was stirred
overnight. The mixture was filtered and the solid was dried in
vacuo to give methyl 3-cyano-1H-indazole-6-carboxylate as a tan
solid (1.47 g, 73%). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.):
13.40 (br. s., 1H), 8.25 (s, 1H), 7.94 (d, J=8.6 Hz, 1H), 7.83 (d,
J=8.4 Hz, 1H), 3.88 (s, 3H).
Step 4: 3-cyano-1H-indazole-6-carboxylic acid
[0241] To a solution of methyl 3-cyano-1H-indazole-6-carboxylate
(1.47 g, 7.31 mmol) in methanol (36 mL) and tetrahydrofuran (20 mL)
was added 2 N aqueous lithium hydroxide (16 mL, 32 mmol). The
reaction was heated to 50.degree. C. for 72 hours. The reaction was
cooled to room temperature and concentrated. The residue was
diluted with water and the pH was adjusted to 4 with 1 N aqueous
hydrochloric acid. The resulting precipitate was filtered off,
rinsed with water, and dried under vacuum to provide the title
compound (500 mg, 37%) as a tan solid. +ESI (M+H) 188.2.
Intermediate 20: 3-chloro-1H-pyrrolo[3,2-b]pyridine-6-carboxylic
acid, shown below, was prepared as follows
##STR00092##
[0242] Step 1: methyl
3-chloro-1H-pyrrolo[3,2-b]pyridine-6-carboxylate
##STR00093##
[0244] To a 0.degree. C. solution of methyl
1H-pyrrolo[3,2-b]pyridine-6-carboxylate (1.00 g, 5.68 mmol) in
N,N-dimethylformamide (15 mL) was added N-chlorosuccinimide (895
mg, 5.96 mmol). The reaction was allowed to gradually warm to room
temperature and stir overnight. The reaction was diluted with water
(125 mL) and stirred for 20 minutes. The resulting solid was
collected by filtration, washed with water, and dried under vacuum
to give the title compound (1.11 g, 93%) as an orange powder. +ESI
(M+H) 211.0; .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 11.99
(br. s., 1H), 8.92 (d, J=2.0 Hz, 1H), 8.31 (d, J=1.8 Hz, 1H), 8.08
(d, J=3.1 Hz, 1H), 3.88 (s, 3H).
Step 2: 3-chloro-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid
[0245] Methyl 3-chloro-1H-pyrrolo[3,2-b]pyridine-6-carboxylate
(1.10 g, 5.22 mmol) was suspended in 1,4-dioxane (25 mL) and 6 N
aqueous hydrochloric acid (8.7 mL) was added. The reaction was
allowed to stir at room temperature overnight. The reaction was
then concentrated to give the title compound (1.2 g, 100%). +ESI
(M+H) 197.1; .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.50
(br. s., 1H), 8.92 (d, J=1.6 Hz, 1H), 8.46 (br. s., 1H), 8.19 (br.
s., 1H).
Intermediate 21: 3-cyano-1H-indazole-5-carboxylic acid, shown
below, was prepared as follows
##STR00094##
[0247] Methyl 3-cyano-1H-indazole-5-carboxylate (500 mg, 2.5 mmol)
was dissolved in methanol (12 mL) and 2 N aqueous lithium hydroxide
(3.7 mL, 7 mmol) was added. The reaction was stirred at room
temperature overnight. The reaction mixture was concentrated to
remove the methanol and the residue was acidified to pH=4 with 1 N
aqueous hydrochloric acid. The resulting yellow precipitate was
collected by filtration, washed with water, and dried in a vacuum
oven to provide the title compound (445 mg, 96%). -ESI (M-H) 186.4;
.sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 13.17 (br. s., 1H),
8.42 (s, 1H), 8.05 (dd, J=8.8, 1.6 Hz, 1H), 7.83 (d, 1H).
Intermediate 22:
6-(2-tert-butoxy-2-oxoethoxy)quinoline-3-carboxylic acid, shown
below, was prepared as follows
##STR00095##
[0248] Step 1: 2-chloro-6-hydroxyquinoline-3-carbaldehyde
##STR00096##
[0250] To a -78.degree. C. mixture of
2-chloro-6-methoxyquinoline-3-carbaldehyde (4.64 g, 20.9 mmol) in
dichloromethane (130 mL) was added boron tribromide (4.0 mL, 42
mmol). The mixture was allowed to warm to room temperature and stir
for 4 hours. The reaction was neutralized by the careful addition
of saturated aqueous sodium bicarbonate. The mixture was then
extracted with 2-methyl tetrahydrofuran (3.times.). The combined
organics were filtered, and the filtrate was washed with saturated
aqueous sodium bicarbonate (3.times.) and once with brine. The
organics were dried over sodium sulfate, filtered, and concentrated
to a yellow solid. The solid was partially dissolved in 2-methyl
tetrahydrofuran and filtered. The filtrate was concentrated to a
solid and again partially dissolved in 2-methyl tetrahydrofuran,
filtered, and concentrated. Purification by flash column
chromatography (10-100% ethyl acetate/heptanes) gave the title
compound (2.65 g, 61%) as a pale yellow solid. +ESI (M+H) 208.1;
.sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 10.54 (s, 1H), 8.59 (s,
1H), 7.98 (d, J=9.17 Hz, 1H), 7.47 (dd, J=9.17, 2.73 Hz, 1H), 7.25
(d, J=2.93 Hz, 1H), 5.57 (br. s., 1H).
Step 2: tert-butyl 2-(2-chloro-3-formylquinolin-6-yloxy)acetate
##STR00097##
[0252] To a solution of 2-chloro-6-hydroxyquinoline-3-carbaldehyde
(2.35 g, 11.3 mmol) in N,N-dimethylformamide (15 mL) was added
tert-butyl 2-bromoacetate (2.0 mL, 13.6 mmol) and potassium
carbonate (3.13 g, 22.6 mmol). The reaction was stirred at room
temperature for 1.5 hours. The reaction was diluted with water (100
mL) and allowed to stir for 1 hour. The resulting solid was
collected by filtration, washed with water, and dried under vacuum
to give the title compound (3.62 g, 99%) as an off-white solid.
+ESI (M+H) 322.1; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 10.54
(s, 1H), 8.60 (s, 1H), 7.99 (d, J=9.36 Hz, 1H), 7.59 (dd, J=9.17,
2.93 Hz, 1H), 7.11 (d, J=2.73 Hz, 1H), 4.65 (s, 2H), 1.49 (s,
9H).
Step 3:
6-(2-tert-butoxy-2-oxoethoxy)-2-chloroquinoline-3-carboxylic
acid
##STR00098##
[0254] To a suspension of tert-butyl
2-(2-chloro-3-formylquinolin-6-yloxy)acetate (3.6 g, 11 mmol) in
tert-butanol (150 mL) was added 2-methyl-2-butene (14.9 mL, 133
mmol) and a solution of sodium chlorite (8.27 g, 73.1 mmol) and
sodium dihydrogenphosphate (8.10 g, 58.7 mmol) in water (50 mL).
The reaction was allowed to stir at room temperature for 1 hour.
The tert-butanol was removed in vacuo. The mixture was diluted with
water (60 mL) and acidified to pH=4 with 1 N aqueous hydrochloric
acid. The resulting precipitate was filtered, washed with water,
and dried under vacuum to give the title compound (3.7 g, 100%) as
a white solid. +ESI (M+H) 338.1; .sup.1H NMR (400 MHz, CD.sub.3OD,
.delta.): 8.69 (s, 1H), 7.89 (d, J=9.19 Hz, 1H), 7.56 (dd, J=9.19,
2.74 Hz, 1H), 7.34 (d, J=2.93 Hz, 1H), 4.76 (s, 2H), 1.49 (s,
9H).
Step 4: 6-(2-tert-butoxy-2-oxoethoxy)quinoline-3-carboxylic
acid
[0255] Methanol (100 mL) and triethylamine (4.5 mL, 33 mmol) were
added to
6-(2-tert-butoxy-2-oxoethoxy)-2-chloroquinoline-3-carboxylic acid
(1.27 g, 3.76 mmol). 10% Palladium on carbon (350 mg) was added and
the reaction was pressurized to 17 psi hydrogen. The reaction was
agitated at room temperature for 3 hours. The reaction mixture was
diluted with methanol and filtered through Celite. The filtrate was
concentrated to a yellow solid. The solid was diluted with water
and the mixture was acidified to pH=4 with 1 N aqueous hydrochloric
acid. The solid was collected by filtration, washed with water, and
dried under vacuum to give the title compound (960 mg, 84%) as a
pale yellow solid. +ESI (M+H) 304.2; .sup.1H NMR (400 MHz,
CD.sub.3OD, .delta.): 9.19 (d, J=2.15 Hz, 1H), 8.87 (d, J=2.15 Hz,
1H), 8.01 (d, J=9.36 Hz, 1H), 7.59 (dd, J=9.27, 2.83 Hz, 1H), 7.38
(d, J=2.73 Hz, 1H), 4.78 (s, 2H), 1.49 (s, 9H).
Intermediate 23: 6-carbamoylquinoline-3-carboxylic acid, shown
below, was prepared as follows
##STR00099##
[0256] Step 1: ethyl 6-bromoquinoline-3-carboxylate
##STR00100##
[0258] To a solution of 5-bromo-2-nitrobenzaldehyde (2 g, 9 mmol)
in ethanol (46 mL) was added tin(II) chloride dihydrate (7.95 g,
35.2 mmol) and 3,3-diethoxypropionic acid ethyl ester (4.2 mL, 22
mmol). The reaction was heated to 90.degree. C. for 16 hours. The
reaction was then allowed to cool to room temperature and stir
overnight. The reaction mixture was concentrated and the residue
was dissolved in ethyl acetate. The mixture was poured into
saturated aqueous sodium bicarbonate. The resulting emulsion was
filtered through Celite, rinsing with ethyl acetate. The layers
were separated and the aqueous was extracted with ethyl acetate.
The combined organics were washed with brine, dried over magnesium
sulfate, filtered, and concentrated. Purification by flash column
chromatography (0-50% ethyl acetate/heptanes) gave the title
compound (1.41 g, 60%) as a solid.
Step 2: 6-carbamoylquinoline-3-carboxylic acid
[0259] The title compound was prepared by a method analogous to
that described in Steps 3-4 of Intermediate 6, using ethyl
6-bromoquinoline-3-carboxylate. +ESI (M+H) 217.0; .sup.1H NMR (400
MHz, DMSO-d.sub.6, .delta.): 13.58 (br. s., 1H), 9.34 (d, J=2.1 Hz,
1H), 8.97 (d, J=2.1 Hz, 1H), 8.67 (d, J=2.0 Hz, 1H), 8.25-8.31 (m,
1H), 8.20 (br. s., 1H), 8.09-8.14 (m, 1H), 7.61 (br. s., 1H).
Intermediate 24: 7-bromo-6-methoxyquinoline-3-carboxylic acid,
shown below, was prepared as follows
##STR00101##
[0260] Step 1: 1-bromo-2-methoxy-4-methyl-5-nitrobenzene
##STR00102##
[0262] To a solution of 4-methoxy-2-methyl-1-nitrobenzene (2.0 g,
12 mmol) in N,N-dimethylformamide (5 mL) was added
N-bromosuccinimide (8.52 g, 47.9 mmol). The reaction was heated to
100.degree. C. for 1.5 hours. The reaction was cooled to room
temperature and diluted with saturated aqueous sodium thiosulfate.
The mixture was extracted with ethyl acetate (3.times.). The
combined organics were washed with water, saturated sodium
thiosulfate, and brine, dried over sodium sulfate, filtered, and
concentrated. The residue was purified via flash column
chromatography (0-30% ethyl acetate/heptanes) to provide the title
compound (2.6 g, .about.43% pure) as a pale yellow solid. .sup.1H
NMR (400 MHz, CDCl.sub.3, .delta.): 8.32 (s, 1H), 6.74 (s, 1H),
3.97 (s, 3H), 2.63 (s, 3H).
Step 2: 4-bromo-5-methoxy-2-nitrobenzaldehyde
##STR00103##
[0264] The crude 1-bromo-2-methoxy-4-methyl-5-nitrobenzene (2.6 g,
11 mmol) was dissolved in N,N-dimethylformamide (15 mL) and N,
N-dimethylformamide dimethylacetal (5 mL, 38 mmol) was added. The
reaction was heated to 120.degree. C. for 18 hours. The reaction
was cooled to room temperature and the mixture was added directly
to a 0.degree. C. suspension of sodium periodate (12.2 g, 57.2
mmol) in water (20 mL) and N,N-dimethylformamide (5 mL). The
reaction was stirred at 0.degree. C. for 2 hours, then allowed to
warm to room temperature and stir for another 6 hours. The reaction
mixture was filtered, rinsing with ethyl acetate, toluene, and
water. The filtrate was extracted with ethyl acetate (3.times.).
The combined organics were washed with water and brine, dried over
sodium sulfate, filtered, and concentrated. Purification by flash
column chromatography (0-50% ethyl acetate/heptanes) gave the title
compound (550 mg, 19%) as a pale yellow solid. .sup.1H NMR (400
MHz, CDCl.sub.3, .delta.): 10.47 (s, 1H), 8.41 (s, 1H), 7.35 (s,
1H), 4.05 (s, 3H).
Step 3: ethyl 7-bromo-6-methoxyquinoline-3-carboxylate
##STR00104##
[0266] To a suspension of 4-bromo-5-methoxy-2-nitrobenzaldehyde
(475 mg, 1.83 mmol) in ethanol (15 mL) was added tin(II) chloride
dihydrate (1.65 g, 7.31 mmol) and ethyl 3,3-diethoxypropionate (1.0
mL, 5.1 mmol). The reaction was heated to 90.degree. C. for 3
hours. LCMS showed the reaction to be incomplete. Additional
tin(II) chloride dihydrate (600 mg, 2.7 mmol) and ethyl
3,3-diethoxypropionate (0.35 mL, 1.8 mmol) were added and the
reaction was left heating overnight. LCMS showed the reaction to be
incomplete. Tin(II) chloride dihydrate (200 mg, 0.89 mmol) and
ethyl 3,3-diethoxypropionate (0.10 mL, 0.51 mmol) were added and
the reaction was heated at 90.degree. C. for another 3 hours. The
reaction was concentrated and the residue partitioned between ethyl
acetate and saturated aqueous sodium bicarbonate. The aqueous layer
was filtered and extracted again with ethyl acetate. The combined
organics were washed with brine, dried over sodium sulfate,
filtered, and concentrated. The residue was purified via flash
column chromatography (0-100% ethyl acetate/heptanes) to give a
yellow solid (410 mg) which contained desired product and
impurities. This material was taken up in tetrahydrofuran (5 mL)
and ethyl 3,3-diethoxypropionate (0.17 mL, 0.87 mmol) and
p-toluenesulfonic acid monohydrate (12.0 mg, 0.63 mmol) were added.
The mixture was heated to 75.degree. C. and stirred for 3 hours.
The reaction was concentrated and the residue partitioned between
ethyl acetate and saturated aqueous sodium bicarbonate. The layers
were separated and the aqueous was extracted with ethyl acetate
(2.times.). The combined organics were washed with brine, dried
over sodium sulfate, filtered, and concentrated. Purification by
flash column chromatography (0-25% ethyl acetate/heptanes) gave the
title compound (256 mg, 45%) as a yellow solid. +ESI (M+H+1)
313.3.
Step 4: 7-bromo-6-methoxyquinoline-3-carboxylic acid
[0267] To a solution of ethyl
7-bromo-6-methoxyquinoline-3-carboxylate (250 mg, 0.80 mmol) in
tetrahydrofuran (5 mL) was added 1 N aqueous lithium hydroxide (1.6
mL, 1.6 mmol). The reaction was stirred at room temperature
overnight. The reaction was concentrated and the residue was taken
up in water and 1 N aqueous lithium hydroxide (0.4 mL). The
solution was extracted twice with ethyl acetate. The aqueous layer
was then acidified to pH=4 with 1 N aqueous hydrochloric acid. The
resulting precipitate was filtered, washed with water, and dried
under vacuum to give the title compound (165 mg, 73%) as an
off-white solid. +ESI (M+H+1) 284.1; .sup.1H NMR (400 MHz,
CD.sub.3OD, .delta.): 9.19 (d, J=2.15 Hz, 1H), 8.89 (d, J=1.76 Hz,
1H), 8.30 (s, 1H), 7.53 (s, 1H), 4.04 (s, 3H).
Intermediate 25: 2-(tert-butylamino)quinoline-7-carboxylic acid,
shown below, was prepared as follows
##STR00105##
[0268] Step 1: 7-(ethoxycarbonyl)quinoline 1-oxide
##STR00106##
[0270] To a solution of ethyl quinoline-7-carboxylate (1.02 g, 5.05
mmol) in dichloromethane (20 mL) was added peracetic acid (2.13 mL,
10.1 mmol, 32 wt % in acetic acid). The reaction was stirred at
room temperature overnight. The reaction was partitioned between
water and dichloromethane. The layers were separated and the
aqueous was extracted with dichloromethane (4.times.). The combined
organics were washed with water and brine, dried over sodium
sulfate, filtered, and concentrated. The solid was concentrated
from heptanes and ethyl acetate several times, then dried under
vacuum to give the title compound (1.01 g, 92%) as a yellow solid.
