U.S. patent application number 14/024552 was filed with the patent office on 2014-10-02 for methods and compositions for the treatment of gastrointestinal disorders.
This patent application is currently assigned to Ironwood Pharmaceuticals, Inc.. The applicant listed for this patent is Ironwood Pharmaceuticals, Inc.. Invention is credited to Mark G. Currie, Shalina Mahajan-Miklos, Li Jing Sun.
Application Number | 20140296163 14/024552 |
Document ID | / |
Family ID | 34198929 |
Filed Date | 2014-10-02 |
United States Patent
Application |
20140296163 |
Kind Code |
A1 |
Currie; Mark G. ; et
al. |
October 2, 2014 |
Methods and Compositions for the Treatment of Gastrointestinal
Disorders
Abstract
Compositions and related methods for treating IBS and other
gastrointestinal disorders and conditions (e.g., gastrointestinal
motility disorders, functional gastrointestinal disorders,
gastroesophageal reflux disease (GERD), duodenogastric reflux,
Crohn's disease, ulcerative colitis, inflammatory bowel disease,
functional heartburn, dyspepsia (including functional dyspepsia or
nonulcer dyspepsia), gastroparesis, chronic intestinal
pseudo-obstruction (or colonic pseudoobstruction), and disorders
and conditions associated with constipation, e.g., constipation
associated with use of opiate pain killers, post-surgical
constipation, and constipation associated with neuropathic
disorders as well as other conditions and disorders are described.
The compositions feature peptides that activate the guanylate
cyclase C (GC-C) receptor.
Inventors: |
Currie; Mark G.; (Sterling,
MA) ; Mahajan-Miklos; Shalina; (Standford, CA)
; Sun; Li Jing; (New York, NY) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Ironwood Pharmaceuticals, Inc. |
Cambridge |
MA |
US |
|
|
Assignee: |
Ironwood Pharmaceuticals,
Inc.
Cambridge
MA
|
Family ID: |
34198929 |
Appl. No.: |
14/024552 |
Filed: |
September 11, 2013 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13291526 |
Nov 8, 2011 |
|
|
|
14024552 |
|
|
|
|
12568107 |
Sep 28, 2009 |
8101579 |
|
|
13291526 |
|
|
|
|
10868744 |
Jun 14, 2004 |
|
|
|
12568107 |
|
|
|
|
60478492 |
Jun 13, 2003 |
|
|
|
60532361 |
Dec 23, 2003 |
|
|
|
60571386 |
May 14, 2004 |
|
|
|
Current U.S.
Class: |
514/21.4 |
Current CPC
Class: |
A61K 38/00 20130101;
A61P 13/08 20180101; A61P 9/04 20180101; A61P 35/04 20180101; A61P
35/00 20180101; C07K 7/08 20130101; A61P 35/02 20180101; A61P 1/14
20180101; A61P 3/04 20180101; A61P 29/00 20180101; A61P 1/04
20180101; A61P 1/02 20180101; A61P 1/00 20180101; A61P 1/10
20180101; A61P 43/00 20180101 |
Class at
Publication: |
514/21.4 |
International
Class: |
C07K 7/08 20060101
C07K007/08 |
Claims
1-52. (canceled)
53. A method for treating a patient suffering from a
gastrointestinal disorder selected from the group consisting of
gastroparesis and dyspepsia; the method comprising orally
administering to the patient a composition comprising a polypeptide
comprising the amino acid sequence Asn Asp Glu Cys Glu Leu Cys Val
Asn Val Ala Cys Thr Gly Cys Leu (SEQ ID NO: 73) or Asn Asp Asp Cys
Glu Leu Cys Val Asn Val Ala Cys Thr Gly Cys Leu (SEQ ID NO: 44),
wherein the polypeptide activates the guanylate cyclase C receptor,
thereby treating the disorder.
54. The method of claim 53, wherein the gastrointestinal disorder
is gastroparesis.
55. The method of claim 53, wherein the gastrointestinal disorder
is dyspepsia.
56. The method of claim 55, wherein the dyspepsia is functional
dyspepsia or nonulcer dyspepsia.
57. The method of claim 55, wherein the dyspepsia is functional
dyspepsia.
58. A method for treating a patient suffering from a
gastrointestinal disorder selected from the group consisting of
gastroparesis and dyspepsia; the method comprising orally
administering to the patient a composition comprising a polypeptide
consisting of the amino acid sequence Asn Asp Glu Cys Glu Leu Cys
Val Asn Val Ala Cys Thr Gly Cys Leu (SEQ ID NO: 73) or Asn Asp Asp
Cys Glu Leu Cys Val Asn Val Ala Cys Thr Gly Cys Leu (SEQ ID NO:
44), wherein the polypeptide activates the guanylate cyclase C
receptor, thereby treating the disorder.
59. The method of claim 58, wherein the gastrointestinal disorder
is gastroparesis.
60. The method of claim 58, wherein the gastrointestinal disorder
is dyspepsia.
61. The method of claim 60, wherein the dyspepsia is functional
dyspepsia or nonulcer dyspepsia.
62. The method of claim 60, wherein the dyspepsia is functional
dyspepsia.
Description
PRIORITY CLAIM
[0001] This application is a continuation (and claims the benefit
of priority under 35 U.S.C. .sctn.120) of U.S. patent application
Ser. No. 13/291,526 filed Nov. 8, 2011, which is a continuation of
U.S. patent application Ser. No. 12/568,107 filed Sep. 28, 2009,
which is a continuation of U.S. patent application Ser. No.
10/868,744 filed Jun. 14, 2004 and also claims the benefit of
priority under 35 U.S.C. .sctn.119 (e) to U.S. Provisional
Application Nos. 60/478,492, filed Jun. 13, 2003; 60/532,361 filed
Dec. 23, 2003; and 60/571,386 filed May 14, 2004. The disclosure of
the prior applications is considered part of (and is incorporated
by reference in) the disclosure of this application.
TECHNICAL FIELD
[0002] This invention relates to methods and compositions for
treating gastrointestinal disorders, obesity, congestive heart
failure, benign prostatic hyperplasia and other disorders.
SEQUENCE LISTING
[0003] This application incorporates by reference in its entirety
the Sequence Listing entitled 14184-034001.txt, containing 2,417
kilobytes of data, created Sep. 1, 2006, and filed with parent
application U.S. patent application Ser. No. 10/868,744 on Sep. 11,
2006 and incorporated in U.S. patent application Ser. No.
12/568,107 in computer readable-format (CRF) and electronic .txt
format.
BACKGROUND
[0004] Irritable bowel syndrome (IBS) is a common chronic disorder
of the intestine that affects 20 to 60 million individuals in the
US alone (Lehman Brothers, Global Healthcare-Irritable Bowel
Syndrome Industry Update, September 1999). IBS is the most common
disorder diagnosed by gastroenterologists (28% of patients
examined) and accounts for 12% of visits to primary care physicians
(Camilleri 2001 Gastroenterology 120:652-668). In the US, the
economic impact of IBS is estimated at $25 billion annually,
through direct costs of health care use and indirect costs of
absenteeism from work (Talley 1995 Gastroenterology 109:1736-1741).
Patients with IBS have three times more absenteeism from work and
report a reduced quality of life. Sufferers may be unable or
unwilling to attend social events, maintain employment, or travel
even short distances (Drossman 1993 Dig Dis Sci 38:1569-1580).
There is a tremendous unmet medical need in this population since
few prescription options exist to treat IBS.
[0005] Patients with IBS suffer from abdominal pain and a disturbed
bowel pattern. Three subgroups of IBS patients have been defined
based on the predominant bowel habit: constipation-predominant
(c-IBS), diarrhea-predominant (d-IBS) or alternating between the
two (a-IBS). Estimates of individuals who suffer from c-IBS range
from 20-50% of the IBS patients with 30% frequently cited. In
contrast to the other two subgroups that have a similar gender
ratio, c-IBS is more common in women (ratio of 3:1) (Talley et al.
1995 Am J Epidemiol 142:76-83).
[0006] The definition and diagnostic criteria for IBS have been
formalized in the "Rome Criteria" (Drossman et al. 1999 Gut
45:Suppl II:1-81), which are well accepted in clinical practice.
However, the complexity of symptoms has not been explained by
anatomical abnormalities or metabolic changes. This has led to the
classification of IBS as a functional GI disorder, which is
diagnosed on the basis of the Rome criteria and limited evaluation
to exclude organic disease (Ringel et al. 2001 Annu Rev Med 52:
319-338). IBS is considered to be a "biopsychosocial" disorder
resulting from a combination of three interacting mechanisms:
altered bowel motility, an increased sensitivity of the intestine
or colon to pain stimuli (visceral sensitivity) and psychosocial
factors (Camilleri 2001 Gastroenterology 120:652-668). Recently,
there has been increasing evidence for a role of inflammation in
the etiology of IBS. Reports indicate that subsets of IBS patients
have small but significant increases in colonic inflammatory and
mast cells, increased inducible nitric oxide (NO) and synthase
(iNOS) and altered expression of inflammatory cytokines (reviewed
by Talley 2000, Medscape Coverage of DDW Week).
SUMMARY OF THE INVENTION
[0007] The present invention features compositions and related
methods for treating IBS and other gastrointestinal disorders and
conditions (e.g., gastrointestinal motility disorders, functional
gastrointestinal disorders, gastroesophageal reflux disease (GERD),
duodenogastric reflux, Crohn's disease, ulcerative colitis,
inflammatory bowel disease, functional heartburn, dyspepsia
(including functional dyspepsia or nonulcer dyspepsia),
gastroparesis, chronic intestinal pseudo-obstruction (or colonic
pseudoobstruction), and disorders and conditions associated with
constipation, e.g., constipation associated with use of opiate pain
killers, post-surgical constipation, and constipation associated
with neuropathic disorders as well as other conditions and
disorders. The compositions feature peptides that activate the
guanylate cyclase C (GC-C) receptor.
[0008] The present invention also features compositions and related
methods for treating obesity, congestive heart failure and benign
prostatic hyperplasia (BPH).
[0009] Without being bound by any particular theory, in the case of
IBS and other gastrointestinal disorders the peptides are useful
because they can increase gastrointestinal motility.
[0010] Without being bound by any particular theory, in the case of
IBS and other gastrointestinal disorders the peptides are useful,
in part, because they can decrease inflammation.
[0011] Without being bound by any particular theory, in the case of
IBS and other gastrointestinal disorders the peptides are also
useful because they can decrease gastrointestinal pain or visceral
pain.
[0012] The invention features pharmaceutical compositions
comprising certain peptides that are capable of activating the
guanylate-cyclase C (GC-C) receptor. Also within the invention are
pharmaceutical compositions comprising a peptide of the invention
as well as combination compositions comprising a peptide of the
invention and one or more additional therapeutic agents, e.g., an
agent for treating constipation (e.g., a chloride channel activator
such as SPI-0211; Sucampo Pharmaceuticals, Inc.; Bethesda, Md., a
laxative such as MiraLax; Braintree Laboratories, Braintree Mass.)
or some other gastrointestinal disorder. Examples of additional
therapeutic agents include: acid reducing agents such as proton
pump inhibitors (e.g. omeprazole, esomeprazole, lansoprazole,
pantorazole and rabeprazole), H2 receptor blockers (e.g.,
cimetidine, ranitidine, famotidine and nizatidine), pro-motility
agents such as motilin agonists (e.g., GM-611 or mitemcinal
fumarate), 5HT receptor agonists (e.g. 5HT4 receptor agonists such
as Zelnorm.RTM.; 5HT3 receptor agonists such as MKC-733), 5HT
receptor antagonists (e.g., 5HT1, 5HT2, 5HT3 (e.g., alosetron),
5HT4 receptor antagonists, muscarinic receptor agonists,
anti-inflammatory agents, antispasmodics, antidepressants,
centrally-acting analgesic agents such as opioid receptor agonists,
opioid receptor antagonists (e.g., naltrexone), agents for the
treatment of Inflammatory bowel disease, Crohn's disease and
ulcerative colitis (e.g., Traficet-EN.TM. (ChemoCentryx, Inc.; San
Carlos, Calif.)), agents that treat gastrointestinal or visceral
pain, and cGMP phosphodiesterase inhibitors (e.g., motapizone,
zaprinast, and suldinac sulfone). The peptides of the invention can
also be used in combination with agents such as tianeptine
(Stablon.RTM.) and other agents described in U.S. Pat. No.
6,683,072, (E)-4
(1,3bis(cyclohexylmethyl)-1,2,34,-tetrahydro-2,6-diono-9H-purin-8-y-
l)cinnamic acid nonaethylene glycol methyl ether ester and related
compounds described in WO 02/067942. The peptides can also be used
in combination with treatments entailing the administration of
microorganisms useful in the treatment of gastrointestinal
disorders such as IBS. Probactrix.RTM. (The BioBalance Corporation;
New York, N.Y.) is one example of a formulation that contains
microorganisms useful in the treatment of gastrointestinal
disorders. The peptides can also be used in combination with
purgatives that draw fluids to the intestine (e.g., Visicol.RTM., a
combination of sodium phosphate monobasic monohydrate and sodium
phosphate dibasic anhydrate.
[0013] In addition, the pharmaceutical compositions can include one
or more agents selected from the group consisting of: Ca channel
blockers (e.g., ziconotide), complete or partial 5HT receptor
antagonists (for example 5HT3 (e.g., alosetron, ATI-7000; Aryx
Thearpeutics, Santa Clara Calif.), 5HT4, 5HT2, and 5HT1 receptor
antagonists), complete or partial 5HT receptor agonists including
5HT3, 5HT2, 5HT4 (e.g., tegaserod, mosapride and renzapride), 5HT1
receptor agonists, CRF receptor agonists (NBI-34041), .beta.-3
adrenoreceptor agonists, opioid receptor agonists (e.g.,
loperamide, fedotozine, and fentanyl, naloxone, naltrexone, methyl
nalozone, nalmefene, cypridime, beta funaltrexamine, naloxonazine,
naltrindole, and nor-binaltorphimine, morphine, diphenyloxylate,
enkephalin pentapeptide, asimadoline, and trimebutine), NK1
receptor antagonists (e.g., ezlopitant and SR-14033), CCK receptor
agonists (e.g., loxiglumide), NK1 receptor antagonists, NK3
receptor antagonists (e.g., talnetant, osanetant (SR-142801),
SSR-241586), norepinephrine-serotonin reuptake inhibitors (NSRI;
e.g., milnacipran), vanilloid and cannabanoid receptor agonists
(e.g., arvanil), sialorphin, sialorphin-related peptides comprising
the amino acid sequence QHNPR (SEQ ID NO:85) for example, VQHNPR
(SEQ ID NO:86); VRQHNPR (SEQ ID NO:87); VRGQHNPR (SEQ ID NO:88);
VRGPQHNPR (SEQ ID NO:89); VRGPRQHNPR (SEQ ID NO:90); VRGPRRQHNPR
(SEQ ID NO:91); and RQHNPR (SEQ ID NO:92), compounds or peptides
that are inhibitors of neprilysin, frakefamide
(H-Tyr-D-Ala-Phe(F)-Phe-NH.sub.2; WO 01/019849 A1), loperamide,
Tyr-Arg (kyotorphin), CCK receptor agonists (caerulein), conotoxin
peptides, peptide analogs of thymulin, loxiglumide, dexloxiglumide
(the R-isomer of loxiglumide) (WO 88/05774). These peptides and
compounds can be administered with the peptides of the invention
(simultaneously or sequentially). They can also be covalently
linked to a peptide of the invention to create therapeutic
conjugates.
[0014] The invention includes methods for treating various
gastrointestinal disorders by administering a peptide that acts as
a partial or complete agonist of the GC-C receptor. The peptide
contains up to four cysteines that form one or two disulfide bonds.
In certain embodiments the disulfide bonds are replaced by other
covalent cross-links and in some cases the cysteines are
substituted by other residues to provide for alternative covalent
cross-links. The peptides may also include at least one trypsin or
chymotrypsin cleavage site and/or a carboxy-terminal analgesic
peptide or small molecule, e.g., AspPhe or some other analgesic
peptide. When present within the peptide, the analgesic peptide or
small molecule may be preceded by a chymotrypsin or trypsin
cleavage site that allows release of the analgesic peptide or small
molecule. The peptides and methods of the invention are also useful
for treating pain and inflammation associated with various
disorders, including gastrointestinal disorders. Certain peptides
include a functional chymotrypsin or trypsin cleavage site located
so as to allow inactivation of the peptide upon cleavage. Certain
peptides having a functional cleavage site undergo cleavage and
gradual inactivation in the digestive tract, and this is desirable
in some circumstances. In certain peptides, a functional
chymotrypsin site is altered, increasing the stability of the
peptide in vivo (e.g., guanylin).
[0015] The invention includes methods for treating other disorders
such as congestive heart failure and benign prostatic hyperplasia
by administering a peptide or small molecule (parenterally or
orally) that acts as an agonist of the GC-C receptor. Such agents
can be used in combination with natriuretic peptides (e.g., atrial
natriuretic peptide, brain natriuretic peptide or C-type
natriuretic peptide), a diuretic, or an inhibitor of angiotensin
converting enzyme.
[0016] The invention features methods and compositions for
increasing intestinal motility. Intestinal motility involves
spontaneous coordinated distentions and contractions of the
stomach, intestines, colon and rectum to move food through the
gastrointestinal tract during the digestive process.
[0017] The peptide can contain additional carboxy terminal or amino
terminal amino acids or both. For example, the peptide can include
an amino terminal sequence that facilitates recombinant production
of the peptide and is cleaved prior to administration of the
peptide to a patient. The peptide can also include other amino
terminal or carboxy terminal amino acids. In some cases the
additional amino acids protect the peptide, stabilize the peptide
or alter the activity of the peptide. In some cases some or all of
these additional amino acids are removed prior to administration of
the peptide to a patient. The peptide can include 1, 2, 3, 4, 5,
10, 15, 20, 25, 30, 40, 50, 60, 70 80, 90, 100 or more amino acids
at its amino terminus or carboxy terminus or both. The number of
flanking amino acids need not be the same. For example, there can
be 10 additional amino acids at the amino terminus of the peptide
and none at the carboxy terminus.
[0018] In certain embodiments the peptides include either one or
two or more contiguous negatively charged amino acids (e.g., Asp or
Glu) or one or two or more contiguous positively charged residues
(e.g., Lys or Arg) or one or two or more contiguous positively or
negatively charged amino acids at the carboxy terminus. In these
embodiments all of the flanking amino acids at the carboxy terminus
are either positively or negatively charged. In other embodiments
the carboxy terminal charged amino acids are preceded by a Leu. For
example, the following amino acid sequences can be added to the
carboxy terminus of the peptide: Asp; Asp Lys; Lys Lys Lys Lys Lys
Lys (SEQ ID NO:93); Asp Lys Lys Lys Lys Lys Lys (SEQ ID NO:94); Leu
Lys Lys; and Leu Asp. It is also possible to simply add Leu at the
carboxy terminus.
