U.S. patent application number 14/159724 was filed with the patent office on 2014-08-21 for rapidly maturing fluroscent proteins and methods for using the same.
The applicant listed for this patent is THE UNIVERSITY OF CHICAGO. Invention is credited to BROOKE BEVIS, BENJAMIN GLICK.
Application Number | 20140237632 14/159724 |
Document ID | / |
Family ID | 23338744 |
Filed Date | 2014-08-21 |
United States Patent
Application |
20140237632 |
Kind Code |
A1 |
BEVIS; BROOKE ; et
al. |
August 21, 2014 |
RAPIDLY MATURING FLUROSCENT PROTEINS AND METHODS FOR USING THE
SAME
Abstract
Nucleic acid compositions encoding rapidly maturing fluorescent
proteins, as well as non-aggregating versions thereof (and mutants
thereof) as well as the proteins encoding the same, are provided.
The proteins of interest are proteins that are fluorescent, where
this feature arises from the interaction of two or more residues of
the protein. The subject proteins are further characterized in
that, in certain embodiments, they are mutants of wild type
proteins that are obtained either from non-bioluminescent
Cnidarian, e.g., Anthozoan, species or are obtained from Anthozoan
non-Pennatulacean (sea pen) species. In certain embodiments, the
subject proteins are mutants of wild type Discosoma sp. "red"
fluorescent protein. Also of interest are proteins that are
substantially similar to, or mutants of, the above specific
proteins. Also provided are fragments of the nucleic acids and the
peptides encoded thereby, as well as antibodies to the subject
proteins and transgenic cells and organisms. The subject protein
and nucleic acid compositions find use in a variety of different
applications. Finally, kits for use in such applications, e.g.,
that include the subject nucleic acid compositions, are
provided.
Inventors: |
BEVIS; BROOKE; (SOMERVILLE,
MA) ; GLICK; BENJAMIN; (CHICAGO, IL) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
THE UNIVERSITY OF CHICAGO |
CHICAGO |
IL |
US |
|
|
Family ID: |
23338744 |
Appl. No.: |
14/159724 |
Filed: |
January 21, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
10844064 |
May 11, 2004 |
8664471 |
|
|
14159724 |
|
|
|
|
Current U.S.
Class: |
800/13 ;
435/252.31; 435/252.33; 435/254.21; 435/320.1; 435/325; 435/348;
435/358; 435/365; 435/369; 435/69.1; 530/350; 530/387.9; 536/23.5;
800/298 |
Current CPC
Class: |
A61K 38/00 20130101;
C07K 14/43595 20130101; C12N 15/8257 20130101; G01N 33/582
20130101; A01K 67/0275 20130101 |
Class at
Publication: |
800/13 ;
536/23.5; 435/320.1; 435/252.33; 435/252.31; 435/254.21; 435/348;
435/365; 435/369; 435/358; 435/325; 435/69.1; 530/350; 530/387.9;
800/298 |
International
Class: |
C07K 14/435 20060101
C07K014/435; C12N 15/82 20060101 C12N015/82; A01K 67/027 20060101
A01K067/027; G01N 33/58 20060101 G01N033/58 |
Goverment Interests
ACKNOWLEDGEMENT OF GOVERNMENT SUPPORT
[0002] The Government may own rights in the present invention
pursuant to Grant Number 9875939 from the National Science
Foundation.
Claims
1. A nucleic acid that encodes a rapidly maturing chromo- or
fluorescent mutant of a Cnidarian chromo- or fluorescent protein or
mutant thereof.
2. The nucleic acid according to claim 1, wherein said Cnidarian
chromo- or fluorescent protein is from a non-bioluminescent
Cnidarian species.
3. The nucleic acid according to claim 2, wherein said
non-bioluminescent Cnidarian species is an Anthozoan species.
4. The nucleic acid according to claim 3, wherein said nucleic acid
Anthozoan species is Discosoma.
5. The nucleic acid according to claim 4, wherein said nucleic acid
encodes a mutant of DsRed.
6. The nucleic acid according to claim 5, wherein said nucleic acid
encodes a product having a point mutation at at least one of
position 2, position 5, position 6, position 21, position 41,
position 42, position 44, and position 117 relative to wild type
DsRed.
7. The nucleic acid according to claim 6, wherein said product is a
product having a point mutation at at least one of position 145 and
217.
8. A nucleic acid according to claim 7, wherein said nucleic acid
has a sequence of residues that is substantially the same as or
identical to a nucleotide sequence of at least 10 residues in
length of SEQ ID NOS: 01 or 02.
9. A fragment of the nucleic acid selected according to claim
1.
10. A construct comprising a vector and a nucleic acid according to
claim 1.
11. An expression cassette comprising: (a) a transcriptional
initiation region functional in an expression host; (b) a nucleic
acid according to claim 1; and (c) and a transcriptional
termination region functional in said expression host.
12. A cell, or the progeny thereof, comprising an expression
cassette according to claim 11 as part of an extrachromosomal
element or integrated into the genome of a host cell as a result of
introduction of said expression cassette into said host cell.
13. A method of producing a chromo and/or fluorescent protein, said
method comprising: growing a cell according to claim 12, whereby
said protein is expressed; and isolating said protein substantially
free of other proteins.
14. A protein or fragment thereof encoded by a nucleic acid
according to claim 1.
15. An antibody binding specifically to a protein according to
claim 14.
16. A transgenic cell or the progeny thereof comprising a transgene
that is a nucleic acid according to claim 1.
17. A transgenic organism comprising a transgene that is a nucleic
acid according to claim 1.
18. In an application that employs a chromo- or fluorescent
protein, the improvement comprising: employing a protein according
to claim 14.
19. In an application that employs a nucleic acid encoding a
chromo- or fluorescent protein, the improvement comprising:
employing a nucleic acid according to claim 1.
20. A kit comprising a nucleic acid according to claim 1.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation-in-part of application
serial no. PCT/US02/40539 filed on Dec. 18, 2002; which
application, pursuant to 35 U.S.C. .sctn.119 (e), claims priority
to the filing date of U.S. Provisional Patent Application Ser. No.
60/341,723 filed Dec. 19, 2001; the disclosures of which are herein
incorporated by reference.
INTRODUCTION
[0003] 1. Field of the Invention
[0004] The field of this invention is fluorescent proteins.
[0005] 2. Background of the Invention
[0006] Labeling is a tool for marking a protein, cell, or organism
of interest and plays a prominent role in many biochemistry,
molecular biology and medical diagnostic applications. A variety of
different labels have been developed, including radiolabels,
chromolabels, fluorescent labels, chemiluminescent labels, etc.
However, there is continued interest in the development of new
labels. Of particular interest is the development of new protein
labels, including chromo- and/or fluorescent protein labels.
[0007] An important new class of fluorescent proteins that have
recently been developed are the Reef Coral Fluorescent Proteins, as
described in Matz, M. V., et al., (1999) Nature Biotechnol.,
17:969-973. While these fluorescent proteins exhibit many positive
attributes, there is intense interest in the development of
versions of this important new class of fluorescent proteins that
exhibit additional desirable features, e.g., fast maturation. The
present invention satisfies this need.
RELEVANT LITERATURE
[0008] U.S. patents of interest include: U.S. Pat. Nos. 6,066,476;
6,020,192; 5,985,577; 5,976,796; 5,968,750; 5,968,738; 5,958,713;
5,919,445; 5,874,304; and 5,491,084. International Patent
Publications of interest include: WO 00/46233; WO 99/49019; and DE
197 18 640 A. Also of interest are: Anderluh et al., Biochemical
and Biophysical Research Communications (1996) 220:437-442; Dove et
al., Biological Bulletin (1995) 189:288-297; Fradkov et al., FEBS
Lett. (2000) 479(3):127-30; Gurskaya et al., FEBS Lett., (2001)
507(1):16-20; Gurskaya et al., BMC Biochem. (2001) 2:6; Lukyanov,
K., et al (2000) J Biol Chemistry 275(34):25879-25882; Macek et
al., Eur. J. Biochem. (1995) 234:329-335; Martynov et al., J Biol.
Chem. (2001) 276:21012-6; Matz, M. V., et al. (1999) Nature
Biotechnol., 17:969-973; Terskikh et al., Science (2000)
290:1585-8; Tsien, Annual Rev. of Biochemistry (1998) 67:509-544;
Tsien, Nat. Biotech. (1999) 17:956-957; Ward et al., J. Biol. Chem.
(1979) 254:781-788; Wiedermann et al., Jarhrestagung der Deutschen
Gesellschact fur Tropenokologie-gto. Ulm. 17-19.02.1999. Poster
P-4.20; Yarbrough et al., Proc Natl Acad Sci USA (2001)
98:462-7.
SUMMARY OF THE INVENTION
[0009] Nucleic acid compositions encoding rapidly maturing
fluorescent proteins, as well as non-aggregating versions thereof
(and mutants thereof) and the proteins encoded by the same, are
provided. The proteins of interest are proteins that are
fluorescent, where this feature arises from the interaction of two
or more residues of the protein. The subject proteins are further
characterized in that, in certain embodiments, they are found in or
are mutants of wild-type proteins that are obtained from either
non-bioluminescent Cnidarian, e.g., Anthozoan, species or are
obtained from Anthozoan non-Pennatulacean (sea pen) species. In
certain embodiments, the subject proteins are mutants of the wild
type Discosoma sp. "red" fluorescent protein sold commercially as
"DsRed". Also of interest are proteins that are substantially
similar to, or mutants of, the above specific proteins. Also
provided are fragments of the nucleic acids and the peptides
encoded thereby, as well as antibodies to the subject proteins and
transgenic cells and organisms. The subject protein and nucleic
acid compositions find use in a variety of different applications.
Finally, kits for use in such applications, e.g., that include the
subject nucleic acid compositions, are provided.
BRIEF DESCRIPTION OF THE FIGURES
[0010] FIG. 1. Normalized excitation and emission spectra of
representative DsRed variants. (A) Mutating residue N42 alters the
spectral properties of DsRed. Spectra are shown for DsRed1 and the
N42H and N42Q variants. All three proteins were fully mature. (B)
Spectra of the optimized DsRed.T3 and DsRed.T4 variants.
[0011] FIG. 2. Maturation kinetics of DsRed variants.
Logarithmically growing E. coli cultures were treated with the
inducer isopropyl .beta.-D-thiogalactopyranoside (IPTG) for 30 min
to generate a pulse of expression for each variant. A chase was
then initiated (at time 0 on the graphs) by adding protein
synthesis inhibitors and continuing the 37.degree. C. incubation.
Aliquots of the cultures were removed at the indicated times and
subsequently analyzed by flow cytometry to determine the average
intensity of red fluorescence per cell. The background fluorescence
(dashed line) was measured using cells carrying the empty pQE81
plasmid. Plotted on the two graphs are (A) the raw fluorescence
values, or (B) the values obtained by subtracting the fluorescence
present at time 0 and normalizing to a maximum signal of 100% for
each DsRed variant. A slight decline at later time points in the
average fluorescence values for DsRed.T3 and DsRed.T4 probably
reflects cell lysis. In a control culture, protein synthesis
inhibitors were added simultaneously with IPTG to cells carrying
the DsRed.T3 expression plasmid; as expected, those cells remained
nonfluorescent (data not shown). Immunoblotting indicated that
during the chase period, the amount of DsRed2, DsRed.T3, and
DsRed.T4 protein in the cultures remained essentially constant,
whereas the amount of DsRed1 protein progressively declined to
about half of its initial level (data not shown).
[0012] FIG. 3. Simultaneous visualization of DsRed.T4 and EGFP in
yeast. DsRed.T4 was targeted to the mitochondrial matrix of
Saccharomyces cerevisiae by fusion to the presequence of Cox4p. The
pCox4-DsRed.T4 fusion protein was produced in a strain that also
contained Sec7p-eGFP, a marker for Golgi cisternae. Cells from a
logarithmically growing culture were imaged using either a Texas
Red filter set (red) or an EGFP filter set (green). In addition,
the cells were visualized by differential interference contrast
(DIC) microscopy. As shown in the merged image, the DsRed.T4 and
EGFP signals are easily resolved. Scale bar, 2 .mu.m.
[0013] FIG. 4. Decreasing the net charge near the N terminus of
DsRed reduces aggregation of the protein. (A) Nondenaturing
SDS-PAGE of purified DsRed1 (WT), the Round 1 variant (R1), the
Round 3 variant (R3), the Round 4 variant (R4), DsRed.T1 (T1),
DsRed.T3 (T3) and DsRed.T4 (T4). 1 .mu.g of each purified DsRed
variant was mixed with SDS-containing sample buffer on ice and
immediately electrophoresed at 4.degree. C. in a 10%
poly-acrylamide gel, followed by staining with Coomassie Blue. WT*
and T4*: Additional aliquots of DsRed1 and DsRed.T4 were denatured
by boiling prior to electrophoresis. MW: broad range prestained
protein standard (Bio-Rad). (B) To measure the solubilities of the
fluorescent proteins in E. coli, cells carrying pREP4 plus
pQE31-based expression vectors encoding DsRed1, DsRed2, the Round 3
variant, the Round 4 variant, or EGFP were grown to an OD.sub.600
of 0.5, induced with IPTG for 7 h, then lysed with B-PER II and
centrifuged for 20 min at 27,000.times.g. Equivalent amounts of the
pellet and supernatant fractions were subjected to SDS-PAGE
followed by immunoblotting with an anti-hexahistidine monoclonal
antibody (Qiagen). The bound antibody was detected using the
ECL-Plus kit (Amersham) and a Molecular Dynamics Storm 860
phosphorimager. For each fluorescent protein, a dilution series
from the bacterial extract was analyzed, and a sample within the
linear range for the detection system was chosen. The percentage of
each protein in the supernatant fraction was then quantified.
Plotted are the average values from two separate experiments; for
each fluorescent protein, the numbers obtained in the two
experiments were within 10% of one another.
DEFINITIONS
[0014] In accordance with the present invention there may be
employed conventional molecular biology, microbiology, and
recombinant DNA techniques within the skill of the art. Such
techniques are explained fully in the literature. See, e.g.,
Maniatis, Fritsch & Sambrook, "Molecular Cloning: A Laboratory
Manual (1982); "DNA Cloning: A Practical Approach," Volumes I and
II (D. N. Glover ed. 1985); "Oligonucleotide Synthesis" (M. J. Gait
ed. 1984); "Nucleic Acid Hybridization" (B. D. Hames & S. J.
Higgins eds. (1985)); "Transcription and Translation" (B. D. Hames
& S. J. Higgins eds. (1984)); "Animal Cell Culture" (R. I.
Freshney, ed. (1986)); "Immobilized Cells and Enzymes" (IRL Press,
(1986)); B. Perbal, "A Practical Guide To Molecular Cloning"
(1984).
[0015] A "vector" is a replicon, such as plasmid, phage or cosmid,
to which another DNA segment may be attached so as to bring about
the replication of the attached segment.
[0016] A "DNA molecule" refers to the polymeric form of
deoxyribonucleotides (adenine, guanine, thymine, or cytosine) in
either single stranded form or a double-stranded helix. This term
refers only to the primary and secondary structure of the molecule,
and does not limit it to any particular tertiary forms. Thus, this
term includes double-stranded DNA found, inter alia, in linear DNA
molecules (e.g., restriction fragments), viruses, plasmids, and
chromosomes.