+ESI (M+H) 218.2; .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 9.40
(s, 1H), 8.65 (d, J=6.05 Hz, 1H), 8.27 (dd, J=8.58, 1.56 Hz, 1H),
7.95 (d, J=8.39 Hz, 1H), 7.82 (d, J=8.58 Hz, 1H), 7.42 (dd, J=8.49,
6.15 Hz, 1H), 4.47 (q, J=7.02 Hz, 2H), 1.45 (t, J=7.1 Hz, 3H).
Step 2: 2-(tert-butylamino)quinoline-7-carboxylic acid
[0271] To a 0.degree. C. solution of 7-(ethoxycarbonyl)quinoline
1-oxide (500 mg, 2.3 mmol) and tert-butylamine (1.46 mL, 13.8 mmol)
in trifluoromethylbenzene (25 mL) was added p-toluenesulfonic
anhydride (1.96 g, 5.76 mmol) portion-wise, maintaining the
internal reaction temperature below 5.degree. C. The reaction was
stirred for 1 hour. Saturated aqueous sodium bicarbonate was added
and the reaction mixture was allowed to stir for 15 minutes. The
phases were then separated and the aqueous was extracted with
dichloromethane (2.times.). The combined organics were washed with
brine, dried over magnesium sulfate, filtered, and concentrated.
Purification by flash column chromatography gave 499 mg of a clear
oil that solidified upon standing. This material was taken up in
tetrahydrofuran (5 mL) and 1 N aqueous lithium hydroxide (3.6 mL,
3.6 mmol) was added. The reaction was stirred at room temperature
overnight. The reaction was concentrated and the residue was
diluted with water and acidified to pH=4 with 1 N aqueous
hydrochloric acid. The resulting precipitate was filtered off and
dried under vacuum to give the title compound (330 mg, 75%) as a
pale yellow powder. -ESI (M-H) 243.1; .sup.1H NMR (400 MHz,
DMSO-d.sub.6, .delta.): 12.86 (br. s., 1H), 8.02 (d, J=1.56 Hz,
1H), 7.81 (d, J=9.03 Hz, 1H), 7.57-7.65 (m, 2H), 6.83 (d, J=8.97
Hz, 1H), 6.81 (br. s., 1H), 1.46 (s, 9H).
Intermediate 26: 2-(methylamino)quinoline-7-carboxylic acid, shown
below, was prepared as follows
##STR00107##
[0272] Step 1: ethyl 2-(methylamino)quinoline-7-carboxylate
##STR00108##
[0274] To a -70.degree. C. solution of 7-(ethoxycarbonyl)quinoline
1-oxide (1.67 g, 7.70 mmol) in dichloromethane (80 mL) was added
trifluoromethanesulfonic anhydride (1.43 mL, 8.47 mmol) dropwise,
under a nitrogen atmosphere. The mixture was stirred at -70.degree.
C. for 5 minutes. Then a solution of methylamine in tetrahydrofuran
(21 mL, 42 mmol, 2.0 M) was added dropwise at -70.degree. C. The
mixture was stirred for 5 minutes and then the reaction was
quenched with water (20 mL). The layers were separated and the
aqueous was extracted with dichloromethane (3.times.30 mL). The
combined organics were washed with brine, dried over sodium
sulfate, filtered, and concentrated. Purification by flash column
chromatography gave the title compound (720 mg, 41%) as a yellow
solid. .sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 8.42 (s, 1H),
7.84-7.82 (m, 2H), 7.63-7.61 (m, 1H), 6.72-6.70 (m, 1H), 4.92 (br.
s., 1H), 4.44-4.38 (m, 2H), 3.12-3.11 (m, 3H), 1.44-1.40 (m,
3H).
Step 2: 2-(methylamino)quinoline-7-carboxylic acid
[0275] The title compound was prepared by a method analogous to
that described in Step 2 of Intermediate 13, using ethyl
2-(methylamino)quinoline-7-carboxylate. .sup.1H NMR (400 MHz, DMSO,
.delta.): 8.08 (s, 1H), 7.91-7.89 (m, 1H), 7.71-7.62 (m, 2H), 7.21
(s, 1H), 6.85-6.83 (m, 1H), 2.91-2.90 (m, 3H).
Example 1
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl) carbonyl]-1H-indole-3-carboxamide
##STR00109##
[0277] A mixture of 3-carbamoyl-1H-indole-6-carboxylic acid (25 mg,
0.12 mmol),
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one (38
mg, 0.13 mmol), (1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyl
uronium hexafluorophosphate (46 mg, 0.12 mmol), and
diisopropyethylamine (85 .mu.L, 0.49 mmol) in 0.5 mL of
dimethylformamide was stirred at room temperature overnight. The
reaction was diluted with ethyl acetate and washed with 0.1 N
hydrochloric acid. The organic layer was dried over magnesium
sulfate, filtered, and concentrated in vacuo. The residue was
purified by reversed-phase HPLC to yield the title compound (14.6
mg, 28%). Analytical LCMS: +ESI (M+H) 434.1; retention time 2.24
minutes (Waters Atlantis C.sub.18 4.6.times.50 mm, 5 .mu.M column;
95% water/acetonitrile linear gradient to 5% water/acetonitrile
over 4.0 minutes, hold at 5% water/acetonitrile to 5.0 minutes;
0.05% trifluoroacetic acid modifier; flow rate 2.0 mL/minute)
(Method A).
Example 2
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl) carbonyl]-1H-indazole-3-carboxamide
##STR00110##
[0279] To a suspension of
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
(16.8 g, 53.6 mmol) and 3-carbamoyl-1H-indazole-5-carboxylic acid
(10.0 g, 48.7 mmol) in N,N-dimethylformamide (120 mL) was added
triethylamine (40 mL, 290 mmol). The mixture was stirred at room
temperature for 5 minutes and was then cooled to 5.degree. C.
1-Propanephosphonic acid cyclic anhydride (60 mL, 100 mmol, 50 wt %
solution in ethyl acetate) was added dropwise over 20 minutes,
maintaining and internal temperature between 5-10.degree. C. The
reaction was allowed to stir overnight, gradually warming to room
temperature. The reaction mixture was slowly poured into 700 mL of
water at 5.degree. C. The resulting precipitate was filtered off
and dried. To the filtrate was added 10% methanol/ethyl acetate (1
L) and the resulting precipitate was filtered off and dried. The
solids collected were combined (8.9 g) and were dissolved in
N,N-dimethylformamide (34 mL) at 130.degree. C. The solution was
cooled to 100.degree. C. and methanol (65 mL) was added. The
solution was allowed to slowly cool to room temperature. The
resulting precipitate was collected by filtration and dried to give
the title compound (6.0 g, 28%). +ESI (M+H) 435.1; .sup.1H NMR (400
MHz, DMSO-d.sub.6, .delta.): 13.65 (s, 1H), 8.15 (s, 1H), 7.75 (s,
1H), 7.60 (d, J=8.6 Hz, 1H), 7.29-7.47 (m, 3H), 5.24 (m, 1H),
3.32-3.79 (m, 4H), 2.78 (s, 2H), 2.59 (s, 2H), 1.47 (br. s., 4H),
1.32 (d, J=6.7 Hz, 6H).
Example 3
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl) carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide
##STR00111##
[0281] To a solution of 1, (3-dimethylaminopropyl)-3-ethyl
carbodiimide hydrochloride (252 mg, 1.31 mmol) and
1-hydroxybenzotriazole hydrate (199 mg, 1.30 mmol) in
dichloromethane (5 mL) was added
3-carbamoyl-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid (212 mg,
1.04 mmol). The mixture was stirred at room temperature for 40
minutes.
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
(312 mg, 1.26 mmol) and triethylamine (0.434 mL, 3.11 mmol) were
then added and the reaction was allowed to stir at room temperature
for 16 hours. The reaction was diluted with saturated aqueous
ammonium chloride and extracted twice with dichloromethane. The
combined organic layers were washed successively with saturated
sodium bicarbonate, water, and brine. The organics were dried over
sodium sulfate, filtered, and concentrated. Purification via flash
column chromatography (0-100% of a 20% methanol/dichloromethane
solution) afforded the title compound (254 mg, 57%). +ESI (M+H)
435.5; .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 8.57 (d, J=1.8
Hz, 1H), 8.26 (s, 1H), 7.98 (d, J=1.0 Hz, 1H), 7.43 (s, 1H), 5.38
(m, 1H), 3.63 (m, 4H), 2.90 (s, 2H), 2.66 (s, 2H), 1.66 (m, 4H),
1.42 (d, J=6.6 Hz, 6H).
[0282] The compounds listed in Table 1 below were prepared using
procedures analogous to those described above for the synthesis of
the compounds of Examples 1-3 using the appropriate starting
materials which are available commercially, prepared using
preparations well-known to those skilled in the art, or prepared by
a route described above. The compounds listed below were isolated
initially as the free base and may be converted to a
pharmaceutically acceptable salt for testing.
TABLE-US-00001 TABLE 1 ##STR00112## Example --R.sup.2 Analytical
Data 4 ##STR00113## +ESI (M + H) 435.3; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 13.64 (s, 1 H), 8.15 (d, J = 8.2 Hz, 1 H), 7.73
(d, J = 0.8 Hz, 1 H), 7.56 (s, 1 H), 7.43 (s, 1 H), 7.33-7.38 (m, 1
H), 7.18 (dd, J = 8.3, 0.9 Hz, 1 H), 5.17-5.32 (m, 1 H), 3.50-3.80
(m, 2 H), 3.22-3.38 (m, 2 H), 2.78 (br. s., 2 H), 2.59 (s, 2 H),
1.40-1.61 (m, 4 H), 1.32 (d, J = 6.3 Hz, 6 H). 5 ##STR00114## +ESI
(M + H) 435.1; retention time 2.1 minutes. (Method A) 6
##STR00115## +ESI (M + H) 434.2; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 11.67-11.72 (m, 1 H), 7.98 (br. s., 1 H), 7.65
(s, 1 H), 7.45 (s, 1 H), 7.42 (d, J = 8.4 Hz, 1 H), 7.38 (br. s., 1
H), 7.21 (d, J = 0.4 Hz, 1 H), 7.15 (d, J = 2.5 Hz, 1 H), 5.26 (dt,
J = 13.3, 6.6 Hz, 1 H), 3.38- 3.54 (m, 4 H), 2.80 (s, 2 H), 2.61
(s, 2 H), 1.45-1.54 (m, 4 H), 1.35 (d, J = 6.4 Hz, 6 H). 7
##STR00116## +ESI (M + H) 434.2; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 11.68 (br. s., 1 H), 8.20 (s, 1 H), 8.08 (s, 1
H), 7.41-7.47 (m, 3 H), 7.17 (dd, J = 8.3, 1.5 Hz, 1 H), 6.81 (br.
s., 1 H), 5.21-5.32 (m, 1 H), 3.42-3.71 (m, 4 H), 2.81 (s, 2 H),
2.62 (s, 2 H), 1.44-1.56 (m, 4 H), 1.36 (d, J = 6.6 Hz, 6 H). 8
##STR00117## .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 8.50 (br.
s., 1 H), 7.44 (s, 1 H), 7.37 (d, J = 9.2 Hz, 2 H), 7.26 (d, J = 8
Hz, 1 H), 5.37-5.44 (m, 1 H), 3.40- 4.00 (m, 4 H), 2.91 (s, 2 H),
2.66 (s, 2 H), 1.50- 1.80 (m, 4 H), 1.44 (d, J = 6.8 Hz, 6 H). 9
##STR00118## .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 13.65
(s, 1 H), 8.35 (m, 1 H), 8.13 (s, 1 H), 7.57 (d, J = 8.4 Hz, 1 H),
7.39 (s, 1 H), 7.35-7.37 (m, 1 H), 5.15-5.30 (m, 1 H), 3.3-3.8 (m,
4 H), 2.75 (m, 5 H), 2.56 (s, 2 H), 1.35-1.60 (m, 4 H), 1.29 (d, J
= 6.8 Hz, 6 H). 10 ##STR00119## .sup.1H NMR (400 MHz, CD.sub.3OD,
.delta.): 8.43 (m, 1 H), 8.31 (s, 1 H), 7.65 (d, J = 8.8 Hz, 1 H),
7.47 (d, J = 8.8 Hz, 1 H), 7.43 (s, 1 H), 5.37-5.40 (m, 1 H),
3.65-4.00 (m, 2 H), 3.44-3.52 (m, 4 H), 2.90 (s, 2 H), 2.66 (s, 2
H), 1.50-1.80 (m, 4 H), 1.42 (d, J = 6.4 Hz, 6 H), 1.26 (t, J = 7.2
Hz, 3 H). 11 ##STR00120## .sup.1H NMR (400 MHz, CD.sub.3OD,
.delta.): 8.31 (s, 1 H), 7.68 (d, J = 8.8 Hz, 1 H), 7.50 (d, J =
8.8 Hz, 1 H), 7.43 (s, 1 H), 5.37-5.40 (m, 1 H), 4.09- 4.16 (m, 2
H), 3.65-4.00 (m, 2 H), 3.45-3.64 (m, 2 H), 2.90 (s, 2 H), 2.66 (s,
2 H), 1.50-1.80 (m, 4 H), 1.42 (d, J = 6.4 Hz, 6 H). 12
##STR00121## +ESI (M + H) 434.3; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 11.67 (s, 1 H), 7.98 (br. s., 1 H), 7.60 (d, J =
8.2 Hz, 1 H), 7.40-7.44 (m, 2 H), 7.36-7.40 (m, 1 H), 7.09-7.13 (m,
1 H), 7.01 (dd, J = 8.3, 1.5 Hz, 1 H), 5.19-5.29 (m, 1 H),
3.31-3.70 (m, 4 H), 2.78 (s, 2 H), 2.59 (s, 2 H), 1.38-1.54 (m, 4
H), 1.33 (d, J = 6.6 Hz, 6 H). 13 ##STR00122## +ESI (M + H) 432.3;
HPLC retention time 2.18 minutes (Method A) 14 ##STR00123## +ESI (M
+ H) 433.3; HPLC retention time 2.52 minutes (Method A). .sup.1H
NMR (500 MHz, CDCl.sub.3, .delta.) 8.78 (d, J = 2.20 Hz, 1 H), 8.13
(d, J = 1.95 Hz, 1 H), 8.03 (d, J = 9.27 Hz, 1 H), 7.44 (dd, J =
9.03, 2.68 Hz, 1 H), 7.40 (s, 1 H), 7.10 (d, J = 2.68 Hz, 1 H),
5.35-5.43 (m, 1 H), 3.96 (s, 3 H), 3.81 (br. s., 2 H), 3.50 (br.
s., 2 H), 2.84 (s, 2 H), 2.63 (s, 2 H), 1.54-1.79 (m, 4 H), 1.47
(d, J=6.34 Hz, 6 H). 15 ##STR00124## +ESI (M + H) 418.2; HPLC
retention time 2.06 minutes (Method A). 16 ##STR00125## +ESI (M +
H) 426.1; HPLC retention time 2.18 minutes (Method A). 17
##STR00126## +ESI (M + H) 417.2; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 7.91 (dd, J = 8.4, 0.8 Hz, 1 H), 7.73 (s, 1 H),
7.42 (s, 1 H), 7.33 (dd, J = 8.4, 1.2 Hz, 1 H), 5.19-5.28 (m, 1 H),
3.49-3.78 (m, 4 H), 2.77 (br. s., 2 H), 2.59 (s, 2 H), 1.36-1.60
(m, 4 H), 1.33 (m, 6 H).
Example 18
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl)carbonyl]-1H-pyrazolo[3,4-b]pyridine-3-carboxamide
##STR00127##
[0283] Step 1. methyl
3-cyano-1H-pyrazolo[3,4-b]pyridine-5-carboxylate
##STR00128##
[0285] Methyl 3-bromo-1H-pyrazolo[3,4-b]pyridine-5-carboxylate
(1.28 g, 5.01 mmol) was combined with N,N-dimethylacetamide (34
mL). To this mixture was added zinc dust (195 mg, 2.90 mmol) and
zinc cyanide (1.20 g, 10.2 mmol). Nitrogen was bubbled through the
mixture for 30 minutes. Then
1,1'-bis(diphenylphosphino)ferrocene-palladium (II) dichloride
dichloromethane complex (611 mg, 0.749 mmol) was added and the
reaction vessel was sealed. The reaction was heated to 120.degree.
C. for 65 hours. The reaction was diluted with 20% methanol/ethyl
acetate and filtered through Celite. The filtrate was diluted with
water and transferred to a separatory funnel. The phases were
separated, and the organics were washed again with water and brine.
The organics were then dried over sodium sulfate, filtered, and
concentrated. Purification by flash column chromatography (0-75%
ethyl acetate/heptanes) gave the title compound (390 mg, 39%). +ESI
(M+H) 203.1.
Step 2.
5-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperid-
ine]-1'-ylcarbonyl)-1H-pyrazolo[3,4-b]pyridine-3-carbonitrile
##STR00129##
[0287] Methyl 3-cyano-1H-pyrazolo[3,4-b]pyridine-5-carboxylate (390
mg, 1.93 mmol) was dissolved in methanol (20 mL). Aqueous 1 N
sodium hydroxide (11 mL, 10 mmol) was added and the reaction was
allowed to stir at room temperature for 22 hours. The crude was
concentrated to remove the methanol and was then washed once with
dichloromethane. The aqueous layer was acidified to pH=2 with 6 N
aqueous hydrochloric acid and the resulting solids were collected
by filtration (172 mg).
[0288] To the carboxylic acid (170 mg, 0.91 mmol) was added
4-dimethylaminopyridine (27.6 mg, 0.22 mmol), 2-propanephosphonic
acid cyclic anhydride (0.65 mL, 1.1 mmol), and dichloromethane (3
mL). The mixture was stirred at room temperature for 1 hour.