[0019] In a first aspect, the invention features a polypeptide
comprising, consisting of, or consisting essentially of the amino
acid sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) wherein: [0020] Xaa.sub.1 is Ser, Asn, Tyr, Ala, Gln, Pro,
Lys, Gly, or Thr, or is missing; [0021] Xaa.sub.2 is His, Asp, Glu,
Ala, Ser, Asn, Gly, or is missing; [0022] Xaa.sub.3 is Thr, Asp,
Ser, Glu, Pro, Val or Leu; [0023] Xaa.sub.5 is Asp, Ile or Glu;
[0024] Xaa.sub.6 is Ile, Trp or Leu; [0025] Xaa.sub.7 is Cys, Ser,
or Tyr; [0026] Xaa.sub.8 is Ala, Val, Thr, Ile, Met or is missing;
[0027] Xaa.sub.9 is a) any amino acid, b) Phe, Tyr, Asn, Trp, c) an
amino acid other than Phe, Trp, or Tyr, d) non-aromatic amino acid
or e) is missing; [0028] Xaa.sub.10 is Ala, Val, Met, Thr or Ile;
[0029] Xaa.sub.11 is Ala or Val; [0030] Xaa.sub.13 is Ala or Thr;
[0031] Xaa.sub.14 is Gly, Ala or Ser; [0032] Xaa.sub.15 is Cys, Tyr
or is missing; and [0033] Xaa.sub.16 is: a) Trp, Tyr or Phe to
create a chymotrypsin cleavage site; b) Lys or Arg to create a
trypsin cleavage site; c) is missing or d) His or Leu or Ser.
[0034] In some embodiments, Xaa.sub.1 is preceded by Lys or
Tyr.
[0035] In certain embodiments, a Cys is replaces by any amino acid
other than Cys. Certain such polypeptides will have fewer disulfide
bonds.
[0036] In a related aspect the invention features a composition
comprising a polypeptide comprising, consisting of, or consisting
essentially of the amino acid sequence: Xaa.sub.1 Xaa.sub.2
Xaa.sub.3 Cys.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7 Xaa.sub.8
Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Cys.sub.12 Xaa.sub.13 Xaa.sub.14
Xaa.sub.15 Xaa.sub.16 (SEQ ID NO:1) wherein: Xaa.sub.1 is Ser, Asn,
Tyr, Ala, Gln, Pro, Lys, Gly, or Thr, or is missing; Xaa.sub.2 is
His, Asp, Glu, Ala, Ser, Asn, Gly, Pro or is missing; Xaa.sub.3 is
Thr, Asp, Ser, Glu, Pro, Val or Leu; Xaa.sub.5 is Asp, Ile or Glu;
Xaa.sub.6 is Ile, Trp or Leu; Xaa.sub.7 is Cys, Ser, or Tyr;
Xaa.sub.8 is Ala, Val, Thr, Ile, Met or is missing; Xaa.sub.9 is
Phe, Tyr, Asn, Trp, an amino acid other than Phe, Trp, or Tyr, is a
non-aromatic amino acid or is missing; Xaa.sub.10 is Ala, Val, Met,
Thr or Ile; Xaa.sub.11 is Ala or Val; Xaa.sub.13 is Ala or Thr;
Xaa.sub.14 is Gly, Ala or Ser; Xaa.sub.15 is Cys, Tyr or is
missing; and Xaa.sub.16 is: a) Trp, Tyr or Phe to create a
chymotrypsin cleavage site; b) Lys or Arg to create a trypsin
cleavage site; c) is missing or d) His or Leu or Ser and a
pharmaceutically acceptable carrier. In related aspects, the
invention features a pharmaceutically acceptable tablet, pill,
capsule comprising the peptide.
[0037] In a related aspect, the invention features a polypeptide
comprising, consisting of, or consisting essentially of the amino
acid sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) wherein: [0038] Xaa.sub.1 is Asn, any amino acid or is
missing; [0039] Xaa.sub.2 is Asp, Glu, any amino acid or is
missing; [0040] Xaa.sub.3 is Asp or Glu; [0041] Xaa.sub.5 is any
amino acid or Glu; [0042] Xaa.sub.6 is any amino acid or Leu;
[0043] Xaa.sub.7 is Cys; [0044] Xaa.sub.8 is any amino acid or Val;
[0045] Xaa.sub.9 is Asn, Gln, Tyr; [0046] Xaa.sub.10 is any amino
acid or Val; [0047] Xaa.sub.11 is any amino acid or Ala; [0048]
Xaa.sub.13 is any amino acid or Thr; [0049] Xaa.sub.14 is any amino
acid or Gly; [0050] Xaa.sub.15 is Cys; [0051] Xaa.sub.16 is any
amino acid, Leu or missing
[0052] In a related aspect, the invention features a polypeptide
comprising, consisting of, or consisting essentially of the amino
acid sequence: Asn.sub.1 Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Glu.sub.5
Leu.sub.6 Xaa.sub.7 Val.sub.8 Asn.sub.9 Xaa.sub.10 Xaa.sub.11
Xaa.sub.12 Thr.sub.13 Xaa.sub.14 Xaa.sub.15 Leu.sub.16 (SEQ ID NO:
2) [0053] Xaa.sub.2 is Asp or Glu; [0054] Xaa.sub.3 is Asp or Glu;
[0055] Xaa.sub.4 is Cys or Mpt (mercaptoproline) or Pen
(penicillamine) or Dpr (diaminopropionic acid) or Asp or Glu;
[0056] Xaa.sub.7 is Cys or Mpt (mercaptoproline) or Pen
(penicillamine) or Dpr (diaminopropionic acid) or Asp or Glu;
[0057] Xaa.sub.10 is Val or Pro; [0058] Xaa.sub.13 is Ala or Aib
(alpha-aminoisobutyric acid); [0059] Xaa.sub.12 is Cys or Mpt
(mercaptoproline) or Pen (penicillamine) or Dpr (diaminopropionic
acid) or Asp or Glu; [0060] Xaa.sub.14 is Gly or Ala; [0061]
Xaa.sub.15 is Cys or Mpt (mercaptoproline) or Pen (penicillamine)
or Dpr (diaminopropionic acid) or Asp or Glu; and
[0062] In certain embodiments, where Xaa.sub.15 is other than Cys
or is missing, Xaa.sub.7 is Ser or an amino acid other than
Cys.
[0063] In certain embodiments 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 or
12 of Xaa.sub.1, Xaa.sub.2, Xaa.sub.3, Xaa.sub.5, Xaa.sub.6,
Xaa.sub.7, Xaa.sub.8, Xaa.sub.9, Xaa.sub.10, Xaa.sub.11,
Xaa.sub.13, Xaa.sub.14, and Xaa.sub.16 are any amino acid other
than Cys.
[0064] In certain embodiments, Xaa.sub.9 is any amino acid other
than Gln. In other embodiments where Xaa.sub.2 and Xaa.sub.3 are
Glu, Xaa.sub.9 is any amino acid other than Gln.
[0065] In certain embodiments Xaa.sub.1 and Xaa.sub.2 are missing;
Xaa.sub.3 is Thr; Xaa.sub.5 is Glu; Xaa.sub.6 is Ile or Leu;
Xaa.sub.8 is Ala, Val, or Ile; Xaa.sub.9 is Phe or Tyr; Xaa.sub.10
is Ala or Val; Xaa.sub.11 is Ala; Xaa.sub.13 is Ala or Thr;
Xaa.sub.14 is Gly; and Xaa.sub.16 is Trp, Tyr, Phe, Lys, Arg or is
missing.
[0066] In certain embodiments the polypeptide comprising,
consisting of, or consisting essentially of the amino acid
sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) is not cleaved after Xaa.sub.9 by chymotrypsin. In these
embodiments wherein: [0067] Xaa.sub.1 is Ser, Asn, Tyr, Ala, Gln,
Pro, Lys, Gly, or Thr, or is missing; [0068] Xaa.sub.2 is His, Asp,
Glu, Ala, Ser, Asn, or Gly, or is missing; [0069] Xaa.sub.3 is Thr,
Asp, Ser, Glu, Pro, Val or Leu or is missing; [0070] Xaa.sub.5 is
Asp, Ile or Glu; [0071] Xaa.sub.6 is Ile, Trp or Leu; [0072]
Xaa.sub.7 is Cys, Ser, or Tyr; [0073] Xaa.sub.8 is Ala, Val, Thr,
Ile, Met or is missing; [0074] Xaa.sub.9 is either: a) any amino
acid other than Phe and Tyr, b) any amino acid other than Phe, Tyr,
and Trp, c) any amino acid other than Phe, Tyr, Trp, Ile, Leu and
Val; d) any amino acid other than Phe, Tyr, Trp, Ile, Leu, Val, and
His; d) any non-aromatic amino acid or e) is missing; [0075]
Xaa.sub.10 is Ala, Val, Met, Thr or Ile; [0076] Xaa.sub.11 is Ala
or Val; [0077] Xaa.sub.13 is Ala or Thr; [0078] Xaa.sub.14 is Gly,
Ala or Ser; [0079] Xaa.sub.15 is Cys, Tyr or is missing; and [0080]
Xaa.sub.16 is: a) Trp, Tyr or Phe to create a chymotrypsin cleavage
site; b) Lys or Arg to create a trypsin cleavage site; c) is
missing or d) His or Leu or Ser.
[0081] In addition, the invention features variants of Xaa.sub.1
Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7
Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Cys.sub.12 Xaa.sub.13
Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID NO:1) that is not cleaved
after Xaa.sub.9 by chymotrypsin due to the addition of an amino
terminal lysine. An example of such a molecule is a human guanylin
variant having an amino terminal lysine: KPGTCEICAYAACTGC (SEQ ID
NO: 3).
[0082] In certain embodiments of the peptide comprising, consisting
of, or consisting essentially of the amino acid sequence: Xaa.sub.1
Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7
Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Cys.sub.12 Xaa.sub.13
Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID NO:1) that is not cleaved
after Xaa.sub.9 by chymotrypsin, Xaa.sub.7 and Xaa.sub.15 are both
Cys.
[0083] Also within the invention are variants of PGTCEICAYAACTGC
(human guanylin) (SEQ ID NO: 4) wherein Y is substituted by any
amino acid other than a) Phe; b) any amino acid other than Phe and
Trp; c) any amino acid other than Phe, Trp, Ile, Leu and Val; d)
any amino acid other than Phe, Trp, Ile, Leu, Val and His; e) any
non-aromatic amino acid or f) is missing.
[0084] In certain embodiments the polypeptide comprising,
consisting of, or consisting essentially of the amino acid
sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) is not cleaved after Xaa.sub.9 by either chymotrypsin or
trypsin. In these embodiments wherein: [0085] Xaa.sub.1 is Ser,
Asn, Tyr, Ala, Gln, Pro, Lys, Gly, or Thr, or is missing; [0086]
Xaa.sub.2 is His, Asp, Glu, Ala, Ser, Asn, or Gly, or is missing;
[0087] Xaa.sub.3 is Thr, Asp, Ser, Glu, Pro, Val or Leu or is
missing; [0088] Xaa.sub.5 is Asp, Ile or Glu; [0089] Xaa.sub.6 is
Ile, Trp or Leu; [0090] Xaa.sub.7 is Cys, Ser, or Tyr; [0091]
Xaa.sub.8 is Ala, Val, Thr, Ile, Met or is missing; [0092]
Xaa.sub.9 is either: a) any amino acid other than Lys, Arg, Phe and
Tyr, b) any amino acid other than Lys, Arg, Phe, Tyr, and Trp, c)
any amino acid other than Lys, Arg, Phe, Tyr, Trp, Ile, Leu and
Val; d) any amino acid other than Lys, Arg, Phe, Tyr, Trp, Ile,
Leu, Val, and His; or e) is missing; [0093] Xaa.sub.10 is Ala, Val,
Met, Thr or Ile; [0094] Xaa.sub.11 is Ala or Val; [0095] Xaa.sub.13
is Ala or Thr; [0096] Xaa.sub.14 is Gly, Ala or Ser; [0097]
Xaa.sub.15 is Cys, Tyr or is missing; and [0098] Xaa.sub.16 is: a)
Trp, Tyr or Phe to create a chymotrypsin cleavage site; b) Lys or
Arg to create a trypsin cleavage site; c) is missing or d) His or
Leu or Ser.
[0099] In certain embodiments of the peptide comprising, consisting
of, or consisting essentially of the amino acid sequence: Xaa.sub.1
Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7
Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Cys.sub.12 Xaa.sub.13
Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID NO:1) that is not cleaved
after Xaa.sub.9 by chymotrypsin or trypsin, Xaa.sub.7 and
Xaa.sub.15 are both Cys.
[0100] Useful variants of PGTCEICAYAACTGC (human guanylin) (SEQ ID
NO: 4) that should not be cleaved by chymotrypsin include:
TABLE-US-00001 (SEQ ID NO: 5) PGTCEICASAACTGC (SEQ ID NO: 6)
PGTCEICATAACTGC (SEQ ID NO: 7) PGTCEICANAACTGC (SEQ ID NO: 8)
PGTCEICAQAACTGC (SEQ ID NO: 9) PGTCEICARAACTGC (SEQ ID NO: 10)
PGTCEICAEAACTGC (SEQ ID NO: 11) PGTCEICADAACTGC (SEQ ID NO: 12)
PGTCEICAGAACTGC (SEQ ID NO: 13) PGTCEICAAAACTGC (SEQ ID NO: 14)
PGTCEICAMAACTGC.
[0101] Additional variants which are not likely to be cleaved by
chymotrypsin under certain conditions include:
TABLE-US-00002 (SEQ ID NO: 15) PGTCEICAIAACTGC (SEQ ID NO: 16)
PGTCEICALAACTGC (SEQ ID NO: 17) PGTCEICAVAACTGC (SEQ ID NO: 18)
PGTCEICAHAACTGC
[0102] The invention also features deletion variants of any of the
peptides described herein in which one, two, three or four amino
acids, other than a Cys, are deleted. Where two (or more) amino
acids are deleted and the peptide comprises the sequence: Cys.sub.a
Xaa Xaa Cys.sub.b Xaa Xaa Xaa Xaa Cys.sub.c Xaa Xaa Cys.sub.d, in
some embodiments two or more deletions can be located between
Cys.sub.a and Cys.sub.b or between Cys.sub.b and Cys.sub.c or
between Cys.sub.c and Cys.sub.d. Thus, there can be two or more
deletions between two Cys. However, in other embodiments there is
at most one deletion between each Cys, i.e., there is no more than
one deletion between each of Cys.sub.a and Cys.sub.b, Cys.sub.b and
Cys.sub.c, and Cys.sub.c and Cys.sub.d. Thus, the invention
includes any of the peptides described herein comprising the
sequence Cys.sub.a Xaa Xaa Cys.sub.b Xaa Xaa Xaa Xaa Cys.sub.c Xaa
Xaa Cys.sub.d wherein: a) one amino acid between Cys.sub.a and
Cys.sub.b is deleted; b) one amino acid between Cys.sub.b and
Cys.sub.c is deleted; c) one amino acid between Cys.sub.c and
Cys.sub.d is deleted; d) one amino acid between Cys.sub.a and
Cys.sub.b is deleted and one amino acid between Cys.sub.b and
Cys.sub.c is deleted; e) one amino acid between Cys.sub.a and
Cys.sub.b is deleted and one amino acid between Cys.sub.c and
Cys.sub.d is deleted; f) one amino acid between Cys.sub.b and
Cys.sub.c is deleted and one amino acid between Cys.sub.c and
Cys.sub.d is deleted; or g) one amino acid between Cys.sub.a and
Cys.sub.b is deleted, one amino acid between Cys.sub.b and
Cys.sub.c is deleted, and one amino acid between Cys.sub.c and
Cys.sub.d is deleted. In addition, one or more amino acids
preceding Cys.sub.a and/or one or more amino acids following
Cys.sub.d can be deleted. The various deletion variants are
peptides that bind to and/or activate the GC-C receptor.
[0103] The invention also features deletion variants of any of the
peptides described herein in which one, two, three or four amino
acids (or non-natural amino acids or natural or non-natural amino
acid analogs), other than a Cys (or an amino acid substituted for
Cys, e.g., an amino acid capable of forming a covalent bond to
another amino acid) is deleted. Thus, additional variants include
those in which a Cys is substituted by an amino acid capable of
forming a covalent linkage with another amino acid (e.g., a Cys or
a substitute therefore). Such amino acids include: Mpt
(mercaptoproline) or Pen (penicillamine) or Dpr (diaminopropionic
acid).
[0104] FIG. 1 includes deletion variants of human guanylin in which
one, two, three or four amino acids are deleted. The deleted amino
acids are between Cys.sub.a and Cys.sub.d as well as amino terminal
to Cys.sub.a.
[0105] The invention also features insertion variants of any of the
peptides described herein in which one, two, three or four amino
acids are inserted.
[0106] Where two (or more) amino acids are inserted and the peptide
comprises the sequence: Cys.sub.a Xaa Xaa Cys.sub.b Xaa Xaa Xaa Xaa
Cys.sub.c Xaa Xaa Cys.sub.d, in some embodiments two or more
insertions can be located between Cys.sub.a and Cys.sub.b or
between Cys.sub.b and Cys.sub.c or between Cys.sub.c and Cys.sub.d.
However, in other embodiments there is at most one insertion
between each of Cys.sub.a and Cys.sub.b or between Cys.sub.b and
Cys.sub.c or between Cys.sub.c and Cys.sub.d. Thus, the invention
includes any of the peptides described herein comprising the
sequence Cys.sub.a Xaa Xaa Cys.sub.b Xaa Xaa Xaa Xaa Cys.sub.c Xaa
Xaa Cys.sub.d wherein: a) one amino acid is inserted between
Cys.sub.a and Cys.sub.b; b) one amino acid is inserted between
Cys.sub.b and Cys.sub.c; c) one amino acid is inserted between
Cys.sub.c and Cys.sub.d; d) one amino acid is inserted between
Cys.sub.a and Cys.sub.b and one amino acid is inserted between
Cys.sub.b and Cys.sub.c; e) one amino acid is inserted between
Cys.sub.a and Cys.sub.b and one amino acid is inserted between
Cys.sub.c and Cys.sub.d; f) one amino acid is inserted between
Cys.sub.b and Cys.sub.c and one amino acid is inserted between
Cys.sub.c and Cys.sub.d or g) one amino acid is inserted between
Cys.sub.a and Cys.sub.b, one amino acid is inserted between
Cys.sub.b and Cys.sub.c, and one amino acid is inserted between
Cys.sub.c and Cys.sub.d. In addition, one or more amino acids can
be inserted preceding Cys.sub.a and/or one or more amino acids can
be inserted following Cys.sub.d. The insertions can be any natural
or non-natural occurring amino acid (e.g., Gly or Ala) or amino
acid analog and where there are more than one insertions present,
they can be the same or different. The various deletion variants
are peptides that bind to and/or activate the GC-C receptor.