[0017] A DNA "coding sequence" is a DNA sequence which is
transcribed and translated into a polypeptide in vivo when placed
under the control of appropriate regulatory sequences. The
boundaries of the coding sequence are determined by a start codon
at the 5' (amino) terminus and a translation stop codon at the 3'
(carboxyl) terminus. A coding sequence can include, but is not
limited to, prokaryotic sequences, cDNA from eukaryotic mRNA,
genomic DNA sequences from eukaryotic (e.g., mammalian) DNA, and
synthetic DNA sequences. A polyadenylation signal and transcription
termination sequence may be located 3' to the coding sequence.
[0018] As used herein, the term "hybridization" refers to the
process of association of two nucleic acid strands to form an
antiparallel duplex stabilized by means of hydrogen bonding between
residues of the opposite nucleic acid strands.
[0019] The term "oligonucleotide" refers to a short (under 100
bases in length) nucleic acid molecule.
[0020] "DNA regulatory sequences", as used herein, are
transcriptional and translational control sequences, such as
promoters, enhancers, polyadenylation signals, terminators, and the
like, that provide for and/or regulate expression of a coding
sequence in a host cell.
[0021] A "promoter sequence" is a DNA regulatory region capable of
binding RNA polymerase in a cell and initiating transcription of a
downstream (3' direction) coding sequence. For purposes of defining
the present invention, the promoter sequence is bounded at its 3'
terminus by the transcription initiation site and extends upstream
(5' direction) to include the minimum number of bases or elements
necessary to initiate transcription at levels detectable above
background. Within the promoter sequence will be found a
transcription initiation site, as well as protein binding domains
responsible for the binding of RNA polymerase. Eukaryotic promoters
will often, but not always, contain "TATA" boxes and "CAT" boxes.
Various promoters, including inducible promoters, may be used to
drive the various vectors of the present invention.
[0022] As used herein, the terms "restriction endonucleases" and
"restriction enzymes" refer to bacterial enzymes, each of which cut
double-stranded DNA at or near a specific nucleotide sequence.
[0023] A cell has been "transformed" or "transfected" by exogenous
or heterologous DNA when such DNA has been introduced inside the
cell. The transforming DNA may or may not be integrated (covalently
linked) into the genome of the cell. In prokaryotes, yeast, and
mammalian cells for example; the transforming DNA may be maintained
on an episomal element such as a plasmid. With respect to
eukaryotic cells, a stably transformed cell is one in which the
transforming DNA has become integrated into a chromosome so that it
is inherited by daughter cells through chromosome replication. This
stability is demonstrated by the ability of the eukaryotic cell to
establish cell lines or clones comprised of a population of
daughter cells containing the transforming DNA. A "clone" is a
population of cells derived from a single cell or common ancestor
by mitosis. A "cell line" is a clone of a primary cell that is
capable of stable growth in vitro for many generations.
[0024] A "heterologous" region of the DNA construct is an
identifiable segment of DNA within a larger DNA molecule that is
not found in association with the larger molecule in nature. Thus,
when the heterologous region encodes a mammalian gene, the gene
will usually be flanked by DNA that does not flank the mammalian
genomic DNA in the genome of the source organism. In another
example, heterologous DNA includes coding sequence in a construct
where portions of genes from two different sources have been
brought together so as to produce a fusion protein product. Allelic
variations or naturally-occurring mutational events do not give
rise to a heterologous region of DNA as defined herein.
[0025] As used herein, the term "reporter gene" refers to a coding
sequence attached to heterologous promoter or enhancer elements and
whose product may be assayed easily and quantifiably when the
construct is introduced into tissues or cells.
[0026] The amino acids described herein are preferred to be in the
"L" isomeric form. The amino acid sequences are given in one-letter
code (A: alanine; C: cysteine; D: aspartic acid; E: glutamic acid;
F: phenylalanine; G: glycine; H: histidine; I: isoleucine; K:
lysine; L: leucine; M: methionine; N: asparagine; P: proline; Q:
glutamine; R: arginine; S: serine; T: threonine; V: valine; W:
tryptophan; Y: tyrosine; X: any residue). NH.sub.2 refers to the
free amino group present at the amino terminus of a polypeptide.
COOH refers to the free carboxy group present at the carboxy
terminus of a polypeptide. In keeping with standard polypeptide
nomenclature, J. Biol. Chem., 243 (1969), 3552-59 is used.
[0027] The term "immunologically active" defines the capability of
the natural, recombinant or synthetic chromo/fluorescent protein,
or any oligopeptide thereof, to induce a specific immune response
in appropriate animals or cells and to bind with specific
antibodies. As used herein, "antigenic amino acid sequence" means
an amino acid sequence that, either alone or in association with a
carrier molecule, can elicit an antibody response in a mammal. The
term "specific binding," in the context of antibody binding to an
antigen, is a term well understood in the art and refers to binding
of an antibody to the antigen to which the antibody was raised, but
not other, unrelated antigens.
[0028] As used herein the term "isolated" is meant to describe a
polynucleotide, a polypeptide, an antibody, or a host cell that is
in an environment different from that in which the polynucleotide,
the polypeptide, the antibody, or the host cell naturally
occurs.
[0029] Bioluminescence (BL) is defined as emission of light by
living organisms that is well visible in the dark and affects
visual behavior of animals (See e.g., Harvey, E. N. (1952).
Bioluminescence. New York: Academic Press; Hastings, J. W. (1995).
Bioluminescence. In: Cell Physiology (ed. by N. Speralakis). pp.
651-681. New York: Academic Press.; Wilson, T. and Hastings, J. W.
(1998). Bioluminescence. Annu Rev Cell Dev Biol 14, 197-230.).
Bioluminescence does not include so-called ultra-weak light
emission, which can be detected in virtually all living structures
using sensitive luminometric equipment (Murphy, M. E. and Sies, H.
(1990). Visible-range low-level chemiluminescence in biological
systems. Meth. Enzymol. 186, 595-610; Radotic, K, Radenovic, C,
Jeremic, M. (1998.) Spontaneous ultra-weak bioluminescence in
plants: origin, mechanisms and properties. Gen Physiol Biophys 17,
289-308), and from weak light emission which most probably does not
play any ecological role, such as the glowing of bamboo growth cone
(Totsune, H., Nakano, M., Inaba, H. (1993). Chemiluminescence from
bamboo shoot cut. Biochem. Biophys. Res Comm. 194, 1025-1029) or
emission of light during fertilization of animal eggs (Klebanoff,
S. J., Froeder, C. A., Eddy, E. M., Shapiro, B. M. (1979).
Metabolic similarities between fertilization and phagocytosis.
Conservation of peroxidatic mechanism. J. Exp. Med. 149, 938-953;
Schomer, B. and Epel, D. (1998). Redox changes during fertilization
and maturation of marine invertebrate eggs. Dev Biol 203,
1-11).
DESCRIPTION OF THE SPECIFIC EMBODIMENTS
[0030] Nucleic acid compositions encoding rapidly maturing
fluorescent proteins, as well as non-aggregating versions thereof
(and mutants thereof) and the proteins encoded the same, are
provided. The proteins of interest are proteins that are
fluorescent, where this feature arises from the interaction of two
or more residues of the protein. The subject proteins are further
characterized in that, in certain embodiments, they are mutants of
wild-type proteins that are obtained either from non-bioluminescent
Cnidarian, e.g., Anthozoan, species or are obtained from Anthozoan
non-Pennatulacean (sea pen) species. In certain embodiments, the
subject proteins are mutants of wild type Discosoma sp. "red"
fluorescent protein. Also of interest are proteins that are
substantially similar to, or mutants of, the above specific
proteins. Also provided are fragments of the nucleic acids and the
peptides encoded thereby, as well as antibodies to the subject
proteins and transgenic cells and organisms. The subject protein
and nucleic acid compositions find use in a variety of different
applications. Finally, kits for use in such applications, e.g.,
that include the subject nucleic acid compositions, are
provided.
[0031] Before the subject invention is described further, it is to
be understood that the invention is not limited to the particular
embodiments of the invention described below, as variations of the
particular embodiments may be made and still fall within the scope
of the appended claims. It is also to be understood that the
terminology employed is for the purpose of describing particular
embodiments, and is not intended to be limiting. Instead, the scope
of the present invention will be established by the appended
claims.
[0032] In this specification and the appended claims, the singular
forms "a," "an" and "the" include plural reference unless the
context clearly dictates otherwise. Unless defined otherwise, all
technical and scientific terms used herein have the same meaning as
commonly understood to one of ordinary skill in the art to which
this invention belongs.
[0033] Where a range of values is provided, it is understood that
each intervening value, to the tenth of the unit of the lower limit
unless the context clearly dictates otherwise, between the upper
and lower limit of that range, and any other stated or intervening
value in that stated range, is encompassed within the invention.
The upper and lower limits of these smaller ranges may
independently be included in the smaller ranges, and are also
encompassed within the invention, subject to any specifically
excluded limit in the stated range. Where the stated range includes
one or both of the limits, ranges excluding either or both of those
included limits are also included in the invention.
[0034] Unless defined otherwise, all technical and scientific terms
used herein have the same meaning as commonly understood to one of
ordinary skill in the art to which this invention belongs. Although
any methods, devices and materials similar or equivalent to those
described herein can be used in the practice or testing of the
invention, the preferred methods, devices and materials are now
described.
[0035] All publications mentioned herein are incorporated herein by
reference for the purpose of describing and disclosing the cell
lines, vectors, methodologies and other invention components that
are described in the publications that might be used in connection
with the presently described invention.
[0036] In further describing the subject invention, the subject
nucleic acid compositions will be described first, followed by a
discussion of the subject protein compositions, antibody
compositions and transgenic cells/organisms. Next a review of
representative methods in which the subject proteins find use is
provided.
Nucleic Acid Compositions
[0037] As summarized above, the subject invention provides nucleic
acid compositions encoding rapidly maturing chromo/fluoroproteins
and mutants thereof, as well as fragments and homologues of these
proteins. By rapidly maturing chromo/fluorescent protein is meant a
protein that is colored and/or fluorescent, e.g., it may exhibit
low, medium or high fluorescence upon irradiation with light of an
excitation wavelength. Furthermore, since the protein is rapidly
maturing, it achieves its final chromo/fluorescent properties in
less than about 72 hours, sometimes less than 48 hours, and
sometimes less than 24 hours. In certain embodiments, the protein
may mature in a period of less than 20 hours, e.g., 18 hours, 16
hours, 14 hours, 12 hours, 10 hours, 8 hours, etc.
[0038] In any event, the subject proteins of interest are those in
which the colored characteristic, i.e., the chromo and/or
fluorescent characteristic, is one that arises from the interaction
of two or more residues of the protein, and not from a single
residue, more specifically a single side chain of a single residue,
of the protein. As such, fluorescent proteins of the subject
invention do not include proteins that exhibit fluorescence only
from residues that act by themselves as intrinsic fluors, i.e.,
tryptophan, tyrosine and phenylalanine. As such, the fluorescent
proteins of the subject invention are fluorescent proteins whose
fluorescence arises from some structure in the protein that is
other than the above-specified single residues, e.g., it arises
from an interaction of two or more residues.
[0039] By nucleic acid composition is meant a composition
comprising a sequence of DNA having an open reading frame that
encodes a chromo/fluoro polypeptide of the subject invention, i.e.,
a chromo/fluoroprotein gene, and is capable, under appropriate
conditions, of being expressed as a chromo/fluoro protein according
to the subject invention. Also encompassed in this term are nucleic
acids that are homologous, substantially similar or identical to
the nucleic acids of the present invention. Thus, the subject
invention provides genes and coding sequences thereof encoding the
proteins of the subject invention, as well as homologs thereof. The
subject nucleic acids, when naturally occurring, are present in
other than their natural environment, e.g., they are isolated,
present in enriched amounts, etc., from their naturally occurring
environment, e.g., the organism from which they are obtained.
[0040] The nucleic acids are further characterized in that, when
they encode proteins that are either from, or are mutants of
proteins that are from: (1) non-bioluminescent species, often
non-bioluminescent Cnidarian species, e.g., non-bioluminescent
Anthozoan species; or (2) from Anthozoan species that are not
Pennatulacean species, i.e., that are not sea pens. As such, the
nucleic acids may encode proteins that are from, or are mutants of
proteins that are from, bioluminescent Anthozoan species, so long
as these species are not Pennatulacean species, e.g., that are not
Renillan or Ptilosarcan species. Of particular interest in certain
embodiments are rapidly maturing mutants of thefollowing specific
wild type proteins (or mutants thereof): (1) amFP485, cFP484,
zFP506, zFP540, drFP585, dsFP484, asFP600, dgFP512, dmFP592, as
disclosed in application Ser. No. 10/006,922, the disclosure of
which is herein incorporated by reference; (2) hcFP640, as
disclosed in application Ser. No. 09/976,673, the disclosure of
which is herein incorporated by reference; (3) CgCP, as disclosed
in application Ser. No. 60/255,533, the disclosure of which is
herein incorporated by reference; and (4) hcriGFP, zoanRFP,
scubGFP1, scubGFP2, rfloRFP, rfloGFP, mcavRFP, mcavGFP, cgigGFP,
afraGFP, rfloGFP2, mcavGFP2, mannFP, as disclosed in application
Ser. No. 60/332,980, the disclosure of which is herein incorporated
by reference.
[0041] In certain embodiments, the proteins encoded by the subject
nucleic acids are mutants of wild type Discosoma sp. "red"
fluorescent protein (drFP585), where the nucleic acid coding
sequence and the amino acid sequence of this protein are disclosed
in application Ser. No. 10/006,922, the disclosure of which is
herein incorporated by reference. Wild-Type DsRED is encoded by a
nucleic acid having a sequence:
TABLE-US-00001 (SEQ ID NO: 01)
ATGAGGTCTTCCAAGAATGTTATCAAGGAGTTCATGAGGTTTAAGGTTCG
CATGGAAGGAACGGTCAATGGGCACGAGTTTGAAATAGAAGGCGAAGGAG
AGGGGAGGCCATACGAAGGCCACAATACCGTAAAGCTTAAGGTAACCAAG
GGGGGACCTTTGCCATTTGCTTGGGATATTTTGTCACCACAATTTCAGTA
TGGAAGCAAGGTATATGTCAAGCACCCTGCCGACATACCAGACTATAAAA
AGCTGTCATTTCCTGAAGGATTTAAATGGGAAAGGGTCATGAACTTTGAA
GACGGTGGCGTCGTTACTGTAACCCAGGATTCCAGTTTGCAGGATGGCTG
TTTCATCTACAAGGTCAAGTTCATTGGCGTGAACTTTCCTTCCGATGGAC
CTGTTATGCAAAAGAAGACAATGGGCTGGGAAGCCAGCACTGAGCGTTTG
TATCCTCGTGATGGCGTGTTGAAAGGAGAGATTCATAAGGCTCTGAAGCT
GAAAGACGGTGGTCATTACCTAGTTGAATTCAAAAGTATTTACATGGCAA
AGAAGCCTGTGCAGCTACCAGGGTACTACTATGTTGACTCCAAACTGGAT
ATAACAAGCCACAACGAAGACTATACAATCGTTGAGCAGTATGAAAGAAC
CGAGGGACGCCACCATCTGTTCCTTTAA
and has the amino acid sequence:
TABLE-US-00002 (SEQ ID NO: 02)
MRSSKNVIKEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVKLKVTK
GGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFE
DGGVVTVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERL
YPRDGVLKGEIHKALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDSKLD
ITSHNEDYTIVEQYERTEGRHHLFL
[0042] Representative rapidly maturing mutants of "DsRed" include,
but are not limited to: point mutations at position 42 relative to
the start residue, e.g., N42H, N42Q, etc.; point mutations at
position 41 relative to the start residue, e.g., H41L, H41T, etc.;
point mutations at position 44 relative to the start residue, e.g.,
V44A, etc.; point mutations at position 21 relative to the start
residue, e.g., T21S, etc.; and the like.