Triethylamine (0.51 mL, 3.6 mmol) and
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
(293 mg, 0.913 mmol) were then added and the reaction was stirred
for 17 hours. Additional triethylamine (0.30 mL, 2.2 mmol) was
added and the reaction was stirred for another 24 hours. The
reaction was diluted with water and the layers were separated. The
aqueous was extracted twice with dichloromethane. The combined
organics were dried over sodium sulfate, filtered, and
concentrated. Purification by column chromatography (0-100% of a
10% methanol in dichloromethane solution/dichloromethane) gave the
title compound (177 mg, 47%). +ESI (M+H) 418.3; .sup.1H NMR (500
MHz, CHLOROFORM-d, .delta.): 13.59 (br. s., 1H), 8.81 (d, J=2.0 Hz,
1H), 8.38 (d, J=1.7 Hz, 1H), 7.44 (s, 1H), 5.40 (m, 1H), 3.77-3.98
(m, 2H), 3.44-3.63 (m, 2H), 2.86 (s, 2H), 2.66 (s, 2H), 1.54-1.85
(m, 4H), 1.47 (d, J=6.6 Hz, 6H).
Step 3.
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-p-
iperidin]-1'-yl)carbonyl]-1H-pyrazolo[3,4-b]pyridine-3-carboxamide
[0289] A solution of
5-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1'-
-ylcarbonyl)-1H-pyrazolo[3,4-b]pyridine-3-carbonitrile (177 mg,
0.424 mmol) in methanol (2 mL) was added to a 0.degree. C. solution
of urea hydrogen peroxide (552 mg, 5.70 mmol) in 1 N aqueous sodium
hydroxide (4.24 mL, 4.24 mmol). The reaction was allowed to warm to
room temperature and stir for 22 hours. The methanol was removed
under reduced pressure and the residue was diluted with water and
saturated aqueous ammonium chloride. The mixture was extracted with
dichloromethane (3.times.). The combined organics were dried over
sodium sulfate, filtered, and concentrated. Purification by
reversed-phase HPLC gave the title compound. Analytical LCMS: +ESI
(M+H) 436.2; retention time 2.11 minutes (Method A).
Example 19
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-2-carboxamide
##STR00130##
[0290] Step 1. ethyl
2-cyano-1H-pyrrolo[2,3-b]pyridine-5-carboxylate
##STR00131##
[0292] The title compound was prepared by a method analogous to
that described in Step 1 of Example 18, using ethyl
2-bromo-1H-pyrrolo[2,3-b]pyridine-5-carboxylate. +ESI (M+H) 216.3;
.sup.1H NMR (400 MHz, METHANOL-d.sub.4, .delta.): 9.02 (d, J=2.1
Hz, 1H), 8.73 (d, J=2.0 Hz, 1H), 7.35 (s, 1H), 4.41 (q, J=7.2 Hz,
2H), 1.40 (t, J=7.1 Hz, 3H).
Step 2.
5-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperid-
ine]-1'-ylcarbonyl)-1H-pyrrolo[2,3-b]pyridine-2-carbonitrile
##STR00132##
[0294] To ethyl 2-cyano-1H-pyrrolo[2,3-b]pyridine-5-carboxylate (36
mg, 0.17 mmol) was added methanol (1 mL), tetrahydrofuran (1 mL),
and water (1 mL), followed by 2 N aqueous lithium hydroxide (0.17
mL, 0.33 mmol). The reaction was stirred at room temperature
overnight and was then concentrated. The crude was taken up in
water and the pH was adjusted to 4 using 1 N aqueous hydrochloric
acid. The mixture was extracted with ethyl acetate (3.times.). The
combined organics were dried over sodium sulfate, filtered, and
concentrated to provide the
2-cyano-1H-pyrrolo[2,3-b]pyridine-5-carboxylic acid. The title
compound was then prepared by a method analogous to that described
in Example 1, using 2-cyano-1H-pyrrolo[2,3-b]pyridine-5-carboxylic
acid. -ESI (M-H) 415.1.
Step 3.
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-p-
iperidin]-1'-yl)carbonyl]-1H-pyrrolo[2,3-b]pyridine-2-carboxamide
[0295] The title compound was prepared by a method analogous to
that described in Step 3 of Example 18. Analytical LCMS: +ESI (M+H)
435.1; retention time 2.17 minutes (Method A).
Example 20
1-isopropyl-1'-{[2-(methylamino)-1H-benzimidazol-5-yl]carbonyl}-1,4-dihydr-
ospiro[indazole-5,4'-piperidin]-7(6H)-one
##STR00133##
[0296] Step 1.
1'-(3,4-diaminobenzoyl)-1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperi-
din]-7(1H)-one
##STR00134##
[0298] The title compound was prepared by a method analogous to
that described for Example 3, using 3,4-diaminobenzoic acid.
.sup.1H NMR (400 MHz, DMSO-d6, .delta.): 7.45 (s, 1H), 6.60 (s,
1H), 6.46 (s, 1H), 5.76 (s, 1H), 5.24-5.30 (m, 1H), 4.78 (s, 2H),
4.56 (s, 2H), 3.35-3.55 (m, 4H), 2.79 (s, 2H), 2.59 (s, 2H),
2.40-2.50 (m, 1H), 1.42-1.46 (m, 3H), 1.35 (d, J=6.8 Hz, 6H).
Step 2.
1-isopropyl-1'-{[2-(methylamino)-1H-benzimidazol-5-yl]carbonyl}-1,-
4-dihydrospiro[indazole-5,4'-piperidin]-7(6H)-one
[0299] A mixture of
1'-(3,4-diaminobenzoyl)-1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperi-
din]-7(1H)-one (0.1 g, 0.3 mmol) and isothiocyanatomethane (19 mg,
0.3 mmol) was dissolved in tetrahydrofuran (3 mL). The reaction was
heated to reflux and stirred for 6 hours. The reaction mixture was
concentrated, and the residue was poured into cold water. The
solution was extracted with ethyl acetate (3.times.20 mL). The
combined organics were dried over sodium sulfate, filtered, and
concentrated to provide
1-(2-amino-4-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-pip-
eridine]-1'-ylcarbonyl)phenyl)-3-methylthiourea (37 mg, 27%).
[0300] The crude product was dissolved in ethanol (2 mL) and methyl
iodide (147 mg, 1.0 mmol) was added. The reaction was heated to
reflux and stirred overnight. The reaction was concentrated and the
residue was basified to pH=9 with ammonium hydroxide. The mixture
was extracted with dichloromethane (3.times.20 mL). The combined
organics were dried over sodium sulfate, filtered, and
concentrated. Purification by reversed-phase HPLC gave the title
compound (28 mg, 83%) as an off white solid. .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 7.39 (s, 1H), 7.13 (s, 1H), 7.05-7.07 (m,
1H), 6.99-7.01 (m, 1H), 5.33-5.43 (m, 1H), 3.44-3.89 (m, 4H), 2.91
(s, 3H), 2.86 (s, 2H), 2.60 (s, 2H), 1.50-1.80 (m, 4H), 1.46 (d,
J=6.8 Hz, 6H).
Example 21
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl)carbonyl]-1H-benzimidazole-2-carboxamide
##STR00135##
[0302] A mixture of
1'-(3,4-diaminobenzoyl)-1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperi-
din]-7(1H)-one (500 mg, 1.3 mmol), 2-chloroacetamide (200 mg, 2.1
mmol), sulfur (200 mg, 6.3 mmol), and triethylamine (1 mL, 7 mmol)
in N,N-dimethylformamide (5 mL) was stirred at 65.degree. C.
overnight. The reaction mixture was cooled to 0.degree. C., diluted
with water (10 mL), and extracted with ethyl acetate (2.times.20
mL). The combined organics were dried over sodium sulfate,
filtered, and concentrated. Purification by column chromatography
gave the title compound (252 mg, 44%) as a yellow solid. .sup.1H
NMR (400 MHz, CD.sub.3OD, .delta.): 7.60-7.90 (m, 2H), 7.30-7.50
(m, 2H), 5.37-5.40 (m, 1H), 3.40-4.00 (m, 4H), 2.89 (s, 2H), 2.65
(s, 2H), 1.50-1.80 (m, 4H), 1.42 (d, J=6.4 Hz, 6H).
Example 22
3-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl)carbonyl]-6-methoxyquinoline-7-carboxamide
##STR00136##
[0303] Step 1:
1'-(7-bromo-6-methoxyquinoline-3-carbonyl)-1-isopropyl-4,6-dihydrospiro[i-
ndazole-5,4'-piperidin]-7(1H)-one
##STR00137##
[0305] The title compound was prepared by a method analogous to
that described for Example 2, using
7-bromo-6-methoxyquinoline-3-carboxylic acid. +ESI (M+H+1) 513.2;
.sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 8.71 (d, J=2.15 Hz,
1H), 8.29 (s, 1H), 8.05 (d, J=2.15 Hz, 1H), 7.32 (s, 1H), 7.05 (s,
1H), 5.25-5.37 (m, 1H), 3.96 (s, 3H), 3.65-3.91 (m, 2H), 3.37-3.58
(m, 2H), 2.77 (s, 2H), 2.55 (s, 2H), 1.59-1.73 (m, 2H), 1.46-1.59
(m, 2H), 1.39 (d, J=6.44 Hz, 6H).
Step 2:
3-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperid-
ine]-1'-ylcarbonyl)-6-methoxyquinoline-7-carbonitrile
##STR00138##
[0307] The title compound was prepared by a method analogous to
that described for Intermediate 6, using
1'-(7-bromo-6-methoxyquinoline-3-carbonyl)-1-isopropyl-4,6-dihydrospiro[i-
ndazole-5,4'-piperidin]-7(1H)-one. +ESI (M+H) 458.4; .sup.1H NMR
(400 MHz, CDCl.sub.3, .delta.): 8.82 (d, J=1.95 Hz, 1H), 8.37 (s,
1H), 8.10 (d, J=1.56 Hz, 1H), 7.35 (s, 1H), 7.14 (s, 1H), 5.33 (m,
1H), 4.02 (s, 3H), 3.70-3.91 (m, 2H), 3.36-3.54 (m, 2H), 2.80 (s,
2H), 2.58 (s, 2H), 1.65-1.77 (m, 2H), 1.51-1.62 (m, 2H), 1.42 (d,
J=4.49 Hz, 6H).
Step 3:
3-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-p-
iperidin]-1'-yl)carbonyl]-6-methoxyquinoline-7-carboxamide
[0308] The title compound was prepared by a method analogous to
that described in Step 4 of Intermediate 6, using
3-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine]-1'-
-ylcarbonyl)-6-methoxyquinoline-7-carbonitrile. +ESI (M+H) 476.4;
.sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 8.77 (s, 1H), 8.52 (s,
1H), 8.36 (s, 1H), 7.55 (s, 1H), 7.42 (s, 1H), 5.31-5.43 (m, 1H),
4.08 (s, 3H), 3.84-4.00 (m, 1H), 3.69-3.83 (m, 1H), 3.48-3.58 (m,
2H), 2.90 (s, 2H), 2.65 (br. s., 2H), 1.53-1.78 (m, 4H), 1.35-1.45
(m, 6H).
Example 23
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidin-
]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carbonitrile
##STR00139##
[0309] Step 1:
1'-(3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carbonyl)-1-isopropyl-4,6-dihydro-
spiro[indazole-5,4'-piperidin]-7(1H)-one
##STR00140##
[0311] The title compound was prepared by a method analogous to
that described for Example 3, using
3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid. +ESI (M+H+1)
472.1; .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 11.85 (br. s.,
1H), 8.39 (d, J=1.8 Hz, 1H), 7.93 (s, 1H), 7.81 (d, J=1.8 Hz, 1H),
7.43 (s, 1H), 5.24 (m, 1H), 3.68 (m, 1H), 3.40 (m, 3H), 2.79 (s,
2H), 2.60 (s, 2H), 1.49 (m, 4H), 1.33 (d, J=6.6 Hz, 6H).
Step 2:
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-p-
iperidin]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carbonitrile
[0312] To a mixture of
1'-(3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carbonyl)-1-isopropyl-4,6-dihydro-
spiro[indazole-5,4'-piperidin]-7(1H)-one (500 mg, 1.1 mmol), zinc
dust (70 mg, 1.1 mmol), and zinc cyanide (187 mg, 1.60 mmol) was
added N,N-dimethylacetamide (9 mL). The reaction vial was capped
and nitrogen gas was bubbled through the mixture for 15 minutes.
Meanwhile, a mixture of palladium(II) acetate (24 mg, 0.11 mmol),
4,5-bis(diphenylphosphino)-9,9-dimethylxanthene (68 mg, 0.12 mmol),
and zinc powder (7 mg, 0.13 mmol) in N,N-dimethylacetamide (1.5 mL)
was heated to 80.degree. C. for 15 minutes to give a reddish brown
solution. This palladium solution was then added via syringe to the
substrate mixture. The reaction was heated to 100.degree. C. and
stirred for 3 days. The reaction was cooled to room temperature and
diluted with ethyl acetate (100 mL). The solution was filtered
through Celite and the filtrate was concentrated. 50 mg of the
crude residue was subjected to purification by reversed-phase HPLC
to give the title compound (25.8 mg). +ESI (M+H) 417.1; HPLC
retention time 2.32 minutes (Method A).
Example 24
2-({3-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piper-
idin]-1'-yl)carbonyl]quinolin-6-yl}oxy)acetamide
##STR00141##
[0313] Step 1:
2-(2-chloro-3-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-pi-
peridine]-1'-ylcarbonyl)quinolin-6-yloxy)acetamide
##STR00142##
[0315] 6-(2-tert-butoxy-2-oxoethoxy)-2-chloroquinoline-3-carboxylic
acid and
1-isopropyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(1H)-one
were coupled by a method analogous to that described for Example 1
to give tert-butyl
2-(2-chloro-3-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-pi-
peridine]-1'-ylcarbonyl)quinolin-6-yloxy)acetate. This material (30
mg, 0.053 mmol) was suspended in ammonia (2 mL, 10 mmol, 7 M in
methanol) and stirred at room temperature for 18 hours. The
reaction was concentrated to give the title compound (27 mg, 100%).
+ESI (M+H) 510.4.
Step 2:
2-({3-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole-5,-
4'-piperidin]-1'-yl)carbonyl]quinolin-6-yl}oxy)acetamide
[0316] Methanol (1.5 mL) and ethyl acetate (1.5 mL) were added to
2-(2-chloro-3-(1-isopropyl-7-oxo-1,4,6,7-tetrahydrospiro[indazole-5,4'-pi-
peridine]-1'-ylcarbonyl)quinolin-6-yloxy)acetamide (27 mg, 0.053
mmol). Palladium hydroxide (15 mg) was then added and the reaction
was pressurized to 40 psi hydrogen and agitated at room temperature
for 20 hours. The reaction mixture was filtered through Celite and
concentrated. Purification via reversed-phase HPLC gave the title
compound (2.1 mg, 8%). +ESI (M+H) 476.2; HPLC retention time 2.11
minutes (Method A).
Example 25
1'-[(2-aminoquinolin-7-yl)carbonyl]-1-isopropyl-1,4-dihydrospiro[indazole--
5,4'-piperidin]-7(6H)-one
##STR00143##
[0317] Step 1:
1'-(2-(tert-butylamino)quinoline-7-carbonyl)-1-isopropyl-4,6-dihydrospiro-
[indazole-5,4'-piperidin]-7(1H)-one
##STR00144##
[0319] The title compound was prepared by a method analogous to
that described for Example 3, using
2-(tert-butylamino)quinoline-7-carboxylic acid. +APCl (M+H) 474.6;
.sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 7.72 (d, J=8.8 Hz, 1H),
7.64 (s, 1H), 7.55 (d, J=8.2 Hz, 1H), 7.36 (s, 1H), 7.16 (dd,
J=8.1, 1.3 Hz, 1H), 6.59 (d, J=9.2 Hz, 1H), 5.36 (quin, J=6.6 Hz,
1H), 3.31-3.96 (m, 4H), 2.79 (s, 2H), 2.58 (s, 2H), 1.55-1.75 (m,
4H), 1.52 (s, 9H), 1.44 (d, J=6.4 Hz, 6H).
Step 2:
1'-[(2-aminoquinolin-7-yl)carbonyl]-1-isopropyl-1,4-dihydrospiro[i-
ndazole-5,4'-piperidin]-7(6H)-one Trifluoroacetate Salt
[0320] Trifluoroacetic acid (0.90 mL, 12 mmol) was added to
I-(2-(tert-butylamino)quinoline-7-carbonyl)-1-isopropyl-4,6-dihydrospiro[-
indazole-5,4'-piperidin]-7(1H)-one (50 mg, 0.11 mmol). The reaction
was heated to 70.degree. C. for 3 hours, then cooled to room
temperature and left stirring overnight. The reaction was
concentrated to dryness and purification by reversed-phase HPLC
gave the title compound (41 mg, 93%). +ESI (M+H) 418.2; HPLC
retention time 2.11 minutes (Method A). .sup.1H NMR (500 MHz,
CD.sub.3OD, .delta.) 8.36 (d, J=9.27 Hz, 1H), 7.97 (d, J=8.05 Hz,
1H), 7.66 (s, 1H), 7.53 (dd, J=8.17, 1.34 Hz, 1H), 7.44 (s, 1H),
7.12 (d, J=9.27 Hz, 1H), 5.39 (quint, J=13.23, 6.68 Hz, 1H), 3.91
(br. s., 1H), 3.76 (br. s., 1H), 3.46 (br. s., 2H), 2.92 (s, 2H),
2.67 (d, J=7.81 Hz, 2H), 1.74 (br. s., 2H), 1.59 (br. s., 2H), 1.43
(br. s., 6H).