[0107] For example, the invention includes the following insertion
variants of PGTCGEICAYAACTGC (human guanylin) (SEQ ID NO:19)
include:
TABLE-US-00003 (SEQ ID NO: 20) PGTCEGICAYAACTGC (SEQ ID NO: 21)
PGTCEIGCAYAACTGC (SEQ ID NO: 22) PGTCEICGAYAACTGC (SEQ ID NO: 23)
PGTCEICAGYAACTGC (SEQ ID NO: 24) PGTCEICAYGAACTGC (SEQ ID NO: 25)
PGTCEICAYAGACTGC (SEQ ID NO: 26) PGTCEICAYAAGCTGC (SEQ ID NO: 27)
PGTCEICAYAACGTGC (SEQ ID NO: 28) PGTCEICAYAACTGGC (SEQ ID NO: 29)
PGTCAEICAYAACTGC (SEQ ID NO: 30) PGTCEAICAYAACTGC (SEQ ID NO: 31)
PGTCEIACAYAACTGC (SEQ ID NO: 32) PGTCEICAAYAACTGC (SEQ ID NO: 33)
PGTCEICAYAAACTGC (SEQ ID NO: 34) PGTCEICAYAACATGC (SEQ ID NO: 35)
PGTCEICAYAACTAGC (SEQ ID NO: 36) PGTCEICAYAACTGAC (SEQ ID NO: 37)
PGTCAEICAAYAACTGC (SEQ ID NO: 38) PGTCEAICAAYAACTGC (SEQ ID NO: 39)
PGTCEIACAAYAACTGC
[0108] Other insertion variants of human guanylin can have up to
four amino acids (i.e., 0, 1, 2, 3 or 4 natural or non-natural
amino acids) inserted after each of the 15 amino acids in human
guanylin. Thus, the invention includes peptides having the
sequence: Pro Xaa.sub.(0-4) Gly Xaa.sub.(0-4) Thr Xaa.sub.(0-4) Cys
Xaa.sub.(0-4) Glu Xaa.sub.(0-4) Ile Xaa.sub.(0-4) Cys Xaa.sub.(0-4)
Ala Xaa.sub.(0-4) Tyr Xaa.sub.(0-4) Ala Xaa.sub.(0-4) Ala
Xaa.sub.(0-4) Cys Xaa.sub.(0-4) Thr Xaa.sub.(0-4) Gly Xaa.sub.(0-4)
Cys Xaa.sub.(0-4) (SEQ ID NO: 95). The inserted amino acids can be
any amino acid and can be the same or different. In certain
embodiments the inserted amino acids are all Gly or all Ala or a
combination of Gly and Ala. FIG. 2 depicts insertion variants of
human guanylin in which one, two, three or four amino acids are
inserted. The inserted amino acids are between Cys.sub.a and
Cys.sub.d as well as amino terminal to Cys.sub.a and carboxy
terminal to Cys.sub.d.
[0109] The invention also features variants of peptides having the
sequence Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1), e.g., variants of PGTCEICAYAACTGC human guanylin (SEQ ID NO:
4) in which up to four amino acids are deleted and/or up to four
amino acids are inserted. The insertions and deletions can be
between Cys4 and Cys 12 in SEQ ID NO:1 or they can be amino
terminal to Cys4 and/or carboxy terminal to Cys 12 in SEQ ID
NO:1
[0110] When Xaa.sub.16 is Trp, Tyr or Phe, the peptide has a
chymotrypsin cleavage site that is located at a position where
cleavage will liberate the portion of the peptide carboxy-terminal
to Xaa.sub.16. When Xaa.sub.16 is Lys or Arg, the peptide has a
trypsin cleavage site that is located at a position where cleavage
will liberate portion of the peptide carboxy-terminal to
Xaa.sub.16. Thus, if the peptide includes an analgesic peptide
carboxy-terminal to Xaa.sub.16, the peptide will be liberated in
the digestive tract upon exposure to the appropriate protease.
Among the analgesic peptides which can be included in the peptide
are: AspPhe, endomorphin-1, endomorphin-2, nocistatin, dalargin,
lupron, and substance P and other analgesic peptides described
herein.
[0111] When Xaa.sub.1 or the amino-terminal amino acid of the
peptide of the invention (e.g., Xaa.sub.2 or Xaa.sub.3) is Trp, Tyr
or Phe, the peptide has a chymotrypsin cleavage site that is
located at a position where cleavage will liberate the portion of
the peptide amino-terminal to Xaa.sub.1 (or Xaa.sub.2 or Xaa.sub.3)
along with Xaa.sub.1, Xaa.sub.2 or Xaa.sub.3. When Xaa.sub.1 or the
amino-terminal amino acid of the peptide of the invention (e.g.,
Xaa.sub.2 or Xaa.sub.3) is Lys or Arg, the peptide has a trypsin
cleavage site that is located at a position where cleavage will
liberate portion of the peptide amino-terminal to Xaa.sub.1 along
with Xaa.sub.1, Xaa.sub.2 or Xaa.sub.3). Thus, for example, if the
peptide includes an analgesic peptide amino-terminal to Xaa.sub.1,
the peptide will be liberated in the digestive tract upon exposure
to the appropriate protease. Among the analgesic peptides which can
be included in the peptide are: AspPhe, endomorphin-1,
endomorphin-2, nocistatin, dalargin, lupron, and substance p and
other analgesic peptides described herein.
[0112] The peptides can linked, e.g., covalently linked to any of a
variety of other analgesic peptides or analgesic compounds. Thus, a
peptide described herein can be linked to a second therapeutic
agent, e.g., an agent for treating constipation (e.g., a chloride
channel activator such as SPI-0211; Sucampo Pharmaceuticals, Inc.;
Bethesda, Md., a laxative such as MiraLax; Braintree Laboratories,
Braintree Mass.) or some other gastrointestinal disorder. Examples
of a second therapeutic agent include: acid reducing agents such as
proton pump inhibitors (e.g., omeprazole, esomeprazole,
lansoprazole, pantorazole and rabeprazole), H2 receptor blockers
(e.g., cimetidine, ranitidine, famotidine and nizatidine),
pro-motility agents such as motilin agonists (e.g., GM-611 or
mitemcinal fumarate), 5HT receptor agonists (e.g., 5HT4 receptor
agonists such as Zelnorm.RTM.; 5HT3 receptor agonists such as
MKC-733), 5HT receptor antagonists (e.g., 5HT1, 5HT2, 5HT3 (e.g.,
alosetron), 5HT4 receptor antagonists, muscarinic receptor
agonists, anti-inflammatory agents, antispasmodics,
antidepressants, centrally-acting analgesic agents such as opioid
receptor agonists, opioid receptor antagonists (e.g., naltrexone),
agents for the treatment of Inflammatory bowel disease, Crohn's
disease and ulcerative colitis (e.g., Traficet-EN.TM.
(ChemoCentryx, Inc.; San Carlos, Calif.), agents that treat
gastrointestinal or visceral pain, and cGMP phosphodiesterase
inhibitors (motapizone, zaprinast, and suldinac sulfone). The
peptides of the invention can also be linked to agents such a
tianeptine (Stablon.RTM.) and other agents described in U.S. Pat.
No. 6,683,072; (E)-4
(1,3bis(cyclohexylmethyl)-1,2,34,-tetrahydro-2,6-diono-9H-purin-8-yl)cinn-
amic acid nonaethylene glycol methyl ether ester and related
compounds described in WO 02/067942. The peptides can be linked to
an agent selected from the group consisting of: Ca channel blockers
(e.g., ziconotide), complete or partial 5HT receptor antagonists
(for example 5HT3 (e.g., alosetron, ATI-7000; Aryx Thearpeutics,
Santa Clara Calif.), 5HT4, 5HT2, and 5HT1 receptor antagonists),
complete or partial 5HT receptor agonists including 5HT3, 5HT2,
5HT4 (e.g., tegaserod, mosapride and renzapride) and 5HT1 receptor
agonists, CRF receptor agonists (NBI-34041), .beta.-3
adrenoreceptor agonists, opioid receptor agonists (e.g.,
loperamide, fedotozine, and fentanyl, naloxone, naltrexone, methyl
nalozone, nalmefene, cypridime, beta funaltrexamine, naloxonazine,
naltrindole, and nor-binaltorphimine, morphine, diphenyloxylate,
enkephalin pentapeptide, asimadoline, and trimebutine), NK1
receptor antagonists (e.g., ezlopitant and SR-14033), CCK receptor
agonists (e.g., loxiglumide), NK1 receptor antagonists, NK3
receptor antagonists (e.g., talnetant, osanetant (SR-142801),
SSR-241586), norepinephrine-serotonin reuptake inhibitors (NSRI;
e.g., milnacipran), vanilloid and cannabanoid receptor agonists
(e.g., arvanil), sialorphin, sialorphin-related peptides comprising
the amino acid sequence QHNPR (SEQ ID NO: 85) for example, VQHNPR
(SEQ ID NO: 86); VRQHNPR (SEQ ID NO: 87); VRGQHNPR (SEQ ID NO: 88);
VRGPQHNPR (SEQ ID NO: 89); VRGPRQHNPR (SEQ ID NO: 90); VRGPRRQHNPR
(SEQ ID NO: 91); and RQHNPR (SEQ ID NO: 92), compounds or peptides
that are inhibitors of neprilysin, frakefamide
(H-Tyr-D-Ala-Phe(F)-Phe-NH.sub.2; WO 01/019849 A1), loperamide,
Tyr-Arg (kyotorphin), CCK receptor agonists (caerulein), conotoxin
peptides, pepetide analogs of thymulin, loxiglumide, dexloxiglumide
(the R-isomer of loxiglumide) (WO 88/05774) and other analgesic
peptides or compounds.
[0113] Amino acid, non-amino acid, peptide and non-peptide spacers
can be interposed between a peptides of the invention and a peptide
that has some other biological function, e.g., an analgesic peptide
or a peptide used to treat obesity. The linker can be one that is
cleaved from the flanking peptides in vivo or one that remains
linked to the flanking peptides in vivo. For example, glycine,
beta-alanine, glycyl-glycine, glycyl-beta-alanine,
gamma-aminobutyric acid, 6-aminocaproic acid, L-phenylalanine,
L-tryptophan and glycil-L-valil-L-phenylalanine can be used as a
spacer (Chaltin et al. 2003 Helvetica Chimica Acta 86:533-547;
Caliceti et al. 1993 FARMCO 48:919-32) as can polyethylene glycols
(Butterworth et al. 1987 J. Med. Chem 30:1295-302) and maleimide
derivatives (King et al. 2002 Tetrahedron Lett. 43:1987-1990).
Various other linkers are described in the literature (Nestler 1996
Molecular Diversity 2:35-42; Finn et al. 1984 Biochemistry
23:2554-8; Cook et al. 1994 Tetrahedron Lett. 35:6777-80; Brokx et
al. 2002 Journal of Controlled Release 78:115-123; Griffin et al.
2003 J. Am. Chem. Soc. 125:6517-6531; Robinson et al. 1998 Proc.
Natl. Acad. Sci. USA 95:5929-5934.
[0114] The peptides can include the amino acid sequence of a
peptide that occurs naturally in a vertebrate (e.g., mammalian)
species or in a bacterial species. In addition, the peptides can be
partially or completely non-naturally occurring peptides. Also
within the invention are peptidomimetics corresponding to the
peptides of the invention.
[0115] When fully folded, disulfide bonds are present between the
first and third cysteines and between the second and fourth
cysteines, e.g., there is a disulfide bond between Cys.sub.4 and
Cys.sub.12 and a disulfide bond between Xaa.sub.7 and Xaa.sub.15
(when Xaa.sub.7 is a Cys and Xaa.sub.15 is a Cys). In some
embodiments, the peptide has only one disulfide bond, e.g., between
the first and third cysteines (i.e., Cys.sub.4 and Cys.sub.12;
corresponds to the first and second cysteines when Xaa.sub.7 is
other than Cys). In certain embodiments one or more Cys can be
replaced by Mpt (mercaptoproline) or Pen (penicillamine) or Dpr
(diaminopropionic acid) or some other amino acid that can
covalently link to another amino acid (e.g., Cys, Mpt, Pen or Dpr).
In some embodiments, one or both members of a pair of Cys residues
which normally form a disulfide bond can be replaced by
homocysteine, 3-mercaptoproline (Kolodziej et al. 1996 Int J Pept
Protein Res 48:274); .theta., .theta. dimethylcysteine (Hunt et al.
1993 Int J Pept Protein Res 42:249) or diaminopropionic acid (Smith
et al. 1978 J Med Chem 21:117) to form alternative internal
cross-links at the positions of the normal disulfide bonds.
[0116] In addition, one or more disulfide bonds can be replaced by
alternative covalent cross-links, e.g., an amide bond, an ester
linkage, an alkyl linkage, a thio ester linkage, a lactam bridge, a
carbamoyl linkage, a urea linkage, a thiourea linkage, a
phosphonate ester linkage, an alkyl linkage, and alkenyl linkage,
an ether, a thioether linkage, or an amino linkage. For example,
Ledu et al. (Proceedings Nat'l Acad. Sci. 100:11263-78, 2003)
described methods for preparing lactam and amide cross-links.
Schafmeister et al. (J. Am. Chem. Soc. 122:5891, 2000) describes
stable, all carbon cross-links. In some cases, the generation of
such alternative cross-links requires replacing the Cys residues
with other residues such as Lys or Glu or non-naturally occurring
amino acids.
[0117] In certain embodiments one or more amino acids can be
replaced by a non-naturally occurring amino acid or a naturally or
non-naturally occurring amino acid analog. For example, an aromatic
amino acid can be replaced by 3,4-dihydroxy-L-phenylalanine,
3-iodo-L-tyrosine, triiodothyronine, L-thyroxine, phenylglycine
(Phg) or nor-tyrosine (norTyr). Phg and norTyr and other amino
acids including Phe and Tyr can be substituted by, e.g., a halogen,
--CH3, --OH, --CH.sub.2NH.sub.3, --C(O)H, --CH.sub.2CH.sub.3, --CN,
--CH.sub.2CH.sub.2CH.sub.3, --SH, or another group.
[0118] Further examples of unnatural amino acids include: an
unnatural analogue of tyrosine; an unnatural analogue of glutamine;
an unnatural analogue of phenylalanine; an unnatural analogue of
serine; an unnatural analogue of threonine; an alkyl, aryl, acyl,
azido, cyano, halo, hydrazine, hydrazide, hydroxyl, alkenyl,
alkynl, ether, thiol, sulfonyl, seleno, ester, thioacid, borate,
boronate, phospho, phosphono, phosphine, heterocyclic, enone,
imine, aldehyde, hydroxylamine, keto, or amino substituted amino
acid, or any combination thereof; an amino acid with a
photoactivatable cross-linker; a spin-labeled amino acid; a
fluorescent amino acid; an amino acid with a novel functional
group; an amino acid that covalently or noncovalently interacts
with another molecule; a metal binding amino acid; a
metal-containing amino acid; a radioactive amino acid; a photocaged
and/or photoisomerizable amino acid; a biotin or biotin-analogue
containing amino acid; a glycosylated or carbohydrate modified
amino acid; a keto containing amino acid; amino acids comprising
polyethylene glycol or polyether; a heavy atom substituted amino
acid (e.g., an amino acid containing deuterium, tritium, .sup.13C,
.sup.15N, or .sup.18O); a chemically cleavable or photocleavable
amino acid; an amino acid with an elongated side chain; an amino
acid containing a toxic group; a sugar substituted amino acid,
e.g., a sugar substituted serine or the like; a carbon-linked
sugar-containing amino acid; a redox-active amino acid; an
.alpha..-hydroxy containing acid; an amino thio acid containing
amino acid; an .alpha., .alpha. disubstituted amino acid; a
.beta.-amino acid; a cyclic amino acid other than proline; an
O-methyl-L-tyrosine; an L-3-(2-naphthyl)alanine; a
3-methyl-phenylalanine; a p-acetyl-L-phenylalanine; an
0-4-allyl-L-tyrosine; a 4-propyl-L-tyrosine; a
tri-O-acetyl-GlcNAc.beta.-serine; an L-Dopa; a fluorinated
phenylalanine; an isopropyl-L-phenylalanine; a
p-azido-L-phenylalanine; a p-acyl-L-phenylalanine; a
p-benzoyl-L-phenylalanine; an L-phosphoserine; a phosphonoserine; a
phosphonotyrosine; a p-iodo-phenylalanine; a 4-fluorophenylglycine;
a p-bromophenylalanine; a p-amino-L-phenylalanine; a
isopropyl-L-phenylalanine; L-3-(2-naphthyl)alanine; an amino-,
isopropyl-, or O-allyl-containing phenylalanine analogue; a dopa,
O-methyl-L-tyrosine; a glycosylated amino acid; a
p-(propargyloxy)phenylalanine, dimethyl-Lysine, hydroxy-proline,
mercaptopropionic acid, methyl-lysine, 3-nitro-tyrosine,
norleucine, pyro-glutamic acid, Z (Carbobenzoxyl),
.epsilon.-Acetyl-Lysine, .beta.-alanine, aminobenzoyl derivative,
aminobutyric acid (Abu), citrulline, aminohexanoic acid,
aminoisobutyric acid, cyclohexylalanine, d-cyclohexylalanine,
hydroxyproline, nitro-arginine, nitro-phenylalanine,
nitro-tyrosine, norvaline, octahydroindole carboxylate, ornithine,
penicillamine, tetrahydroisoquinoline, acetamidomethyl protected
amino acids and a pegylated amino acid. Further examples of
unnatural amino acids can be found in U.S. 20030108885, U.S.
20030082575, and the references cited therein.
[0119] In some embodiments, an amino acid can be replaced by a
naturally-occurring, non-essential amino acid, e.g., taurine.
[0120] Methods to manufacture peptides containing unnatural amino
acids can be found in, for example, U.S. 20030108885, U.S.
20030082575, Deiters et al., J Am Chem Soc. (2003) 125:11782-3,
Chin et al., Science (2003) 301:964-7, and the references cited
therein.
[0121] Peptides that include non-natural amino acids can also be
prepared using the methods described in WO02086075.