[0043] One representative nucleic acid of interest that encodes the
DsRed.T1 mutant described in greater detail below includes coding
sequence found in the following sequence:
TABLE-US-00003 (SEQ ID NO: 03)
GGATCCACTAGTCGCCACCATGGCCTCCTCCGAGGACGTCATCAAGGAGT
TCATGCGCTTCAAGGTGCGCATGGAGGGCTCCGTGAACGGCCACGAGTTC
GAGATCGAGGGCGAGGGCGAGGGCCGCCCCTACGAGGGCACCCAGACCGC
CAAGCTGAAGGTGACCAAGGGCGGCCCCCTGCCCTTCGCCTGGGACATCC
TGTCCCCCCAGTTCCAGTACGGCTCCAAGGTGTACGTGAAGCACCCCGCC
GACATCCCCGACTACAAGAAGCTGTCCTTCCCCGAGGGCTTCAAGTGGGA
GCGCGTGATGAACTTCGAGGACGGCGGCGTGGTGACCGTGACCCAGGACT
CCTCCCTGCAGGACGGCTCCTTCATCTACAAGGTGAAGTTCATCGGCGTG
AACTTCCCCTCCGACGGCCCCGTAATGCAGAAGAAGACTATGGGCTGGGA
GGCCTCCACCGAGCGCCTGTACCCCCGCGACGGCGTGCTGAAGGGCGAGA
TCCACAAGGCCCTGAAGCTGAAGGACGGCGGCCACTACCTGGTGGAGTTC
AAGTCCATCTACATGGCCAAGAAGCCCGTGCAGCTGCCCGGCTACTACTA
CGTGGACTCCAAGCTGGACATCACCTCCCACAACGAGGACTACACCATCG
TGGAGCAGTACGAGCGCGCCGAGGGCCGCCACCACCTGTTCCTGTAGCGG CCGC
where the bolded/underlined ATG codon is the start codon and the
bold/underlined TAG is the stop codon.
[0044] In addition to the above-described fast maturing DsRed
mutants, fast-maturing mutants of other species as mentioned above
are also of interest. Such mutants or variants have point mutations
such as those described above in analogous or corresponding
positions of their sequence with respect to the specific positions
identified in the above representative DsRed mutants. Analogous or
corresponding sequence positions to make point mutations in a given
protein are readily determining by aligning the enclosed specific
DsRed mutants and the sequences of the wildtype protein from the
species of interest with Aquoria victoria green fluorescent
protein, using the protocol described in, and as illustrated in
FIG. 1 of, Matz et al., Nature Biotechnology (1999) 969-973.
Specific representative fast-maturing mutants of other species
include, but are not limited to (where the following point
positions are numbered according to the "GFP" numbering protocol
illustrated in FIG. 1 of Matz et al., supra): (1) fast maturing
mutants of dsFP483 having one or more point mutations selected from
N42, e.g., Q or H, V44, e.g., A, T21, e.g., S; fast maturing
mutants of zFP506 having one or more point mutations selected from
K41, e.g., L or T, 144, e.g., A, C21, e.g., S; fast maturing
mutants of aFP538 having one or more point mutations selected from
K41, e.g., L or T, 144, e.g., A, C21, e.g., S; fast maturing
mutants of amFP483 having one or more point mutations selected from
C21, e.g., S; and fast maturing mutants of cFP484 having one or
more point mutations selected from N21, e.g., S, L44, e.g. A;
etc.
[0045] In addition to the above-described specific nucleic acid
compositions, also of interest are homologues of the
above-sequences. With respect to homologues of the subject nucleic
acids, the source of homologous genes may be any species of plant
or animal or the sequence may be wholly or partially synthetic. In
certain embodiments, sequence similarity between homologues is at
least about 20%, sometimes at least about 25%, and may be 30%, 35%,
40%, 50%, 60%, 70% or higher, including 75%, 80%, 85%, 90% and 95%
or higher. Sequence similarity is calculated based on a reference
sequence, which may be a subset of a larger sequence, such as a
conserved motif, coding region, flanking region, etc. A reference
sequence will usually be at least about 18 nt long, more usually at
least about 30 nt long, and may extend to the complete sequence
that is being compared. Algorithms for sequence analysis are known
in the art, such as BLAST, described in Altschul et al. (1990), J.
Mol. Biol. 215:403-10 (using default settings, i.e. parameters w=4
and T=17). The sequences provided herein are essential for
recognizing related and homologous nucleic acids in database
searches.
[0046] Of particular interest in certain embodiments are nucleic
acids of substantially the same length as the nucleic acid
identified as SEQ ID NO: 01 or 02, where by substantially the same
length is meant that any difference in length does not exceed about
20 number %, usually does not exceed about 10 number % and more
usually does not exceed about 5 number %; and have sequence
identity to any of these sequences of at least about 90%, usually
at least about 95% and more usually at least about 99% over the
entire length of the nucleic acid. In many embodiments, the nucleic
acids have a sequence that is substantially similar (i.e., the same
as) or identical to the sequence of SEQ ID NO: 01 or 02. By
substantially similar is meant that sequence identity will
generally be at least about 60%, usually at least about 75% and
often at least about 80, 85, 90, or even 95%.
[0047] Also provided are nucleic acids that encode the proteins
encoded by the above-described nucleic acids, but differ in
sequence from the above-described nucleic acids due to the
degeneracy of the genetic code.
[0048] Also provided are nucleic acids that hybridize to the
above-described nucleic acid under stringent conditions. An example
of stringent hybridization conditions is hybridization at
50.degree. C. or higher and 0.1.times.SSC (15 mM sodium
chloride/1.5 mM sodium citrate). Another example of stringent
hybridization conditions is overnight incubation at 42.degree. C.
in a solution: 50% formamide, 5.times.SSC (150 mM NaCl, 15 mM
trisodium citrate), 50 mM sodium phosphate (pH7.6),
5.times.Denhardt's solution, 10% dextran sulfate, and 20 .mu.g/ml
denatured, sheared salmon sperm DNA, followed by washing the
filters in 0.1.times.SSC at about 65.degree. C. Stringent
hybridization conditions are hybridization conditions that are at
least as stringent as the above representative conditions, where
conditions are considered to be at least as stringent if they are
at least about 80% as stringent, typically at least about 90% as
stringent as the above specific stringent conditions. Other
stringent hybridization conditions are known in the art and may
also be employed to identify nucleic acids of this particular
embodiment of the invention.
[0049] Nucleic acids encoding mutants of the proteins of the
invention are also provided. Mutant nucleic acids can be generated
by random mutagenesis or targeted mutagenesis, using well-known
techniques that are routine in the art. In some embodiments,
chromo- or fluorescent proteins encoded by nucleic acids encoding
homologues or mutants have the same fluorescent properties as the
wild-type fluorescent protein. In other embodiments, homologue or
mutant nucleic acids encode chromo- or fluorescent proteins with
altered spectral properties, as described in more detail
herein.
[0050] One category of mutant that is of particular interest is the
non-aggregating mutant. In many embodiments, the non-aggregating
mutant differs from the wild type sequence by a mutation in the
N-terminus that modulates the charges appearing on side groups of
the N-terminus residues, e.g., to reverse or neutralize the charge,
in a manner sufficient to produce a non-aggregating mutant of the
naturally occurring protein or mutant, where a particular protein
is considered to be non-aggregating if it is determined be
non-aggregating using the assay reported in U.S. patent application
Ser. No. 10/081,864, the disclosure of which is herein incorporated
by reference, and published in PCT publication no. WO
02/068459.
[0051] In some embodiments, nucleic acids of this embodiment encode
non-aggregating polypeptides that exhibit reduced aggregation in
vivo. "Reduced aggregation in vivo" refers to reduced aggregation
in a cell. In some embodiments, the non-aggregating polypeptide
shows less than about 90%, less than about 80%, less than about
70%, less than about 60%; less than about 50%, less than about 40%,
less than about 30%, less than about 25%, less than about 20%, less
than about 15%, less than about 10%, or less than about 5% of the
aggregation shown by its corresponding aggregating analogue under
the same in vivo conditions, e.g., in another eukaryotic cell from
the same cell line, in an identical prokaryotic cell, or in a
eukaryotic cell or cell population of the same cell type. In
general, less than about 60%, less than about 50%, less than about
40%, less than about 30%, less than about 20%, less than about 10%,
or less than about 5%, of the subject non-aggregating polypeptide
present in a cell or a cell population is aggregated.
[0052] Methods of measuring the degree of aggregation are known in
the art; any known method can be used to determine whether a given
mutant shows a reduction in aggregation compared to corresponding
aggregating analogue, e.g., when compared to a corresponding
aggregating wild type polypeptide. Such methods include, but are
not limited to, "pseudo-native" protein gel electrophoresis; gel
filtration; ultracentrifugation; circular dichroism; and light
scattering. Aggregation can be measured by light scattering. For
non-aggregated proteins, the ratio of absorption at a shorter
wavelength to the absorption at a longer wavelength is close to
zero. In some embodiments, the ratio of absorption at 400 nm to the
absorption at 566 nm of a non-aggregating polypeptide is in the
range of from about 0.01 to about 0.1, from about 0.015 to about
0.09, from about 0.02 to about 0.08, from about 0.025 to about
0.07, or from about 0.03 to about 0.06.
[0053] In many embodiments, the nucleic acids encode
non-aggregating rapidly maturing polypeptides that have amino acid
sequences that differ from their corresponding wild type sequences
by a mutation in the N-terminus that modulates the charges
appearing on side groups of the N-terminus residues, e.g., to
reverse or neutralize the charge, in a manner sufficient to produce
a non-aggregating mutant of the naturally occurring protein or
aggregating mutant thereof. More specifically, basic residues
located near the N-termini of the proteins are substituted, e.g.,
Lys and Arg residues close to the N-terminus are substituted with
negatively charged or neutral residues. By N-terminus is meant
within about 50 residues from the N-terminus, often within about 25
residues of the N-terminus and more often within about 15 residues
of the N-terminus, where in many embodiments, residue modifications
occur within about 10 residues of the N-terminus. Specific residues
of interest in many embodiments include: 2, 3, 4, 5, 6, 7, 8, 9 and
10.
[0054] Where the protein encoded by the nucleic acid is a DsRed
mutant, as described above, specific non-aggregating point
mutations of interest include, but are not limited to: mutations at
position 2, e.g., R2H, R2L, R2A, etc.; mutations at position 5,
e.g., K5E, K5Q, K5M, etc.; mutations at position 6, e.g., N6D,
etc.; and the like.
[0055] Another category of mutant of particular interest is the
modulated oligomerization mutant. A mutant is considered to be a
modulated oligomerization mutant if its oligomerization properties
are different as compared to the wild type protein. For example, if
a particular mutant oligomerizes to a greater or lesser extent than
the wild type, it is considered to be an oligomerization mutant. Of
particular interest are oligomerization mutants that do to not
oligomerize, i.e., are monomers under physiological (e.g.,
intracellular) conditions, or oligomerize to a lesser extent that
the wild type, e.g., are dimers or trimers under intracellular
conditions. As such, of particular interest are nucleic acids that
encode monomeric versions of the subject rapidly maturing proteins.
One representative monomeric variant of the rapidly maturing DsRed
proteins described herein is the mutant named mRFP1 (monomeric red
fluorescent protein) and described in Campbell et al., Proc. Natl.
Acad. Sci. USA. 2002 June 11; 99 (12): 7877-7882. This specific
mutant contains a total of 33 mutations relative to DsRed of which
13 are internal to the .beta.-barrel (N42Q, V44A, V71A, K83L,
F124L, L150M, K163M, V175A, F177V, S179T, V195T, S1971, and T217A);
three are the aggregation-reducing mutations from T1 (R2A, K5E, and
N6D), three are AB interface mutations (I125R, V1271, and 1180T),
ten are AC interface mutations (R153E, H162K, A164R, L174D, Y192A,
Y194K, H222S, L223T, F224G, and L225A), and four are additional
beneficial mutations (T21S, H41T, C117E, and V156A). The nucleic
acid and amino acid sequences for this protein having been
deposited with GENBANK and assigned an accession no. of
AF506027.
[0056] Nucleic acids of the subject invention may be cDNA or
genomic DNA or a fragment thereof. In certain embodiments, the
nucleic acids of the subject invention include one or more of the
open reading frames encoding specific fluorescent proteins and
polypeptides, and introns, as well as adjacent 5' and 3' non-coding
nucleotide sequences involved in the regulation of expression, up
to about 20 kb beyond the coding region, but possibly further in
either direction. The subject nucleic acids may be introduced into
an appropriate vector for extrachromosomal maintenance or for
integration into a host genome, as described in greater detail
below.
[0057] The term "cDNA" as used herein is intended to include all
nucleic acids that share the arrangement of sequence elements found
in native mature mRNA species, where sequence elements are exons
and 5' and 3' non-coding regions. Normally mRNA species have
contiguous exons, with the intervening introns, when present, being
removed by nuclear RNA splicing, to create a continuous open
reading frame encoding the protein.
[0058] A genomic sequence of interest comprises the nucleic acid
present between the initiation codon and the stop codon, as defined
in the listed sequences, including all of the introns that are
normally present in a native chromosome. It may further include 5'
and 3' un-translated regions found in the mature mRNA. It may
further include specific transcriptional and translational
regulatory sequences, such as promoters, enhancers, etc., including
about 1 kb, but possibly more, of flanking genomic DNA at either
the 5' or 3' end of the transcribed region. The genomic DNA may be
isolated as a fragment of 100 kbp or smaller; and substantially
free of flanking chromosomal sequence. The genomic DNA flanking the
coding region, either 3' or 5', or internal regulatory sequences as
sometimes found in introns, contains sequences required for proper
tissue and stage specific expression.
[0059] The nucleic acid compositions of the subject invention may
encode all or a part of the subject proteins. Double or single
stranded fragments may be obtained from the DNA sequence by
chemically synthesizing oligonucleotides in accordance with
conventional methods, by restriction enzyme digestion, by PCR
amplification, etc. For the most part, DNA fragments will be of at
least about 15 nt, usually at least about 18 nt or about 25 nt, and
may be at least about 50 nt. In some embodiments, the subject
nucleic acid molecules may be about 100 nt, about 200 nt, about 300
nt, about 400 nt, about 500 nt, about 600 nt, about 700 nt, or
about 720 nt in length. The subject nucleic acids may encode
fragments of the subject proteins or the full-length proteins,
e.g., the subject nucleic acids may encode polypeptides of about 25
aa, about 50 aa, about 75 aa, about 100 aa, about 125 aa, about 150
aa, about 200 aa, about 210 aa, about 220 aa, about 230 aa, or
about 240 aa, up to the entire protein.