[0321] The compounds listed in Table 2 below were prepared using
procedures analogous to those described above for the synthesis of
the compounds of Examples 1-3 using the appropriate starting
materials which are available commercially, prepared using
preparations well-known to those skilled in the art, or prepared by
a route described above. The compounds listed below were isolated
initially as the free base and may be converted to a
pharmaceutically acceptable salt for testing.
TABLE-US-00002 TABLE 2 ##STR00145## Example --R.sup.2 Analytical
Data 26 ##STR00146## +APCI (M + H) 449.5; .sup.1H NMR (400 MHz,
DMSO-d.sub.6, .delta.): 13.66 (br. s., 1 H), 8.17 (s, 1 H), 7.77
(br. s., 1 H), 7.59-7.64 (m, 1 H), 7.35- 7.43 (m, 3 H), 3.33-3.83
(m, 4 H), 2.82 (br. s., 2 H), 2.62 (s, 2 H), 1.56 (s, 9 H),
1.33-1.53 (m, 4 H). 27 ##STR00147## +ESI (M + H) 449.2; retention
time 2.31 minutes. (Method A)
[0322] The compounds listed in Table 3 below were prepared using
procedures analogous to those described above for the synthesis of
the compounds of Examples 1-3 using the appropriate starting
materials which are available commercially, prepared using
preparations well-known to those skilled in the art, or prepared by
a route described above. The compounds listed below were isolated
initially as the free base and may be converted to a
pharmaceutically acceptable salt for testing.
TABLE-US-00003 TABLE 3 ##STR00148## Example --R.sup.2 Analytical
Data 28 ##STR00149## +ESI (M + H) 448.2; .sup.1H NMR (400 MHz,
DMSO- d.sub.6, .delta.): 11.65 (br. s., 1 H), 8.13 (d, J = 8.0 Hz,
1 H), 8.08 (d, J = 2.2 Hz, 1 H), 7.81 (s, 1 H), 7.43 (s, 1 H), 7.36
(br. s., 1 H), 7.10 (d, J = 8.0 Hz, 1 H), 6.79 (br. s., 1 H),
3.34-3.67 (m, 4 H), 2.77 (s, 2 H), 2.55 (s, 2 H), 1.51 (s, 9 H),
1.42-1.50 (m, 4 H). 29 ##STR00150## +ESI (M + H) 449.2; .sup.1H NMR
(400 MHz, DMSO- d.sub.6, .delta.): 13.63 (s, 1 H), 8.14 (d, J = 8.4
Hz, 1 H), 7.78 (s, 1 H), 7.73 (s, 1 H), 7.55 (s, 1 H), 7.34 (s, 1
H), 7.18 (dd, J = 8.3, 1.3 Hz, 1 H), 3.50- 3.72 (m, 2 H), 3.21-3.39
(m, 2 H), 2.74 (s, 2 H), 2.53 (s, 2 H), 1.49 (s, 9 H), 1.22-1.61
(m, 4 H). 30 ##STR00151## +ESI (M + H) 449.2; HPLC retention time
1.99 minutes. (Method A) 31 ##STR00152## +ESI (M + H) 449.3;
.sup.1H NMR (400 MHz, DMSO- d.sub.6, .delta.): 13.67 (s, 1 H), 8.17
(s, 1 H), 7.81 (s, 1 H), 7.75-7.79 (m, 1 H), 7.62 (d, J = 8.6 Hz, 1
H), 7.41 (dd, J = 8.6, 1.6 Hz, 2 H), 3.31-3.71 (m, 4 H), 2.77 (br.
s., 2 H), 2.55 (s, 2 H), 1.52 (s, 9 H), 1.39-1.50 (m, 4 H). 32
##STR00153## +ESI (M + H) 448.2; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 11.70 (d, J = 1.4 Hz, 1 H), 7.99 (br. s., 1 H),
7.82 (s, 1 H), 7.66 (s, 1 H), 7.42 (d, J = 8.6 Hz, 1 H), 7.39 (br.
s., 1 H), 7.21 (dd, J = 8.4, 1.6 Hz, 1 H), 7.16 (d, J = 1.4 Hz, 1
H), 3.49 (br. s., 4 H), 2.78 (s, 2 H), 2.56 (s, 2 H), 1.50 (s, 9
H), 1.48 (br. s., 4H). 33 ##STR00154## -ESI (M - H) 446.2; .sup.1H
NMR (400 MHz, DMSO- d.sub.6, .delta.): 11.68 (br. s., 1 H), 8.20
(d, J = 0.8 Hz, 1 H), 8.07 (d, J = 2.7 Hz, 1 H), 7.82 (s, 1 H),
7.46 (br. s., 1 H), 7.43 (d, J = 8.4 Hz, 1 H), 7.17 (dd, J = 8.3,
1.7 Hz, 1 H), 6.82 (br. s., 1 H), 3.50 (br. s., 4 H), 2.78 (s, 2
H), 2.55 (s, 2 H), 1.53 (s, 9 H), 1.48 (br. s., 4 H). 34
##STR00155## +ESI (M + H) 448.4; .sup.1H NMR (400 MHz, DMSO-
d.sub.6, .delta.): 11.67 (d, J = 1.6 Hz, 1 H), 7.98 (br. s., 1 H),
7.79 (s, 1 H), 7.60 (d, J = 8.2 Hz, 1 H), 7.41 (s, 1 H), 7.36-7.40
(m, 1 H), 7.09-7.13 (m, 1 H), 7.02 (dd, J = 8.3, 1.5 Hz, 1 H), 3.43
(br. s., 4 H), 2.75 (s, 2 H), 2.52 (s, 2 H), 1.37-1.55 (m, 13 H).
35 ##STR00156## .sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 8.36
(br. s., 1 H), 7.75 (s, 1 H), 7.34-7.36 (m, 2 H), 7.24-7.26 (m, 1
H), 3.50-3.88 (m, 4 H), 2.91 (s, 2 H), 2.68 (s, 2 H), 1.62 (s, 9
H), 1.56-1.70 (m, 4 H). 36 ##STR00157## .sup.1H NMR (400 MHz,
CD.sub.3OD, .delta.): 8.42-8.45 (m, 1 H), 8.31 (s, 1 H), 7.74 (s, 1
H), 7.65 (d, J = 8.8 Hz, 1 H), 7.47 (d, J = 8.8 Hz, 1 H), 3.65-4.00
(m, 2 H), 3.44-3.60 (m, 4 H), 2.90 (s, 2 H), 2.66 (s, 2 H),
1.50-1.80 (m, 4 H), 1.60 (s, 9 H), 1.26 (t, J = 7.2 Hz, 3 H). 37
##STR00158## .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 13.70
(s, 1 H), 8.40-8.41 (m, 1 H), 8.19 (s, 1 H), 7.83 (s, 1 H), 7.63
(d, J = 8.8 Hz, 1 H), 7.43 (d, J = 8.4 Hz, 1 H), 3.40-3.80 (m, 4
H), 2.81 (d, J = 4.4 Hz, 3 H), 2.80 (s, 2 H), 2.57 (s, 2 H),
1.40-1.60 (m, 13 H). 38 ##STR00159## .sup.1H NMR (400 MHz,
CD.sub.3OD, .delta.): 8.31 (s, 1 H), 7.74 (s, 1 H), 7.68 (d, J =
8.8 Hz, 1 H), 7.50 (d, J = 8.8 Hz, 1 H), 4.10-4.17 (m, 2 H),
3.65-4.00 (m, 2 H), 3.40-3.65 (m, 2 H), 2.90 (s, 2 H), 2.67 (s, 2
H), 1.50-1.80 (m, 4 H), 1.60 (s, 9 H). 39 ##STR00160## .sup.1H NMR
(400 MHz, CD.sub.3OD, .delta.): 8.30 (s, 1 H), 7.73 (s, 1 H), 7.31
(d, J = 9.6 Hz, 2 H), 7.18- 7.20 (m, 1 H), 3.40-3.95 (m, 4 H), 3.04
(s, 3 H), 2.88 (s, 2 H), 2.65 (s, 2 H), 1.60 (s, 9 H), 1.45-1.80
(m, 4 H). 40 ##STR00161## +ESI (M + H) 446.3; HPLC retention time
2.07 minutes (Method A). 41 ##STR00162## +ESI (M + H) 431.2;
.sup.1H NMR (400 MHz, CD.sub.3OD, .delta.): 7.93 (d, 1 H), 7.74 (d,
2 H), 7.40 (dd, 1 H), 3.70-4.00 (m, 2 H), 3.40-3.50 (m, 2 H), 2.89
(s, 2 H), 2.66 (s, 2 H), 1.65-1.80 (m, 2 H), 1.60 (s, 9H),
1.50-1.65 (m, 2 H). 42 ##STR00163## +ESI (M + H) 440.1; HPLC
retention time 2.06 minutes (Method A). 43 ##STR00164## +ESI (M +
H) 431.3; .sup.1H NMR (400 MHz, DMSO- d.sub.6, .delta.): 7.89-7.92
(m, 1 H), 7.83 (s, 1 H), 7.81 (dd, J = 8.61, 0.78 Hz, 1 H), 7.54
(dd, J = 8.71, 1.47 Hz, 1 H), 3.36-3.78 (m, 4 H), 2.79 (s, 2 H),
2.58 (s, 2 H), 1.53 (s, 9 H), 1.41-1.52 (m, 4 H). 44 ##STR00165##
+ESI (M + H) 460.2; .sup.1H NMR (400 MHz, DMSO- d.sub.6, .delta.):
8.94 (d, J = 2.1 Hz, 1 H), 8.56 (d, J = 2.0 Hz, 1 H), 8.47 (d, J =
2.1 Hz, 1 H), 8.18-8.24 (m, 2 H), 8.07 (d, J = 8.78 Hz, 1H), 7.81
(s, 1 H), 7.57 (s, 1 H), 3.57-3.77 (m, 2 H), 3.33-3.44 (m, 2 H),
2.77 (s, 2 H), 2.56 (s, 2 H), 1.53-1.61 (m, 2 H), 1.50 (s, 9 H),
1.45-1.50 (m, 2 H).
Example 45
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-piperidi-
n]-1'-yl) carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide
##STR00166##
[0323] Step 1. methyl
3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylate
##STR00167##
[0325] The title compound was prepared by a method analogous to
that described in Step 2 for Intermediate 9, using methyl
1H-pyrrolo[3,2-b]pyridine-6-carboxylate. +ESI (M+H) 257.1; .sup.1H
NMR (DMSO-d.sub.6, .delta.): 12.08 (br. s., 1H), 8.92 (d, J=1.8 Hz,
1H), 8.30 (d, J=2.0 Hz, 1H), 8.10 (d, J=2.9 Hz, 1H), 3.88 (s,
3H).
Step 2. 3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid
hydrochloride
##STR00168##
[0327] To a solution of methyl
3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylate (2.90 g, 11.4 mmol)
in 1,4-dioxane (30 mL) was added 6 N aqueous hydrochloric acid
(18.9 mL, 114 mmol). The reaction was heated to 90.degree. C. and
stirred overnight. The reaction was cooled to room temperature and
concentrated to dryness to afford the title compound (2.76 g,
quantitative). .sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 12.31
(br. s., 1H), 8.91 (d, J=1.8 Hz, 1H), 8.37 (s, 1H), 8.14 (d, J=1.6
Hz, 1H).
Step 3.
1'-(3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carbonyl)-2-tert-butyl-4,6-
-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
##STR00169##
[0329] To a suspension of
3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carboxylic acid hydrochloride
(2.75 g, 9.91 mmol) and
2-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
hydrochloride salt (2.95 g, 9.91 mmol) in dichloromethane (30 mL)
was added triethylamine (5.52 mL, 39.6 mmol). N,N-dimethylformamide
(5 mL) was then added, followed by 1-hydroxybenzotriazole (1.61 g,
11.9 mmol) and 1, (3-dimethylaminopropyl)-3-ethyl carbodiimide
hydrochloride (2.28 g, 11.9 mmol). The reaction was allowed to stir
at room temperature for 60 hours. The reaction was diluted with
ethyl acetate and washed with saturated aqueous sodium bicarbonate
and brine. The organics were dried over magnesium sulfate,
filtered, and concentrated. Purification by flash column
chromatography (0-10% methanol/ethyl acetate) gave the title
compound (3.39 g, 71%) as a pale brown solid. +ESI (M+1+H) 486.2;
.sup.1H NMR (400 MHz, CDCl.sub.3, .delta.): 10.05 (br. s., 1H),
8.57 (d, J=1.8 Hz, 1H), 7.87 (d, J=1.8 Hz, 1H), 7.61 (d, J=2.7 Hz,
1H), 7.44 (s, 1H), 3.78 (br. s., 2H), 3.51 (br. s., 2H), 2.81 (s,
2H), 2.65 (s, 2H), 1.63 (s, 13H).
Step 4.
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'--
piperidin]-1'-yl)carbonyl]-1H-pyrrolo[3,2-b]pyridine-3-carboxamide
[0330] A round bottom flask was charged with
1'-(3-bromo-1H-pyrrolo[3,2-b]pyridine-6-carbonyl)-2-tert-butyl-4,6-dihydr-
ospiro[indazole-5,4'-piperidin]-7(2H)-one (1.25 g, 2.58 mmol), zinc
cyanide (454 mg, 3.87 mmol), zinc dust (169 mg, 2.58 mmol), and
lastly dimethylacetamide (22 mL). Nitrogen was bubbled through the
mixture for 5 minutes. Copper (I) iodide (494 mg, 2.58 mmol) and
[1,1'-bis(diphenylphosphino)ferrocene]dichloropalladium(II),
complex with dichloromethane (189 mg, 0.258 mmol) were added and
the reaction was heated to 120.degree. C. overnight. The reaction
mixture was diluted with ethyl acetate and filtered through Celite.
The filtrate was washed with sodium bicarbonate (7% aqueous) and
brine. The organics were dried over magnesium sulfate, filtered,
and concentrated. The crude residue was triturated with methyl
tert-butyl ether and the resulting orange powder was filtered off
and dried.
[0331] The powder (550 mg) was suspended in dichloromethane (20 mL)
and concentrated sulfuric acid (1 mL) was added. The reaction was
stirred vigorously for 3 hours, then the upper dichloromethane
layer was decanted and set aside. To the remaining brown syrup was
added 50 g ice and the pH was adjusted to 7 using 5 N aqueous
sodium hydroxide. The mixture was combined with the previously
separated dichloromethane layer and transferred to a separatory
funnel. The phases were separated and the aqueous layer was
extracted twice with dichloromethane. The combined organics were
washed with brine, dried over magnesium sulfate, filtered, and
concentrated. Purification by flash column chromatography (0-10%
methanol/dichloromethane) gave the title compound (420 mg, 73%) as
an off-white solid. +ESI (M+H) 449.3; .sup.1H NMR (400 MHz,
DMSO-d.sub.6, .delta.): 12.09 (br. s., 1H), 8.49 (d, J=1.8 Hz, 1H),
8.24 (s, 1H), 8.12 (br. s., 1H), 7.93 (d, J=1.8 Hz, 1H), 7.83 (s,
1H), 7.39 (d, J=2.7 Hz, 1H), 3.62 (br. s., 2H), 3.43 (br. s., 2H),
2.79 (s, 2H), 2.58 (s, 2H), 1.53 (s, 13H).
Example 46
2-({3-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5,4'-pipe-
ridin]-1'-yl)carbonyl]quinolin-6-yl}oxy)acetamide
##STR00170##
[0332] Step 1: tert-butyl
2-(3-(2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine-
]-1'-ylcarbonyl)quinolin-6-yloxy)acetate
##STR00171##
[0334] The title compound was prepared by a method analogous to
that described for Example 3, using
6-(2-tert-butoxy-2-oxoethoxy)quinoline-3-carboxylic acid and
2-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
hydrochloride salt. +ESI (M+H) 547.3; .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 8.77 (d, J=2.0 Hz, 1H), 8.10 (d, J=1.6 Hz,
1H), 8.06 (d, J=9.2 Hz, 1H), 7.50 (dd, J=9.3, 2.8 Hz 1H), 7.41 (s,
1H), 7.02 (d, J=2.7 Hz, 1H), 4.64 (s, 2H), 3.68-3.93 (m, 2H),
3.41-3.51 (m, 2H), 2.78 (s, 2H), 2.65 (s, 2H), 1.53-1.76 (m, 4H),
1.61 (s, 9H), 1.49 (s, 9H).
Step 2:
2-(3-(2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-pip-
eridine]-1'-ylcarbonyl)quinolin-6-yloxy)acetic acid
##STR00172##
[0336] Hydrochloric acid (10 mL, 40 mmol, 4 M in 1,4-dioxane) was
added to tert-butyl
2-(3-(2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine-
]-1'-ylcarbonyl)quinolin-6-yloxy)acetate (470 mg, 0.860 mmol). The
reaction was stirred vigorously at room temperature for 1 hour. The
reaction was concentrated. The residue was coevaporated with ethyl
acetate and heptanes several times, and then dried under vacuum to
provide the title compound (422 mg, 100%). +ESI (M+H) 491.4;
.sup.1H NMR (400 MHz, DMSO-d.sub.6, .delta.): 8.76 (d, J=2.0 Hz,
1H), 8.35 (d, J=1.4 Hz, 1H), 7.98 (d, J=9.2 Hz, 1H), 7.81 (s, 1H),
7.52 (dd, J=9.3, 2.8 Hz, 1H), 7.42 (d, J=2.9 Hz, 1H), 4.82 (s, 2H),
3.57-3.73 (m, 2H), 3.34-3.50 (m, 2H), 2.77 (s, 2H), 2.56 (s, 2H),
1.50 (s, 9H), 1.44-1.58 (m, 4H).