[0122] The peptides of the invention can be modified using standard
modifications. Modifications may occur at the amino (N--), carboxy
(C--) terminus, internally or a combination of any of the
preceeding. In one aspect of the invention, there may be more than
one type of modification on the peptide. Modifications include but
are not limited to: acetylation, amidation, biotinylation,
cinnamoylation, famesylation, formylation, myristoylation,
palmitoylation, phosphorylation (Ser, Tyr or Thr), stearoylation,
succinylation, sulfurylation and cyclisation (via disulfide bridges
or amide cyclisation), and modification by Cy3 or Cy5. The peptides
of the invention may also be modified by 2, 4-dinitrophenyl (DNP),
DNP-lysin, modification by 7-Amino-4-methyl-coumarin (AMC),
flourescein, NBD (7-Nitrobenz-2-Oxa-1,3-Diazole), p-nitro-anilide,
rhodamine B, EDANS (5-((2-aminoethyl)amino)naphthalene-1-sulfonic
acid), dabcyl, dabsyl, dansyl, texas red, FMOC, and Tamra
(Tetramethylrhodamine). The peptides of the invention may also be
conjugated to, for example, BSA or KLH (Keyhole Limpet
Hemocyanin).
[0123] The invention also features a purified polypeptide
comprising, consisting of or consisting essentially of the amino
acid sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) wherein: [0124] Xaa.sub.1 is any amino acid or is missing;
[0125] Xaa.sub.2 is any amino acid or is missing; [0126] Xaa.sub.3
is any amino acid or is missing; [0127] Xaa.sub.5 is Glu; [0128]
Xaa.sub.6 is Tyr, Trp, Phe or Leu; [0129] Xaa.sub.7 is Cys; [0130]
Xaa.sub.8 is any of the 20 naturally-occurring amino acids other
than Cys or is missing; [0131] Xaa.sub.9 is any of the 20
naturally-occurring amino acids; [0132] Xaa.sub.10 is Pro or Gly;
[0133] Xaa.sub.11 is any of the 20 naturally-occurring amino acids;
[0134] Xaa.sub.13 is Thr, Val or Gly; [0135] Xaa.sub.14 is Gly or
Ala; [0136] Xaa.sub.15 is Cys; and [0137] Xaa.sub.16 is any of the
20 naturally-occurring amino acids or is missing.
[0138] In various embodiments: Xaa.sub.9 is Asn; Xaa.sub.11 is Ala
or Thr; Xaa.sub.8 is missing; and Xaa.sub.16 is Tyr.
[0139] In other embodiments Xaa4 is immediately preceded by an
amino acid sequence selected from: Ser His Thr; Pro Ser Thr; Thr;
Pro Asp Pro; Ile Ala Glu Asp Ser His Thr (SEQ ID NO:8604); Ile Ala
Gln Asp Pro Ser Thr (SEQ ID NO:8605); Ala Asn Thr; Asn Thr; Asp Pro
Asn Thr (SEQ ID NO:8606); Lys Asn Thr; Pro Asn Thr; Ile Ala Gln Asp
Pro Asn Thr (SEQ ID NO:8607); Lys Pro Asn Thr (SEQ ID NO:8608); Asp
Pro Gly Thr (SEQ ID NO:8609); Glu Asp Pro Gly Thr (SEQ ID NO:8610);
Pro Gly Thr; Pro Ala Thr; Val Ala Ala Arg Ala Asp Leu (SEQ ID
NO:8611); Gly Asp Asp; Asn Asp Glu; Gln Glu Asp; Asn Asp Asp; Arg
Thr Ile Ala Asn Asp Asp (SEQ ID NO:8612); Thr Ile Ala Asn Asp Asp
(SEQ ID NO:8613); Asp Asp; Arg Thr Met Asp Asn Asp Glu (SEQ ID
NO:8614); Arg Thr Ile Ala Gly Asp Asp (SEQ ID NO:8615); Arg Thr Ile
Ala Asn Asp (SEQ ID NO:8616); Asp; Glu Asp; Arg Ser Ile Ser Gln Glu
Asp (SEQ ID NO:8617); Thr Asp Glu; Arg Thr Ile Ala Thr Asp Glu (SEQ
ID NO:8618); Glu; Ile Ile Thr Pro Pro Asp Pro (SEQ ID NO:8619); Gln
Glu Leu; Lys Asp Asp; Gln Glu Glu; Arg Tyr Ile Asn Gln Glu Glu (SEQ
ID NO:8620); Ala Ser Ser Tyr Ala Ser (SEQ ID NO:8621); and Thr Ser
Ser Tyr Ala Ser (SEQ ID NO:8622).
[0140] The invention further features a purified polypeptide
comprising, consisting of or consisting essentially the amino acid
sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) wherein: [0141] Xaa.sub.1 is: a) Ser, Asn, Tyr, Ala, Gln,
Pro, Lys, Gly, or Thr, or is missing; b) preceded by Lys or Tyr; c)
any amino acid; d) missing; e) any amino acid other than Cys; or f)
Lys or Arg; [0142] Xaa.sub.2 is: a) His, Asp, Glu, Ala, Ser, Asn,
Gly, or is missing; b) His, Asp, Glu, Ala, Ser, Asn, Gly, Pro or is
missing; c) Asp, Glu, any amino acid or is missing; d) Asp or Glu;
e) any amino acid other than Cys; e) Glu; f) missing; g) Trp, Tyr
or Phe; or h) Lys or Arg; [0143] Xaa.sub.3 is: a) Thr, Asp, Ser,
Glu, Pro, Val or Leu; Asp or Glu; b) any amino acid other than Cys;
c) Glu; d) Thr; e) Thr, Asp, Ser, Glu, Pro, Val or Leu or is
missing; f) Trp, Tyr or Phe; or g) Lys or Arg; [0144] Xaa.sub.4 is:
a) Cys, Mpt (mercaptoproline), Pen (penicillamine), Dpr
(diaminopropionic acid), Asp, or Glu; [0145] Xaa.sub.5 is: a) any
amino acid; b) Glu, Asp, Gln, Gly or Pro; c) Glu; d) Glu or Asp; e)
Asp, Ile or Glu; f) any amino acid; or g) any amino acid other than
Cys; [0146] Xaa.sub.6 is: a) Leu, Ile, Val, Ala, Lys, Arg, Trp, Tyr
or Phe; b) Leu, Ile, Val, Lys, Arg, Trp, Tyr or Phe; Leu, Ile, Lys,
Arg, Trp, Tyr or Phe; c) Leu, Ile, Val, Trp, Tyr or Phe; d) Trp,
Tyr, Phe or Leu; e) Leu, Ile or Val; f) Ile, Trp or Leu; g) Trp,
Tyr or Phe; h) Ile or Leu; i) Tyr; j) any amino acid; k) any amino
acid except Leu; l) any natural or non-natural aromatic amino acid;
or m) any amino acid other than Cys; [0147] Xaa.sub.7 is: a) Cys,
Ser, or Tyr; Cys; b) Cys, Mpt (mercaptoproline), Pen
(penicillamine), Dpr (diaminopropionic acid), Asp or Glu; c) Ser;
or d) an amino acid other than Cys; [0148] Xaa.sub.8 is: a) Ala,
Val, or Ile; b) Ala, Val, Thr, Ile, Met or is missing; c) any amino
acid; d) Val; e) any amino acid other than Cys; or f) missing;
[0149] Xaa.sub.9 is: a) any amino acid; b) any amino acid other
than Phe and Tyr; c) any amino acid other than Phe, Tyr, and Trp;
d) any amino acid other than Phe, Tyr, Trp, Ile, Leu and Val; e)
any amino acid other than Phe, Tyr, Trp, Ile, Leu, Val, and His; f)
any amino acid other than Gln; g) any amino acid other than Lys,
Arg, Phe, Tyr, and Trp; h) any amino acid other than Lys, Arg, Phe,
Tyr, Trp, Ile, Leu and Val; i) any amino acid other than Lys, Arg,
Phe, Tyr, Trp, Ile, Leu, Val, and His; j) any non-aromatic amino
acid; k) missing; l) Phe, Tyr, Asn, or Trp; m) Asn, Tyr, Asp or
Ala; n) Asn, Gln, or Tyr; o) Phe or Tyr; p) Asn; or q) any amino
acid other than Cys; [0150] Xaa.sub.10 is: a) Ala, Pro or Gly; b)
Pro or Gly; c) Pro; d) Ala, Val, Met, Thr or Ile; e) any amino
acid; f) Val; g) Val or Pro; h) Ala or Val; i) any amino acid other
than Cys; j) Pro; or k) Gly; [0151] Xaa.sub.13 is: a) any amino
acid; b) Ala, Leu, Ser, Gly, Val, Glu, Gln, Ile, Leu, Lys, Arg, or
Asp; c) Ala or Gly; d) Ala; e) Ala or Val; f) any amino acid; g)
Ala or Aib (alpha-aminoisobutyric acid); h) any amino acid other
than Cys; i) Ala or Thr; or j) Thr. [0152] Xaa.sub.12 is: a) Cys,
Mpt (mercaptoproline), Pen (penicillamine), Dpr (diaminopropionic
acid), Asp, or Glu; or b) any amino acid other than Cys; [0153]
Xaa.sub.13 is: a) Thr, Ala, Asn, Lys, Arg, or Trp; b) Thr, Ala,
Lys, Arg, or Trp; c) any amino acid; d) any non-aromatic amino
acid; e) Thr, Ala, or Trp; f) Trp, Tyr or Phe; g) Thr or Ala; h)
any amino acid; i) Thr; j) any amino acid other than Cys; k) Thr,
Val, or Gly; l) Thr or Val, m) Thr or Gly, n) Val or Thr; o) Val;
p) Thr; or q) Gly; [0154] Xaa.sub.14 is: a) Gly, Pro or Ala; b)
Gly; c) any amino acid; d) Gly, Ala or Ser; e) Gly or Ala; f) any
amino acid other than Cys; or g) Ala; [0155] Xaa.sub.15 is: a) Cys,
Tyr or is missing; b) Cys; c) Cys, Mpt (mercaptoproline), Pen
(penicillamine), Dpr (diaminopropionic acid), Asp, Glu; or d) any
amino acid other than Cys or is missing; and [0156] Xaa.sub.36 is:
a) Trp, Tyr, Phe, Asn, Ile, Val, His or Leu; b) Trp, Tyr, Phe, Asn
or Leu; c) Trp, Tyr, Phe or Leu; d) Trp, Tyr, or Phe; e) Leu, Ile
or Val; f) His, Leu or Ser; g) Tyr or Leu; Lys or Arg; h) His; i)
any amino acid, j) Leu, or missing; k) Trp, Tyr, Phe, Lys, Arg or
is missing; l) missing; m) any amino acid other than Cys; or n)
Tyr.
[0157] Also featured is purified polypeptide comprising, consisting
of or consisting essentially of the amino acid sequence: Xaa.sub.1
Xaa.sub.2 Xaa.sub.3 Xaa.sub.4 Xaa.sub.5 Xaa.sub.6 Xaa.sub.7
Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11 Xaa.sub.12 Xaa.sub.13
Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID NO:1) wherein: [0158]
Xaa.sub.1 is any amino acid or is missing; [0159] Xaa.sub.2 is any
amino acid or is missing; [0160] Xaa.sub.3 is any amino acid or is
missing; [0161] Xaa.sub.4 is Cys, Mpt (mercaptoproline), Pen
(penicillamine), Dpr (diaminopropionic acid), Asp or Glu; [0162]
Xaa.sub.5 is Glu; [0163] Xaa.sub.6 is Tyr, Trp, Phe or Leu; [0164]
Xaa.sub.7 is Cys, Mpt (mercaptoproline), Pen (penicillamine), Dpr
(diaminopropionic acid), Asp or Glu; [0165] Xaa.sub.8 is any amino
acid other than Cys or is missing; [0166] Xaa.sub.9 is any amino
acid; [0167] Xaa.sub.10 is Pro or Gly; [0168] Xaa.sub.11 is any
amino acid; [0169] Xaa.sub.12 is Cys, Mpt (mercaptoproline), Pen
(penicillamine), Dpr (diaminopropionic acid), Asp or Glu; [0170]
Xaa.sub.13 is Thr, Val or Gly; [0171] Xaa.sub.14 is Gly or Ala;
[0172] Xaa.sub.15 is Cys, Mpt (mercaptoproline), Pen
(penicillamine), Dpr (diaminopropionic acid), Asp or Glu; and
[0173] Xaa.sub.16 is any amino acid or is missing.
[0174] The various peptides can be present with a counterion.
Useful counterions include salts of: acetate, benzenesulfonate,
benzoate, calcium edetate, camsylate, carbonate, citrate, edetate
(EDTA), edisylate, embonate, esylate, fumarate, gluceptate,
gluconate, glutamate, glycollylarsanilate, hexylresorcinate,
iodide, bromide, chloride, hydroxynaphthoate, isethionate, lactate,
lactobionate, estolate, maleate, malate, mandelate, mesylate,
mucate, napsylate, nitrate, pantothenate, phosphate, salicylate,
stearate, succinate, sulfate, tartarate, theoclate,
acetamidobenzoate, adipate, alginate, amino salicylate,
anhydromethylenecitrate, ascorbate, aspartate, camphorate, caprate,
caproate, caprylate, cinnamate, cyclamate, dichloroacetate,
formate, gentisate, glucuronate, glycerophosphate, glycolate,
hippurate, fluoride, malonate, napadisylate, nicotinate, oleate,
orotate, oxalate, oxoglutarate, palmitate, pectinate, pectinate
polymer, phenylethylbarbiturate, picrate, propionate, pidolate,
sebacate, rhodanide, tosylate, tannate
[0175] In a second aspect, the invention also features a
therapeutic or prophylactic method comprising administering a
composition comprising a purified peptide comprising, consisting
essentially or consisting of the amino acid sequence of SEQ ID
NO:1. For the treatment of gastrointestinal disorders, the peptide
can be administered orally, by rectal suppository or
parenterally.
[0176] In various embodiments, the patient is suffering from a
gastrointestinal disorder; the patient is suffering from a disorder
selected from the group consisting of: a gastrointestinal motility
disorder, irritable bowel syndrome, a functional gastrointestinal
disorder, gastroesophageal reflux disease, duodenogastric reflux,
functional heartburn, dyspepsia, functional dyspepsia, nonulcer
dyspepsia, gastroparesis, chronic intestinal pseudo-obstruction,
colonic pseudo-obstruction, obesity, congestive heart failure, or
benign prostatic hyperplasia; the composition is administered
orally; the peptide comprises 150, 140, 130, 120, 110, 100, 90, 80,
70, 60, 50, 40, or 30 or fewer amino acids. In other embodiments,
the peptide comprises 20 or fewer amino acids, and the peptide
comprises no more than 5 amino acids prior to Cys.sub.4. In other
embodiments the peptide comprises no more than 20, 15, 10, or 5
peptides subsequent to Cys.sub.15. In certain embodiments
Xaa.sub.16 is a chymotrypsin or trypsin cleavage site and an
analgesic peptide is present immediately following Xaa.sub.16.
[0177] Among the useful peptides are those comprising, consisting
of or consisting essentially of any of the following amino acid
sequences:
TABLE-US-00004 (SEQ ID NO: 40) SHTCEICAFAACAGC (opossum guanylin);
(SEQ ID NO: 4) PGTCEICAYAACTGC (human guanylin); (SEQ ID NO: 41)
PSTCEICAYAACAGC (pig guanylin); (SEQ ID NO: 42 PNTCEICAYAACTGC (rat
guanylin); (SEQ ID NO: 43) PDPCEICANAACTGCL (European eel guanylin,
inferred); (SEQ ID NO: 44) NDDCELCVNVACTGCL (human uroguanylin);
(SEQ ID NO: 45) QEECELCINMACTGY (opossum lymphoguanylin); (SEQ ID
NO: 46) GDDCELCVNVACTGCS (pig uroguanylin); (SEQ ID NO: 47)
NDECELCVNIACTGC (guinea pig uroguanylin); (SEQ ID NO: 48)
TDECELCINVACTGC (rat uroguanylin); (SEQ ID NO: 49) QEDCELCINVACTGC
(opossum uroguanylin); (SEQ ID NO: 50)
MPSTQYIRRPASSYASCIWCTTACASCHGRTTKPSLAT (EAST 1); (SEQ ID NO: 51)
MPSTQYIRRPASSYASCIWCATACASCHGRTTKPSLAT; (SEQ ID NO: 52)
MPSTQYIRRPTSSYASCIWCATACASCHGRTTKPSLAT; (SEQ ID NO: 53)
MPSTQYIRRPTSSYASCIWCATVCASCHGRTTKPSLAT; (SEQ ID NO: 54)
MPSTQYIRRPASSYASCIWYATACASCHGRTTEPSLAT; (SEQ ID NO: 55)
QEECELSINMACTGY (opossum lymphoguanylin analog); (SEQ ID NO: 56)
YDECEICMFAACTGC (Japanese eel guanylin); (SEQ ID NO: 57)
VCEICAFAACTGC (Zebrafish guanylin, inferred); (SEQ ID NO: 58)
ADLCEICAFAACTGCL (Japenese eel renoguanylin, inferred); (SEQ ID NO:
59) PGTCEICAYAACTGCL; (SEQ ID NO: 60) PGTCEICAYAACTGCLKK; (SEQ ID
NO: 61) PNTCEICAYAACTGCKKKKKK; (SEQ ID NO: 62) PNTCEICAYAACTGCD;
(SEQ ID NO: 63) PNTCEICAYAACTGCDK; (SEQ ID NO: 64)
YPNTCEICAYAACTGC; (SEQ ID NO: 65 KNTCEICAYAACTGC (SEQ ID NO: 66)
KPNTCEICAYAACTGC; (SEQ ID NO: 67) EDPGTCEICAYAACTGC; (SEQ ID NO:
68) VTVQDG NFSFSLESVK KLKDLQEPQE PRVGKLRNFA PIPGEPVVPI LCSNPNFPEE
LKPLCKEPNA QEILQRLEEIAEDPGTCEICAYAACTGC; (SEQ ID NO: 69)
DPGTCEICAYAACTGC; (SEQ ID NO: 70) MNAFLLSALC LLGAWAALAG GVTVQDGNFS
FSLESVKKLK DLQEPQEPRV GKLRNFAPIP GEPVVPILCS NPNFPEELKP LCKEPNAQEI
LQRLEEIAED PGTCEICAYAACTGC; (SEQ ID NO: 71) MNAFLLFALC LLGAWAALAG
GVTVQDGNFS FSLEPRVGKL RNFAPIPGEP VVPILCSNPN FPEELKPLCK EPNAQEILQR
LEEIAEDPGTCEICAYAACTGC; (SEQ ID NO: 72) TGSMNAFLLF ALCLLGAWAA
LAGGVTVQDG NFSFSLEPRV GKLRNFAPIP GEPVVPILCS NPNFPEELKP LCKEPNAQEI
LQRLEEIAEDPGTCEICAYAACTGCLEG; (SEQ ID NO: 73) NDECELCVNVACTGCL;
(SEQ ID NO: 74) ECELCVNVACTGCL; (SEQ ID NO: 75) EDCELCINVACTGC;
(SEQ ID NO: 76) NDDCELCVACTGCL; (SEQ ID NO: 77)
FKTLRTIANDDCELCVNVACTGCL; (SEQ ID NO: 78) FKTLRTIANDDCLCVNVACTGCL;
(SEQ ID NO: 79) DDCELCVNVACTGCL; (SEQ ID NO: 80) DCELCVNVACTGCL;
(SEQ ID NO: 81) CELCVNVACTGCL; (SEQ ID NO: 82) KDDCELCVNVACTGCL;
(SEQ ID NO: 83) PNTCEICANPACTGC.