[0060] The subject nucleic acids are isolated and obtained in
substantial purity, generally as other than an intact chromosome.
Usually, the DNA will be obtained substantially free of other
nucleic acid sequences that do not include a nucleic acid of the
subject invention or fragment thereof, generally being at least
about 50%, usually at least about 90% pure and are typically
"recombinant", i.e. flanked by one or more nucleotides with which
it is not normally associated on a naturally occurring
chromosome.
[0061] The subject polynucleotides (e.g., a polynucleotide having a
sequence of SEQ ID NO: 01) the corresponding cDNA, the full-length
gene and constructs of the subject polynucleotides are provided.
These molecules can be generated synthetically by a number of
different protocols known to those of skill in the art. Appropriate
polynucleotide constructs are purified using standard recombinant
DNA techniques as described in, for example, Sambrook et al.,
Molecular Cloning: A Laboratory Manual, 2nd Ed., (1989) Cold Spring
Harbor Press, Cold Spring Harbor, N.Y., and under current
regulations described in United States Dept. of HHS, National
Institute of Health (NIH) Guidelines for Recombinant DNA
Research.
[0062] Also provided are nucleic acids that encode fusion proteins
of the subject proteins, or fragments thereof, which are fused to a
second protein, e.g., a degradation sequence, a signal peptide,
etc. For example, of interest are fusions of the present proteins
with rapid degradation sequences, such as those described in U.S.
Pat. No. 6,306,600 (the disclosure of which is herein incorporated
by reference), the degradation domain of mouse ornithine
decarboxylase (MODC), which contains a PEST sequence. A
representative fusion protein of this embodiment is marketed under
the name "Destabilized DsRed-Express" by BD Biosciences Clontech
(Palo Alto Calif.). Fusion proteins may comprise a subject
polypeptide, or fragment thereof, and a non-Anthozoan polypeptide
("the fusion partner") fused in-frame at the N-terminus and/or
C-terminus of the subject polypeptide. Fusion partners include, but
are not limited to, polypeptides that can bind antibody specific to
the fusion partner (e.g., epitope tags); antibodies or binding
fragments thereof; polypeptides that provide a catalytic function
or induce a cellular response; ligands or receptors or mimetics
thereof; and the like. In such fusion proteins, the fusion partner
is generally not naturally associated with the subject Anthozoan
portion of the fusion protein, and is typically not an Anthozoan
protein or derivative/fragment thereof, i.e., it is not found in
Anthozoan species.
[0063] Also provided are constructs comprising the subject nucleic
acids inserted into a vector, where such constructs may be used for
a number of different applications, including propagation, protein
production, etc. Viral and non-viral vectors may be prepared and
used, including plasmids. The choice of vector will depend on the
type of cell in which propagation is desired and the purpose of
propagation. Certain vectors are useful for amplifying and making
large amounts of the desired DNA sequence. Other vectors are
suitable for expression in cells in culture. Still other vectors
are suitable for transfer and expression in cells in a whole animal
or person. The choice of appropriate vector is well within the
skill of the art. Many such vectors are available commercially. To
prepare the constructs, the partial or full-length polynucleotide
is inserted into a vector typically by means of DNA ligase
attachment to a cleaved restriction enzyme site in the vector.
Alternatively, the desired nucleotide sequence can be inserted by
homologous recombination in vivo. Typically this is accomplished by
attaching regions of homology to the vector on the flanks of the
desired nucleotide sequence. Regions of homology are added by
ligation of oligonucleotides, or by polymerase chain reaction using
primers comprising both the region of homology and a portion of the
desired nucleotide sequence, for example. Representative specific
vectors of interest include, but are not limited to:
pCMV-DsRed-Express Vector; pDsRED-Express Vector and
pDsRed-Express-1 vector; all of which are sold by BD Biosciences
Clontech (Palo Alto Calif.).
[0064] Also provided are expression cassettes or systems that find
use in, among other applications, the synthesis of the subject
proteins. For expression, the gene product encoded by a
polynucleotide of the invention is expressed in any convenient
expression system, including, for example, bacterial, yeast,
insect, amphibian and mammalian systems. Suitable vectors and host
cells are described in U.S. Pat. No. 5,654,173. In the expression
vector, a subject polynucleotide, e.g., as set forth in SEQ ID
NO:01 or 02, is linked to a regulatory sequence as appropriate to
obtain the desired expression properties. These regulatory
sequences can include promoters (attached either at the 5' end of
the sense strand or at the 3' end of the antisense strand),
enhancers, terminators, operators, repressors, and inducers. The
promoters can be regulated or constitutive. In some situations it
may be desirable to use conditionally active promoters, such as
tissue-specific or developmental stage-specific promoters. These
are linked to the desired nucleotide sequence using the techniques
described above for linkage to vectors. Any techniques known in the
art can be used. In other words, the expression vector will provide
a transcriptional and translational initiation region, which may be
inducible or constitutive, where the coding region is operably
linked under the transcriptional control of the transcriptional
initiation region, and a transcriptional and translational
termination region. These control regions may be native to the
subject species from which the subject nucleic acid is obtained, or
may be derived from exogenous sources.
[0065] Expression vectors generally have convenient restriction
sites located near the promoter sequence to provide for the
insertion of nucleic acid sequences encoding heterologous proteins.
A selectable marker operative in the expression host may be
present. Expression vectors may be used for, among other things,
the production of fusion proteins, as described above.
[0066] Expression cassettes may be prepared comprising a
transcription initiation region, the gene or fragment thereof, and
a transcriptional termination region. Of particular interest is the
use of sequences that allow for the expression of functional
epitopes or domains, usually at least about 8 amino acids in
length, more usually at least about 15 amino acids in length, to
about 25 amino acids, and up to the complete open reading frame of
the gene. After introduction of the DNA, the cells containing the
construct may be selected by means of a selectable marker, the
cells expanded and then used for expression.
[0067] The above described expression systems may be employed with
prokaryotes or eukaryotes in accordance with conventional ways,
depending upon the purpose for expression. For large scale
production of the protein, a unicellular organism, such as E. coli,
B. subtilis, S. cerevisiae, insect cells in combination with
baculovirus vectors, or cells of a higher organism such as
vertebrates, e.g. COS 7 cells, HEK 293, CHO, Xenopus Oocytes, etc.,
may be used as the expression host cells. In some situations, it is
desirable to express the gene in eukaryotic cells, where the
expressed protein will benefit from native folding and
post-translational modifications. Small peptides can also be
synthesized in the laboratory. Polypeptides that are subsets of the
complete protein sequence may be used to identify and investigate
parts of the protein important for function.
[0068] Specific expression systems of interest include bacterial,
yeast, insect cell and mammalian cell derived expression systems.
Representative systems from each of these categories is are
provided below:
[0069] Bacteria. Expression systems in bacteria include those
described in Chang et al., Nature (1978) 275:615; Goeddel et al.,
Nature (1979) 281:544; Goeddel et al., Nucleic Acids Res. (1980)
8:4057; EP 0 036,776; U.S. Pat. No. 4,551,433; DeBoer et al., Proc.
Natl. Acad. Sci. (USA) (1983) 80:21-25; and Siebenlist et al., Cell
(1980) 20:269.
[0070] Yeast. Expression systems in yeast include those described
in Hinnen et al., Proc. Natl. Acad. Sci. (USA) (1978) 75:1929; Ito
et al., J. Bacteriol. (1983) 153:163; Kurtz et al., Mol. Cell.
Biol. (1986) 6:142; Kunze et al., J. Basic Microbiol. (1985)
25:141; Gleeson et al., J. Gen. Microbiol. (1986) 132:3459;
Roggenkamp et al., Mol. Gen. Genet. (1986) 202:302; Das et al., J.
Bacteriol. (1984) 158:1165; De Louvencourt et al., J. Bacteriol.
(1983) 154:737; Van den Berg et al., Bio/Technology (1990) 8:135;
Kunze et al., J. Basic Microbiol. (1985) 25:141; Cregg et al., Mol.
Cell. Biol. (1985) 5:3376; U.S. Pat. Nos. 4,837,148 and 4,929,555;
Beach and Nurse, Nature (1981) 300:706; Davidow et al., Curr.
Genet. (1985) 10:380; Gaillardin et al., Curr. Genet. (1985) 10:49;
Ballance et al., Biochem. Biophys. Res. Commun. (1983) 112:284-289;
Tilburn et al., Gene (1983) 26:205-221; Yelton et al., Proc. Natl.
Acad. Sci. (USA) (1984) 81:1470-1474; Kelly and Hynes, EMBO J.
(1985) 4:475479; EP 0 244,234; and WO 91/00357.
[0071] Insect Cells. Expression of heterologous genes in insects is
accomplished as described in U.S. Pat. No. 4,745,051; Friesen et
al., "The Regulation of Baculovirus Gene Expression", in: The
Molecular Biology Of Baculoviruses (1986) (W. Doerfler, ed.); EP 0
127,839; EP 0 155,476; and Vlak et al., J. Gen. Virot (1988)
69:765-776; Miller et al., Ann. Rev. Microbiol. (1988) 42:177;
Carbonell et al., Gene (1988) 73:409; Maeda et al., Nature (1985)
395:592-594; Lebacq-Verheyden et al., Mol. Cell. Biol. (1988)
8:3129; Smith et al., Proc. Natl. Acad. Sci. (USA) (1985) 82:8844;
Miyajima et al., Gene (1987) 58:273; and Martin et al., DNA (1988)
7:99. Numerous baculoviral strains and variants and corresponding
permissive insect host cells from hosts are described in Luckow et
al., Bio/Technology (1988) 6:47-55, Miller et al., Generic
Engineering (1986) 8:277-279, and Maeda et al., Nature (1985)
315:592-594.
[0072] Mammalian Cells. Mammalian expression is accomplished as
described in Dijkema et al., EMBO J. (1985) 4:761, Gorman et al.,
Proc. Natl. Acad. Sci. (USA) (1982) 79:6777, Boshart et al., Cell
(1985) 41:521 and U.S. Pat. No. 4,399,216. Other features of
mammalian expression are facilitated as described in Ham and
Wallace, Meth. Enz. (1979) 58:44, Barnes and Sato, Anal. Biochem.
(1980) 102:255, U.S. Pat. Nos. 4,767,704, 4,657,866, 4,927,762,
4,560,655, WO 90/103430, WO 87/00195, and U.S. RE 30,985.
[0073] When any of the above host cells, or other appropriate host
cells or organisms, are used to replicate and/or express the
polynucleotides or nucleic acids of the invention, the resulting
replicated nucleic acid, RNA, expressed protein or polypeptide, is
within the scope of the invention as a product of the host cell or
organism. The product is recovered by any appropriate means known
in the art.
[0074] Once the gene corresponding to a selected polynucleotide is
identified, its expression can be regulated in the cell to which
the gene is native. For example, an endogenous gene of a cell can
be regulated by an exogenous regulatory sequence inserted into the
genome of the cell at location sufficient to at least enhance
expressed of the gene in the cell. The regulatory sequence may be
designed to integrate into the genome via homologous recombination,
as disclosed in U.S. Pat. Nos. 5,641,670 and 5,733,761, the
disclosures of which are herein incorporated by reference, or may
be designed to integrate into the genome via non-homologous
recombination, as described in WO 99/15650, the disclosure of which
is herein incorporated by reference. As such, also encompassed in
the subject invention is the production of the subject proteins
without manipulation of the encoding nucleic acid itself, but
instead through integration of a regulatory sequence into the
genome of cell that already includes a gene encoding the desired
protein, as described in the above incorporated patent
documents.
[0075] Also provided are homologs of the subject nucleic acids.
Homologs are identified by any of a number of methods. A fragment
of the provided cDNA may be used as a hybridization probe against a
cDNA library from the target organism of interest, where low
stringency conditions are used. The probe may be a large fragment,
or one or more short degenerate primers. Nucleic acids having
sequence similarity are detected by hybridization under low
stringency conditions, for example, at 50.degree. C. and
6.times.SSC (0.9 M sodium chloride/0.09 M sodium citrate) and
remain bound when subjected to washing at 55.degree. C. in
1.times.SSC (0.15 M sodium chloride/0.015 M sodium citrate).
Sequence identity may be determined by hybridization under
stringent conditions, for example, at 50.degree. C. or higher and
0.1.times.SSC (15 mM sodium chloride/1.5 mM sodium citrate).
Nucleic acids having a region of substantial identity to the
provided sequences, e.g. allelic variants, genetically altered
versions of the gene, etc., bind to the provided sequences under
stringent hybridization conditions. By using probes, particularly
labeled probes of DNA sequences, one can isolate homologous or
related genes.
[0076] Also of interest are promoter elements of the subject
genomic sequences, where the sequence of the 5' flanking region may
be utilized for promoter elements, including enhancer binding
sites, e.g., that provide for regulation of expression in
cells/tissues where the subject proteins gene are expressed.
[0077] Also provided are small DNA fragments of the subject nucleic
acids, which fragments are useful as primers for PCR, hybridization
screening probes, etc. Larger DNA fragments, i.e., greater than 100
nt are useful for production of the encoded polypeptide, as
described in the previous section. For use in geometric
amplification reactions, such as geometric PCR, a pair of primers
will be used. The exact composition of the primer sequences is not
critical to the invention, but for most applications the primers
will hybridize to the subject sequence under stringent conditions,
as known in the art. It is preferable to choose a pair of primers
that will generate an amplification product of at least about 50
nt, preferably at least about 100 nt. Algorithms for the selection
of primer sequences are generally known, and are available in
commercial software packages. Amplification primers hybridize to
complementary strands of DNA, and will prime towards each
other.
[0078] The DNA may also be used to identify expression of the gene
in a biological specimen. The manner in which one probes cells for
the presence of particular nucleotide sequences, as genomic DNA or
RNA, is well established in the literature. Briefly, DNA or mRNA is
isolated from a cell sample. The mRNA may be amplified by RT-PCR,
using reverse transcriptase to form a complementary DNA strand,
followed by polymerase chain reaction amplification using primers
specific for the subject DNA sequences. Alternatively, the mRNA
sample is separated by gel electrophoresis, transferred to a
suitable support, e.g. nitrocellulose, nylon, etc., and then probed
with a fragment of the subject DNA as a probe. Other techniques,
such as oligonucleotide ligation assays, in situ hybridizations,
and hybridization to DNA probes arrayed on a solid chip may also
find use. Detection of mRNA hybridizing to the subject sequence is
indicative of Anthozoan protein gene expression in the sample.