Step 3:
2-({3-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-spiro[indazole-5-
,4'-piperidin]-1'-yl)carbonyl]quinolin-6-yl}oxy)acetamide
[0337] To a suspension of
2-(3-(2-tert-butyl-7-oxo-2,4,6,7-tetrahydrospiro[indazole-5,4'-piperidine-
]-1'-ylcarbonyl)quinolin-6-yloxy)acetic acid (290 mg, 0.59 mmol) in
dichloromethane (6 mL) was added ammonia (2.36 mL, 1.18 mmol, 0.5 M
in 1,4-dioxane) and (1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyl
uronium hexafluorophosphate (225 mg, 0.591 mmol). The reaction was
stirred at room temperature overnight. The reaction was
concentrated and purified by flash column chromatography (0-10%
methanol/dichloromethane). The resulting material was dissolved in
ethyl acetate, washed with water and brine, dried over magnesium
sulfate, filtered, and concentrated to give the title compound (280
mg, 97%). +ESI (M+H) 490.4; .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 8.81 (d, J=2.1 Hz, 1H), 8.11 (d, J=2.1 Hz, 1H), 8.06 (d,
J=9.2 Hz, 1H), 7.46 (dd, J=9.3, 2.8 Hz, 1H), 7.41 (s, 1H), 7.11 (d,
J=2.7 Hz, 1H), 6.54 (br. s., 1H), 5.66 (br. s., 1H), 4.63 (s, 2H),
3.68-3.96 (m, 2H), 3.41-3.51 (m, 2H), 2.78 (s, 2H), 2.65 (s, 2H),
1.66-1.76 (m, 2H), 1.61 (s, 9H), 1.50-1.60 (m, 2H).
Example 47
1'-[(2-aminoquinolin-7-yl)carbonyl]-2-tert-butyl-2,4-dihydrospiro[indazole-
-5,4'-piperidin]-7(6H)-one
##STR00173##
[0339] The title compound was prepared by a method analogous to
that described for Example 25, using
2-tert-butyl-4,6-dihydrospiro[indazole-5,4'-piperidin]-7(2H)-one
hydrochloride salt. +ESI (M+H) 432.3; .sup.1H NMR (400 MHz,
CDCl.sub.3, .delta.): 8.10 (d, J=9.21 Hz, 1H), 7.82 (s, 1H), 7.76
(dd, J=7.95 Hz, 1H), 7.49 (dd, 1H), 7.43 (s, 1H), 6.87 (d, J=9.33
Hz, 1H), 3.95 (m, 1H), 3.64 (m, 1H), 3.26-3.46 (m, 2H), 2.79 (s,
2H), 2.66 (s, 2H), 1.57-1.80 (m, 4H), 1.61 (s, 9H).
Example 48
2-bicyclo[1.1.1]pent-1-yl-1'-(1H-indazol-5-ylcarbonyl)-2,4-dihydrospiro[in-
dazole-5,4'-piperidin]-7(6H)-one
##STR00174##
[0341] The title compound was prepared by a method analogous to
that described in Example 1, using
2-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piperidin]-7-
(2H)-one and 1H-indazole-5-carboxylic acid. +ESI (M+H) 416.2; HPLC
retention time 2.32 minutes (Method A).
Example 49
5-[(1-bicyclo[1.1.1]pent-1-yl-7-oxo-1,4,6,7-tetrahydro-1'H-spiro[indazole--
5,4'-piperidin]-1'-yl)carbonyl]-1H-indazole-3-carboxamide
##STR00175##
[0343] The title compound was prepared by a method analogous to
that described for Example 2, using
1-(bicyclo[1.1.1]pentan-1-yl)-4,6-dihydrospiro[indazole-5,4'-piperidin]-7-
(1H)-one hydrochloride and 3-carbamoyl-1H-indazole-5-carboxylic
acid. +APCl (M+H) 459.5; .sup.1H NMR (400 MHz, CDCl.sub.3,
.delta.): 8.42 (s, 1H), 7.50 (s, 2H), 7.35 (s, 1H), 6.93 (br. s.,
1H), 5.47 (br. s., 1H), 3.32-3.93 (m, 4H), 2.79 (s, 2H), 2.58 (s,
2H), 2.56 (s, 1H), 2.39 (s, 6H), 1.45-1.76 (m, 4H).
[0344] The following compounds shown in Table 4 can be prepared in
a manner analogous to the foregoing examples.
TABLE-US-00004 TABLE 4 ##STR00176## Example 50:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-1H-pyrrolo[3,2-
b]pyridine-3-carbonitrile ##STR00177## Example 51:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-1H-pyrrolo[2,3-
b]pyridine-3-carbonitrile ##STR00178## Example 52:
1'-[(2-aminoquinolin-6-yl)carbonyl]-
2-tert-butyl-2,4-dihydrospiro[indazole-5,4'- piperidin]-7(6H)-one
##STR00179## Example 53:
5-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-methyl-1H-
indole-3-carboxamide ##STR00180## Example 54:
6-[(1-isopropyl-7-oxo-1,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-methyl-1H-
indole-3-carboxamide ##STR00181## Example 55:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclopropyl-
1H-indazole-3-carboxamide ##STR00182## Example 56:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-isopropyl-
1H-indazole-3-carboxamide ##STR00183## Example 57:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-propyl-1H-
indazole-3-carboxamide ##STR00184## Example 58:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-(2-
methoxyethyl)-1H-indazole-3-carboxamide ##STR00185## Example 59:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclobutyl-
1H-indazole-3-carboxamide ##STR00186## Example 60:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-oxetan-3-yl-
1H-indazole-3-carboxamide ##STR00187## Example 61:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclopropyl-
1H-indazole-3-carboxamide ##STR00188## Example 62:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-methyl-1H-
indazole-3-carboxamide ##STR00189## Example 63:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-ethyl-1H-
indazole-3-carboxamide ##STR00190## Example 64:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-(2-
methoxyethyl)-1H-indazole-3-carboxamide ##STR00191## Example 65:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-isopropyl-
1H-indazole-3-carboxamide ##STR00192## Example 66:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-propyl-1H-
indazole-3-carboxamide ##STR00193## Example 67:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclopropyl-
1H-indole-3-carboxamide ##STR00194## Example 68:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclobutyl-
1H-indazole-3-carboxamide ##STR00195## Example 69:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-oxetan-3-yl-
1H-indazole-3-carboxamide ##STR00196## Example 70:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-(2-
methoxyethyl)-1H-indole-3-carboxamide ##STR00197## Example 71:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-methyl-1H-
indole-3-carboxamide ##STR00198## Example 72:
5-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-ethyl-1H-
indole-3-carboxamide ##STR00199## Example 73:
6-[(2-tert-butyl-7-oxo-2,4,6,7-tetrahydro-1'H-
spiro[indazole-5,4'-piperidin]-1'-yl)carbonyl]-N-cyclopropyl-
1H-indole-3-carboxamide
Pharmacological Data
Biological Protocols
[0345] The utility of the compounds of present invention, in the
treatment of diseases (such as are detailed herein) in animals,
particularly mammals (e.g., humans) may be demonstrated by the
activity thereof in conventional assays known to one of ordinary
skill in the art, including the in vitro and in vivo assays
described below. Such assays also provide a means whereby the
activities of the compound of the present invention can be compared
with the activities of other known compounds.
Direct Inhibition of the Activities of ACC1 and ACC2
[0346] The ACC inhibitory activity of the compound of the present
invention was demonstrated by methods based on standard procedures.
For example direct inhibition of ACC activity, for the compound of
Formula (I) was determined using preparations of recombinant human
ACC1 (rhACC1) and recombinant human ACC2 (rhACC2). Representative
sequences of the recombinant human ACC1 and ACC2 that can be used
in the assay are provided herein as SEQ ID NO. 1 and SEQ. ID NO. 2,
respectively.
[0347] [1] Preparation of rhACC1. Two liters of SF9 cells, infected
with recombinant baculovirus containing full length human ACC1
cDNA, were suspended in ice-cold lysis buffer (25 mM Tris, pH 7.5;
150 mM NaCl; 10% glycerol; 5 mM imidazole (EMD Bioscience;
Gibbstown, N.J.); 2 mM TCEP (BioVectra; Charlottetown, Canada);
Benzonase nuclease (10000 U/100 g cell paste; Novagen; Madison,
Wis.); EDTA-free protease inhibitor cocktail (1 tab/50 mL; Roche
Diagnostics; Mannheim, Germany). Cells were lysed by 3 cycles of
freeze-thaw and centrifuged at 40,000.times.g for 40 minutes
(4.degree. C.). Supernatant was directly loaded onto a HisTrap FF
crude column (GE Healthcare; Piscataway, N.J.) and eluted with an
imidazole gradient up to 0.5 M over 20 column volumes (CV).
ACC1-containing fractions were pooled and diluted 1:5 with 25 mM
Tris, pH 7.5, 2 mM TCEP, 10% glycerol and direct loaded onto a
CaptoQ (GE Healthcare) column and eluted with an NaCl gradient up
to 1 M over 20 CV's. Phosphate groups were removed from purified
ACC1 by incubation with lambda phosphatase (100 U/10 .mu.M target
protein; New England Biolabs; Beverly, Mass.) for 14 hours at
4.degree. C.; okadaic acid was added (1 .mu.M final concentration;
Roche Diagnostics) to inhibit the phosphatase. Purified ACC1 was
exchanged into 25 mM Tris, pH 7.5, 2 mM TCEP, 10% glycerol, 0.5 M
NaCl by 6 hour dialysis at 4.degree. C. Aliquots were prepared and
frozen at -80.degree. C.
[0348] [2] Measurement of rhACC1 inhibition. hACC1 was assayed in a
Costar #3676 (Costar, Cambridge, Mass.) 384-well plate using the
Transcreener ADP detection FP assay kit (Bellbrook Labs, Madison,
Wis.) using the manufacturer's recommended conditions for a 50
.mu.M ATP reaction. The final conditions for the assay were 50 mM
HEPES, pH 7.2, 10 mM MgCl.sub.2, 7.5 mM tripotassium citrate, 2 mM
DTT, 0.1 mg/mL BSA, 30 .mu.M acetyl-CoA, 50 .mu.M ATP, and 10 mM
KHCO.sub.3 Typically, a 10 .mu.l reaction was run for 120 min at
25.degree. C., and 10 .mu.l of Transcreener stop and detect buffer
was added and the combination incubated at room temp for an
additional 1 hour. The data was acquired on a Envision Fluorescence
reader (Perkinelmer) using a 620 excitation Cy5 FP general dual
mirror, 620 excitation Cy5 FP filter, 688 emission (S) and a 688
(P) emission filter.
[0349] [3] Preparation of rhACC2. Human ACC2 inhibition was
measured using purified recombinant human ACC2 (hrACC2). Briefly, a
full length Cytomax clone of ACC2 was purchased from Cambridge
Bioscience Limited and was sequenced and subcloned into PCDNA5 FRT
TO-TOPO (Invitrogen, Carlsbad, Calif.). The ACC2 was expressed in
CHO cells by tetracycline induction and harvested in 5 liters of
DMEM/F12 with glutamine, biotin, hygromycin and blasticidin with 1
.mu.g/mL tetracycline (Invitrogen, Carlsbad, Calif.). The
conditioned medium containing ACC2 was then applied to a Softlink
Soft Release Avidin column (Promega, Madison, Wis.) and eluted with
5 mM biotin. 4 mgs of ACC2 were eluted at a concentration of 0.05
mg/mL (determined by A280) with an estimated purity of 95%
(determined by A280). The purified ACC2 was dialyzed in 50 mM Tris,
200 mM NaCl, 4 mM DTT, 2 mM EDTA, and 5% glycerol. The pooled
protein was frozen and stored at -80.degree. C., with no loss of
activity upon thawing. For measurement of ACC2 activity and
assessment of ACC2 inhibition, test compounds were dissolved in
DMSO and added to the rhACC2 enzyme as a 5.times. stock with a
final DMSO concentration of 1%.
[0350] [4] Measurement of human ACC2 inhibition. hACC2 was assayed
in a Costar #3676 (Costar, Cambridge, Mass.) 384-well plate using
the Transcreener ADP detection FP assay kit (Bellbrook Labs,
Madison, Wis.) using the manufacturer's recommended conditions for
a 50 uM ATP reaction. The final conditions for the assay were 50 mM
HEPES, pH 7.2, 5 mM MgCl.sub.2, 5 mM tripotassium citrate, 2 mM
DTT, 0.1 mg/mL BSA, 30 .mu.M acetyl-CoA, 50 .mu.M ATP, and 8 mM
KHCO.sub.3. Typically, a 10 .mu.l reaction was run for 50 min at
25.degree. C., and 10 .mu.l of Transcreener stop and detect buffer
was added and the combination incubated at room temp for an
additional 1 hour. The data was acquired on an Envision
Fluorescence reader (Perkinelmer) using a 620 excitation Cy5 FP
general dual mirror, 620 excitation Cy5 FP filter, 688 emission (S)
and a 688 (P) emission filter.
[0351] The results using the recombinant hACC1 and recombinant
hACC2 Transcreener assays described above are summarized in the
table below for the Compounds of Formula (I) exemplified in the
Examples above.
TABLE-US-00005 hACC1 hACC2 Example IC50 (nM) n IC50 (nM) n 1 6.0 6
1.4 6 2 7.9 12 3.1 12 3 32 6 13 6 4 6.5 7 2.9 7 5 17 4 5.8 4 6 11 4
2.9 4 7 5.6 4 1.6 4 8 17 3 3.3 3 9 8.4 3 2.9 3 10 6.1 3 2.7 3 11 14
3 5.5 3 12 13 5 3.0 5 13 2.4 3 1.5 3 14 5.0 5 2.1 5 15 14 3 2.6 3
16 6.7 3 3.1 3 17 19 3 11 3 18 33 3 22 3 19 63 3 15 3 20 13 4 3.0 4
21 47 4 6.7 4 22 30 3 6.9 3 23 32 3 15 3 24 43 1 20 1 25 12 2 10 1
26 7.4 3 2.1 3 27 5.5 3 3.5 3 28 6.5 5 1.3 5 29 8.6 6 1.7 7 30 9.4
4 2.6 4 31 3.8 4 1.3 4 32 8.1 4 1.5 4 33 3.1 4 1.0 4 34 8.1 3 2.8 3
35 12 4 1.4 4 36 4.0 5 1.7 5 37 2.9 7 1.3 7 38 4.3 3 1.1 3 39 9.8 3
1.5 3 40 2.2 3 1.3 3 41 18 7 3.7 7 42 6.6 3 1.8 3 43 6.4 4 2.8 4 44
31 3 5.4 3 45 23 4 2.8 4 46 14 3 3.8 3 47 5.3 4 1.3 4 48 32 3 5.6 3
49 12 3 8.4 3
[0352] SEQ. ID NO. 1 provides a sequence of recombinant human ACC1
(SEQ. ID NO. 1) that can be employed in the Transcreener in vitro
assay.
TABLE-US-00006 Sequence of hACC1 SEQ. ID NO. 1:
MAHHHHHHDEVDDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKL
DLLEKEGSLSPASVGSDTLSDLGISSLQDGLALHIRSSMSGLHLVKQGRD
RKKIDSQRDFTVASPAEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRW
SYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANV
ELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWAL
GDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQELYEKGY
VKDVDDGLQAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAE
VPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEE
APATIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNP
RLQVEHPCTEMVADVNLPAAQLQIAMGIPLYRIKDIRMMYGVSPWGDSPI
DFEDSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGY
FSVAAAGGLHEFADSQFGH
CFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQMNRID
TGWLDRLIAEKVQAERPDTMLGVVCGALHVADVSLRNSVSNFLHSLERGQ
VLPAHTLLNTVDVELIYEGVKYVLKVTRQSPNSYVVIMNGSCVEVDVHRL
SDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVMRSPSA
GKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAAL
DPGCVLAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDN
LVNVMNGYCLPDPFFSSKVKDWVERLMKTLRDPSLPLLELQDIMTSVSGR
IPPNVEKSIKKEMAQYASNITSVLCQFPSQQIANILDSHAATLNRKSERE
VFFMNTQSIVQLVQRYRSGIRGHMKAVVMDLLRQYLRVETQFQNGHYDKC
VFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLCGRDPTLTDEL
LNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAID
MYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYI
AYELNSVQHRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFSSNLNHY
GMTHVASVSDVLLDNSFTPPCQRMGGMVSFRTFEDFVRIFDEVMGCFSDS
PPQSPTFPEAGHTSLYDEDKVPRDEPIHILNVAIKTDCDIEDDRLAAMFR
EFTQQNKATLVDHGIRRLTFLVAQKDFRKQVNYEVDRRFHREFPKFFTFR
ARDKFEEDRIYRHLEPALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAK
VEVGTEVTDYRFFVRAIIRHSDLVTKEASFEYLQNEGERLLLEAMDELEV
AFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVRSMVMRYGSRLWKLRVL
QAELKINIRLTPTGKAIPIRLFLTNESGYYLDISLYKEVTDSRTAQIMFQ
AYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSL
IKLWESMSTQAFLPSPPLPSDMLTYTELVLDDQGQLVHMNRLPGGNEIGM
VAWKMTFKSPEYPEGRDIIVIGNDITYRIGSFGPQEDLLFLRASELARAE
GIPRIYVSANSGARIGLAEEIRHMFHVAWVDPEDPYKGYRYLYLTPQDYK
RVSALNSVHCEHVEDEGESRYKITDIIGKEEIGPENLRGSGMIAGESSLA
YNEIITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVLGR
EVYTSNNQLGGIQIMHNNGVTHCTVCDDFEGVFTVLHWLSYMPKSVHSSV
PLLNSKDPIDRIIEFVPTKTPYDPRWMLAGRPHPTQKGQWLSGFFDYGSF
SEIMQPWAQTVVVGRARLGGIPVGVVAVETRTVELSIPADPANLDSEAKI
IQQAGQVWFPDSAFKTYQAIKDFNREGLPLMVFANWRGFSGGMKDMYDQV
LKFGAYIVDGLRECCQPVLVYIPPQAELRGGSWVVIDSSINPRHMEMYAD
RESRGSVLEPEGTVEIKFRRKDLVKTMRRVDPVYIHLAERLGTPELSTAE
RKELENKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVISDILDWKT
SRTFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVK
AYVWDNNKDLAEWLEKQLTEEDGVHSVIEENIKCISRDYVLKQIRSLVQA
NPEVAMDSIIHMTQHISPTQRAEVIRILSTMDSPST
[0353] SEQ. ID NO. 2 provides a sequence of recombinant human ACC2
(SEQ. ID NO. 2) that can be employed in the Transcreener in vitro
assay.