[0178] The peptides can include the amino acid sequence of a
peptide that occurs naturally in a vertebrate (e.g., mammalian)
species or in a bacterial species. In addition, the peptides can be
partially or completely non-naturally occurring peptides.
[0179] In a third aspect, the invention features a method for
treating a patient suffering from constipation, the method
comprising administering a composition comprising a peptide
comprising, consisting essentially or consisting of the amino acid
sequence of SEQ ID NO:1. Clinically accepted criteria that define
constipation range from the frequency of bowel movements, the
consistency of feces and the ease of bowel movement. One common
definition of constipation is less than three bowel movements per
week. Other definitions include abnormally hard stools or
defecation that requires excessive straining (Schiller 2001 Aliment
Pharmacol Ther 15:749-763). Constipation may be idiopathic
(functional constipation or slow transit constipation) or secondary
to other causes including neurologic, metabolic or endocrine
disorders. These disorders include diabetes mellitus,
hypothyroidism, hyperthyroidism, hypocalcaemia, Multiple sclerosis,
Parkinson's disease, spinal cord lesions, Neurofibromatosis,
autonomic neuropathy, Chagas disease, Hirschsprung disease and
cystic fibrosis. Constipation may also be the result of surgery or
due to the use of drugs such as analgesics (like opioids),
antihypertensives, anticonvulsants, antidepressants, antispasmodics
and antipsychotics.
[0180] In various embodiments, the constipation is associated with
use of a therapeutic agent; the constipation is associated with a
neuropathic disorder; the constipation is post-surgical
constipation; the constipation is associated with a
gastrointestinal disorder; the constipation is idiopathic
(functional constipation or slow transit constipation); the
constipation is associated with neuropathic, metabolic or endocrine
disorder (e.g., diabetes mellitus, hypothyroidism, hyperthyroidism,
hypocalcaemia, Multiple Sclerosis, Parkinson's disease, spinal cord
lesions, neurofibromatosis, autonomic neuropathy, Chagas disease,
Hirschsprung disease or cystic fibrosis). Constipation may also be
the result of surgery or due to the use of drugs such as analgesics
(e.g., opioids), antihypertensives, anticonvulsants,
antidepressants, antispasmodics and antipsychotics.
[0181] In a fourth aspect, the invention features a method for
treating a patient suffering a gastrointestinal disorder, the
method comprising administering to the patient a composition
comprising a purified peptide comprising, consisting essentially of
or consisting of the amino acid sequence of SEQ ID NO:1.
[0182] In various embodiments, the patient is suffering from a
gastrointestinal disorder; the patient is suffering from a disorder
selected from the group consisting of: a gastrointestinal motility
disorder, irritable bowel syndrome, a functional gastrointestinal
disorder, gastroesophageal reflux disease, functional heartburn,
dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis,
chronic intestinal pseudo-obstruction, colonic pseudo-obstruction;
Crohn's disease, ulcerative colitis, Inflammatory bowel disease,
colonic pseudo-obstruction, obesity, congestive heart failure, and
benign prostatic hyperplasia.
[0183] In a fifth aspect, the invention features a method for
increasing gastrointestinal motility in a patient, the method
comprising administering to the patient a composition comprising a
purified peptide comprising, consisting essentially of or
consisting of the amino acid sequence of SEQ ID NO:1.
[0184] In a sixth aspect, the invention features a method for
decreasing gastrointestinal pain or visceral pain in a patient, the
method comprising administering to the patient a composition
comprising a purified peptide comprising, consisting essentially of
or consisting of the amino acid sequence of SEQ ID NO:1.
[0185] In a seventh aspect, the invention features a method for
increasing the activity of an intestinal guanylate cyclase (GC-C)
receptor in a patient, the method comprising administering to the
patient a composition comprising a purified peptide comprising,
consisting essentially of or consisting of the amino acid sequence
of SEQ ID NO:1.
[0186] In an eighth aspect, the invention features an isolated
nucleic acid molecule comprising a nucleotide sequence encoding a
peptide comprising, consisting essentially of or consisting of the
amino acid sequence of SEQ ID NO:1.
[0187] In a ninth aspect, the invention features a composition
comprising a purified polypeptide comprising, consisting
essentially of or consisting of the amino acid sequence of SEQ ID
NO:1. In an embodiment, the composition is a pharmaceutical
composition.
[0188] In a tenth aspect, the invention features a method for
treating obesity, the method comprising administering a composition
comprising a purified peptide comprising, consisting essentially of
or consisting of the amino acid sequence of SEQ ID NO:1. The
peptide can be administered in combination with one or more agents
for treatment of obesity, for example, gut hormone fragment peptide
YY.sub.3-36 (PYY.sub.3-36) (N. Engl. J. Med. 349:941, 2003;
ikpeapge daspeelnry yaslrhylnl vtrqry) or a variant thereof, glp-1
(glucagon-like peptide-1), exendin-4 (an inhibitor of glp-1),
sibutramine, phentermine, phendimetrazine, benzphetamine
hydrochloride (Didrex), orlistat (Xenical), diethylpropion
hydrochloride (Tenuate), fluoxetine (Prozac), bupropion, ephedra,
chromium, garcinia cambogia, benzocaine, bladderwrack (focus
vesiculosus), chitosan, nomame herba, galega (Goat's Rue, French
Lilac), conjugated linoleic acid, L-carnitine, fiber (psyllium,
plantago, guar fiber), caffeine, dehydroepiandrosterone, germander
(teucrium chamaedrys), B-hydroxy-.beta.-methylbutyrate, ATL-962
(Alizyme PLC), and pyruvate. A peptide useful for treating obesity
can be administered as a co-therapy with a peptide of the invention
either as a distinct molecule or as part of a fusion protein with a
peptide of the invention. Thus, for example, PYY.sub.3-36 can be
fused to the carboxy or amino terminus of a peptide of the
invention. Such a fusion protein can include a chymostrypsin or
trypsin cleavage site that can permit cleavage to separate the two
peptides. A peptide useful for treating obesity can be administered
as a co-therapy with electrostimulation (U.S. 20040015201).
[0189] In an eleventh aspect, the invention features a method for
treating congestive heart failure, the method comprising:
administering to the patient a composition comprising a purified
peptide comprising, consisting essentially of or consisting of the
amino acid sequence of SEQ ID NO:1. The peptide can be administered
in combination with one or more agents for treatment of congestive
heart failure, for example, a natriuretic peptide such as atrial
natriuretic peptide, brain natriuretic peptide or C-type
natriuretic peptide), a diuretic, or an inhibitor of angiotensin
converting enzyme.
[0190] In a twelfth aspect, the invention features a method for
treating benign prostatic hyperplasia, the method comprising:
administering to the patient a composition comprising a purified
peptide comprising, consisting essentially of or consisting of the
amino acid sequence of SEQ ID NO:1. The peptide can be administered
in combination with one or more agents for treatment of BPH, for
example, a 5-alpha reductase inhibitor (e.g., finasteride) or an
alpha adrenergic inhibitor (e.g., doxazosine).
[0191] In a thirteenth aspect, the invention features a method for
treating a patient suffering a gastrointestinal disorder, the
method comprising administering to the patient a composition
comprising a complete or partial agonist of the GC-C receptor. In
various embodiments, the patient is suffering from a
gastrointestinal disorder; the patient is suffering from a disorder
selected from the group consisting of: a gastrointestinal motility
disorder, irritable bowel syndrome, a functional gastrointestinal
disorder, gastroesophageal reflux disease, functional heartburn,
dyspepsia, functional dyspepsia, nonulcer dyspepsia, gastroparesis,
chronic intestinal pseudo-obstruction, and colonic
pseudo-obstruction.
[0192] In a fourteenth aspect, the invention features a method for
treating a patient suffering from constipation, the method
comprising administering a composition comprising a complete or
partial agonist of the GC-C receptor.
[0193] In a fifteenth aspect, the invention features a method for
increasing gastrointestinal motility in a patient, the method
comprising administering to the patient a composition comprising a
complete or partial agonist of the GC-C receptor.
[0194] In a sixteenth aspect, the invention features a method for
decreasing gastrointestinal pain or visceral pain in a patient, the
method comprising administering to the patient a composition
comprising a complete or partial agonist of the GC-C receptor.
[0195] In a seventeenth aspect, the invention features a method for
treating congestive heart failure, the method comprising
administering a complete or partial agonist of the GC-C receptor.
GC-C agonists can act in the kidney and adrenal gland to control
natriuresis, kaliuresis, and diuresis thereby reducing the build-up
of fluid associated with congestive heart failure (Lorenz et al. J
Clin Invest 112:1138, 2003; Carrithers et al. Kidney Int 65:40,
2004). The agonist can be administered in combination with one or
more agents for treatment of congestive heart failure, for example,
a natriuretic peptide such as atrial natriuretic peptide, brain
natriuretic peptide or C-type natriuretic peptide), a diuretic, or
an inhibitor of angiotensin converting enzyme.
[0196] In an eighteenth aspect, the invention features a method for
treating BPH, the method comprising administering a complete or
partial agonist of the GC-C receptor. GC-C agonists acting in the
prostate can reduce cellular hypertrophy and complications
associated with cellular hypertrophy. The agonist can be
administered in combination with one or more agents for treatment
of BPH, for example, a 5-alpha reductase inhibitor (e.g.,
finasteride) or an alpha adrenergic inhibitor (e.g.,
doxazosine).
[0197] In a nineteenth aspect, the invention features a method for
treating obesity, the method comprising administering a complete or
partial agonist of the GC-C receptor. The agonist can be
administered in combination with one or more agents for treatment
of obesity, for example, sibutramine.
[0198] The peptides and agonists of the GC-C receptor can be used
to treat constipation or decreased intestinal motility, slow
digestion or slow stomach emptying. The peptides can be used to
relieve one or more symptoms of IBS (bloating, pain, constipation),
GERD (acid reflux into the esophagus), duodenogastric reflux,
functional dyspepsia, or gastroparesis (nausea, vomiting, bloating,
delayed gastric emptying) and other disorders described herein.
Clinically accepted criteria that define constipation range from
the frequency of bowel movements, the consistency of feces and the
ease of bowel movement. One common definition of constipation is
less than three bowel movements per week. Other definitions include
abnormally hard stools or defecation that requires excessive
straining (Schiller 2001, Aliment Pharmacol Ther 15:749-763).
Constipation may be idiopathic (functional constipation or slow
transit constipation) or secondary to other causes including
neurologic, metabolic or endocrine disorders. These disorders
include diabetes mellitus, hypothyroidism, hyperthyroidism,
hypocalcaemia, Multiple Sclerosis, Parkinson's disease, spinal cord
lesions, Neurofibromatosis, autonomic neuropathy, Chagas disease,
Hirschsprung's disease and cystic fibrosis. Constipation may also
be the result of surgery or due to the use of drugs such as
analgesics (like opioids), antihypertensives, anticonvulsants,
antidepressants, antispasmodics and antipsychotics.
[0199] In a twentieth aspect, the invention features isolated
nucleic acid molecules comprising or consisting of a sequence
encoding a peptide of the invention. The invention also features
vectors, e.g., expression vectors that include such nucleic acid
molecules and can be used to express a peptide of the invention in
a cultured cell (e.g., a eukaryotic cell or a prokaryotic cell).
The vector can further include one or more regulatory elements,
e.g., a heterologous promoter or elements required for translation
operably linked to the sequence encoding the peptide. In some cases
the nucleic acid molecule will encode an amino acid sequence that
includes the amino acid sequence of a peptide of the invention. For
example, the nucleic acid molecule can encode a preprotein or a
preproprotein that can be processed to produce a peptide of the
invention.
[0200] A vector that includes a nucleotide sequence encoding a
peptide of the invention or a peptide or polypeptide comprising a
peptide of the invention may be either RNA or DNA, single- or
double-stranded, prokaryotic, eukaryotic, or viral. Vectors can
include transposons, viral vectors, episomes, (e.g., plasmids),
chromosomes inserts, and artificial chromosomes (e.g. BACs or
YACs). Suitable bacterial hosts for expression of the encode
peptide or polypeptide include, but are not limited to, E. coli.
Suitable eukaryotic hosts include yeast such as S. cerevisiae,
other fungi, vertebrate cells, invertebrate cells (e.g., insect
cells), plant cells, human cells, human tissue cells, and whole
eukaryotic organisms. (e.g., a transgenic plant or a transgenic
animal). Further, the vector nucleic acid can be used to generate a
virus such as vaccinia or baculovirus.
[0201] As noted above the invention includes vectors and genetic
constructs suitable for production of a peptide of the invention or
a peptide or polypeptide comprising such a peptide. Generally, the
genetic construct also includes, in addition to the encoding
nucleic acid molecule, elements that allow expression, such as a
promoter and regulatory sequences. The expression vectors may
contain transcriptional control sequences that control
transcriptional initiation, such as promoter, enhancer, operator,
and repressor sequences. A variety of transcriptional control
sequences are well known to those in the art and may be functional
in, but are not limited to, a bacterium, yeast, plant, or animal
cell. The expression vector can also include a translation
regulatory sequence (e.g., an untranslated 5' sequence, an
untranslated 3' sequence, a poly A addition site, or an internal
ribosome entry site), a splicing sequence or splicing regulatory
sequence, and a transcription termination sequence. The vector can
be capable of autonomous replication or it can integrate into host
DNA.
[0202] The invention also includes isolated host cells harboring
one of the forgoing nucleic acid molecules and methods for
producing a peptide by culturing such a cell and recovering the
peptide or a precursor of the peptide. Recovery of the peptide or
precursor may refer to collecting the growth solution and need not
involve additional steps of purification. Proteins of the present
invention, however, can be purified using standard purification
techniques, such as, but not limited to, affinity chromatography,
thermaprecipitation, immunoaffinity chromatography, ammonium
sulfate precipitation, ion exchange chromatography, filtration,
electrophoresis and hydrophobic interaction chromatography.
[0203] In a twenty first aspect, the invention features a method of
increasing the level of cyclic guanosine 3'-monophosphate (cGMP) in
an organ, tissue (e.g, the intestinal mucosa), or cell (e.g., a
cell bearing GC-A receptor) by administering a composition that
includes a peptide of the invention.
[0204] The details of one or more embodiments of the invention are
set forth in the accompanying description and claims. The
publications and patents referenced herein are incorporated by
reference.
DRAWINGS
[0205] FIG. 1 depicts deletion variants of human guanylin in which
one, two, three or four amino acids are deleted. The deleted amino
acids are between Cys.sub.a and Cys.sub.d as well as amino terminal
to Cys.sub.a.
[0206] FIG. 2 depicts insertion variants of human guanylin in which
one, two, three or four amino acids are inserted. The inserted
amino acids are between Cys.sub.a and Cys.sub.d as well as amino
terminal to Cys.sub.a and carboxy terminal to Cys.sub.d.
[0207] FIG. 3 depicts various polypeptides which include the amino
acid sequence: Xaa.sub.1 Xaa.sub.2 Xaa.sub.3 Cys.sub.4 Xaa.sub.5
Xaa.sub.6 Xaa.sub.7 Xaa.sub.8 Xaa.sub.9 Xaa.sub.10 Xaa.sub.11
Cys.sub.12 Xaa.sub.13 Xaa.sub.14 Xaa.sub.15 Xaa.sub.16 (SEQ ID
NO:1) wherein: Xaa.sub.1 is any amino acid or is missing; Xaa.sub.2
is any amino acid or is missing; Xaa.sub.3 is any amino acid or is
missing; Xaa.sub.5 is Glu; Xaa.sub.6 is Tyr, Trp, Phe or Leu; Xaa
is Cys; Xaa.sub.8 is any of the 20 naturally-occurring amino acids
other than Cys or is missing; Xaa.sub.9 is any of the 20
naturally-occurring amino acids; Xaa.sub.10 is Pro or Gly;
Xaa.sub.11 is any of the 20 naturally-occurring amino acids;
Xaa.sub.13 is Thr, Val or Gly; Xaa.sub.14 is Gly or Ala; Xaa.sub.15
is Cys; and Xaa.sub.16 is any of the 20 naturally-occurring amino
acids or is missing.
DETAILED DESCRIPTION
[0208] The peptides of the invention bind to the guanylate cyclase
(GC-C) receptor, a key regulator of fluid and electrolyte balance
in the intestine and kidney. When stimulated, this receptor, which
is located on the apical membrane of the intestinal epithelial
surface, causes an increase in intestinal epithelial cyclic GMP
(cGMP). This increase in cGMP is believed to cause a decrease in
water and sodium absorption and an increase in chloride and
potassium ion secretion, leading to changes in intestinal fluid and
electrolyte transport and increased intestinal motility. The
intestinal GC-C receptor possesses an extracellular ligand binding
region, a transmembrane region, an intracellular protein
kinase-like region and a cyclase catalytic domain. Proposed
functions for the GC-C receptor are the fluid and electrolyte
homeostasis, the regulation of epithelial cell proliferation and
the induction of apoptosis (Shaibhubhai 2002 Curr Opin Drug Dis
Devel 5:261-268).
[0209] In addition to being expressed in gastrointestinal
epithelial cells, GC-C is expressed in extra-intestinal tissues
including kidney, lung, pancreas, pituitary, adrenal, developing
liver, heart and male and female reproductive tissues (reviewed in
Vaandrager 2002 Mol Cell Biochem 230:73-83). This suggests that the
GC-C receptor agonists can be used in the treatment of disorders
outside the GI tract, for example, congestive heart failure and
benign prostatic hyperplasia.
[0210] Ghrelin, a peptide hormone secreted by the stomach, is a key
regulator of appetite in humans. Ghrelin expression levels are
regulated by fasting and by gastric emptying. (Kim et al., 2003,
Neuroreprt 14:1317-20; Gualillo et al., 2003, FEBS Letts 552:
105-9). Thus, by increasing gastrointestinal motility, GC-C
receptor agonists may also be used to regulate obesity.
[0211] In humans, the GC-C receptor is activated by guanylin (Gn)
(U.S. Pat. No. 5,96,097), uroguanylin (Ugn) (U.S. Pat. No.
5,140,102) and lymphoguanylin (Forte et al. 1999 Endocrinology
140:1800-1806).