[0079] The subject nucleic acids, including flanking promoter
regions and coding regions, may be mutated in various ways known in
the art to generate targeted changes in promoter strength, sequence
of the encoded protein, properties of the encoded protein,
including fluorescent properties of the encoded protein, etc. The
DNA sequence or protein product of such a mutation will usually be
substantially similar to the sequences provided herein, e.g. will
differ by at least one nucleotide or amino acid, respectively, and
may differ by at least two but not more than about ten nucleotides
or amino acids. The sequence changes may be substitutions,
insertions, deletions, or a combination thereof. Deletions may
further include larger changes, such as deletions of a domain or
exon, e.g. of stretches of 10, 20, 50, 75, 100, 150 or more aa
residues. Techniques for in vitro mutagenesis of cloned genes are
known. Examples of protocols for site specific mutagenesis may be
found in Gustin et al. (1993), Biotechniques 14:22; Barany (1985),
Gene 37:111-23; Colicelli et al. (1985), Mol. Gen. Genet.
199:537-9; and Prentki et al. (1984), Gene 29:303-13. Methods for
site specific mutagenesis can be found in Sambrook et al.,
Molecular Cloning: A Laboratory Manual, CSH Press 1989, pp.
15.3-15.108; Weiner et al. (1993), Gene 126:35-41; Sayers et al.
(1992), Biotechniques 13:592-6; Jones and Winistorfer (1992),
Biotechniques 12:528-30; Barton at al. (1990), Nucleic Acids Res
18:7349-55; Marotti and Tomich (1989), Gene Anal. Tech. 6:67-70;
and Zhu (1989), Anal Biochem 177:120-4. Such mutated nucleic acid
derivatives may be used to study structure-function relationships
of a particular chromo/fluorescent protein, or to alter properties
of the protein that affect its function or regulation.
[0080] Also of interest are humanized versions of the subject
nucleic acids. As used herein, the term "humanized" refers to
changes made to the nucleic acid sequence to optimize the codons
for expression of the protein in human cells (Yang et al., Nucleic
Acids Research 24 (1996), 4592-4593). See also U.S. Pat. No.
5,795,737 which describes humanization of proteins, the disclosure
of which is herein incorporated by reference.
Protein/Polypeptide Compositions
[0081] Also provided by the subject invention are rapidly maturing
chromo- and/or fluorescent proteins and mutants thereof, as well as
polypeptide compositions related thereto. As the subject proteins
are chromoproteins, they are colored proteins, which may be
fluorescent, low or non-fluorescent. As used herein, the terms
chromoprotein and fluorescent protein do not include luciferases,
such as Renilla luciferase, and refer to any protein that is
pigmented or colored and/or fluoresces when irradiated with light,
e.g., white light or light of a specific wavelength (or narrow band
of wavelengths such as an excitation wavelength). The term
polypeptide composition as used herein refers to both the
full-length protein, as well as portions or fragments thereof. Also
included in this term are variations of the naturally occurring
protein, where such variations are homologous or substantially
similar to the naturally occurring protein, and mutants of the
naturally occurring proteins, as described in greater detail below.
The subject polypeptides are present in other than their natural
environment.
[0082] In many embodiments, the excitation spectra of the subject
proteins typically ranges from about 300 to 700, usually from about
350 to 650 and more usually from about 400 to 600 nm while the
emission spectra of the subject proteins typically ranges from
about 400 to 800, usually from about 425 to 775 and more usually
from about 450 to 750 nm. The subject proteins generally have a
maximum extinction coefficient that ranges from about 10,000 to
55,000 and usually from about 15,000 to 55,000. The subject
proteins typically range in length from about 150 to 300 and
usually from about 200 to 300 amino acid residues, and generally
have a molecular weight ranging from about 15 to 35 kDa, usually
from about 17.5 to 32.5 kDa.
[0083] In certain embodiments, the subject proteins are bright,
where by bright is meant that the chromoproteins and their
fluorescent mutants can be detected by common methods (e.g., visual
screening, spectrophotometry, spectrofluorometry, fluorescent
microscopy, by FACS machines, etc.) Fluorescence brightness of
particular fluorescent proteins is determined by its quantum yield
multiplied by maximal extinction coefficient. Brightness of
chromoprotein may be expressed by its maximal extinction
coefficient.
[0084] In certain embodiments, the subject proteins fold rapidly
following expression in the host cell. By rapidly folding is meant
that the proteins achieve their tertiary structure that gives rise
to their chromo- or fluorescent quality in a short period of time.
In these embodiments, the proteins fold in a period of time that
generally does not exceed about 3 days, usually does not exceed
about 2 days and more usually does not exceed about 1 day.
[0085] Specific proteins of interest include rapidly maturing
variants of DsRed, which mature at least about 5 times more
rapidly, sometimes at least about 10 times more rapidly, e.g., at
least about 15 times more rapidly or faster, than the corresponding
DsRed wild type protein. Exemplary proteins of this specific
embodiment include those described in the experimental section,
below, e.g., DsRed.T1; DsRed.T3; and DsRedT4.
[0086] Homologs or proteins (or fragments thereof) that vary in
sequence from the above provided specific amino acid sequences of
the subject invention are also provided. By homolog is meant a
protein having at least about 10%, usually at least about 20% and
more usually at least about 30%, and in many embodiments at least
about 35%, usually at least about 40% and more usually at least
about 60% amino acid sequence identity to the protein of the
subject invention, as determined using MegAlign, DNAstar (1998)
clustal algorithm as described in D. G. Higgins and P. M. Sharp,
"Fast and Sensitive multiple Sequence Alignments on a
Microcomputer," (1989) CABIOS, 5: 151-153. (Parameters used are
ktuple 1, gap penalty 3, window, 5 and diagonals saved 5). In many
embodiments, homologues of interest have much higher sequence
identify, e.g., 65%, 70%, 75%, 80%, 85%, 90% or higher.
[0087] Also provided are proteins that are substantially identical
to the specifically described proteins herein, where by
substantially identical is meant that the protein has an amino acid
sequence identity to the reference protein of at least about 60%,
usually at least about 65% and more usually at least about 70%,
where in some instances the identity may be much higher, e.g., 75%,
80%, 85%, 90%, 95% or higher.
[0088] In many embodiments, the subject homologues have structural
features found in the above provided specific sequences, where such
structural features include the .beta.-can fold.
[0089] Proteins that are mutants of the specifically described
proteins herein are also provided. Mutants may retain biological
properties of the wild-type (e.g., naturally occurring) proteins,
or may have biological properties that differ from the wild-type
proteins. The term "biological property" of the subject proteins
includes, but is not limited to, spectral properties, such as
absorbance maximum, emission maximum, maximum extinction
coefficient, brightness (e.g., as compared to the wild-type protein
or another reference protein such as green fluorescent protein from
A. victoria), and the like; in vivo and/or in vitro stability
(e.g., half-life); etc. Mutants include single amino acid changes,
deletions of one or more amino acids, N-terminal truncations,
C-terminal truncations, insertions, etc.
[0090] Mutants can be generated using standard techniques of
molecular biology, e.g., random mutagenesis, and targeted
mutagenesis. Several mutants are described herein. Given the
guidance provided in the Examples, and using standard techniques,
those skilled in the art can readily generate a wide variety of
additional mutants and test whether a biological property has been
altered. For example, fluorescence intensity can be measured using
a spectrophotometer at various excitation wavelengths.
[0091] Those proteins of the subject invention that are naturally
occurring proteins are present in a non-naturally occurring
environment, e.g., are separated from their naturally occurring
environment. In certain embodiments, the subject proteins are
present in a composition that is enriched for the subject protein
as compared to its naturally occurring environment. For example,
purified protein is provided, where by purified is meant that the
protein is present in a composition that is substantially free of
non-chromo/fluoroprotein proteins of interest, where by
substantially free is meant that less than 90%, usually less than
60% and more usually less than 50% of the composition is made up of
non-chromoproteins or mutants thereof of interest. The proteins of
the subject invention may also be present as an isolate, by which
is meant that the protein is substantially free of other proteins
and other naturally occurring biologic molecules, such as
oligosaccharides, polynucleotides and fragments thereof, and the
like, where the term "substantially free" in this instance means
that less than 70%, usually less than 60% and more usually less
than 50, % of the composition containing the isolated protein is
some other naturally occurring biological molecule. In certain
embodiments, the proteins are present in substantially pure form,
where by "substantially pure form" is meant at least 95%, usually
at least 97% and more usually at least 99% pure.
[0092] In addition to the specifically described proteins herein,
polypeptides that vary from these proteins, e.g., the mutant
proteins described above, are also provided. Generally such
polypeptides include an amino acid sequence encoded by an open
reading frame (ORF) of the gene encoding the subject wild type
protein, including the full length protein and fragments thereof,
particularly biologically active fragments and/or fragments
corresponding to functional domains, and the like; and including
fusions of the subject polypeptides to other proteins or parts
thereof. Fragments of interest will typically be at least about 10
aa in length, usually at least about 50 aa in length, and may be as
long as 300 aa in length or longer, but will usually not exceed
about 1000 aa in length, where the fragment will have a stretch of
amino acids that is identical to the subject protein of at least
about 10 aa, and usually at least about 15 aa, and in many
embodiments at least about 50 aa in length. In some embodiments,
the subject polypeptides are about 25 aa, about 50 aa, about 75 aa,
about 100 aa, about 125 aa, about 150 aa, about 200 aa, about 210
aa, about 220 aa, about 230 aa, or about 240 aa in length, up to
the entire protein. In some embodiments, a protein fragment retains
all or substantially all of a biological property of the wild-type
protein.
[0093] The subject proteins and polypeptides may be obtained from
naturally occurring sources or synthetically produced. For example,
wild type proteins may be derived from biological sources which
express the proteins, e.g., non-bioluminescent Cnidarian, e.g.,
Anthozoan, species, such as the specific ones listed above. The
subject proteins may also be derived from synthetic means, e.g., by
expressing a recombinant gene or nucleic acid coding sequence
encoding the protein of interest in a suitable host, as described
above. Any convenient protein purification procedures may be
employed, where suitable protein purification methodologies are
described in Guide to Protein Purification, (Deuthser ed.)
(Academic Press, 1990). For example, a lysate may prepared from the
original source and purified using HPLC, exclusion chromatography,
gel electrophoresis, affinity chromatography, and the like.
Antibody Compositions
[0094] Also provided are antibodies that specifically bind to the
subject fluorescent proteins. Suitable antibodies are obtained by
immunizing a host animal with peptides comprising all or a portion
of the subject protein. Suitable host animals include mouse, rat
sheep, goat, hamster, rabbit, etc. The origin of the protein
immunogen will generally be a Cnidarian species, specifically a
non-bioluminescent Cnidarian species, such as an Anthozoan species
or a non-Petalucean Anthozoan species. The host animal will
generally be a different species than the immunogen, e.g., mice,
etc.
[0095] The immunogen may comprise the complete protein, or
fragments and derivatives thereof. Preferred immunogens comprise
all or a part of the protein, where these residues contain the
post-translation modifications found on the native target protein.
Immunogens are produced in a variety of ways known in the art,
e.g., expression of cloned genes using conventional recombinant
methods, isolation from Anthozoan species of origin, etc.
[0096] For preparation of polyclonal antibodies, the first step is
immunization of the host animal with the target protein, where the
target protein will preferably be in substantially pure form,
comprising less than about 1% contaminant. The immunogen may
comprise the complete target protein, fragments or derivatives
thereof. To increase the immune response of the host animal, the
target protein may be combined with an adjuvant, where suitable
adjuvants include alum, dextran, sulfate, large polymeric anions,
oil & water emulsions, e.g. Freund's adjuvant, Freund's
complete adjuvant, and the like. The target protein may also be
conjugated to synthetic carrier proteins or synthetic antigens. A
variety of hosts may be immunized to produce the polyclonal
antibodies. Such hosts include rabbits, guinea pigs, rodents, e.g.
mice, rats, sheep, goats, and the like. The target protein is
administered to the host, usually intradermally, with an initial
dosage followed by one or more, usually at least two, additional
booster dosages. Following immunization, the blood from the host
will be collected, followed by separation of the serum from the
blood cells. The Ig present in the resultant antiserum may be
further fractionated using known methods, such as ammonium salt
fractionation, DEAE chromatography, and the like.
[0097] Monoclonal antibodies are produced by conventional
techniques. Generally, the spleen and/or lymph nodes of an
immunized host animal provide a source of plasma cells. The plasma
cells are immortalized by fusion with myeloma cells to produce
hybridoma cells. Culture supernatant from individual hybridomas is
screened using standard techniques to identify those producing
antibodies with the desired specificity. Suitable animals for
production of monoclonal antibodies to the human protein include
mouse, rat, hamster, etc. To raise antibodies against the mouse
protein, the animal will generally be a hamster, guinea pig,
rabbit, etc. The antibody may be purified from the hybridoma cell
supernatants or ascites fluid by conventional techniques, e.g.
affinity chromatography using protein bound to an insoluble
support, protein A sepharose, etc.
[0098] The antibody may be produced as a single chain, instead of
the normal multimeric structure. Single chain antibodies are
described in Jost et al. (1994) J.B.C. 269:26267-73, and others.
DNA sequences encoding the variable region of the heavy chain and
the variable region of the light chain are ligated to a spacer
encoding at least about 4 amino acids of small neutral amino acids,
including glycine and/or serine. The protein encoded by this fusion
allows assembly of a functional variable region that retains the
specificity and affinity of the original antibody.
[0099] Also of interest in certain embodiments are humanized
antibodies. Methods of humanizing antibodies are known in the art.
The humanized antibody may be the product of an animal having
transgenic human immunoglobulin constant region genes (see for
example International Patent Applications WO 90/10077 and WO
90/04036). Alternatively, the antibody of interest may be
engineered by recombinant DNA techniques to substitute the CH1,
CH2, CH3, hinge domains, and/or the framework domain with the
corresponding human sequence (see WO 92/02190).
[0100] The use of Ig cDNA for construction of chimeric
immunoglobulin genes is known in the art (Liu et al. (1987)
P.N.A.S. 84:3439 and (1987) J. Immunol. 139:3521). mRNA is isolated
from a hybridoma or other cell producing the antibody and used to
produce cDNA. The cDNA of interest may be amplified by the
polymerase chain reaction using specific primers (U.S. Pat. Nos.
4,683,195 and 4,683,202). Alternatively, a library is made and
screened to isolate the sequence of interest. The DNA sequence
encoding the variable region of the antibody is then fused to human
constant region sequences. The sequences of human constant regions
genes may be found in Kabat et al. (1991) Sequences of Proteins of
Immunological Interest, N.I.H. publication no. 91-3242. Human C
region genes are readily available from known clones. The choice of
isotype will be guided by the desired effector functions, such as
complement fixation, or activity in antibody-dependent cellular
cytotoxicity. Preferred isotypes are IgG1, IgG3 and IgG4. Either of
the human light chain constant regions, kappa or lambda, may be
used. The chimeric, humanized antibody is then expressed by
conventional methods.
[0101] Antibody fragments, such as Fv, F(ab').sub.2 and Fab may be
prepared by cleavage of the intact protein, e.g. by protease or
chemical cleavage. Alternatively, a truncated gene is designed. For
example, a chimeric gene encoding a portion of the F(ab').sub.2
fragment would include DNA sequences encoding the CH1 domain and
hinge region of the H chain, followed by a translational stop codon
to yield the truncated molecule.
[0102] Consensus sequences of H and L J regions may be used to
design oligonucleotides for use as primers to introduce useful
restriction sites into the J region for subsequent linkage of V
region segments to human C region segments. C region cDNA can be
modified by site directed mutagenesis to place a restriction site
at the analogous position in the human sequence.