TABLE-US-00007 Sequence of hACC2 SEQ. ID NO. 2:
MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPA
SDNSGETPQRNGEGHTLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPP
RNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQGQQAGSPSKE
DKKQANIKRQLMTNFILGSFDDYSSDEDSVAGSSRESTRKGSRASLGALS
LEAYLTTGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEF
VTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAG
WGHASENPKLPELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTL
PWSGSGLTVEWTEDDLQQGKRISVPEDVYDKGCVKDVDEGLEAAERIGFP
LMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPIFLMKLAQHARH
LEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQC
AIRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIA
ARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQF
GHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLINLLETESFQNND
IDTGWLDYLIAEKVQAEKPDIMLGVVCGALNVADAMFRTCMTDFLHSLER
GQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIMNGCHIEIDAH
RLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGA
VLEAGCVVARLELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVL
ENLTNVMSGFCLPEPVFSIKLKEWVQKLMMTLRHPSLPLLELQEIMTSVA
GRIPAPVEKSVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKAD
REVFFINTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLRVEHHFQQAHYD
KCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSA
IDMYGHQFCPENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRG
YIAYELNSLQHRQLPDGTCVVEFQFMLPSSHPNRMTVPISITNPDLLRHS
TELFMDSGFSPLCQRMGAMVAFRRFEDFTRNFDEVISCFANVPKDTPLFS
EARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVPILRTFVQSKK
NILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRFFIRAIIRHSD
LITKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTV
IMDPFKIEESVRYMVMRYGSRLWKLRVLQAEVKINIRQTTTGSAVPIRLF
ITNESGYYLDISLYKEVTDSRSGNIMFHSFGNKQGPQHGMLINTPYVTKD
LLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPKDILTYTELVL
DSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWV
DPEDPHKGFKYLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKD
DGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVI
QVENSHIILTGASALNKVLGREVYTSNNQLGGVQIMHYNGVSHITVPDDF
EGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSRAPYDPRWMLA
GRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLP
LMIFANWRGFSGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELR
GGSWVVIDATINPLCIEMYADKESRGGVLEPEGTVEIKFRKKDLIKSMRR
IDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVAVQFADF
HDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVKQEILQASGEL
SHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQAGDGPRSTIR
ENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLS TMDSPAST
[0354] Acute In Vivo Assessment of ACC Inhibition in Experimental
Animals
[0355] The ACC inhibitory activity of the compounds of the present
invention can be confirmed in vivo by evaluation of their ability
to reduce malonyl-CoA levels in liver and muscle tissue from
treated animals.
[0356] Measurement of malonyl-CoA production inhibition in
experimental animals can be determined using the following
methodology.
[0357] In this method, male Sprague-Dawley Rats, maintained on
standard chow and water ad libitum (225-275 g), were randomized
prior to the study. Animals were either fed, or fasted for 18 hours
prior to the beginning of the experiment. Two hours into the light
cycle the animals were orally dosed with a volume of 5 mL/kg, (0.5%
methyl cellulose; vehicle) or with the appropriate compound
(prepared in vehicle). Fed vehicle controls were included to
determine baseline tissue malonyl-CoA levels while fasted animals
were included to determine the effect fasting had on malonyl-CoA
levels. One hour after compound administration the animals were
asphyxiated with CO.sub.2 and the tissues were removed.
Specifically, blood was collected by cardiac puncture and placed
into BD Microtainer tubes containing EDTA (BD Biosciences, N.J.),
mixed, and placed on ice. Plasma was used to determine drug
exposure. Liver and quadriceps were removed, immediately
freeze-clamped, wrapped in foil and stored in liquid nitrogen.
[0358] Tissues were pulverized under liquid N.sub.2 to ensure
uniformity in sampling. Malonyl-CoA was extracted from the tissue
(150-200 mg) with 5 volumes 10% tricarboxylic acid in Lysing Matrix
A (MP Biomedicals, PN 6910) in a FastPrep FP120 (Thermo Scientific,
speed=5.5; for 45 seconds). The supernatant containing malonyl-CoA
was removed from the cell debris after centrifugation at
15000.times.g for 30 minutes (Eppendorf Centrifuge 5402). Samples
were stably frozen at -80 C until analysis was completed.
[0359] Analysis of malonyl CoA levels in liver and muscle tissue
can be evaluated using the following methodology.
[0360] The method utilized the following materials: Malonyl-CoA
tetralithium salt and malonyl-.sup.13C.sub.3-CoA trilithium salt
which were purchased from Isotec (Miamisburg, Ohio, USA), sodium
perchlorate (Sigma, cat no. 410241), trichloroacetic acid (ACROS,
cat no. 42145), phosphoric acid (J. T. Baker, cat no. 0260-01),
ammonium formate (Fluka, cat no. 17843), methanol (HPLC grade, J.
T. Baker, cat no. 9093-33), and water (HPLC grade, J. T. Baker,
4218-03) were used to make the necessary mobile phases. Strata-X
on-line solid phase extraction columns, 25 .mu.m, 20 mm.times.2.0
mm I.D (cat no. 00M-S033-B0-CB) were obtained from Phenomenex
(Torrance, Calif., USA). SunFire C18 reversed-phase columns, 3.5
.mu.m, 100 mm.times.3.0 mm I.D. (cat no. 186002543) were purchased
from Waters Corporation (Milford, Mass., USA).
[0361] This method may be performed utilizing the following
equipment. Two-dimensional chromatography using an Agilent 1100
binary pump, an Agilent 1100 quaternary pump and two Valco
Cheminert 6-port two position valves. Samples were introduced via a
LEAP HTC PAL auto sampler with Peltier cooled stack maintained at
10.degree. C. and a 20 .mu.L sampling loop. The needle wash
solutions for the autosampler were 10% trichloroacetic acid in
water (w/v) for Wash 1 and 90:10 methanol:water for Wash 2. The
analytical column (Sunfire) was maintained at 35.degree. C. using a
MicroTech Scientific Micro-LC Column Oven. The eluent was analyzed
on an ABI Sciex API3000 triple quadrupole mass spectrometer with
Turbo Ion Spray.
[0362] Two-dimensional chromatography was performed in parallel
using distinct gradient elution conditions for on-line solid phase
extraction and reversed-phase chromatography. The general design of
the method was such that the first dimension was utilized for
sample clean-up and capture of the analyte of interest followed by
a brief coupling of both dimensions for elution from the first
dimension onto the second dimension. The dimensions were
subsequently uncoupled allowing for gradient elution of the analyte
from the second dimension for quantification while simultaneously
preparing the first dimension for the next sample in the sequence.
When both dimensions were briefly coupled together, the flow of the
mobile phase in the first dimension was reversed for analyte
elution on to the second dimension, allowing for optimal peak
width, peak shape, and elution time.
[0363] The first dimension of the HPLC system utilized the
Phenomenex strata-X on-line solid phase extraction column and the
mobile phase consisted of 100 mM sodium perchlorate/0.1% (v/v)
phosphoric acid for solvent A and methanol for solvent B.
[0364] The second dimension of the HPLC system utilized the Waters
SunFire C18 reversed-phase column and the mobile phase consisted of
100 mM ammonium formate for solvent A and methanol for solvent B.
The initial condition of the gradient was maintained for 2 minutes
and during this time the analyte was transferred to the analytical
column. It was important that the initial condition was at a
sufficient strength to elute the analyte from the on-line SPE
column while retaining it on the analytical. Afterwards, the
gradient rose linearly to 74.5% A in 4.5 minutes before a wash and
re-equilibration step.
[0365] Mass spectrometry when coupled with HPLC can be a highly
selective and sensitive method for quantitatively measuring
analytes in complex matrices but is still subject to interferences
and suppression. By coupling a two dimensional HPLC to the mass
spectrometer, these interferences were significantly reduced.
Additionally, by utilizing the Multiple Reaction Monitoring (MRM)
feature of the triple quadrupole mass spectrometer, the
signal-to-noise ratio was significantly improved.
[0366] For this assay, the mass spectrometer was operated in
positive ion mode with a TurbolonSpray voltage of 2250V. The
nebulizing gas was heated to 450.degree. C. The Declustering
Potential (DP), Focusing Potential (FP), and Collision Energy (CE)
were set to 60, 340, and 42 V, respectively. Quadrupole 1 (Q1)
resolution was set to unit resolution with Quadrupole 3 (Q3) set to
low. The CAD gas was set to 8. The MRM transitions monitored were
for malonyl CoA: 854.1.fwdarw.347.0 m/z (L. Gao et al. (2007) J.
Chromatogr. B 853, 303-313); and for malonyl-.sup.13C.sub.3-CoA:
857.1.fwdarw.350.0 m/z with dwell times of 200 ms. The eluent was
diverted to the mass spectrometer near the expected elution time
for the analyte, otherwise it was diverted to waste to help
preserve the source and improve robustness of the instrumentation.
The resulting chromatograms were integrated using Analyst software
(Applied Biosystems). Tissue concentrations for malonyl CoA were
calculated from a standard curve prepared in a 10% solution of
trichloroacetic acid in water.
[0367] Samples comprising the standard curve for the quantification
of malonyl-CoA in tissue extracts were prepared in 10% (w/v)
trichloroacetic acid (TCA) and ranged from 0.01 to 1 pmol/.mu.L.
Malonyl-.sup.13C.sub.3-CoA (final concentration of 0.4 pmol/.mu.L)
was added to each standard curve component and sample as an
internal standard.
[0368] Six intra-assay quality controls were prepared; three from a
pooled extract prepared from fasted animals and three from a pool
made from fed animals. These were run as independent samples spiked
with 0, 0.1 or 0.3 pmol/.mu.L .sup.12C-malonyl-CoA as well as
malonyl-.sup.13C.sub.3-CoA (0.4 pmol/.mu.L). Each intra-assay
quality control contained 85% of aqueous tissue extract with the
remaining portion contributed by internal standard (0.4 pmol/.mu.L)
and .sup.12C-malonyl-CoA. Inter assay controls were included in
each run; they consist of one fasted and one fed pooled sample of
quadriceps and/or one fasted and one fed pooled sample of liver.
All such controls are spiked with malonyl-.sup.13C.sub.3-CoA (0.4
pmol/.mu.L).
[0369] All publications, including but not limited to issued
patents, patent applications, and journal articles, cited in this
application are each herein incorporated by reference in their
entirety.
[0370] Although the invention has been described above with
reference to the disclosed embodiments, those skilled in the art
will readily appreciate that the specific experiments detailed are
only illustrative of the invention. It should be understood that
various modifications can be made without departing from the spirit
of the invention. Accordingly, the invention is limited only by the
following claims.
Sequence CWU 1
1
212356PRTHomo sapiens 1Met Ala His His His His His His Asp Glu Val
Asp Asp Glu Pro Ser 1 5 10 15 Pro Leu Ala Gln Pro Leu Glu Leu Asn
Gln His Ser Arg Phe Ile Ile 20 25 30 Gly Ser Val Ser Glu Asp Asn
Ser Glu Asp Glu Ile Ser Asn Leu Val 35 40 45 Lys Leu Asp Leu Leu
Glu Lys Glu Gly Ser Leu Ser Pro Ala Ser Val 50 55 60 Gly Ser Asp
Thr Leu Ser Asp Leu Gly Ile Ser Ser Leu Gln Asp Gly 65 70 75 80 Leu