[0212] Many gastrointestinal disorders, including IBS, are
associated with abdominal or visceral pain. Certain of the peptides
of the invention include the analgesic or anti-nociceptive tags
such as the carboxy-terminal sequence AspPhe immediately following
a Trp, Tyr or Phe (i.e., a chymotrypsin cleavage site) or following
Lys or Arg (a trypsin cleavage site). Chymotrypsin in the
intestinal tract will cleave such peptides immediately carboxy
terminal to the Trp, Phe or Tyr residue, releasing the dipeptide,
AspPhe. This dipeptide has been shown to have analgesic activity is
animal models (Abdikkahi et al. 2001 Fundam Clin Pharmacol
15:117-23; Nikfar et al 1997, 29:583-6; Edmundson et al 1998 Clin
Pharmacol Ther 63:580-93). In this manner such peptides can treat
both pain and inflammation. Other analgesic peptides can be present
at the carboxy terminus of the peptide (following a cleavage site)
including: endomorphin-1, endomorphin-2, nocistatin, dalargin,
lupron, and substance P. As described in greater detail below,
various analgesic peptides and compounds can be covalently linked
to or used in combination therapy with the therapeutic peptides
described herein.
[0213] In the human body an inactive form of chymotrypsin,
chymotrypsinogen is produced in the pancreas. When this inactive
enzyme reaches the small intestine it is converted to active
chymotrypsin by the excision of two di-peptides. Active
chymotrypsin will cleave peptides at the peptide bond on the
carboxy-terminal side of Trp, Tyr or Phe. The presence of active
chymotrypsin in the intestinal tract will lead to cleavage of
certain of the peptides of the invention having an appropriately
positioned chymotrypsin cleavage site. Certain of the peptides of
the invention include a Trp, Tyr or Phe immediately followed by a
carboxy-terminal analgesic peptide. It is expected that
chymotrypsin cleavage will release the analgesic peptide from
peptide of the invention having an appropriately positioned
chymotrypsin cleavage site as the peptide passes through the
intestinal tract.
[0214] Trypsinogen, like chymotrypsin, is a serine protease that is
produced in the pancreas and is present in the digestive tract. The
active form, trypsin, will cleave peptides having a Lys or Arg. The
presence of active trypsin in the intestinal tract will lead to
cleavage of certain of the peptides of the invention having an
appropriately positioned trypsin cleavage site. It is expected that
chymotrypsin cleavage will release the analgesic peptide from
peptide of the invention having an appropriately positioned trypsin
cleavage site as the peptide passes through the intestinal
tract.
[0215] In some cases, the peptides of the invention are produced as
a prepro protein. The prepro protein can include any suitable
prepro sequence, including, for example, mnafllsalc llgawaalag
gvtvqdgnfs fslesvkklk dlqepqepry gklrnfapip gepvvpilcs npnfpeelkp
lckepnaqei lqrleeiaed (SEQ ID NO:) and mgcraasgll pgvavvllll
qstqsvyiq yqgfrvqles mkklsdleaq wapsprlqaq sllpavchhp alpqdlqpvc
asqeassifk tlrtia (SEQ ID NO:) or a bacterial leader sequence such
as: mkksilfiflsvlsfspfaqdakpvesskekitleskkcniakksnksgpesmn. Where
the peptide is produced by a bacterial cell, e.g., E. coli, the
forgoing leader sequence will be cleaved and the mature peptide
will be efficiently secreted from the bacterial cell. U.S. Pat. No.
5,395,490 describes vectors, expression systems and methods for the
efficient production of certain mature peptides having disulfide
bonds in bacterial cells and methods for achieving efficient
secretion of such mature peptides. The vectors, expression systems
and methods described in U.S. Pat. No. 5,395,490 can be used to
produce the polypeptides of the present invention.
Variant Peptides
[0216] The invention includes variant peptides that can include
one, two, three, four, or five or more (e.g., 6, 7, 8, 9, 10, 11,
12, 13, 14, or 15) amino acid substitutions compared to any of the
peptides described above. The substitution(s) can be conservative
or non-conservative. The naturally-occurring amino acids can be
substituted by D-isomers of any amino acid, non-natural amino
acids, natural and non-natural amino acid analogs, and other
groups. A conservative amino acid substitution results in the
alteration of an amino acid for a similar acting amino acid, or
amino acid of like charge, polarity, or hydrophobicity. At some
positions, even conservative amino acid substitutions can reduce
the activity of the peptide. A conservative substitution can
substitute a naturally-occurring amino acid for a
non-naturally-occurring amino acid. Among the naturally occurring
amino acid substitutions generally considered conservative are:
TABLE-US-00005 For Amino Acid Code Replace with any of Alanine Ala
Gly, Cys, Ser Arginine Arg Lys, His Asparagine Asn Asp, Glu, Gln,
Aspartic Acid Asp Asn, Glu, Gln Cysteine Cys Met, Thr, Ser
Glutamine Gln Asn, Glu, Asp Glutamic Acid Glu Asp, Asn, Gln Glycine
Gly Ala Histidine His Lys, Arg Isoleucine Ile Val, Leu, Met Leucine
Leu Val, Ile, Met Lysine Lys Arg, His Methionine Met Ile, Leu, Val
Phenylalanine Phe Tyr, His, Trp Proline Pro Serine Ser Thr, Cys,
Ala Threonine Thr Ser, Met, Val Tryptophan Trp Phe, Tyr Tyrosine
Tyr Phe, His Valine Val Leu, Ile, Met
[0217] In some circumstances it can be desirable to treat patients
with a variant peptide that binds to and activates intestinal GC-C
receptor, but is less active or more active than the non-variant
form of the peptide. Reduced activity can arise from reduced
affinity for the receptor or a reduced ability to activate the
receptor once bound or reduced stability of the peptide. Increased
activity can arise from increased affinity for the receptor or an
increased ability to activate the receptor once bound or increased
stability of the peptide.
[0218] In some peptides one or both members of one or both pairs of
Cys residues which normally form a disulfide bond can be replaced
by homocysteine, 3-mercaptoproline (Kolodziej et al. 1996 Int J
Pept Protein Res 48:274); .theta., .theta. dimethylcysteine (Hunt
et al. 1993 Int J Pept Protein Res 42:249) or diaminopropionic acid
(Smith et al. 1978 J Med Chem 21:117) to form alternative internal
cross-links at the positions of the normal disulfide bonds.
Production of Peptides
[0219] Useful peptides can be produced either in bacteria
including, without limitation, E. coli, or in other existing
systems for peptide or protein production (e.g., Bacillus subtilis,
baculovirus expression systems using Drosophila Sf9 cells, yeast or
filamentous fungal expression systems, mammalian cell expression
systems), or they can be chemically synthesized.
[0220] If the peptide or variant peptide is to be produced in
bacteria, e.g., E. coli, the nucleic acid molecule encoding the
peptide may also encode a leader sequence that permits the
secretion of the mature peptide from the cell. Thus, the sequence
encoding the peptide can include the pre sequence and the pro
sequence of, for example, a naturally-occurring bacterial ST
peptide. The secreted, mature peptide can be purified from the
culture medium.
[0221] The sequence encoding a peptide of the invention is can be
inserted into a vector capable of delivering and maintaining the
nucleic acid molecule in a bacterial cell. The DNA molecule may be
inserted into an autonomously replicating vector (suitable vectors
include, for example, pGEM3Z and pcDNA3, and derivatives thereof).
The vector nucleic acid may be a bacterial or bacteriophage DNA
such as bacteriophage lambda or M13 and derivatives thereof.
Construction of a vector containing a nucleic acid described herein
can be followed by transformation of a host cell such as a
bacterium. Suitable bacterial hosts include but are not limited to,
E. coli, B subtilis, Pseudomonas, Salmonella. The genetic construct
also includes, in addition to the encoding nucleic acid molecule,
elements that allow expression, such as a promoter and regulatory
sequences. The expression vectors may contain transcriptional
control sequences that control transcriptional initiation, such as
promoter, enhancer, operator, and repressor sequences. A variety of
transcriptional control sequences are well known to those in the
art. The expression vector can also include a translation
regulatory sequence (e.g., an untranslated 5' sequence, an
untranslated 3' sequence, or an internal ribosome entry site). The
vector can be capable of autonomous replication or it can integrate
into host DNA to ensure stability during peptide production.
[0222] The protein coding sequence that includes a peptide of the
invention can also be fused to a nucleic acid encoding a
polypeptide affinity tag, e.g., glutathione S-transferase (GST),
maltose E binding protein, protein A, FLAG tag, hexa-histidine, myc
tag or the influenza HA tag, in order to facilitate purification.
The affinity tag or reporter fusion joins the reading frame of the
peptide of interest to the reading frame of the gene encoding the
affinity tag such that a translational fusion is generated.
Expression of the fusion gene results in translation of a single
polypeptide that includes both the peptide of interest and the
affinity tag. In some instances where affinity tags are utilized,
DNA sequence encoding a protease recognition site will be fused
between the reading frames for the affinity tag and the peptide of
interest.
[0223] Genetic constructs and methods suitable for production of
immature and mature forms of the peptides and variants of the
invention in protein expression systems other than bacteria, and
well known to those skilled in the art, can also be used to produce
peptides in a biological system.
[0224] Mature peptides and variants thereof can be synthesized by
the solid-phase method using an automated peptide synthesizer. For
example, the peptide can be synthesized on Cyc(4-CH.sub.2
Bxl)-OCH.sub.2-4-(oxymethyl)-phenylacetamidomethyl resin using a
double coupling program. Protecting groups must be used
appropriately to create the correct disulfide bond pattern. For
example, the following protecting groups can be used:
t-butyloxycarbonyl (alpha-amino groups); acetamidomethyl (thiol
groups of Cys residues B and E); 4-methylbenyl (thiol groups of Cys
residues C and F); benzyl (y-carboxyl of glutamic acid and the
hydroxyl group of threonine, if present); and bromobenzyl (phenolic
group of tyrosine, if present). Coupling is effected with
symmetrical anhydride of t-butoxylcarbonylamino acids or
hydroxybenzotriazole ester (for asparagine or glutamine residues),
and the peptide is deprotected and cleaved from the solid support
in hydrogen fluoride, dimethyl sulfide, anisole, and p-thiocresol
using 8/1/1/0.5 ratio (v/v/v/w) at 0.degree. C. for 60 min. After
removal of hydrogen fluoride and dimethyl sulfide by reduced
pressure and anisole and p-thiocresol by extraction with ethyl
ether and ethyl acetate sequentially, crude peptides are extracted
with a mixture of 0.5M sodium phosphate buffer, pH 8.0 and
N,N-dimethylformamide using 1/1 ratio, v/v. The disulfide bond for
Cys residues B and E is the formed using dimethyl sulfoxide (Tam et
al. (1991) J. Am. Chem. Soc. 113:6657-62). The resulting peptide is
the purified by reverse-phase chromatography. The disulfide bond
between Cys residues C and F is formed by first dissolving the
peptide in 50% acetic acid in water. Saturated iodine solution in
glacial acetic acid is added (1 ml iodine solution per 100 ml
solution). After incubation at room temperature for 2 days in an
enclosed glass container, the solution is diluted five-fold with
deionized water and extracted with ethyl ether four times for
removal of unreacted iodine. After removal of the residual amount
of ethyl ether by rotary evaporation the solution of crude product
is lyophilized and purified by successive reverse-phase
chromatography.
Intestinal GC-C Receptor Binding and Activity Assays
[0225] The ability of peptides, variant peptides and other
compounds to bind to and activate the intestinal GC-C receptor can
be tested using the T84 human colon carcinoma cell line (American
Type Culture Collection (Bethesda, Md.).
[0226] Briefly, cells are grown to confluency in 24-well culture
plates with a 1:1 mixture of Ham's F12 medium and Dulbecco's
modified Eagle's medium (DMEM), supplemented with 5% fetal calf
serum and are used at between passages 54 and 60.
[0227] Monolayers of T84 cells in 24-well plates are washed twice
with 1 ml/well DMEM, then incubated at 37.degree. C. for 10 min
with 0.45 ml DMEM containing 1 mM isobutylmethylxanthine (IBMX), a
cyclic nucleotide phosphodiesterase inhibitor. Test peptides (50Tl)
are then added and incubated for 30 minutes at 37.degree. C. The
media is aspirated and the reaction is terminated by the addition
of ice cold 0.5 ml of 0.1N HCl. The samples are held on ice for 20
minutes and then evaporated to dryness using a heat gun or vacuum
centrifugation. The dried samples are resuspended in 0.5 ml of
phosphate buffer provided in the Cayman Chemical Cyclic GMP EIA kit
(Cayman Chemical, Ann Arbor, Mich.). Cyclic GMP is measured by EIA
according to procedures outlined in the Cayman Chemical Cyclic GMP
EIA kit.
[0228] For the binding assay, T84 cell monolayers in 24-well plates
are washed twice with 1 ml of binding buffer (DMEM containing 0.05%
bovine serum albumin and 25 mM HEPES, pH 7.2), then incubated for
30 min at 37.degree. C. in the presence of mature radioactively
labeled E. coli ST peptide and the test material at various
concentrations. The cells are then washed 4 times with 1 ml of DMEM
and solubilized with 0.5 ml/well 1N NaOH. The level of
radioactivity in the solubilized material is then determined using
standard methods.
Murine Gastrointestinal Transit (GIT) Assay
[0229] In order to determine whether a test compound or a peptide,
increases the rate of gastrointestinal transit, the test compound
can be tested in the murine gastrointestinal transit (GIT) assay
(Moon et al. Infection and Immunity 25:127, 1979). In this assay,
charcoal, which can be readily visualized in the gastrointestinal
tract is administered to mice after the administration of a test
compound. The distance traveled by the charcoal is measured and
expressed as a percentage of the total length of the colon.
[0230] Mice are fasted with free access to water for 12 to 16 hours
before the treatment with peptide or control buffer. The peptides
are orally administered at 1 Tg/kg-1 mg/kg of peptide in buffer (20
mM Tris pH 7.5) seven minutes before being given an oral dose of 5%
Activated Carbon (Aldrich 242276-250G). Control mice are
administered buffer only before being given a dose of Activated
Carbon. After 15 minutes, the mice are sacrificed and their
intestines from the stomach to the cecum are dissected. The total
length of the intestine as well as the distance traveled from the
stomach to the charcoal front is measured for each animal and the
results are expressed as the percent of the total length of the
intestine traveled by the charcoal front. Results are reported as
the average of 10 mice.+-.standard deviation. A comparison of the
distance traveled by the charcoal between the mice treated with
peptide versus the mice treated with vehicle alone is performed
using a Student's t test and a statistically significant difference
is considered for P<0.05. Positive controls for this assay may
include commercially available wild-type ST peptide (Sigma-Aldrich,
St Louis, Mo.) and Zelnorm.RTM., a drug approved for IBS that is an
agonist for the serotonin receptor 5HT4.
Suckling Mouse Model of Intestinal Secretion (SuMi Assay)
[0231] The peptides of the invention can be tested for their
ability to increase intestinal secretion using a suckling mouse
model of intestinal secretion. In this model a test compound is
administered to suckling mice that are between seven and nine days
old. After the mice are sacrificed, the gastrointestinal tract from
the stomach to the cecum is dissected ("guts"). The remains
("carcass") as well as the guts are weighed and the ratio of guts
to carcass weight is calculated. If the ratio is above 0.09, one
can conclude that the test compound increases intestinal secretion.
Controls for this assay may include wild-type ST peptide and
Zelnorm.RTM.
Phenylbenzoquinone-Induced Writhing Model
[0232] The PBQ-induced writhing model can be used to assess pain
control activity of the peptides and GC-C receptor agonists of the
invention. This model is described by Siegmund et al. (1957 Proc.
Soc. Exp. Bio. Med. 95:729-731). Briefly, one hour after oral
dosing with a test compound, e.g., a peptide, morphine or vehicle,
0.02% phenylbenzoquinone (PBQ) solution (12.5 mL/kg) is injected by
intraperitoneal route into the mouse. The number of stretches and
writhings are recorded from the 5.sup.th to the 10.sup.th minute
after PBQ injection, and can also be counted between the 35.sup.th
and 40.sup.th minute and between the 60.sup.th and 65.sup.th minute
to provide a kinetic assessment. The results are expressed as the
number of stretches and writhings (mean.+-.SEM) and the percentage
of variation of the nociceptive threshold calculated from the mean
value of the vehicle-treated group. The statistical significance of
any differences between the treated groups and the control group is
determined by a Dunnett's test using the residual variance after a
one-way analysis of variance (P<0.05) using SigmaStat
Software.
Colonic Hyperalgesia Animal Models
[0233] Hypersensitivity to colorectal distension is a common
feature in patients with IBS and may be responsible for the major
symptom of pain. Both inflammatory and non-inflammatory animal
models of visceral hyperalgesia to distension have been developed
to investigate the effect of compounds on visceral pain in IBS.
[0234] I. Trinitrobenzenesulphonic Acid (TNBS)-Induced Rectal
Allodynia Model
[0235] Male Wistar rats (220-250 g) are premedicated with 0.5 mg/kg
of acepromazine injected intraperitoneally (IP) and anesthetized by
intramuscular administration of 100 mg/kg of ketamine. Pairs of
nichrome wire electrodes (60 cm in length and 80 .mu.m in diameter)
are implanted in the striated muscle of the abdomen, 2 cm laterally
from the white line. The free ends of electrodes are exteriorized
on the back of the neck and protected by a plastic tube attached to
the skin. Electromyographic (EMG) recordings are started 5 days
after surgery. Electrical activity of abdominal striated muscle is
recorded with an electroencephalograph machine (Mini VIII, Alvar,
Paris, France) using a short time constant (0.03 sec.) to remove
low-frequency signals (<3 Hz).
[0236] Ten days post surgical implantation,
trinitrobenzenesulphonic acid (TNBS) is administered to induce
rectal inflammation. TNBS (80 mg kg.sup.-1 in 0.3 ml 50% ethanol)
is administered intrarectally through a silicone rubber catheter
introduced at 3 cm from the anus under light diethyl-ether
anesthesia, as described (Morteau et al. 1994 Dig Dis Sci 39:1239).
Following TNBS administration, rats are placed in plastic tunnels
where they are severely limited in mobility for several days before
colorectal distension (CRD). Experimental compound is administered
one hour before CRD which is performed by insertion into the
rectum, at 1 cm of the anus, a 4 cm long balloon made from a latex
condom (Gue et al, 1997 Neurogastroenterol. Motil. 9:271). The
balloon is fixed on a rigid catheter taken from an embolectomy
probe (Fogarty). The catheter attached balloon is fixed at the base
of the tail. The balloon, connected to a barostat is inflated
progressively by step of 15 mmHg, from 0 to 60 mmHg, each step of
inflation lasting 5 min. Evaluation of rectal sensitivity, as
measured by EMG, is performed before (1-2 days) and 3 days
following rectal instillation of TNBS. The number of spike bursts
that corresponds to abdominal contractions is determined per 5 min
periods. Statistical analysis of the number of abdominal
contractions and evaluation of the dose-effects relationships is
performed by a one way analysis of variance (ANOVA) followed by a
post-hoc (Student or Dunnett tests) and regression analysis for
ED50 if appropriate.