[0103] Expression vectors include plasmids, retroviruses, YACs, EBV
derived episomes, and the like. A convenient vector is one that
encodes a functionally complete human CH or CL immunoglobulin
sequence, with appropriate restriction sites engineered so that any
VH or VL sequence can be easily inserted and expressed. In such
vectors, splicing usually occurs between the splice donor site in
the inserted J region and the splice acceptor site preceding the
human C region, and also at the splice regions that occur within
the human CH exons. Polyadenylation and transcription termination
occur at native chromosomal sites downstream of the coding regions.
The resulting chimeric antibody may be joined to any strong
promoter, including retroviral LTRs, e.g. SV-40 early promoter,
(Okayama et al. (1983) Mol. Cell. Bio. 3:280), Rous sarcoma virus
LTR (Gorman et al. (1982) P.N.A.S. 79:6777), and moloney murine
leukemia virus LTR (Grosschedl et al. (1985) Cell 41:885); native
Ig promoters, etc.
Transgenics
[0104] The subject nucleic acids can be used to generate
transgenic, non-human plants or animals or site specific gene
modifications in cell lines. Transgenic cells of the subject
invention include on or more nucleic acids according to the subject
invention present as a transgene, where included within this
definition are the parent cells transformed to include the
transgene and the progeny thereof. In many embodiments, the
transgenic cells are cells that do not normally harbor or contain a
nucleic acid according to the subject invention. In those
embodiments where the transgenic cells do naturally contain the
subject nucleic acids, the nucleic acid will be present in the cell
in a position other than its natural location, i.e. integrated into
the genomic material of the cell at a non-natural location.
Transgenic animals may be made through homologous recombination,
where the endogenous locus is altered. Alternatively, a nucleic
acid construct is randomly integrated into the genome. Vectors for
stable integration include plasmids, retroviruses and other animal
viruses, YACs, and the like.
[0105] Transgenic organisms of the subject invention include cells
and multicellular organisms, e.g., plants and animals, that are
endogenous knockouts in which expression of the endogenous gene is
at least reduced if not eliminated. Transgenic organisms of
interest also include cells and multicellular organisms, e.g.,
plants and animals, in which the protein or variants thereof is
expressed in cells or tissues where it is not normally expressed
and/or at levels not normally present in such cells or tissues.
[0106] DNA constructs for homologous recombination will comprise at
least a portion of the gene of the subject invention, wherein the
gene has the desired genetic modification(s), and includes regions
of homology to the target locus. DNA constructs for random
integration need not include regions of homology to mediate
recombination. Conveniently, markers for positive and negative
selection are included. Methods for generating cells having
targeted gene modifications through homologous recombination are
known in the art. For various techniques for transfecting mammalian
cells, see Keown et al. (1990), Meth. Enzymol. 185:527-537.
[0107] For embryonic stem (ES) cells, an ES cell line may be
employed, or embryonic cells may be obtained freshly from a host,
e.g. mouse, rat, guinea pig, etc. Such cells are grown on an
appropriate fibroblast-feeder layer or grown in the presence of
leukemia inhibiting factor (LIF). When ES or embryonic cells have
been transformed, they may be used to produce transgenic animals.
After transformation, the cells are plated onto a feeder layer in
an appropriate medium. Cells containing the construct may be
detected by employing a selective medium. After sufficient time for
colonies to grow, they are picked and analyzed for the occurrence
of homologous recombination or integration of the construct. Those
colonies that are positive may then be used for embryo manipulation
and blastocyst injection. Blastocysts are obtained from 4 to 6 week
old superovulated females. The ES cells are trypsinized, and the
modified cells are injected into the blastocoel of the blastocyst.
After injection, the blastocysts are returned to each uterine horn
of pseudopregnant females. Females are then allowed to go to term
and the resulting offspring screened for the construct. By
providing for a different phenotype of the blastocyst and the
genetically modified cells, chimeric progeny can be readily
detected.
[0108] The chimeric animals are screened for the presence of the
modified gene and males and females having the modification are
mated to produce homozygous progeny. If the gene alterations cause
lethality at some point in development, tissues or organs can be
maintained as allogeneic or congenic grafts or transplants, or in
in vitro culture. The transgenic animals may be any non-human
mammal, such as laboratory animals, domestic animals, etc. The
transgenic animals may be used in functional studies, drug
screening, etc. Representative examples of the use of transgenic
animals include those described infra.
[0109] Transgenic plants may be produced in a similar manner.
Methods of preparing transgenic plant cells and plants are
described in U.S. Pat. Nos. 5,767,367; 5,750,870; 5,739,409;
5,689,049; 5,689,045; 5,674,731; 5,656,466; 5,633,155; 5,629,470;
5,595,896; 5,576,198; 5,538,879; 5,484,956; the disclosures of
which are herein incorporated by reference. Methods of producing
transgenic plants are also reviewed in Plant Biochemistry and
Molecular Biology (eds Lea & Leegood, John Wiley &
Sons)(1993) pp 275-295. In brief, a suitable plant cell or tissue
is harvested, depending on the nature of the plant species. As
such, in certain instances, protoplasts will be isolated, where
such protoplasts may be isolated from a variety of different plant
tissues, e.g. leaf, hypoctyl, root, etc. For protoplast isolation,
the harvested cells are incubated in the presence of cellulases in
order to remove the cell wall, where the exact incubation
conditions vary depending on the type of plant and/or tissue from
which the cell is derived. The resultant protoplasts are then
separated from the resultant cellular debris by sieving and
centrifugation. Instead of using protoplasts, embryogenic explants
comprising somatic cells may be used for preparation of the
transgenic host. Following cell or tissue harvesting, exogenous DNA
of interest is introduced into the plant cells, where a variety of
different techniques are available for such introduction. With
isolated protoplasts, the opportunity arise for introduction via
DNA-mediated gene transfer protocols, including: incubation of the
protoplasts with naked DNA, e.g. plasmids, comprising the exogenous
coding sequence of interest in the presence of polyvalent cations,
e.g. PEG or PLO; and electroporation of the protoplasts in the
presence of naked DNA comprising the exogenous sequence of
interest. Protoplasts that have successfully taken up the exogenous
DNA are then selected, grown into a callus, and ultimately into a
transgenic plant through contact with the appropriate amounts and
ratios of stimulatory factors, e.g. auxins and cytokinins. With
embryogenic explants, a convenient method of introducing the
exogenous DNA in the target somatic cells is through the use of
particle acceleration or "gene-gun" protocols. The resultant
explants are then allowed to grow into chimera plants, cross-bred
and transgenic progeny are obtained. Instead of the naked DNA
approaches described above, another convenient method of producing
transgenic plants is Agrobacterium mediated transformation. With
Agrobacterium mediated transformation, co-integrative or binary
vectors comprising the exogenous DNA are prepared and then
introduced into an appropriate Agrobacterium strain, e.g. A.
tumefaciens. The resultant bacteria are then incubated with
prepared protoplasts or tissue explants, e.g. leaf disks, and a
callus is produced. The callus is then grown under selective
conditions, selected and subjected to growth media to induce root
and shoot growth to ultimately produce a transgenic plant.
Utility
[0110] The subject chromoproteins and fluorescent mutants thereof
find use in a variety of different applications, where the
applications necessarily differ depending on whether the protein is
a chromoprotein or a fluorescent protein. Representative uses for
each of these types of proteins will be described below, where the
follow described uses are merely representative and are in no way
meant to limit the use of the subject proteins to those described
below.
Chromoproteins
[0111] The subject chromoproteins of the present invention find use
in a variety of different applications. One application of interest
is the use of the subject proteins as coloring agents which are
capable of imparting color or pigment to a particular composition
of matter. Of particular interest in certain embodiments are
non-toxic chromoproteins. The subject chromoproteins may be
incorporated into a variety of different compositions of matter,
where representative compositions of matter include: food
compositions, pharmaceuticals, cosmetics, living organisms, e.g.,
animals and plants, and the like. Where used as a coloring agent or
pigment, a sufficient amount of the chromoprotein is incorporated
into the composition of matter to impart the desired color or
pigment thereto. The chromoprotein may be incorporated into the
composition of matter using any convenient protocol, where the
particular protocol employed will necessarily depend, at least in
part, on the nature of the composition of matter to be colored.
Protocols that may be employed include, but are not limited to:
blending, diffusion, friction, spraying, injection, tattooing, and
the like.
[0112] The chromoproteins may also find use as labels in analyte
detection assays, e.g., assays for biological analytes of interest.
For example, the chromoproteins may be incorporated into adducts
with analyte specific antibodies or binding fragments thereof and
subsequently employed in immunoassays for analytes of interest in a
complex sample, as described in U.S. Pat. No. 4,302,536; the
disclosure of which is herein incorporated by reference. Instead of
antibodies or binding fragments thereof, the subject chromoproteins
or chromogenic fragments thereof may be conjugated to ligands that
specifically bind to an analyte of interest, or other moieties,
growth factors, hormones, and the like; as is readily apparent to
those of skill in the art.
[0113] In yet other embodiments, the subject chromoproteins may be
used as selectable markers in recombinant DNA applications, e.g.,
the production of transgenic cells and organisms, as described
above. As such, one can engineer a particular transgenic production
protocol to employ expression of the subject chromoproteins as a
selectable marker, either for a successful or unsuccessful
protocol. Thus, appearance of the color of the subject
chromoprotein in the phenotype of the transgenic organism produced
by a particular process can be used to indicate that the particular
organism successfully harbors the transgene of interest, often
integrated in a manner that provides for expression of the
transgene in the organism. When used a selectable marker, a nucleic
acid encoding for the subject chromoprotein can be employed in the
transgenic generation process, where this process is described in
greater detail supra. Particular transgenic organisms of interest
where the subject proteins may be employed as selectable markers
include transgenic plants, animals, bacteria, fungi, and the
like.
[0114] In yet other embodiments, the chromoproteins (and
fluorescent proteins) of the subject invention find use in
sunscreens, as selective filters, etc., in a manner similar to the
uses of the proteins described in WO 00/46233.
Fluorescent Proteins
[0115] The subject fluorescent proteins of the present invention
(as well as other components of the subject invention described
above) find use in a variety of different applications, where such
applications include, but are not limited to, the following. The
first application of interest is the use of the subject proteins in
fluorescence resonance energy transfer (FRET) applications. In
these applications, the subject proteins serve as donor and/or
acceptors in combination with a second fluorescent protein or dye,
e.g., a fluorescent protein as described in Matz et al., Nature
Biotechnology (October 1999) 17:969-973, a green fluorescent
protein from Aequoria victoria or fluorescent mutant thereof, e.g.,
as described in U.S. Pat. Nos. 6,066,476; 6,020,192; 5,985,577;
5,976,796; 5,968,750; 5,968,738; 5,958,713; 5,919,445; 5,874,304,
the disclosures of which are herein incorporated by reference,
other fluorescent dyes, e.g., coumarin and its derivatives, e.g.
7-amino-4-methylcoumarin, aminocoumarin, bodipy dyes, such as
Bodipy FL, cascade blue, fluorescein and its derivatives, e.g.
fluorescein isothiocyanate, Oregon green, rhodamine dyes, e.g.
texas red, tetramethylrhodamine, eosins and erythrosins, cyanine
dyes, e.g. Cy3 and Cy5, macrocyclic chelates of lanthanide ions,
e.g. quantum dye, etc., chemilumescent dyes, e.g., luciferases,
including those described in U.S. Pat. Nos. 5,843,746; 5,700,673;
5,674,713; 5,618,722; 5,418,155; 5,330,906; 5,229,285; 5,221,623;
5,182,202; the disclosures of which are herein incorporated by
reference. Specific examples of where FRET assays employing the
subject fluorescent proteins may be used include, but are not
limited to: the detection of protein-protein interactions, e.g.,
mammalian two-hybrid system, transcription factor dimerization,
membrane protein multimerization, multiprotein complex formation,
etc., as a biosensor for a number of different events, where a
peptide or protein covalently links a FRET fluorescent combination
including the subject fluorescent proteins and the linking peptide
or protein is, e.g., a protease specific substrate, e.g., for
caspase mediated cleavage, a linker that undergoes conformational
change upon receiving a signal which increases or decreases FRET,
e.g., PKA regulatory domain (cAMP-sensor), phosphorylation, e.g.,
where there is a phosphorylation site in the linker or the linker
has binding specificity to phosphorylated/dephosphorylated domain
of another protein, or the linker has Ca.sup.2+ binding domain.
Representative fluorescence resonance energy transfer or FRET
applications in which the subject proteins find use include, but
are not limited to, those described in: U.S. Pat. Nos. 6,008,373;
5,998,146; 5,981,200; 5,945,526; 5,945,283; 5,911,952; 5,869,255;
5,866,336; 5,863,727; 5,728,528; 5,707,804; 5,688,648; 5,439,797;
the disclosures of which are herein incorporated by reference.
[0116] The subject fluorescent proteins also find use as biosensors
in prokaryotic and eukaryotic cells, e.g. as Ca.sup.2+ ion
indicator; as pH indicator, as phorphorylation indicator, as an
indicator of other ions, e.g., magnesium, sodium, potassium,
chloride and halides. For example, for detection of Ca ion,
proteins containing an EF-hand motif are known to translocate from
the cytosol to membranes upon Ca.sup.2+ binding. These proteins
contain a myristoyl group that is buried within the molecule by
hydrophobic interactions with other regions of the protein. Binding
of Ca.sup.2+ induces a conformational change exposing the myristoyl
group which then is available for the insertion into the lipid
bilayer (called a "Ca.sup.2+-myristoyl switch"). Fusion of such a
EF-hand containing protein to Fluorescent Proteins (FP) could make
it an indicator of intracellular Ca.sup.2+ by monitoring the
translocation from the cytosol to the plasma membrane by confocal
microscopy. EF-hand proteins suitable for use in this system
include, but are not limited to: recoverin (1-3), calcineurin B,
troponin C, visinin, neurocalcin, calmodulin, parvalbumin, and the
like. For pH, a system based on hisactophilins may be employed.
Hisactophilins are myristoylated histidine-rich proteins known to
exist in Dictyostelium. Their binding to actin and acidic lipids is
sharply pH-dependent within the range of cytoplasmic pH variations.
In living cells membrane binding seems to override the interaction
of hisactophilins with actin filaments. At pH.ltoreq.6.5 they
locate to the plasma membrane and nucleus. In contrast, at pH 7.5
they evenly distribute throughout the cytoplasmic space. This
change of distribution is reversible and is attributed to histidine
clusters exposed in loops on the surface of the molecule. The
reversion of intracellular distribution in the range of cytoplasmic
pH variations is in accord with a pK of 6.5 of histidine residues.