Ala Leu His Ile Arg Ser Ser Met Ser Gly Leu His Leu Val Lys 85 90
95 Gln Gly Arg Asp Arg Lys Lys Ile Asp Ser Gln Arg Asp Phe Thr Val
100 105 110 Ala Ser Pro Ala Glu Phe Val Thr Arg Phe Gly Gly Asn Lys
Val Ile 115 120 125 Glu Lys Val Leu Ile Ala Asn Asn Gly Ile Ala Ala
Val Lys Cys Met 130 135 140 Arg Ser Ile Arg Arg Trp Ser Tyr Glu Met
Phe Arg Asn Glu Arg Ala 145 150 155 160 Ile Arg Phe Val Val Met Val
Thr Pro Glu Asp Leu Lys Ala Asn Ala 165 170 175 Glu Tyr Ile Lys Met
Ala Asp His Tyr Val Pro Val Pro Gly Gly Pro 180 185 190 Asn Asn Asn
Asn Tyr Ala Asn Val Glu Leu Ile Leu Asp Ile Ala Lys 195 200 205 Arg
Ile Pro Val Gln Ala Val Trp Ala Gly Trp Gly His Ala Ser Glu 210 215
220 Asn Pro Lys Leu Pro Glu Leu Leu Leu Lys Asn Gly Ile Ala Phe Met
225 230 235 240 Gly Pro Pro Ser Gln Ala Met Trp Ala Leu Gly Asp Lys
Ile Ala Ser 245 250 255 Ser Ile Val Ala Gln Thr Ala Gly Ile Pro Thr
Leu Pro Trp Ser Gly 260 265 270 Ser Gly Leu Arg Val Asp Trp Gln Glu
Asn Asp Phe Ser Lys Arg Ile 275 280 285 Leu Asn Val Pro Gln Glu Leu
Tyr Glu Lys Gly Tyr Val Lys Asp Val 290 295 300 Asp Asp Gly Leu Gln
Ala Ala Glu Glu Val Gly Tyr Pro Val Met Ile 305 310 315 320 Lys Ala
Ser Glu Gly Gly Gly Gly Lys Gly Ile Arg Lys Val Asn Asn 325 330 335
Ala Asp Asp Phe Pro Asn Leu Phe Arg Gln Val Gln Ala Glu Val Pro 340
345 350 Gly Ser Pro Ile Phe Val Met Arg Leu Ala Lys Gln Ser Arg His
Leu 355 360 365 Glu Val Gln Ile Leu Ala Asp Gln Tyr Gly Asn Ala Ile
Ser Leu Phe 370 375 380 Gly Arg Asp Cys Ser Val Gln Arg Arg His Gln
Lys Ile Ile Glu Glu 385 390 395 400 Ala Pro Ala Thr Ile Ala Thr Pro
Ala Val Phe Glu His Met Glu Gln 405 410 415 Cys Ala Val Lys Leu Ala
Lys Met Val Gly Tyr Val Ser Ala Gly Thr 420 425 430 Val Glu Tyr Leu
Tyr Ser Gln Asp Gly Ser Phe Tyr Phe Leu Glu Leu 435 440 445 Asn Pro
Arg Leu Gln Val Glu His Pro Cys Thr Glu Met Val Ala Asp 450 455 460
Val Asn Leu Pro Ala Ala Gln Leu Gln Ile Ala Met Gly Ile Pro Leu 465
470 475 480 Tyr Arg Ile Lys Asp Ile Arg Met Met Tyr Gly Val Ser Pro
Trp Gly 485 490 495 Asp Ser Pro Ile Asp Phe Glu Asp Ser Ala His Val
Pro Cys Pro Arg 500 505 510 Gly His Val Ile Ala Ala Arg Ile Thr Ser
Glu Asn Pro Asp Glu Gly 515 520 525 Phe Lys Pro Ser Ser Gly Thr Val
Gln Glu Leu Asn Phe Arg Ser Asn 530 535 540 Lys Asn Val Trp Gly Tyr
Phe Ser Val Ala Ala Ala Gly Gly Leu His 545 550 555 560 Glu Phe Ala
Asp Ser Gln Phe Gly His Cys Phe Ser Trp Gly Glu Asn 565 570 575 Arg
Glu Glu Ala Ile Ser Asn Met Val Val Ala Leu Lys Glu Leu Ser 580 585
590 Ile Arg Gly Asp Phe Arg Thr Thr Val Glu Tyr Leu Ile Lys Leu Leu
595 600 605 Glu Thr Glu Ser Phe Gln Met Asn Arg Ile Asp Thr Gly Trp
Leu Asp 610 615 620 Arg Leu Ile Ala Glu Lys Val Gln Ala Glu Arg Pro
Asp Thr Met Leu 625 630 635 640 Gly Val Val Cys Gly Ala Leu His Val
Ala Asp Val Ser Leu Arg Asn 645 650 655 Ser Val Ser Asn Phe Leu His
Ser Leu Glu Arg Gly Gln Val Leu Pro 660 665 670 Ala His Thr Leu Leu
Asn Thr Val Asp Val Glu Leu Ile Tyr Glu Gly 675 680 685 Val Lys Tyr
Val Leu Lys Val Thr Arg Gln Ser Pro Asn Ser Tyr Val 690 695 700 Val
Ile Met Asn Gly Ser Cys Val Glu Val Asp Val His Arg Leu Ser 705 710
715 720 Asp Gly Gly Leu Leu Leu Ser Tyr Asp Gly Ser Ser Tyr Thr Thr
Tyr 725 730 735 Met Lys Glu Glu Val Asp Arg Tyr Arg Ile Thr Ile Gly
Asn Lys Thr 740 745 750 Cys Val Phe Glu Lys Glu Asn Asp Pro Ser Val
Met Arg Ser Pro Ser 755 760 765 Ala Gly Lys Leu Ile Gln Tyr Ile Val
Glu Asp Gly Gly His Val Phe 770 775 780 Ala Gly Gln Cys Tyr Ala Glu
Ile Glu Val Met Lys Met Val Met Thr 785 790 795 800 Leu Thr Ala Val
Glu Ser Gly Cys Ile His Tyr Val Lys Arg Pro Gly 805 810 815 Ala Ala
Leu Asp Pro Gly Cys Val Leu Ala Lys Met Gln Leu Asp Asn 820 825 830
Pro Ser Lys Val Gln Gln Ala Glu Leu His Thr Gly Ser Leu Pro Arg 835
840 845 Ile Gln Ser Thr Ala Leu Arg Gly Glu Lys Leu His Arg Val Phe
His 850 855 860 Tyr Val Leu Asp Asn Leu Val Asn Val Met Asn Gly Tyr
Cys Leu Pro 865 870 875 880 Asp Pro Phe Phe Ser Ser Lys Val Lys Asp
Trp Val Glu Arg Leu Met 885 890 895 Lys Thr Leu Arg Asp Pro Ser Leu
Pro Leu Leu Glu Leu Gln Asp Ile 900 905 910 Met Thr Ser Val Ser Gly
Arg Ile Pro Pro Asn Val Glu Lys Ser Ile 915 920 925 Lys Lys Glu Met
Ala Gln Tyr Ala Ser Asn Ile Thr Ser Val Leu Cys 930 935 940 Gln Phe
Pro Ser Gln Gln Ile Ala Asn Ile Leu Asp Ser His Ala Ala 945 950 955
960 Thr Leu Asn Arg Lys Ser Glu Arg Glu Val Phe Phe Met Asn Thr Gln
965 970 975 Ser Ile Val Gln Leu Val Gln Arg Tyr Arg Ser Gly Ile Arg
Gly His 980 985 990 Met Lys Ala Val Val Met Asp Leu Leu Arg Gln Tyr
Leu Arg Val Glu 995 1000 1005 Thr Gln Phe Gln Asn Gly His Tyr Asp
Lys Cys Val Phe Ala Leu 1010 1015 1020 Arg Glu Glu Asn Lys Ser Asp
Met Asn Thr Val Leu Asn Tyr Ile 1025 1030 1035 Phe Ser His Ala Gln
Val Thr Lys Lys Asn Leu Leu Val Thr Met 1040 1045 1050 Leu Ile Asp
Gln Leu Cys Gly Arg Asp Pro Thr Leu Thr Asp Glu 1055 1060 1065 Leu
Leu Asn Ile Leu Thr Glu Leu Thr Gln Leu Ser Lys Thr Thr 1070 1075
1080 Asn Ala Lys Val Ala Leu Arg Ala Arg Gln Val Leu Ile Ala Ser
1085 1090 1095 His Leu Pro Ser Tyr Glu Leu Arg His Asn Gln Val Glu
Ser Ile 1100 1105 1110 Phe Leu Ser Ala Ile Asp Met Tyr Gly His Gln
Phe Cys Ile Glu 1115 1120 1125 Asn Leu Gln Lys Leu Ile Leu Ser Glu
Thr Ser Ile Phe Asp Val 1130 1135 1140 Leu Pro Asn Phe Phe Tyr His
Ser Asn Gln Val Val Arg Met Ala 1145 1150 1155 Ala Leu Glu Val Tyr
Val Arg Arg Ala Tyr Ile Ala Tyr Glu Leu 1160 1165 1170 Asn Ser Val
Gln His Arg Gln Leu Lys Asp Asn Thr Cys Val Val 1175 1180 1185 Glu
Phe Gln Phe Met Leu Pro Thr Ser His Pro Asn Arg Gly Asn 1190 1195
1200 Ile Pro Thr Leu Asn Arg Met Ser Phe Ser Ser Asn Leu Asn His
1205 1210 1215 Tyr Gly Met Thr His Val Ala Ser Val Ser Asp Val Leu
Leu Asp 1220 1225 1230 Asn Ser Phe Thr Pro Pro Cys Gln Arg Met Gly
Gly Met Val Ser 1235 1240 1245 Phe Arg Thr Phe Glu Asp Phe Val Arg
Ile Phe Asp Glu Val Met 1250 1255 1260 Gly Cys Phe Ser Asp Ser Pro
Pro Gln Ser Pro Thr Phe Pro Glu 1265 1270 1275 Ala Gly His Thr Ser
Leu Tyr Asp Glu Asp Lys Val Pro Arg Asp 1280 1285 1290 Glu Pro Ile
His Ile Leu Asn Val Ala Ile Lys Thr Asp Cys Asp 1295 1300 1305 Ile
Glu Asp Asp Arg Leu Ala Ala Met Phe Arg Glu Phe Thr Gln 1310 1315
1320 Gln Asn Lys Ala Thr Leu Val Asp His Gly Ile Arg Arg Leu Thr
1325 1330 1335 Phe Leu Val Ala Gln Lys Asp Phe Arg Lys Gln Val Asn
Tyr Glu 1340 1345 1350 Val Asp Arg Arg Phe His Arg Glu Phe Pro Lys
Phe Phe Thr Phe 1355 1360 1365 Arg Ala Arg Asp Lys Phe Glu Glu Asp
Arg Ile Tyr Arg His Leu 1370 1375 1380 Glu Pro Ala Leu Ala Phe Gln
Leu Glu Leu Asn Arg Met Arg Asn 1385 1390 1395 Phe Asp Leu Thr Ala
Ile Pro Cys Ala Asn His Lys Met His Leu 1400 1405 1410 Tyr Leu Gly
Ala Ala Lys Val Glu Val Gly Thr Glu Val Thr Asp 1415 1420 1425 Tyr
Arg Phe Phe Val Arg Ala Ile Ile Arg His Ser Asp Leu Val 1430 1435
1440 Thr Lys Glu Ala Ser Phe Glu Tyr Leu Gln Asn Glu Gly Glu Arg
1445 1450 1455 Leu Leu Leu Glu Ala Met Asp Glu Leu Glu Val Ala Phe
Asn Asn 1460 1465 1470 Thr Asn Val Arg Thr Asp Cys Asn His Ile Phe
Leu Asn Phe Val 1475 1480 1485 Pro Thr Val Ile Met Asp Pro Ser Lys
Ile Glu Glu Ser Val Arg 1490 1495 1500 Ser Met Val Met Arg Tyr Gly
Ser Arg Leu Trp Lys Leu Arg Val 1505 1510 1515 Leu Gln Ala Glu Leu
Lys Ile Asn Ile Arg Leu Thr Pro Thr Gly 1520 1525 1530 Lys Ala Ile
Pro Ile Arg Leu Phe Leu Thr Asn Glu Ser Gly Tyr 1535 1540 1545 Tyr
Leu Asp Ile Ser Leu Tyr Lys Glu Val Thr Asp Ser Arg Thr 1550 1555
1560 Ala Gln Ile Met Phe Gln Ala Tyr Gly Asp Lys Gln Gly Pro Leu
1565 1570 1575 His Gly Met Leu Ile Asn Thr Pro Tyr Val Thr Lys Asp
Leu Leu 1580 1585 1590 Gln Ser Lys Arg Phe Gln Ala Gln Ser Leu Gly
Thr Thr Tyr Ile 1595 1600 1605 Tyr Asp Ile Pro Glu Met Phe Arg Gln
Ser Leu Ile Lys Leu Trp 1610 1615 1620 Glu Ser Met Ser Thr Gln Ala
Phe Leu Pro Ser Pro Pro Leu Pro 1625 1630 1635 Ser Asp Met Leu Thr
Tyr Thr Glu Leu Val Leu Asp Asp Gln Gly 1640 1645 1650 Gln Leu Val
His Met Asn Arg Leu Pro Gly Gly Asn Glu Ile Gly 1655 1660 1665 Met
Val Ala Trp Lys Met Thr Phe Lys Ser Pro Glu Tyr Pro Glu 1670 1675
1680 Gly Arg Asp Ile Ile Val Ile Gly Asn Asp Ile Thr Tyr Arg Ile
1685 1690 1695 Gly Ser Phe Gly Pro Gln Glu Asp Leu Leu Phe Leu Arg
Ala Ser 1700 1705 1710 Glu Leu Ala Arg Ala Glu Gly Ile Pro Arg Ile
Tyr Val Ser Ala 1715 1720 1725 Asn Ser Gly Ala Arg Ile Gly Leu Ala
Glu Glu Ile Arg His Met 1730 1735 1740 Phe His Val Ala Trp Val Asp
Pro Glu Asp Pro Tyr Lys Gly Tyr 1745 1750 1755 Arg Tyr Leu Tyr Leu
Thr Pro Gln Asp Tyr Lys Arg Val Ser Ala 1760 1765 1770 Leu Asn Ser
Val His Cys Glu His Val Glu Asp Glu Gly Glu Ser 1775 1780 1785 Arg
Tyr Lys Ile Thr Asp Ile Ile Gly Lys Glu Glu Gly Ile Gly 1790 1795
1800 Pro Glu Asn Leu Arg Gly Ser Gly Met Ile Ala Gly Glu Ser Ser
1805 1810 1815 Leu Ala Tyr Asn Glu Ile Ile Thr Ile Ser Leu Val Thr
Cys Arg 1820 1825 1830 Ala Ile Gly Ile Gly Ala Tyr Leu Val Arg Leu
Gly Gln Arg Thr 1835 1840 1845 Ile Gln Val Glu Asn Ser His Leu Ile
Leu Thr Gly Ala Gly Ala 1850 1855 1860 Leu Asn Lys Val Leu Gly Arg
Glu Val Tyr Thr Ser Asn Asn Gln 1865 1870 1875 Leu Gly Gly Ile Gln
Ile Met His Asn Asn Gly Val Thr His Cys 1880 1885 1890 Thr Val Cys
Asp Asp Phe Glu Gly Val Phe Thr Val Leu His Trp 1895 1900 1905 Leu
Ser Tyr Met Pro Lys Ser Val His Ser Ser Val Pro Leu Leu 1910 1915
1920 Asn Ser Lys Asp Pro Ile Asp Arg Ile Ile Glu Phe Val Pro Thr
1925 1930 1935 Lys Thr Pro Tyr Asp Pro Arg Trp Met Leu Ala Gly Arg
Pro His 1940 1945 1950 Pro Thr Gln Lys Gly Gln Trp Leu Ser Gly Phe
Phe Asp Tyr Gly 1955 1960 1965 Ser Phe Ser Glu Ile Met Gln Pro Trp
Ala Gln Thr Val Val Val 1970 1975 1980 Gly Arg Ala Arg Leu Gly Gly
Ile Pro Val Gly Val Val Ala Val 1985 1990 1995 Glu Thr Arg Thr Val
Glu Leu Ser Ile Pro Ala Asp Pro Ala Asn 2000 2005 2010 Leu Asp Ser
Glu Ala Lys Ile Ile Gln Gln Ala Gly Gln Val Trp 2015 2020 2025 Phe
Pro Asp Ser Ala Phe Lys Thr Tyr Gln Ala Ile Lys Asp Phe 2030 2035
2040 Asn Arg Glu Gly Leu Pro Leu Met Val Phe Ala Asn Trp Arg Gly
2045 2050 2055 Phe Ser Gly Gly Met Lys Asp Met Tyr Asp Gln Val Leu
Lys Phe 2060 2065 2070 Gly Ala Tyr Ile Val Asp Gly Leu Arg Glu Cys
Cys Gln Pro Val 2075 2080 2085 Leu Val Tyr Ile Pro Pro Gln Ala Glu
Leu Arg Gly Gly Ser Trp 2090 2095 2100 Val Val Ile Asp Ser Ser Ile
Asn Pro Arg His Met Glu Met Tyr 2105 2110 2115 Ala Asp Arg Glu Ser
Arg Gly Ser Val Leu Glu Pro Glu Gly Thr 2120 2125 2130 Val Glu Ile
Lys Phe Arg Arg Lys Asp Leu Val Lys Thr Met Arg 2135 2140 2145 Arg
Val Asp Pro Val Tyr Ile His Leu Ala Glu Arg Leu Gly Thr 2150 2155
2160 Pro Glu Leu Ser Thr Ala Glu Arg Lys Glu Leu Glu Asn Lys Leu
2165 2170 2175 Lys Glu Arg Glu Glu Phe Leu Ile Pro Ile Tyr His Gln
Val Ala 2180 2185 2190 Val Gln Phe Ala Asp Leu His Asp Thr Pro Gly
Arg Met Gln Glu 2195 2200 2205 Lys Gly Val Ile Ser Asp Ile Leu Asp
Trp Lys Thr Ser Arg Thr 2210 2215 2220 Phe Phe Tyr Trp Arg Leu Arg
Arg Leu Leu Leu Glu Asp Leu Val 2225 2230 2235 Lys Lys Lys Ile His
Asn Ala
Asn Pro Glu Leu Thr Asp Gly Gln 2240 2245 2250 Ile Gln Ala Met Leu
Arg Arg Trp Phe Val Glu Val Glu Gly Thr 2255 2260 2265 Val Lys Ala
Tyr Val Trp Asp Asn Asn Lys Asp Leu Ala Glu Trp 2270 2275 2280 Leu
Glu Lys Gln Leu Thr Glu Glu Asp Gly Val His Ser Val Ile 2285 2290
2295 Glu Glu Asn Ile Lys Cys Ile Ser Arg Asp Tyr Val Leu Lys Gln
2300 2305 2310 Ile Arg Ser Leu Val Gln Ala Asn Pro Glu Val Ala Met
Asp Ser 2315 2320 2325 Ile Ile His Met Thr Gln His Ile Ser Pro Thr
Gln Arg Ala Glu 2330 2335 2340 Val Ile Arg Ile Leu Ser Thr Met Asp
Ser Pro Ser Thr 2345 2350 2355 22458PRTHomo sapiens 2Met Val Leu
Leu Leu Cys Leu Ser Cys Leu Ile Phe Ser Cys Leu Thr 1 5 10 15 Phe
Ser Trp Leu Lys Ile Trp Gly Lys Met Thr Asp Ser Lys Pro Ile 20 25
30 Thr Lys Ser Lys Ser Glu Ala Asn Leu Ile Pro Ser Gln Glu Pro Phe
35 40 45 Pro Ala Ser Asp Asn Ser Gly Glu Thr Pro Gln Arg Asn Gly
Glu Gly 50 55 60 His Thr Leu Pro Lys Thr Pro Ser Gln Ala Glu Pro
Ala Ser His Lys 65 70 75 80 Gly Pro Lys Asp Ala Gly Arg Arg Arg Asn
Ser Leu Pro Pro Ser His 85 90 95 Gln Lys Pro Pro Arg Asn Pro Leu