[0237] II. Stress-Induced Hyperalgesia Model
[0238] Male Wistar Rats (200-250 g) are surgically implanted with
nichrome wire electrodes as in the TNBS model. Ten days post
surgical implantation, partial restraint stress (PRS), is performed
as described by Williams et al. for two hours (Williams et al. 1988
Gastroenterology 64:611). Briefly, under light anaesthesia with
ethyl-ether, the foreshoulders, upper forelimbs and thoracic trunk
are wrapped in a confining harness of paper tape to restrict, but
not prevent body movements. Control sham-stress animals are
anaesthetized but not wrapped. Thirty minutes before the end of the
PRS session, the animals are administered test-compound or vehicle.
Thirty minutes to one hour after PRS completion, the CRD distension
procedure is performed as described above for the TNBS model with
barostat at pressures of 15, 30, 45 and 60 mm Hg. Statistical
analysis on the number of bursts is determined and analyzed as in
the TNBS model above.
Administration of Peptides and GC-C Receptor Agonists
[0239] For treatment of gastrointestinal disorders, the peptides
and agonists of the invention are can be administered orally, e.g.,
as a tablet or cachet containing a predetermined amount of the
active ingredient, pellet, gel, paste, syrup, bolus, electuary,
slurry, capsule; powder; granules; as a solution or a suspension in
an aqueous liquid or a non-aqueous liquid; as an oil-in-water
liquid emulsion or a water-in-oil liquid emulsion, via a liposomal
formulation (see, e.g., EP 736299) or in some other form. Orally
administered compositions can include binders, lubricants, inert
diluents, lubricating, surface active or dispersing agents,
flavoring agents, and humectants. Orally administered formulations
such as tablets may optionally be coated or scored and may be
formulated so as to provide sustained, delayed or controlled
release of the active ingredient therein. The peptides and agonists
can be co-administered with other agents used to treat
gastrointestinal disorders including but not limited to acid
suppressing agents such as Histamine-2 receptor agonists (H2As) and
proton pump inhibitors (PPIs). The peptides and agonists can also
be administered by rectal suppository. For the treatment of
disorders outside the gastrointestinal tract such as congestive
heart failure and benign prostatic hypertrophy, peptides and
agonists can be administered parenterally or orally.
[0240] The peptides described herein can be used alone or in
combination with other agents. For example, the peptides can be
administered together with one or more analgesic peptides or
compounds. The analgesic peptide and/or compound can be covalently
attached to a peptide described herein or it can be a separate
agent that is administered together with or sequentially with a
peptide described herein in a combination therapy.
[0241] Combination therapy can be achieved by administering two or
more agents, e.g., a peptide described herein and an analgesic
peptide or compound, each of which is formulated and administered
separately, or by administering two or more agents in a single
formulation. Other combinations are also encompassed by combination
therapy. For example, two agents can be formulated together and
administered in conjunction with a separate formulation containing
a third agent. While the two or more agents in the combination
therapy can be administered simultaneously, they need not be. For
example, administration of a first agent (or combination of agents)
can precede administration of a second agent (or combination of
agents) by minutes, hours, days, or weeks. Thus, the two or more
agents can be administered within minutes of each other or within
1, 2, 3, 6, 9, 12, 15, 18, or 24 hours of each other or within 1,
2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14 days of each other or within 2,
3, 4, 5, 6, 7, 8, 9, or 10 weeks of each other. In some cases even
longer intervals are possible. While in many cases it is desirable
that the two or more agents used in a combination therapy be
present in within the patient's body at the same time, this need
not be so.
[0242] Combination therapy can also include two or more
administrations of one or more of the agents used in the
combination. For example, if agent X and agent Y are used in a
combination, one could administer them sequentially in any
combination one or more times, e.g., in the order X-Y-X, X-X-Y,
Y-X-Y, Y-Y-X, X-X-Y-Y, etc.
[0243] The agents, alone or in combination, can be combined with
any pharmaceutically acceptable carrier or medium. Thus, they can
be combined with materials that do not produce an adverse, allergic
or otherwise unwanted reaction when administered to a patient. The
carriers or mediums used can include solvents, dispersants,
coatings, absorption promoting agents, controlled release agents,
and one or more inert excipients (which include starches, polyols,
granulating agents, microcrystalline cellulose, diluents,
lubricants, binders, disintegrating agents, and the like), etc. If
desired, tablet dosages of the disclosed compositions may be coated
by standard aqueous or nonaqueous techniques.
[0244] Compositions of the present invention may also optionally
include other therapeutic ingredients, anti-caking agents,
preservatives, sweetening agents, colorants, flavors, desiccants,
plasticizers, dyes, and the like. Any such optional ingredient must
be compatible with the compound of the invention to insure the
stability of the formulation. The composition may contain other
additives as needed, including for example lactose, glucose,
fructose, galactose, trehalose, sucrose, maltose, raffinose,
maltitol, melezitose, stachyose, lactitol, palatinite, starch,
xylitol, mannitol, myoinositol, and the like, and hydrates thereof,
and amino acids, for example alanine, glycine and betaine, and
peptides and proteins, for example albumen.
[0245] Examples of excipients for use as the pharmaceutically
acceptable carriers and the pharmaceutically acceptable inert
carriers and the aforementioned additional ingredients include, but
are not limited to binders, fillers, disintegrants, lubricants,
anti-microbial agents, and coating agents such as:
[0246] BINDERS: corn starch, potato starch, other starches,
gelatin, natural and synthetic gums such as acacia, sodium
alginate, alginic acid, other alginates, powdered tragacanth, guar
gum, cellulose and its derivatives (e.g., ethyl cellulose,
cellulose acetate, carboxymethyl cellulose calcium, sodium
carboxymethyl cellulose), polyvinyl pyrrolidone, methyl cellulose,
pre-gelatinized starch (e.g., STARCH 1500.RTM. and STARCH 1500
LM.RTM., sold by Colorcon, Ltd.), hydroxypropyl methyl cellulose,
microcrystalline cellulose (e.g. AVICEL.TM., such as,
AVICEL-PH-101.TM., -103.TM. and -105.TM., sold by FMC Corporation,
Marcus Hook, Pa., USA), or mixtures thereof,
[0247] FILLERS: talc, calcium carbonate (e.g., granules or powder),
dibasic calcium phosphate, tribasic calcium phosphate, calcium
sulfate (e.g., granules or powder), microcrystalline cellulose,
powdered cellulose, dextrates, kaolin, mannitol, silicic acid,
sorbitol, starch, pre-gelatinized starch, or mixtures thereof,
[0248] DISINTEGRANTS: agar-agar, alginic acid, calcium carbonate,
microcrystalline cellulose, croscarmellose sodium, crospovidone,
polacrilin potassium, sodium starch glycolate, potato or tapioca
starch, other starches, pre-gelatinized starch, clays, other
algins, other celluloses, gums, or mixtures thereof,
[0249] LUBRICANTS: calcium stearate, magnesium stearate, mineral
oil, light mineral oil, glycerin, sorbitol, mannitol, polyethylene
glycol, other glycols, stearic acid, sodium lauryl sulfate, talc,
hydrogenated vegetable oil (e.g., peanut oil, cottonseed oil,
sunflower oil, sesame oil, olive oil, corn oil and soybean oil),
zinc stearate, ethyl oleate, ethyl laurate, agar, syloid silica gel
(AEROSIL 200, W.R. Grace Co., Baltimore, Md. USA), a coagulated
aerosol of synthetic silica (Deaussa Co., Plano, Tex. USA), a
pyrogenic silicon dioxide (CAB-O-SIL, Cabot Co., Boston, Mass.
USA), or mixtures thereof,
[0250] ANTI-CAKING AGENTS: calcium silicate, magnesium silicate,
silicon dioxide, colloidal silicon dioxide, talc, or mixtures
thereof,
[0251] ANTIMICROBIAL AGENTS: benzalkonium chloride, benzethonium
chloride, benzoic acid, benzyl alcohol, butyl paraben,
cetylpyridinium chloride, cresol, chlorobutanol, dehydroacetic
acid, ethylparaben, methylparaben, phenol, phenylethyl alcohol,
phenoxyethanol, phenylmercuric acetate, phenylmercuric nitrate,
potassium sorbate, propylparaben, sodium benzoate, sodium
dehydroacetate, sodium propionate, sorbic acid, thimersol, thymo,
or mixtures thereof, and
[0252] COATING AGENTS: sodium carboxymethyl cellulose, cellulose
acetate phthalate, ethylcellulose, gelatin, pharmaceutical glaze,
hydroxypropyl cellulose, hydroxypropyl methylcellulose,
hydroxypropyl methyl cellulose phthalate, methylcellulose,
polyethylene glycol, polyvinyl acetate phthalate, shellac, sucrose,
titanium dioxide, carnauba wax, microcrystalline wax, or mixtures
thereof.
[0253] The agents either in their free form or as a salt can be
combined with a polymer such as polylactic-glycoloic acid (PLGA),
poly-(I)-lactic-glycolic-tartaric acid (P(I)LGT) (WO 01/12233),
polyglycolic acid (U.S. Pat. No. 3,773,919), polylactic acid (U.S.
Pat. No. 4,767,628), poly(M-caprolactone) and poly(alkylene oxide)
(U.S. 20030068384) to create a sustained release formulation. Such
formulations can be used to implants that release a peptide or
another agent over a period of a few days, a few weeks or several
months depending on the polymer, the particle size of the polymer,
and the size of the implant (see, e.g., U.S. Pat. No. 6,620,422).
Other sustained release formulations and polymers for use in such
formulations are described in EP 0 467 389 A2, WO 93/24150, U.S.
Pat. No. 5,612,052, WO 97/40085, WO 03/075887, WO 01/01964A2, U.S.
Pat. No. 5,922,356, WO 94/155587, WO 02/074247A2, WO 98/25642, U.S.
5,968,895, U.S. Pat. No. 6,180,608, U.S. 20030171296, U.S.
20020176841, U.S. Pat. No. 5,672,659, U.S. Pat. No. 5,893,985, U.S.
Pat. No. 5,134,122, U.S. Pat. No. 5,192,741, U.S. Pat. No.
5,192,741, U.S. Pat. No. 4,668,506, U.S. Pat. No. 4,713,244, U.S.
Pat. No. 5,445,832 U.S. Pat. No. 4,931,279, U.S. Pat. No.
5,980,945, WO 02/058672, WO 9726015, WO 97/04744, and.
US20020019446. In such sustained release formulations
microparticles of peptide are combined with microparticles of
polymer. One or more sustained release implants can be placed in
the large intestine, the small intestine or both. U.S. Pat. No.
6,011,011 and WO 94/06452 describe a sustained release formulation
providing either polyethylene glycols (i.e. PEG 300 and PEG 400) or
triacetin. WO 03/053401 describes a formulation which may both
enhance bioavailability and provide controlled release of the agent
within the GI tract. Additional controlled release formulations are
described in WO 02/38129, EP 326 151, U.S. Pat. No. 5,236,704, WO
02/30398, WO 98/13029; U.S. 20030064105, U.S. 20030138488A1, U.S.
20030216307A1,U.S. Pat. No. 6,667,060, WO 01/49249, WO 01/49311, WO
01/49249, WO 01/49311, and U.S. Pat. No. 5,877,224.
[0254] The agents can be administered, e.g., by intravenous
injection, intramuscular injection, subcutaneous injection,
intraperitoneal injection, topical, sublingual, intraarticular (in
the joints), intradermal, buccal, ophthalmic (including
intraocular), intranasaly (including using a cannula), or by other
routes. The agents can be administered orally, e.g., as a tablet or
cachet containing a predetermined amount of the active ingredient,
gel, pellet, paste, syrup, bolus, electuary, slurry, capsule,
powder, granules, as a solution or a suspension in an aqueous
liquid or a non-aqueous liquid, as an oil-in-water liquid emulsion
or a water-in-oil liquid emulsion, via a micellar formulation (see,
e.g. WO 97/11682) via a liposomal formulation (see, e.g., EP
736299, WO 99/59550 and WO 97/13500), via formulations described in
WO 03/094886 or in some other form. Orally administered
compositions can include binders, lubricants, inert diluents,
lubricating, surface active or dispersing agents, flavoring agents,
and humectants. Orally administered formulations such as tablets
may optionally be coated or scored and may be formulated so as to
provide sustained, delayed or controlled release of the active
ingredient therein. The agents can also be administered
transdermally (i.e. via reservoir-type or matrix-type patches,
microneedles, thermal poration, hypodermic needles, iontophoresis,
electroporation, ultrasound or other forms of sonophoresis, jet
injection, or a combination of any of the preceding methods
(Prausnitz et al. 2004, Nature Reviews Drug Discovery 3:115-124)).
The agents can be administered using high-velocity transdermal
particle injection techniques using the hydrogel particle
formulation described in U.S. 20020061336. Additional particle
formulations are described in WO 00/45792, WO 00/53160, and WO
02/19989. An example of a transdermal formulation containing
plaster and the absorption promoter dimethylisosorbide can be found
in WO 89/04179. WO 96/11705 provides formulations suitable for
transdermal administration. The agents can be administered in the
form a suppository or by other vaginal or rectal means. The agents
can be administered in a transmembrane formulation as described in
WO 90/07923. The agents can be administered non-invasively via the
dehydrated particles described in U.S. Pat. No. 6,485,706. The
agent can be administered in an enteric-coated drug formulation as
described in WO 02/49621. The agents can be administered
intranassaly using the formulation described in U.S. Pat. No.
5,179,079. Formulations suitable for parenteral injection are
described in WO 00/62759. The agents can be administered using the
casein formulation described in U.S. 20030206939 and WO 00/06108.
The agents can be administered using the particulate formulations
described in U.S. 20020034536.
[0255] The agents, alone or in combination with other suitable
components, can be administered by pulmonary route utilizing
several techniques including but not limited to intratracheal
instillation (delivery of solution into the lungs by syringe),
intratracheal delivery of liposomes, insufflation (administration
of powder formulation by syringe or any other similar device into
the lungs) and aerosol inhalation. Aerosols (e.g., jet or
ultrasonic nebulizers, metered-dose inhalers (MDIs), and dry-powder
inhalers (DPIs)) can also be used in intranasal applications.
Aerosol formulations are stable dispersions or suspensions of solid
material and liquid droplets in a gaseous medium and can be placed
into pressurized acceptable propellants, such as hydrofluroalkanes
(HFAs, i.e. HFA-134a and HFA-227, or a mixture thereof),
dichlorodifluoromethane (or other chlorofluocarbon propellants such
as a mixture of Propellants 11, 12, and/or 114), propane, nitrogen,
and the like. Pulmonary formulations may include permeation
enhancers such as fatty acids, and saccharides, chelating agents,
enzyme inhibitors (e.g., protease inhibitors), adjuvants (e.g.,
glycocholate, surfactin, span 85, and nafamostat), preservatives
(e.g., benzalkonium chloride or chlorobutanol), and ethanol
(normally up to 5% but possibly up to 20%, by weight). Ethanol is
commonly included in aerosol compositions as it can improve the
function of the metering valve and in some cases also improve the
stability of the dispersion. Pulmonary formulations may also
include surfactants which include but are not limited to bile salts
and those described in U.S. Pat. No. 6,524,557 and references
therein. The surfactants described in U.S. Pat. No. 6,524,557,
e.g., a C8-C16 fatty acid salt, a bile salt, a phospholipid, or
alkyl saccaride are advantageous in that some of them also
reportedly enhance absorption of the peptide in the formulation.
Also suitable in the invention are dry powder formulations
comprising a therapeutically effective amount of active compound
blended with an appropriate carrier and adapted for use in
connection with a dry-powder inhaler. Absorption enhancers which
can be added to dry powder formulations of the present invention
include those described in U.S. Pat. No. 6,632,456. WO 02/080884
describes new methods for the surface modification of powders.
Aerosol formulations may include U.S. Pat. No. 5,230,884, U.S. Pat.
No. 5,292,499, WO 017/8694, WO 01/78696, U.S. 2003019437, U.S.
20030165436, and WO 96/40089 (which includes vegetable oil).
Sustained release formulations suitable for inhalation are
described in U.S. 20010036481A1, 20030232019A1, and U.S.
20040018243A1 as well as in WO 01/13891, WO 02/067902, WO
03/072080, and WO 03/079885. Pulmonary formulations containing
microparticles are described in WO 03/015750, U.S. 20030008013, and
WO 00/00176. Pulmonary formulations containing stable glassy state
powder are described in U.S. 20020141945 and U.S. Pat. No.
6,309,671. Other aerosol formulations are described in EP 1338272A1
WO 90/09781, U.S. Pat. No. 5,348,730, U.S. Pat. No. 6,436,367, WO
91/04011, and U.S. Pat. No. 6,294,153 and U.S. Pat. No. 6,290,987
describes a liposomal based formulation that can be administered
via aerosol or other means. Powder formulations for inhalation are
described in U.S. 20030053960 and WO 01/60341. The agents can be
administered intranasally as described in U.S. 20010038824.
[0256] Solutions of medicament in buffered saline and similar
vehicles are commonly employed to generate an aerosol in a
nebulizer. Simple nebulizers operate on Bernoulli's principle and
employ a stream of air or oxygen to generate the spray particles.
More complex nebulizers employ ultrasound to create the spray
particles. Both types are well known in the art and are described
in standard textbooks of pharmacy such as Sprowls' American
Pharmacy and Remington's The Science and Practice of Pharmacy.
Other devices for generating aerosols employ compressed gases,
usually hydrofluorocarbons and chlorofluorocarbons, which are mixed
with the medicament and any necessary excipients in a pressurized
container, these devices are likewise described in standard
textbooks such as Sprowls and Remington.
[0257] The agents can be a free acid or base, or a
pharmacologically acceptable salt thereof. Solids can be dissolved
or dispersed immediately prior to administration or earlier. In
some circumstances the preparations include a preservative to
prevent the growth of microorganisms. The pharmaceutical forms
suitable for injection can include sterile aqueous or organic
solutions or dispersions which include, e.g., water, an alcohol, an
organic solvent, an oil or other solvent or dispersant (e.g.,
glycerol, propylene glycol, polyethylene glycol, and vegetable
oils). The formulations may contain antioxidants, buffers,
bacteriostats, and solutes that render the formulation isotonic
with the blood of the intended recipient, and aqueous and
non-aqueous sterile suspensions that can include suspending agents,
solubilizers, thickening agents, stabilizers, and preservatives.
Pharmaceutical agents can be sterilized by filter sterilization or
by other suitable means.