The cellular distribution is independent of myristoylation of the
protein. By fusing FPs (Fluoresent Proteins) to hisactophilin the
intracellular distribution of the fusion protein can be followed by
laser scanning, confocal microscopy or standard fluorescence
microscopy. Quantitative fluorescence analysis can be done by
performing line scans through cells (laser scanning confocal
microscopy) or other electronic data analysis (e.g., using
metamorph software (Universal Imaging Corp) and averaging of data
collected in a population of cells. Substantial pH-dependent
redistribution of hisactophilin-FP from the cytosol to the plasma
membrane occurs within 1-2 min and reaches a steady state level
after 5-10 min. The reverse reaction takes place on a similar time
scale. As such, hisactophilin-fluorescent protein fusion protein
that acts in an analogous fashion can be used to monitor cytosolic
pH changes in real time in live mammalian cells. Such methods have
use in high throuhgput applications, e.g., in the measurement of pH
changes as consequence of growth factor receptor activation (e.g.
epithelial or platelet-derived growth factor) chemotactic
stimulation/cell locomotion, in the detection of intracellular pH
changes as second messenger, in the monitoring of intracellular pH
in pH manipulating experiments, and the like. For detection of PKC
activity, the reporter system exploits the fact that a molecule
called MARCKS (myristoylated alanine-rich C kinase substrate) is a
PKC substrate. It is anchored to the plasma membrane via
myristoylation and a stretch of positively charged amino acids
(ED-domain) that bind to the negatively charged plasma membrane via
electrostatic interactions. Upon PKC activation the ED-domain
becomes phosphorylated by PKC, thereby becoming negatively charged,
and as a consequence of electrostatic repulsion MARCKS translocates
from the plasma membrane to the cytoplasm (called the
"myristoyl-electrostatic switch"). Fusion of the N-terminus of
MARCKS ranging from the myristoylation motif to the ED-domain of
MARCKS to fluorescent proteins of the present invention makes the
above a detector system for PKC activity. When phosphorylated by
PKC, the fusion protein translocates from the plasma membrane to
the cytosol. This translocation is followed by standard
fluorescence microscopy or confocal microscopy e.g. using the
Cellomics technology or other High Content Screening systems (e.g.
Universal Imaging Corp./Becton Dickinson). The above reporter
system has application in High Content Screening, e.g., screening
for PKC inhibitors, and as an indicator for PKC activity in many
screening scenarios for potential reagents interfering with this
signal transduction pathway. Methods of using fluorescent proteins
as biosensors also include those described in U.S. Pat. Nos.
972,638; 5,824,485 and 5,650,135 (as well as the references cited
therein) the disclosures of which are herein incorporated by
reference.
[0117] The subject fluorescent proteins also find use in
applications involving the automated screening of arrays of cells
expressing fluorescent reporting groups by using microscopic
imaging and electronic analysis. Screening can be used for drug
discovery and in the field of functional genomics: e.g., where the
subject proteins are used as markers of whole cells to detect
changes in multicellular reorganization and migration, e.g.,
formation of multicellular tubules (blood vessel formation) by
endothelial cells, migration of cells through Fluoroblok Insert
System (Becton Dickinson Co.), wound healing, neurite outgrowth,
etc.; where the proteins are used as markers fused to peptides
(e.g., targeting sequences) and proteins that allow the detection
of change of intracellular location as indicator for cellular
activity, for example: signal transduction, such as kinase and
transcription factor translocation upon stimuli, such as protein
kinase C, protein kinase A, transcription factor NFkB, and NFAT;
cell cycle proteins, such as cyclin A, cyclin B1 and cyclinE;
protease cleavage with subsequent movement of cleaved substrate,
phospholipids, with markers for intracellular structures such as
endoplasmic reticulum, Golgi apparatus, mitochondria, peroxisomes,
nucleus, nucleoli, plasma membrane, histones, endosomes, lysosomes,
microtubules, actin) as tools for High Content Screening:
co-localization of other fluorescent fusion proteins with these
localization markers as indicators of movements of intracellular
fluorescent fusion proteins/peptides or as marker alone; and the
like. Examples of applications involving the automated screening of
arrays of cells in which the subject fluorescent proteins find use
include: U.S. Pat. No. 5,989,835; as well as WO/0017624; WO
00/26408; WO 00/17643; and WO 00/03246; the disclosures of which
are herein incorporated by reference.
[0118] The subject fluorescent proteins also find use in high
through-put screening assays. The subject fluorescent proteins are
stable proteins with half-lives of more than 24 h. Also provided
are destabilized versions of the subject fluorescent proteins with
shorter half-lives that can be used as transcription reporters for
drug discovery. For example, a protein according to the subject
invention can be fused with a putative proteolytic signal sequence
derived from a protein with shorter half-life, e.g., PEST sequence
from the mouse ornithine decarboxylase gene, mouse cyclin B1
destruction box and ubiquitin, etc. For a description of
destabilized proteins and vectors that can be employed to produce
the same, see e.g., U.S. Pat. No. 6,130,313; the disclosure of
which is herein incorporated by reference. Promoters in signal
transduction pathways can be detected using destabilized versions
of the subject fluorescent proteins for drug screening, e.g., AP1,
NFAT, NFkB, Smad, STAT, p53, E2F, Rb, myc, CRE, ER, GR and TRE, and
the like.
[0119] The subject proteins can be used as second messenger
detectors, e.g., by fusing the subject proteins to specific
domains: e.g., PKCgamma Ca binding domain, PKCgamma DAG binding
domain, SH2 domain and SH3 domain, etc.
[0120] Secreted forms of the subject proteins can be prepared, e.g.
by fusing secreted leading sequences to the subject proteins to
construct secreted forms of the subject proteins, which in turn can
be used in a variety of different applications.
[0121] The subject proteins also find use in fluorescence activated
cell sorting applications. In such applications, the subject
fluorescent protein is used as a label to mark a population of
cells and the resulting labeled population of cells is then sorted
with a fluorescent activated cell sorting device, as is known in
the art. FACS methods are described in U.S. Pat. Nos. 5,968,738 and
5,804,387; the disclosures of which are herein incorporated by
reference.
[0122] The subject proteins also find use as in vivo marker in
animals (e.g., transgenic animals). For example, expression of the
subject protein can be driven by tissue specific promoters, where
such methods find use in research for gene therapy, e.g., testing
efficiency of transgenic expression, among other applications. A
representative application of fluorescent proteins in transgenic
animals that illustrates this class of applications of the subject
proteins is found in WO 00/02997, the disclosure of which is herein
incorporated by reference.
[0123] Additional applications of the subject proteins include: as
markers following injection into cells or animals and in
calibration for quantitative measurements (fluorescence and
protein); as markers or reporters in oxygen biosensor devices for
monitoring cell viability; as markers or labels for animals, pets,
toys, food, etc.; and the like.
[0124] The subject fluorescent proteins also find use in protease
cleavage assays. For example, cleavage inactivated fluorescence
assays can be developed using the subject proteins, where the
subject proteins are engineered to include a protease specific
cleavage sequence without destroying the fluorescent character of
the protein. Upon cleavage of the fluorescent protein by an
activated protease fluorescence would sharply decrease due to the
destruction of a functional chromophor. Alternatively, cleavage
activated fluorescence can be developed using the subject proteins,
where the subject proteins are engineered to contain an additional
spacer sequence in close proximity/or inside the chromophor. This
variant would be significantly decreased in its fluorescent
activity, because parts of the functional chromophor would be
divided by the spacer. The spacer would be framed by two identical
protease specific cleavage sites. Upon cleavage via the activated
protease the spacer would be cut out and the two residual
"subunits" of the fluorescent protein would be able to reassemble
to generate a functional fluorescent protein. Both of the above
types of application could be developed in assays for a variety of
different types of proteases, e.g., caspases, etc.
[0125] The subject proteins can also be used is assays to determine
the phospholipid composition in biological membranes. For example,
fusion proteins of the subject proteins (or any other kind of
covalent or non-covalent modification of the subject proteins) that
allows binding to specific phospholipids to localize/visualize
patterns of phospholipid distribution in biological membranes also
allowing colocalization of membrane proteins in specific
phospholipid rafts can be accomplished with the subject proteins.
For example, the PH domain of GRP1 has a high affinity to
phosphatidyl-inositol tri-phosphate (PIP3) but not to PIP2. As
such, a fusion protein between the PH domain of GRP1 and the
subject proteins can be constructed to specifically label PIP3 rich
areas in biological membranes.
[0126] Yet another application of the subject proteins is as a
fluorescent timer, in which the switch of one fluorescent color to
another (e.g. green to red) concomitant with the ageing of the
fluorescent protein is used to determine the
activation/deactivation of gene expression, e.g., developmental
gene expression, cell cycle dependent gene expression, circadian
rhythm specific gene expression, and the like
[0127] The antibodies of the subject invention, described above,
also find use in a number of applications, including the
differentiation of the subject proteins from other fluorescent
proteins.
[0128] Kits
[0129] Also provided by the subject invention are kits for use in
practicing one or more of the above described applications, where
the subject kits typically include elements for making the subject
proteins, e.g., a construct comprising a vector that includes a
coding region for the subject protein. The subject kit components
are typically present in a suitable storage medium, e.g., buffered
solution, typically in a suitable container. Also present in the
subject kits may be antibodies to the provided protein. In certain
embodiments, the kit comprises a plurality of different vectors
each encoding the subject protein, where the vectors are designed
for expression in different environments and/or under different
conditions, e.g., constitutive expression where the vector includes
a strong promoter for expression in mammalian cells, a promoterless
vector with a multiple cloning site for custom insertion of a
promoter and tailored expression, etc.
[0130] In addition to the above components, the subject kits will
further include instructions for practicing the subject methods.
These instructions may be present in the subject kits in a variety
of forms, one or more of which may be present in the kit. One form
in which these instructions may be present is as printed
information on a suitable medium or substrate, e.g., a piece or
pieces of paper on which the information is printed, in the
packaging of the kit, in a package insert, etc. Yet another means
would be a computer readable medium, e.g., diskette, CD, etc., on
which the information has been recorded. Yet another means that may
be present is a website address which may be used via the internet
to access the information at a removed site. Any convenient means
may be present in the kits.
[0131] The following examples are offered by way of illustration
and not by way of limitation.
EXPERIMENTAL
I. Introduction
[0132] The red fluorescent protein DsRed has spectral properties
that are ideal for dual-color experiments with green fluorescent
protein (GFP). But wild-type DsRed has several drawbacks, including
slow chromophore maturation and poor solubility. To overcome the
slow maturation, we used random and directed mutagenesis to create
DsRed variants that mature 10-15 times faster than the wild-type
protein. An asparagine-to-glutamine substitution at position 42
greatly accelerates the maturation of DsRed, but also increases the
level of green emission. Additional amino acid substitutions
suppress this green emission while further accelerating the
maturation. To enhance the solubility of DsRed, the net charge near
the N terminus of the protein was reduced. The resultant DsRed
variants yield bright fluorescence even in rapidly growing
organisms such as yeast.
II. Experimental Protocol
A. Mutagenesis and Screening.
[0133] For mutagenesis, a wild-type or mutant DsRed gene present in
the pDsRed1-N1 vector (Clontech, Palo Alto, Calif.) was excised
with NheI and HpaI and used as a template for error-prone PCR
(Cadwell, R. C. & Joyce, G. F. In PCR Primer. A laboratory
manual. (eds Dieffenbach, C. W. & Dveksler, G. S.) 583-589
(Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.;
1995)). The amplified product was digested with BamHI and BsaBI,
gel purified, and ligated between the BamHI and EcI13611 sites of
the pQE31 expression vector (Qiagen, Valencia, Calif.), which
encodes an N-terminal hexahistidine tag. The library of mutated
DsRed genes was transformed into E. coli strain DH10B. For rounds
1-3 of the mutagenesis, 50,000-100,000 colonies were screened for
bright fluorescence using the slide projector assay described in
the text. For round 4, 4,000 brightly fluorescent colonies were
picked into wells of 96-well plates, then grown to saturation,
lysed with B-PER II reagent (Pierce, Rockford, Ill.), and
centrifuged for 5 min at 2,500 g. The supernatants were transferred
to a second set of 96-well plates, and the fluorescence signals
from the pellets and supernatants were compared visually using the
slide projector assay. Clones that showed an elevated ratio of
soluble to insoluble fluorescence were analyzed further. For round
5, 10 pools of 10,000 mutant clones each were recovered from the
transformation plates and subjected to cell sorting using a Becton
Dickinson FACStarPlus flow cytometer. Fluorescence signals were
measured simultaneously in the green (FL-1) and red (FL-2)
channels, and cells were collected if they showed strong red
fluorescence but reduced green fluorescence.
B. Purification and Spectral Analysis of the DsRed Variants
[0134] To purify the hexa-histidine-tagged proteins, a fluorescent
protein gene in the pQE31 vector was transformed into E. coli cells
carrying the pREP4 repressor plasmid (Qiagen). A 250 ml culture was
grown to an OD600 of 0.5 and then induced with 1 mM
isopropyl-.beta.-D-thiogalactoside (IPTG) for 6-8 h at 37.degree.
C. The cells were lysed with 10 ml of B-PER II and centrifuged for
20 min at 27,000 g. Detergent was removed from the supernatant by
adding NaCl to 300 mM and centrifuging for 10 min at 2,500 g. After
adding 1 ml of Ni.sup.2+-NTA-agarose beads (Qiagen), the tube was
mixed end-over-end for 1 h. The beads were washed three times with
10 ml of 300 mM NaCl, 20 mM imidazole-HCl, pH 7.4, 0.5% Triton
X-100, and then three times with the same buffer lacking Triton
X-100. The fluorescent protein was eluted with 2.5 ml of 300 mM
imidazole-HCl, pH 7.4, and dialyzed into 50 mM Na.sup.+-HEPES, pH
7.5, 100 mM NaCl, 1 mM EDTA.
[0135] Corrected excitation and emission spectra of purified DsRed
variants, diluted to an A558 of <0.04 in Na.sup.+-HEPES, pH 7.5,
100 mM NaCl, 1 mM EDTA, were acquired with a Horiba FluoroMax-3
spectrofluorometer. The scanning windows were 1 nM. Emission was
measured at 600 nm for the excitation spectra, and excitation was
at 470 nm for the emission spectra. To determine extinction
coefficients, the fluorescent protein concentrations were assayed
using the BCA method (Pierce), and the absorbances of the proteins
at their excitation maxima were measured using a Spectronic Unicam
GENESYS 10 UV spectrophotometer. Quantum yields were determined as
described (Baird, et al., Proc. Natl. Acad. Sci. USA 97,
11984-11989 (2000); Lakowicz, J. R. Principles of fluorescence
spectroscopy, Edn. 2. (Kluwer Academic/Plenum Publishers, New York,
N.Y.; 1999)) using ethanolic rhodamine 101 as a reference; for
these measurements the excitation wavelength was 535 nm and the
fluorescence emission as integrated from 550-800 nm.