Ser Ser Ser Asp Ala Ala Pro Ser 100 105 110 Pro Glu Leu Gln Ala Asn
Gly Thr Gly Thr Gln Gly Leu Glu Ala Thr 115 120 125 Asp Thr Asn Gly
Leu Ser Ser Ser Ala Arg Pro Gln Gly Gln Gln Ala 130 135 140 Gly Ser
Pro Ser Lys Glu Asp Lys Lys Gln Ala Asn Ile Lys Arg Gln 145 150 155
160 Leu Met Thr Asn Phe Ile Leu Gly Ser Phe Asp Asp Tyr Ser Ser Asp
165 170 175 Glu Asp Ser Val Ala Gly Ser Ser Arg Glu Ser Thr Arg Lys
Gly Ser 180 185 190 Arg Ala Ser Leu Gly Ala Leu Ser Leu Glu Ala Tyr
Leu Thr Thr Gly 195 200 205 Glu Ala Glu Thr Arg Val Pro Thr Met Arg
Pro Ser Met Ser Gly Leu 210 215 220 His Leu Val Lys Arg Gly Arg Glu
His Lys Lys Leu Asp Leu His Arg 225 230 235 240 Asp Phe Thr Val Ala
Ser Pro Ala Glu Phe Val Thr Arg Phe Gly Gly 245 250 255 Asp Arg Val
Ile Glu Lys Val Leu Ile Ala Asn Asn Gly Ile Ala Ala 260 265 270 Val
Lys Cys Met Arg Ser Ile Arg Arg Trp Ala Tyr Glu Met Phe Arg 275 280
285 Asn Glu Arg Ala Ile Arg Phe Val Val Met Val Thr Pro Glu Asp Leu
290 295 300 Lys Ala Asn Ala Glu Tyr Ile Lys Met Ala Asp His Tyr Val
Pro Val 305 310 315 320 Pro Gly Gly Pro Asn Asn Asn Asn Tyr Ala Asn
Val Glu Leu Ile Val 325 330 335 Asp Ile Ala Lys Arg Ile Pro Val Gln
Ala Val Trp Ala Gly Trp Gly 340 345 350 His Ala Ser Glu Asn Pro Lys
Leu Pro Glu Leu Leu Cys Lys Asn Gly 355 360 365 Val Ala Phe Leu Gly
Pro Pro Ser Glu Ala Met Trp Ala Leu Gly Asp 370 375 380 Lys Ile Ala
Ser Thr Val Val Ala Gln Thr Leu Gln Val Pro Thr Leu 385 390 395 400
Pro Trp Ser Gly Ser Gly Leu Thr Val Glu Trp Thr Glu Asp Asp Leu 405
410 415 Gln Gln Gly Lys Arg Ile Ser Val Pro Glu Asp Val Tyr Asp Lys
Gly 420 425 430 Cys Val Lys Asp Val Asp Glu Gly Leu Glu Ala Ala Glu
Arg Ile Gly 435 440 445 Phe Pro Leu Met Ile Lys Ala Ser Glu Gly Gly
Gly Gly Lys Gly Ile 450 455 460 Arg Lys Ala Glu Ser Ala Glu Asp Phe
Pro Ile Leu Phe Arg Gln Val 465 470 475 480 Gln Ser Glu Ile Pro Gly
Ser Pro Ile Phe Leu Met Lys Leu Ala Gln 485 490 495 His Ala Arg His
Leu Glu Val Gln Ile Leu Ala Asp Gln Tyr Gly Asn 500 505 510 Ala Val
Ser Leu Phe Gly Arg Asp Cys Ser Ile Gln Arg Arg His Gln 515 520 525
Lys Ile Val Glu Glu Ala Pro Ala Thr Ile Ala Pro Leu Ala Ile Phe 530
535 540 Glu Phe Met Glu Gln Cys Ala Ile Arg Leu Ala Lys Thr Val Gly
Tyr 545 550 555 560 Val Ser Ala Gly Thr Val Glu Tyr Leu Tyr Ser Gln
Asp Gly Ser Phe 565 570 575 His Phe Leu Glu Leu Asn Pro Arg Leu Gln
Val Glu His Pro Cys Thr 580 585 590 Glu Met Ile Ala Asp Val Asn Leu
Pro Ala Ala Gln Leu Gln Ile Ala 595 600 605 Met Gly Val Pro Leu His
Arg Leu Lys Asp Ile Arg Leu Leu Tyr Gly 610 615 620 Glu Ser Pro Trp
Gly Val Thr Pro Ile Ser Phe Glu Thr Pro Ser Asn 625 630 635 640 Pro
Pro Leu Ala Arg Gly His Val Ile Ala Ala Arg Ile Thr Ser Glu 645 650
655 Asn Pro Asp Glu Gly Phe Lys Pro Ser Ser Gly Thr Val Gln Glu Leu
660 665 670 Asn Phe Arg Ser Ser Lys Asn Val Trp Gly Tyr Phe Ser Val
Ala Ala 675 680 685 Thr Gly Gly Leu His Glu Phe Ala Asp Ser Gln Phe
Gly His Cys Phe 690 695 700 Ser Trp Gly Glu Asn Arg Glu Glu Ala Ile
Ser Asn Met Val Val Ala 705 710 715 720 Leu Lys Glu Leu Ser Ile Arg
Gly Asp Phe Arg Thr Thr Val Glu Tyr 725 730 735 Leu Ile Asn Leu Leu
Glu Thr Glu Ser Phe Gln Asn Asn Asp Ile Asp 740 745 750 Thr Gly Trp
Leu Asp Tyr Leu Ile Ala Glu Lys Val Gln Ala Glu Lys 755 760 765 Pro
Asp Ile Met Leu Gly Val Val Cys Gly Ala Leu Asn Val Ala Asp 770 775
780 Ala Met Phe Arg Thr Cys Met Thr Asp Phe Leu His Ser Leu Glu Arg
785 790 795 800 Gly Gln Val Leu Pro Ala Asp Ser Leu Leu Asn Leu Val
Asp Val Glu 805 810 815 Leu Ile Tyr Gly Gly Val Lys Tyr Ile Leu Lys
Val Ala Arg Gln Ser 820 825 830 Leu Thr Met Phe Val Leu Ile Met Asn
Gly Cys His Ile Glu Ile Asp 835 840 845 Ala His Arg Leu Asn Asp Gly
Gly Leu Leu Leu Ser Tyr Asn Gly Asn 850 855 860 Ser Tyr Thr Thr Tyr
Met Lys Glu Glu Val Asp Ser Tyr Arg Ile Thr 865 870 875 880 Ile Gly
Asn Lys Thr Cys Val Phe Glu Lys Glu Asn Asp Pro Thr Val 885 890 895
Leu Arg Ser Pro Ser Ala Gly Lys Leu Thr Gln Tyr Thr Val Glu Asp 900
905 910 Gly Gly His Val Glu Ala Gly Ser Ser Tyr Ala Glu Met Glu Val
Met 915 920 925 Lys Met Ile Met Thr Leu Asn Val Gln Glu Arg Gly Arg
Val Lys Tyr 930 935 940 Ile Lys Arg Pro Gly Ala Val Leu Glu Ala Gly
Cys Val Val Ala Arg 945 950 955 960 Leu Glu Leu Asp Asp Pro Ser Lys
Val His Pro Ala Glu Pro Phe Thr 965 970 975 Gly Glu Leu Pro Ala Gln
Gln Thr Leu Pro Ile Leu Gly Glu Lys Leu 980 985 990 His Gln Val Phe
His Ser Val Leu Glu Asn Leu Thr Asn Val Met Ser 995 1000 1005 Gly
Phe Cys Leu Pro Glu Pro Val Phe Ser Ile Lys Leu Lys Glu 1010 1015
1020 Trp Val Gln Lys Leu Met Met Thr Leu Arg His Pro Ser Leu Pro
1025 1030 1035 Leu Leu Glu Leu Gln Glu Ile Met Thr Ser Val Ala Gly
Arg Ile 1040 1045 1050 Pro Ala Pro Val Glu Lys Ser Val Arg Arg Val
Met Ala Gln Tyr 1055 1060 1065 Ala Ser Asn Ile Thr Ser Val Leu Cys
Gln Phe Pro Ser Gln Gln 1070 1075 1080 Ile Ala Thr Ile Leu Asp Cys
His Ala Ala Thr Leu Gln Arg Lys 1085 1090 1095 Ala Asp Arg Glu Val
Phe Phe Ile Asn Thr Gln Ser Ile Val Gln 1100 1105 1110 Leu Val Gln
Arg Tyr Arg Ser Gly Ile Arg Gly Tyr Met Lys Thr 1115 1120 1125 Val
Val Leu Asp Leu Leu Arg Arg Tyr Leu Arg Val Glu His His 1130 1135
1140 Phe Gln Gln Ala His Tyr Asp Lys Cys Val Ile Asn Leu Arg Glu
1145 1150 1155 Gln Phe Lys Pro Asp Met Ser Gln Val Leu Asp Cys Ile
Phe Ser 1160 1165 1170 His Ala Gln Val Ala Lys Lys Asn Gln Leu Val
Ile Met Leu Ile 1175 1180 1185 Asp Glu Leu Cys Gly Pro Asp Pro Ser
Leu Ser Asp Glu Leu Ile 1190 1195 1200 Ser Ile Leu Asn Glu Leu Thr
Gln Leu Ser Lys Ser Glu His Cys 1205 1210 1215 Lys Val Ala Leu Arg
Ala Arg Gln Ile Leu Ile Ala Ser His Leu 1220 1225 1230 Pro Ser Tyr
Glu Leu Arg His Asn Gln Val Glu Ser Ile Phe Leu 1235 1240 1245 Ser
Ala Ile Asp Met Tyr Gly His Gln Phe Cys Pro Glu Asn Leu 1250 1255
1260 Lys Lys Leu Ile Leu Ser Glu Thr Thr Ile Phe Asp Val Leu Pro
1265 1270 1275 Thr Phe Phe Tyr His Ala Asn Lys Val Val Cys Met Ala
Ser Leu 1280 1285 1290 Glu Val Tyr Val Arg Arg Gly Tyr Ile Ala Tyr
Glu Leu Asn Ser 1295 1300 1305 Leu Gln His Arg Gln Leu Pro Asp Gly
Thr Cys Val Val Glu Phe 1310 1315 1320 Gln Phe Met Leu Pro Ser Ser
His Pro Asn Arg Met Thr Val Pro 1325 1330 1335 Ile Ser Ile Thr Asn
Pro Asp Leu Leu Arg His Ser Thr Glu Leu 1340 1345 1350 Phe Met Asp
Ser Gly Phe Ser Pro Leu Cys Gln Arg Met Gly Ala 1355 1360 1365 Met
Val Ala Phe Arg Arg Phe Glu Asp Phe Thr Arg Asn Phe Asp 1370 1375
1380 Glu Val Ile Ser Cys Phe Ala Asn Val Pro Lys Asp Thr Pro Leu
1385 1390 1395 Phe Ser Glu Ala Arg Thr Ser Leu Tyr Ser Glu Asp Asp
Cys Lys 1400 1405 1410 Ser Leu Arg Glu Glu Pro Ile His Ile Leu Asn
Val Ser Ile Gln 1415 1420 1425 Cys Ala Asp His Leu Glu Asp Glu Ala
Leu Val Pro Ile Leu Arg 1430 1435 1440 Thr Phe Val Gln Ser Lys Lys
Asn Ile Leu Val Asp Tyr Gly Leu 1445 1450 1455 Arg Arg Ile Thr Phe
Leu Ile Ala Gln Glu Lys Glu Phe Pro Lys 1460 1465 1470 Phe Phe Thr
Phe Arg Ala Arg Asp Glu Phe Ala Glu Asp Arg Ile 1475 1480 1485 Tyr
Arg His Leu Glu Pro Ala Leu Ala Phe Gln Leu Glu Leu Asn 1490 1495
1500 Arg Met Arg Asn Phe Asp Leu Thr Ala Val Pro Cys Ala Asn His
1505 1510 1515 Lys Met His Leu Tyr Leu Gly Ala Ala Lys Val Lys Glu
Gly Val 1520 1525 1530 Glu Val Thr Asp His Arg Phe Phe Ile Arg Ala
Ile Ile Arg His 1535 1540 1545 Ser Asp Leu Ile Thr Lys Glu Ala Ser
Phe Glu Tyr Leu Gln Asn 1550 1555 1560 Glu Gly Glu Arg Leu Leu Leu
Glu Ala Met Asp Glu Leu Glu Val 1565 1570 1575 Ala Phe Asn Asn Thr
Ser Val Arg Thr Asp Cys Asn His Ile Phe 1580 1585 1590 Leu Asn Phe
Val Pro Thr Val Ile Met Asp Pro Phe Lys Ile Glu 1595 1600 1605 Glu
Ser Val Arg Tyr Met Val Met Arg Tyr Gly Ser Arg Leu Trp 1610 1615
1620 Lys Leu Arg Val Leu Gln Ala Glu Val Lys Ile Asn Ile Arg Gln
1625 1630 1635 Thr Thr Thr Gly Ser Ala Val Pro Ile Arg Leu Phe Ile
Thr Asn 1640 1645 1650 Glu Ser Gly Tyr Tyr Leu Asp Ile Ser Leu Tyr
Lys Glu Val Thr 1655 1660 1665 Asp Ser Arg Ser Gly Asn Ile Met Phe
His Ser Phe Gly Asn Lys 1670 1675 1680 Gln Gly Pro Gln His Gly Met
Leu Ile Asn Thr Pro Tyr Val Thr 1685 1690 1695 Lys Asp Leu Leu Gln
Ala Lys Arg Phe Gln Ala Gln Thr Leu Gly 1700 1705 1710 Thr Thr Tyr
Ile Tyr Asp Phe Pro Glu Met Phe Arg Gln Ala Leu 1715 1720 1725 Phe
Lys Leu Trp Gly Ser Pro Asp Lys Tyr Pro Lys Asp Ile Leu 1730 1735
1740 Thr Tyr Thr Glu Leu Val Leu Asp Ser Gln Gly Gln Leu Val Glu
1745 1750 1755 Met Asn Arg Leu Pro Gly Gly Asn Glu Val Gly Met Val
Ala Phe 1760 1765 1770 Lys Met Arg Phe Lys Thr Gln Glu Tyr Pro Glu
Gly Arg Asp Val 1775 1780 1785 Ile Val Ile Gly Asn Asp Ile Thr Phe
Arg Ile Gly Ser Phe Gly 1790 1795 1800 Pro Gly Glu Asp Leu Leu Tyr
Leu Arg Ala Ser Glu Met Ala Arg 1805 1810 1815 Ala Glu Gly Ile Pro
Lys Ile Tyr Val Ala Ala Asn Ser Gly Ala 1820 1825 1830 Arg Ile Gly
Met Ala Glu Glu Ile Lys His Met Phe His Val Ala 1835 1840 1845 Trp
Val Asp Pro Glu Asp Pro His Lys Gly Phe Lys Tyr Leu Tyr 1850 1855
1860 Leu Thr Pro Gln Asp Tyr Thr Arg Ile Ser Ser Leu Asn Ser Val
1865 1870 1875 His Cys Lys His Ile Glu Glu Gly Gly Glu Ser Arg Tyr
Met Ile 1880 1885 1890 Thr Asp Ile Ile Gly Lys Asp Asp Gly Leu Gly
Val Glu Asn Leu 1895 1900 1905 Arg Gly Ser Gly Met Ile Ala Gly Glu
Ser Ser Leu Ala Tyr Glu 1910 1915 1920 Glu Ile Val Thr Ile Ser Leu
Val Thr Cys Arg Ala Ile Gly Ile 1925 1930 1935 Gly Ala Tyr Leu Val
Arg Leu Gly Gln Arg Val Ile Gln Val Glu 1940 1945 1950 Asn Ser His
Ile Ile Leu Thr Gly Ala Ser Ala Leu Asn Lys Val 1955 1960 1965 Leu
Gly Arg Glu Val Tyr Thr Ser Asn Asn Gln Leu Gly Gly Val 1970 1975
1980 Gln Ile Met His Tyr Asn Gly Val Ser His Ile Thr Val Pro Asp
1985 1990 1995 Asp Phe Glu Gly Val Tyr Thr Ile Leu Glu Trp Leu Ser
Tyr Met 2000 2005 2010 Pro Lys Asp Asn His Ser Pro Val Pro Ile Ile
Thr Pro Thr Asp 2015 2020 2025 Pro Ile Asp Arg Glu Ile Glu Phe Leu
Pro Ser Arg Ala Pro Tyr 2030 2035 2040 Asp Pro Arg Trp Met Leu Ala
Gly Arg Pro His Pro Thr Leu Lys 2045 2050 2055 Gly Thr Trp Gln Ser
Gly Phe Phe Asp His Gly Ser Phe Lys Glu 2060 2065 2070 Ile Met Ala
Pro Trp Ala Gln Thr Val Val Thr Gly Arg Ala Arg 2075 2080 2085 Leu
Gly Gly Ile Pro Val Gly Val Ile Ala Val Glu Thr Arg Thr 2090 2095
2100 Val Glu Val Ala Val Pro Ala Asp Pro Ala Asn Leu Asp Ser Glu
2105 2110 2115 Ala Lys Ile Ile Gln Gln Ala Gly Gln Val Trp Phe Pro
Asp Ser 2120
2125 2130 Ala Tyr Lys Thr Ala Gln Ala Ile Lys Asp Phe Asn Arg Glu
Lys 2135 2140 2145 Leu Pro Leu Met Ile Phe Ala Asn Trp Arg Gly Phe
Ser Gly Gly 2150 2155 2160 Met Lys Asp Met Tyr Asp Gln Val Leu Lys
Phe Gly Ala Tyr Ile 2165 2170 2175 Val Asp Gly Leu Arg Gln Tyr Lys
Gln Pro Ile Leu Ile Tyr Ile 2180 2185 2190 Pro Pro Tyr Ala Glu Leu
Arg Gly Gly Ser Trp Val Val Ile Asp 2195 2200 2205 Ala Thr Ile Asn
Pro Leu Cys Ile Glu Met Tyr Ala Asp Lys Glu 2210 2215 2220 Ser Arg
Gly Gly Val Leu Glu Pro Glu Gly Thr Val Glu Ile Lys 2225 2230 2235
Phe Arg Lys Lys Asp Leu Ile Lys Ser Met Arg Arg Ile Asp Pro 2240
2245 2250 Ala Tyr Lys Lys Leu Met Glu Gln Leu Gly Glu Pro Asp Leu
Ser 2255 2260 2265 Asp Lys Asp Arg Lys Asp Leu Glu Gly Arg Leu Lys
Ala Arg Glu 2270 2275 2280 Asp Leu Leu Leu Pro Ile Tyr His Gln Val
Ala Val Gln Phe Ala 2285 2290 2295 Asp Phe His Asp Thr Pro Gly Arg
Met Leu Glu Lys Gly Val Ile 2300 2305 2310 Ser Asp Ile Leu Glu Trp
Lys Thr Ala Arg Thr Phe Leu Tyr Trp 2315 2320 2325 Arg Leu Arg Arg
Leu Leu Leu Glu Asp Gln Val Lys Gln Glu Ile 2330 2335 2340 Leu Gln
Ala Ser Gly Glu Leu Ser His Val His Ile Gln Ser Met 2345 2350 2355
Leu Arg Arg Trp Phe Val Glu Thr Glu Gly Ala Val Lys Ala Tyr 2360
2365 2370 Leu Trp Asp Asn Asn Gln Val Val Val Gln Trp Leu Glu Gln
His 2375 2380 2385 Trp Gln Ala Gly Asp Gly Pro Arg Ser Thr Ile Arg
Glu Asn Ile 2390 2395 2400 Thr Tyr Leu Lys His Asp Ser Val Leu Lys
Thr Ile Arg Gly Leu 2405 2410 2415 Val Glu Glu Asn Pro Glu Val Ala
Val Asp Cys Val Ile Tyr Leu 2420 2425 2430 Ser Gln His Ile Ser Pro
Ala Glu Arg Ala Gln Val Val His Leu 2435 2440 2445 Leu Ser Thr Met
Asp Ser Pro Ala Ser Thr 2450 2455
* * * * *