[0258] The agent can be fused to immunoglobulins or albumin, or
incorporated into a lipsome to improve half-life. The agent can
also be conjugated to polyethylene glycol (PEG) chains. Methods for
pegylation and additional formulations containing PEG-conjugates
(i.e. PEG-based hydrogels, PEG modified liposomes) can be found in
Harris and Chess, Nature Reviews Drug Discovery 2: 214-221 and the
references therein. The peptides of the invention may also be
conjugated to, for example, alkyl groups (e.g., C1-C20 straight or
branched alkyl groups); fatty acid radicals; and combinations of
PEG, alkyl groups and fatty acid radicals (see U.S. Pat. No.
6,309,633; Soltero et al., 2001 Innovations in Pharmaceutical
Technology 106-110). The agent can be administered via a
nanocochleate or cochleate delivery vehicle (BioDelivery Sciences
International). The agents can be delivered transmucosally (i.e.
across a mucosal surface such as the vagina, eye or nose) using
formulations such as that described in U.S. Pat. No. 5,204,108. The
agents can be formulated in microcapsules as described in WO
88/01165. The agent can be administered intra-orally using the
formulations described in U.S. 20020055496, WO 00/47203, and U.S.
Pat. No. 6,495,120. The agent can be delivered using nanoemulsion
formulations described in WO 01/91728A2.
[0259] Suitable pharmaceutical compositions in accordance with the
invention will generally include an amount of the active
compound(s) with an acceptable pharmaceutical diluent or excipient,
such as a sterile aqueous solution, to give a range of final
concentrations, depending on the intended use. The techniques of
preparation are generally well known in the art, as exemplified by
Remington's Pharmaceutical Sciences (18th Edition, Mack Publishing
Company, 1995).
[0260] The agents described herein and combination therapy agents
can be packaged as a kit that includes single or multiple doses of
two or more agents, each packaged or formulated individually, or
single or multiple doses of two or more agents packaged or
formulated in combination. Thus, one or more agents can be present
in first container, and the kit can optionally include one or more
agents in a second container. The container or containers are
placed within a package, and the package can optionally include
administration or dosage instructions. A kit can include additional
components such as syringes or other means for administering the
agents as well as diluents or other means for formulation.
[0261] Methods to increase chemical and/or physical stability of
the agents the described herein are found in U.S. Pat. No.
6,541,606, U.S. Pat. No. 6,068,850, U.S. Pat. No. 6,124,261, U.S.
Pat. No. 5,904,935, and WO 00/15224, U.S. 20030069182 (via the
addition of nicotinamide), U.S. 20030175230A1, U.S. 20030175230A1,
U.S. 20030175239A1, U.S. 20020045582, U.S. 20010031726, WO
02/26248, WO 03/014304, WO 98/00152A1, WO 98/00157A1, WO 90/12029,
WO 00/04880, and WO 91/04743, WO 97/04796 and the references cited
therein.
[0262] Methods to increase bioavailability of the agents described
herein are found in U.S. Pat. No. 6,008,187, U.S. Pat. No.
5,424,289, U.S. 20030198619, WO 90/01329, WO 01/49268, WO 00/32172,
and WO 02/064166. Glycyrrhizinate can also be used as an absorption
enhancer (see, e.g., EP397447). WO 03/004062 discusses Ulex
europaeus I (UEAI) and UEAI mimetics which may be used to target
the agents of the invention to the GI tract.
Analgesic Agents
[0263] The peptides described herein can be used in combination
therapy with an analgesic agent, e.g., an analgesic compound or an
analgesic peptide. The analgesic agent can optionally be covalently
attached to a peptide described herein. Among the useful analgesic
agents are: Ca channel blockers, 5HT receptor antagonists (for
example 5HT3, 5HT4 and 5HT1 receptor antagonists), opioid receptor
agonists (loperamide, fedotozine, and fentanyl), NK1 receptor
antagonists, CCK receptor agonists (e.g., loxiglumide), NK1
receptor antagonists, NK3 receptor antagonists,
norepinephrine-serotonin reuptake inhibitors (NSRI), vanilloid and
cannabanoid receptor agonists, and sialorphin. Analgesics agents in
the various classes are described in the literature.
[0264] Among the useful analgesic peptides are sialorphin-related
peptides, including those comprising the amino acid sequence QHNPR
(SEQ ID NO:85), including: VQHNPR (SEQ ID NO:86); VRQHNPR (SEQ ID
NO:87); VRGQHNPR (SEQ ID NO:88); VRGPQHNPR (SEQ ID NO:89);
VRGPRQHNPR (SEQ ID NO:90); VRGPRRQHNPR (SEQ ID NO:91); and RQHNPR
(SEQ ID NO:92). Sialorphin-related peptides bind to neprilysin and
inhibit neprilysin-mediated breakdown of substance P and
Met-enkephalin. Thus, compounds or peptides that are inhibitors of
neprilysin are useful analgesic agents which can be administered
with the peptides of the invention in a co-therapy or linked to the
peptides of the invention, e.g., by a covalent bond. Sialophin and
related peptides are described in U.S. Pat. No. 6,589,750; U.S.
20030078200 A1; and WO 02/051435 A2.
[0265] Opioid receptor antagonists and agonists can be administered
with the peptides of the invention in co-therapy or linked to the
peptide of the invention, e.g., by a covalent bond. For example,
opioid receptor antagonists such as naloxone, naltrexone, methyl
nalozone, nalmefene, cypridime, beta funaltrexamine, naloxonazine,
naltrindole, and nor-binaltorphimine are thought to be useful in
the treatment of IBS. It can be useful to formulate opioid
antagonists of this type is a delayed and sustained release
formulation such that initial release of the antagonist is in the
mid to distal small intestine and/or ascending colon. Such
antagonists are described in WO 01/32180 A2. Enkephalin
pentapeptide (HOE825; Tyr-D-Lys-Gly-Phe-L-homoserine) is an agonist
of the mu and delta opioid receptors and is thought to be useful
for increasing intestinal motility (Eur. J. Pharm. 219:445, 1992),
and this peptide can be used in conjunction with the peptides of
the invention. Also useful is trimebutine which is thought to bind
to mu/delta/kappa opioid receptors and activate release of motilin
and modulate the release of gastrin, vasoactive intestinal peptide,
gastrin and glucagons. Kappa opioid receptor agonists such as
fedotozine, ketocyclazocine, and compounds described in WO
03/097051 A2 can be used with or linked to the peptides of the
invention. In addition, mu opioid receptor agonists such as
morphine, diphenyloxylate, frakefamide
(H-Tyr-D-Ala-Phe(F)-Phe-NH.sub.2; WO 01/019849 A1) and loperamide
can be used.
[0266] Tyr-Arg (kyotorphin) is a dipeptide that acts by stimulating
the release of met-enkephalins to elicit an analgesic effect (J.
Biol. Chem. 262:8165, 1987). Kyotorphin can be used with or linked
to the peptides of the invention.
[0267] CCK receptor agonists such as caerulein from amphibians and
other species are useful analgesic agents that can be used with or
linked to the peptides of the invention.
[0268] Conotoxin peptides represent a large class of analgesic
peptides that act at voltage gated Ca channels, NMDA receptors or
nicotinic receptors. These peptides can be used with or linked to
the peptides of the invention.
[0269] Peptide analogs of thymulin (FR 2830451) can have analgesic
activity and can be used with or linked to the peptides of the
invention.
[0270] CCK (CCKa or CCKb) receptor antagonists, including
loxiglumide and dexloxiglumide (the R-isomer of loxiglumide) (WO
88/05774) can have analgesic activity and can be used with or
linked to the peptides of the invention.
[0271] Other useful analgesic agents include 5-HT4 agonists such as
tegaserod/zelnorm and lirexapride. Such agonists are described in:
EP1321142 A1, WO 03/053432A1, EP 505322 A1, EP 505322 B1, U.S. Pat.
No. 5,510,353, EP 507672 A1, EP 507672 B1, and U.S. Pat. No.
5,273,983.
[0272] Calcium channel blockers such as ziconotide and related
compounds described in, for example, EP 625162B1, U.S. Pat. No.
5,364,842, U.S. Pat. No. 5,587,454, U.S. Pat. No. 5,824,645, U.S.
Pat. No. 5,859,186, U.S. Pat. No. 5,994,305, U.S. Pat. No.
6,087,091, U.S. Pat. No. 6,136,786, WO 93/13128 A1, EP 1336409 A1,
EP 835126 A1, EP 835126 B1, U.S. Pat. No. 5,795,864, U.S. Pat. No.
5,891,849, U.S. Pat. No. 6,054,429, WO 97/01351 A1, can be used
with or linked to the peptides of the invention.
[0273] Various antagonists of the NK-1, NK-2, and NK-3 receptors
(for a review see Giardina et al. 2003 Drugs 6:758) can be can be
used with or linked to the peptides of the invention.
[0274] NK1 receptor antagonists such as: aprepitant (Merck & Co
Inc), vofopitant, ezlopitant (Pfizer, Inc.), R-673 (Hoffmann-La
Roche Ltd), SR-14033 and related compounds described in, for
example, EP 873753 A1, U.S. 20010006972 A1, U.S. 20030109417 A1, WO
01/52844 A1, can be used with or linked to the peptides of the
invention.
[0275] NK-2 receptor antagonists such as nepadutant (Menarini
Ricerche SpA), saredutant (Sanofi-Synthelabo), SR-144190
(Sanofi-Synthelabo) and UK-290795 (Pfizer Inc) can be used with or
linked to the peptides of the invention.
[0276] NK3 receptor antagonists such as osanetant
(Sanofi-Synthelabo), talnetant and related compounds described in,
for example, WO 02/094187 A2, EP 876347 A1, WO 97/21680 A1, U.S.
Pat. No. 6,277,862, WO 98/11090, WO 95/28418, WO 97/19927, and
Boden et al. (J Med Chem. 39:1664-75, 1996) can be used with or
linked to the peptides of the invention.
[0277] Norepinephrine-serotonin reuptake inhibitors such as
milnacipran and related compounds described in WO 03/077897 A1 can
be used with or linked to the peptides of the invention.
[0278] Vanilloid receptor antagonists such as arvanil and related
compounds described in WO 01/64212 A1 can be used with or linked to
the peptides of the invention.
[0279] Where the analgesic is a peptide and is covalently linked to
a peptide described herein the resulting peptide may also include
at least one trypsin or chymotrypsin cleavage site. When present
within the peptide, the analgesic peptide may be preceded by (if it
is at the carboxy terminus) or followed by (if it is at the amino
terminus) a chymotrypsin or trypsin cleavage site that allows
release of the analgesic peptide.
[0280] In addition to sialorphin-related peptides, analgesic
peptides include: AspPhe, endomorphin-1, endomorphin-2, nocistatin,
dalargin, lupron, zicnotide, and substance P.
Methods of Treatment
[0281] The peptides of the invention can be used alone or in
combination therapy for the treatment or prevention of cancer,
pre-cancerous growths, or metastatic growths. For example, they can
be used for the prevention or treatment of: colorectal/local
metastasized colorectal cancer, gastrointestinal tract cancer, lung
cancer, cancer or pre-cancerous growths or metastatic growths of
epithelial cells, polyps, breast, colorectal, lung, ovarian,
pancreatic, prostatic, renal, stomach, bladder, liver, esophageal
and testicular carcinoma, carcinoma (e.g., basal cell,
basosquamous, Brown-Pearce, ductal carcinoma, Ehrlich tumor, Krebs,
Merkel cell, small or non-small cell lung, oat cell, papillary,
bronchiolar, squamous cell, transitional cell, Walker), leukemia
(e.g., B-cell, T-cell, HTLV, acute or chronic lymphocytic, mast
cell, myeloid), histiocytonia, histiocytosis, Hodgkin's disease,
non-Hodgkin's lymphoma, plasmacytoma, reticuloendotheliosis,
adenoma, adeno-carcinoma, adenofibroma, adenolymphoma,
ameloblastoma, angiokeratoma, angiolymphoid hyperplasia with
eosinophilia, sclerosing angioma, angiomatosis, apudoma,
branchionia, malignant carcinoid syndrome, carcinoid heart disease,
carcinosarcoma, cementoma, cholangioma, cholesteatoma,
chondrosarcoma, chondroblastoma, chondrosarcoma, chordoma,
choristoma, craniopharyngioma, chrondrorna, cylindroma,
cystadenocarcinoma, cystadenoma, cystosarconia phyllodes,
dysgenninoma, ependymoma, Ewing sarcoma, fibroma, fibrosarcoma,
giant cell tumor, ganglioneuroma, glioblastoma, glomangioma,
granulosa cell tumor, gynandroblastoma, hamartoma,
hemangioendothelioma, hemangioma, hemangio-pericytoma,
hemangiosarcoma, hepatoma, islet cell tumor, Kaposi sarcoma,
leiomyoma, leiomyosarcoma, leukosarcoma, Leydig cell tumor, lipoma,
liposarcoma, lymphaugioma, lymphangiomyoma, lymphangiosarcoma,
medulloblastoma, meningioma, mesenchymoma, mesonephroma,
mesothelioma, myoblastoma, myoma, myosarcoma, myxoma, myxosarcoma,
neurilemmoma, neuroma, neuroblastoma, neuroepithelioma,
neurofibroma, neurofibromatosis, odontoma, osteoma, osteosarcoma,
papilloma, paraganglioma, paraganglionia. nonchroinaffin,
pinealoma, rhabdomyoma, rhabdomyosarcoma, Sertoli cell tumor,
teratoma, theca cell tumor, and other diseases in which cells have
become dysplastic, immortalized, or transformed.
[0282] The peptides of the invention can be used alone or in
combination therapy for the treatment or prevention of: Familial
Adenomatous Polyposis (FAP) (autosomal dominant syndrome) that
precedes colon cancer, hereditary nonpolyposis colorectal cancer
(HNPCC), and inherited autosomal dominant syndrome.
[0283] For treatment or prevention of cancer, pre-cancerous growths
and metastatic growths, the peptides can be used alone or in
combination therapy with radiation or chemotherapeutic agents, an
inhibitor of a cGMP-dependent phosphodiesterase or a selective
cyclooxygenase-2 inhibitor (a number of selective cyclooxygenase-2
inhibitors are described in WO02062369, hereby incorporated by
reference).
[0284] The peptides can be for treatment or prevention of
inflammation. Thus, they can be used alone or in combination with
inhibitors of cGMP-dependent phosphodiesterase or a selective
cyclooxygenase-2 inhibitor for treatment of: organ inflammation,
IBD (e.g, Crohn's disease, ulcerative colitis), asthma, nephritis,
hepatitis, pancreatitis, bronchitis, cystic fibrosis, ischemic
bowel diseases, intestinal inflammations/allergies, coeliac
disease, proctitis, eosnophilic gastroenteritis, mastocytosis, and
other inflammatory disorders.
[0285] The peptides can also be used alone or in combination
therapy to treat or prevent insulin-related disorders, for example:
II diabetes mellitus, hyperglycemia, obesity, disorders associated
with disturbances in glucose or electrolyte transport and insulin
secretion in cells, or endocrine disorders. They can be also used
in insulin resistance treatment and post-surgical and non-post
surgery decrease in insulin responsiveness.
[0286] The peptides can be used alone or in combination therapy to
prevent or treat respiratory disorders, including, inhalation,
ventilation and mucus secretion disorders, pulmonary hypertension,
chronic obstruction of vessels and airways, and irreversible
obstructions of vessels and bronchi.
[0287] The peptides can be used in combination therapy with a
phosphodiesterase inhibitor (examples of such inhibitors can be
found in U.S. Pat. No. 6,333,354, hereby incorporated by
reference).
[0288] The peptides can also be used alone or in combination
therapy to prevent or treat: retinopathy, nephropathy, diabetic
angiopathy, and edema formation
[0289] The peptides can also be used alone or in combination
therapy to prevent or treat neurological disorders, for example,
headache, anxiety, movement disorders, aggression, psychosis,
seizures, panic attacks, hysteria, sleep disorders, depression,
schizoaffective disorders, sleep apnea, attention deficit
syndromes, memory loss, and narcolepsy. They may also be used as a
sedative.
[0290] The peptides and detectabley labeled peptides can be used as
markers to identify, detect, stage, or diagnosis diseases and
conditions of the small intestine, including: Crohn's disease,
colitis, inflammatory bowel disease, tumors, benign tumors, such as
benign stromal tumors, adenoma, angioma, adenomatous (pedunculated
and sessile) polyps, malignant, carcinoid tumors, endocrine cell
tumors, lymphoma, adenocarcinoma, foregut, midgut, and hindgut
carcinoma, gastroinstestinal stromal tumor (GIST), such as
leiomyoma, cellular leiomyoma, leiomyoblastoma, and leiomyo
sarcoma, gastrointestinal autonomic nerve tumor, malabsorption
syndromes, celiac diseases, diverticulosis, Meckel's diverticulurn,
colonic diverticula, megacolon, Hirschsprung's disease, irritable
bowel syndrome, mesenteric ischemia, ischemic colitis, colorectal
cancer, colonic polyposis, polyp syndrome, intestinal
adenocarcinoma, Liddle syndrome, Brody myopathy, infantile
convulsions, and choreoathetosis
[0291] The peptides can be conjugated to another molecule (e.g, a
diagnostic or therapeutic molecule) to target cells bearing the GCC
receptor, e.g., cystic fibrosis lesions and specific cells lining
the intestinal tract. Thus, they can be used to target radioactive
moieties or therapeutic moieties to the intestine to aid in imaging
and diagnosing or treating colorectal/metastasized or local
colorectal cancer and to deliver normal copies of the p53 tumor
suppressor gene to the intestinal tract.
[0292] The peptides can be used alone or in combination therapy to
treat erectile dysfunction.
[0293] The peptides can be used alone or in combination therapy to
treat inner ear disorders, e.g., to treat Meniere's disease,
including symptoms of the disease such as vertigo, hearing loss,
tinnitus, sensation of fullness in the ear, and to maintain fluid
homeostasis in the inner ear.
[0294] The peptides can be used alone or in combination therapy to
treat disorders associated with fluid and sodium retention, e.g.,
diseases of the electrolyte-water/electrolyte transport system
within the kidney, gut and urogenital system, congestive heart
failure, hypertension, hypotension, liver cirrhosis, and nephrotic
syndrome. In addition they can be used to facilitate diuresis or
control intestinal fluid.
[0295] The peptides can be used alone or in combination therapy to
treat disorders associated with chloride or bicarbonate secretion,
e.g., Cystic Fibrosis.
[0296] The peptides can be used alone or in combination therapy to
treat disorders associated with bile secretion. In addition, they
can be used to facilitate or control chloride and bile fluid
secretion in the gall bladder.
[0297] The peptides can be used alone or in combination therapy to
treat disorders associated with liver cell regeneration.
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140296163A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140296163A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References