C. Measurement of Maturation Kinetics
[0136] Genes encoding the DsRed variants were cloned into the pQE81
expression vector (Qiagen) and transformed into E. coli. Bacterial
cultures growing with aeration at 37.degree. C. were induced with 1
mM IPTG for 30 min to generate a pulse of expression for each DsRed
variant. A chase was then initiated by inhibiting protein synthesis
with a mixture of 170 .mu.g/ml chloramphenicol, 30 .mu.g/ml
kanamycin, and 50 .mu.g/ml tetracycline. At the designated time
points, aliquots of the cultures were removed, adjusted to 15%
glycerol, and frozen at -80.degree. C. These aliquots were later
thawed rapidly and evaluated using a Becton Dickinson FACScan flow
cytometer to determine the average intensity of red fluorescence
(channel FL-2) per cell. A portion of each aliquot was precipitated
with trichloroacetic acid, then subjected to SDS--PAGE and
immunoblotting with an anti-hexahistidine monoclonal antibody
(Qiagen) to measure the total amount of DsRed polypeptide in the
cultures. Fluorescence microscopy of yeast. A CEN plasmid derived
from pRS315 (Sikorski, Genetics 122, 19-27 (1989)) and carrying a
pCox4-DsRed1 fusion gene under the control of the ADH1 promoter was
used. Derivatives of this plasmid were created by replacing the
DsRed1 coding sequence with the coding sequence of DsRed.T3 or
DsRed.T4. These plasmids were introduced into S. cerevisiae strain
BGY101, which carries a chromosomal SEC7-EGFPx3 gene 20. Cells from
the resulting yeast strains were grown in minimal glucose medium
and fixed, and projected fluorescence images were acquired as
described Rossanese et al., J. Cell Biol. 145, 69-81 (1999).
III. Results and Discussion
[0137] A family of fluorescent proteins has recently been
described. The most useful of these newly discovered proteins is
DsRed, which is derived from the coral Discosoma. DsRed has an
orange-red fluorescence with an emission maximum at 583 nm.
Biophysical and X-ray crystallographic studies revealed that DsRed
forms a stable tetramer, and that each monomer is structurally very
similar to GFP. The red-shifted fluorescence of DsRed relative to
GFP results from a chromophore with a more extensive conjugated
.pi.-system. DsRed fluorescence is excited optimally at 558 nm, but
can also be excited by a standard 488 nm laser, allowing DsRed to
be used with laser-based confocal micro-scopes and flow cytometers.
DsRed has a high quantum yield and is photostable. These
characteristics make DsRed an ideal candidate for fluorescence
imaging, particularly for multicolor experiments involving GFP and
its variants. A codon-optimized version of DsRed is now available
under the name DsRed1.
[0138] Despite these advantages, wild-type DsRed has several
problems for use as a fluorescent reporter. When DsRed is fused to
another protein, tetramerization of the DsRed domain can perturb
the function and localization of the protein. The DsRed tetramer
also self-associates to form higher-order aggregates. Perhaps the
most serious problem with DsRed is that chromophore maturation is
slow, with a half-time of >24 h at room temperature. Newly
synthesized DsRed develops a dim green fluorescence by forming the
same chromophore that is present in GFP. A second oxidation
reaction then generates the red chromophore. This slow maturation
has been put to use with a DsRed variant termed the "fluorescent
timer", in which the fluorescence of the initial green species is
enhanced. However, for most applications the slow maturation of
DsRed is not desirable. In dual-label imaging with GFP, the initial
green fluorescence of DsRed produces bleed-through into the GFP
channel. More generally, the slow development of red fluorescence
limits the intensity of the DsRed signal, particularly with rapidly
growing organisms such as yeast. A variant termed DsRed2 matures
faster than DsRed1, but DsRed2 still requires many hours to attain
full fluorescence. Here random and directed mutagenesis was used to
create improved variants of DsRed. These new variants mature
rapidly, and they are more soluble than wild-type DsRed.
[0139] To identify rapidly maturing DsRed variants, an earlier
method for visualizing GFP fluorescence in microbial colonies was
modified. Hexahistidine-tagged DsRed is produced at high levels in
Escherichia coli. The fluorescence of the bacterial colonies is
excited by placing a 520.+-.20 nm bandpass filter over the lens of
a slide projector, and the emission is detected through goggles
covered with a Kodak Wratten filter no. 22, which passes
wavelengths >550 nm. This technique is simple and efficient.
[0140] A library of mutant expression plasmids was generated using
error-prone PCR to amplify the DsRed1 template. This library was
transformed into E. coli, and over 100,000 transformant colonies
were examined. Colonies producing the wild-type DsRed1 protein
required two days to develop significant fluorescence, but three
mutant colonies showed strong fluorescence after one day of growth.
Sequencing revealed that the three mutant plasmids were distinct,
but that all of them contained an N42H codon change. We therefore
generated a variant that had only the N42H substitution.
[0141] The N42H variant was purified in parallel with DsRed1, and
the two proteins were analyzed by spectrofluorometry. As previously
observed, the spectra of purified DsRed1 changed over a period of
days as the protein matured (data not shown). By contrast, the
spectra of the purified N42H variant remained stable over time
(data not shown), consistent with rapid maturation. Unfortunately,
in addition to accelerating maturation, the N42H substitution
altered the spectral properties of the mature protein (FIG. 1A).
Mature DsRed1 is thought to be an equilibrium mixture of red
fluorescent molecules and some green fluorescent molecules that are
spectrally similar to GFP. The GFP-like species has a blue
excitation peak at approximately 480 nm and a green emission peak
at approximately 500 nm; but DsRed is a tetramer, so excitation of
the green molecules often results in fluorescence resonance energy
transfer (FRET) with neighboring red molecules to produce red
emission. This FRET effect, together with the relatively low
percentage of green molecules in mature DsRed1, yields a very small
peak of green emission relative to the red emission (FIG. 1A). In
the N42H variant, the peaks of blue excitation and green emission
were dramatically enhanced (FIG. 1A), indicating that the
equilibrium had shifted so that a larger percentage of the mature
molecules contained the green chromophore.
[0142] Because the N42H substitution considerably increases the
size of the side chain, a more conservative N42Q substitution was
also tried. This mutation required two base changes and probably
would not have been present in the original mutant collection. The
N42Q variant retained the rapid maturation property of the N42H
variant, but showed much less blue excitation and green emission
(FIG. 1A). The N42Q variant was therefore chosen as the starting
point for further study.
[0143] Additional mutagenesis (see below) yielded DsRed variants
that showed even faster maturation and lower green emission than
the original N42Q variant. After six rounds of mutagenesis, three
optimized variants were selected and termed DsRed.T1, DsRed.T3, and
DsRed.T4 (Table 1). The spectral properties of DsRed.T4 (FIG. 1B)
are virtually identical to those of DsRed.T1 (data not shown) and
very similar to those of the wild-type DsRed1 (FIG. 1A). Compared
with DsRed.T1 and DsRed.T4, DsRed.T3 is somewhat brighter (see
below) but has a significantly higher peak of blue excitation and a
marginally higher peak of green emission (FIG. 1B).
[0144] The optimized DsRed variants were examined both in vivo and
in vitro. As judged by colony fluorescence, colony size, and
plasmid stability, these variants were less toxic to E. coli than
DsRed1, and they developed fluorescence more efficiently at growth
temperatures of 37.degree. C. and higher (data not shown). Like
wild-type DsRed, the optimized variants appeared to be tetrameric:
they exhibited FRET between the green and red molecules (FIG. 1B),
and upon nondenaturing SDS-PAGE they migrated at the position
expected for tetramers (see below). With purified DsRed1, we
measured an extinction coefficient of 52,000 M-1 cm-1 and a quantum
yield of approximately 0.7 (Table 1).
TABLE-US-00004 TABLE 1 Properties of the mature DsRed
variants.sup.a Excita- Emis- Matu- tion sion Maximal Rela- ration
maxi- maxi- extinction Quan- tive half- DsRed mum mum coefficient
tum bright- time variant (nm) (nm) (M.sup.-1 cm.sup.-1) yield
ness.sup.b (h).sup.c DsRed 558 583 52,000 0.68 (1.00) 11 1 DsRed
561 587 43,800 0.55 0.68 6.5 2 DsRed. 554 586 30,100 0.42 0.36 0.70
T1 DsRed. 560 587 49,500 0.59 0.83 1.3 T3 DsRed. 555 586 30,300
0.44 0.38 0.71 T4 .sup.a"Relative to wild-type DsRed, the other
variants contain the following substitutions, where P(-4)L
indicates a codon change in the polylinker upstream of the start
codon." DsRed2: R2A, K5E, K9T, V105A, I161T, S197A. DsRed. T1:
P(-4)L, R2A, K5E, N6D, T21S, H41T, N42Q, V44A, C117S, T217A. DsRed.
T3: P(-4)L, R2A, K5E, N6D, T21S, H41T, N42Q, V44A, A145P. DsRed.
T4: P(-4)L, R2A, K5E, N6D, T21S, H41T, N42Q, V44A, A145P, T217A.
.sup.bBrightness is determined by the product of the extinction
coefficient and the quantum yield. Relative brightness is
calculated by defining the brightness of DsRed1 as 1.00. .sup.cThe
half-times for maturation were estimated graphically using the
experimental protocol of FIG. 2. Values listed are the averages
from two separate experiments; for each DsRed variant, the numbers
obtained in the two experiments were within 15% of one another.
[0145] A previous study of wild-type DsRed reported a similar
quantum yield but a higher extinction coefficient of 75,000
M.sup.-1 cm.sup.-1; the reason for this discrepancy is unclear.
DsRed2 shows slight reductions in both extinction coefficient and
quantum yield, resulting in a relative brightness of 0.68 compared
to DsRed1 (Table 1). DsRed.T3 is nearly as bright as DsRed1.
However, DsRed.T1 and DsRed.T4 are dimmer, with relative
brightnesses of 0.36-0.38 compared to DsRed1. To quantify the
maturation kinetics of the DsRed variants, an in vivo pulse-chase
analysis with E. coli cultures growing at 37.degree. C. (FIG. 2)
was performed. After a 30 min pulse of induction, protein synthesis
inhibitors were added, and samples of the cultures were taken at
various chase times. The average cellular fluorescence for each
sample was measured by flow cytometry using a 488 nm excitation
laser.
[0146] FIG. 2A shows the raw data, while FIG. 2B shows the data
normalized to a maximal fluorescence of 100%. Under these
conditions, DsRed1 matures with a half-time of approximately 11 h,
although accurate measurements are difficult with DsRed1 because
the fluorescence values do not reach a plateau (FIG. 2) and because
some of the DsRed1 protein is degraded during the chase period
(data not shown). DsRed2 matures somewhat faster, with a half-time
of approximately 6.5 h. The rates of fluorescence acquisition for
DsRed1 and DsRed2 increase after a pro-nounced lag phase,
indicating that multiple slow steps are involved. DsRed.T3 matures
with a brief lag phase and half-time of approximately 1.3 h.
[0147] DsRed.T4 and DsRed.T1 mature with no detectable lag phase
and with half-times of 0.7 h, about 15-fold faster than DsRed1
(FIG. 2, and data not shown). With this pulse-chase protocol, the
different DsRed variants reproducibly showed distinct plateau
values of average cellular fluorescence (FIG. 2A). The highsignal
from DsRed.T3 can be explained by the relatively strong excitation
of this protein at 488 nm (see FIG. 1B). DsRed1, DsRed2, and
DsRed.T4 all have similar fluorescence spectra, yet the plateau
fluorescence of DsRed.T4-expressing cells is 4-fold higher than
that of DsRed1-expressing cells and 10-fold higher than that of
DsRed2-expressing cells. This result is surprising because purified
dsRed.T4 is less bright than DsRed1 or DsRed2 (Table 1). We
speculate that immature DsRed1 is unstable in E. coli, and that
this problem is exacerbated with DsRed2, so that a large fraction
of the newly synthesized DsRed1 and DsRed2 molecules are lost
through aggregation and/or degradation. Consistent with this idea,
a previous study reported that most of the newly synthesized DsRed1
molecules are degraded in E. coli or Drosophila cells.
Interestingly, DsRed2 gives a brighter fluorescence signal than
DsRed1 in mammalian cells suggesting that the efficiency of
expression for a given DsRed variant may be cell type specific.
[0148] The benefits of accelerated maturation should be
particularly evident when the DsRed variants are produced in a
rapidly growing organism. To test this prediction, we targeted
different DsRed variants to yeast mitochondria. The parental yeast
strain also contained an EGFP-tagged marker for Golgi cisternae.
With mitochondrially targeted DsRed1, the fluorescence was
extremely faint in cells from growing cultures, and only became
readily visible in a subset of the cells once the cultures reached
stationary phase (data not shown). By contrast, mitochondrially
targeted DsRed.T4 consistently gave a strong fluorescence signal in
cells from growing cultures (FIG. 3). As shown in the merged image,
we observed no detectable bleed-through of DsRed.T4 fluorescence
into the green channel or of EGFP fluorescence into the red
channel. Similar results were obtained with mitochondrially
targeted DsRed.T3 (data not shown). However, with other fusion
constructs we found that when a large amount of DsRed.T3 was
concentrated in a small region of the cell, some bleed-through
occurred into the green channel (not shown). Therefore, DsRed.T4 is
the protein of choice for obtaining a clean separation of red and
green fluorescence signals.
[0149] These results confirm that random mutagenesis followed by
screening is a powerful method for creating improved fluorescent
proteins. Our key finding is that Asn42 substitutions such as N42Q
dramatically accelerate chromophore formation.
[0150] A side effect of Asn42 substitutions is a pronounced
increase in blue excitation and green emission (FIG. 1A). Mature
wild-type DsRed appears to be an equilibrium mixture of a red
species and a green species, and the Asn42 substitutions evidently
shift the equilibrium to yield a higher percentage of the green
species. By introducing a series of additional substitutions into
the N42Q background, we could suppress nearly all of the blue
excitation and green emission that were conferred by N42Q while
preserving the rapid maturation (FIG. 1 and Table 1).
[0151] Another improvement over wild-type DsRed was achieved by
decreasing the net charge near the N terminus. The resulting DsRed
variants show reduced aggregation in vitro (see below) and in vivo.
Wild-type DsRed is unusually basic, with a predicted pI of 8.0, and
probably associates nonspecifically with anionic cellular
components. In addition, basic patches on the surface of a DsRed
tetramer may interact with acidic patches on a second tetramer to
cause higher-order aggregation. This interaction of DsRed with
other macromolecules is evidently reduced by eliminating the
cluster of positive charges near the N terminus.
[0152] The end result of our work is a pair of optimized variants
termed DsRed.T3 and DsRed.T4. DsRed.T3 matures rapidly, and the
purified protein is nearly as bright as mature wild-type DsRed
(Table 1), making this variant well suited to single-color imaging
of red fluo-rescence. DsRed.T3 has a higher peak of blue excitation
and a slightly higher peak of green emission than wild-type DsRed
(FIG. 1B), resulting in some contamination of the GFP signal in
dual-color experiments. However, this contamination is usually
minor. The enhanced blue excitation of DsRed.T3 can actually be
advantageous, for example, if the fluorescence is being excited by
a 488 nm laser (FIG. 2). DsRed.T4 has fluorescence spectra very
similar to those of wild-type DsRed (FIG. 1B) and yields negligible
contamination of the GFP signal (FIG. 3). Although purified
DsRed.T4 is only about half as bright as DsRed.T3, this effect is
partially offset in vivo because DsRed.T4 matures nearly twice as
fast as DsRed.T3 (Table 1). Thus, DsRed.T4 is probably the best
variant for most applications. DsRed.T1 is essentially identical to
DsRed.T4 (Table 1), except that DsRed.T1 lacks cysteine residues
and therefore might fold more efficiently in the oxidizing
environment of the secretory pathway.
[0153] DsRed.T4 is a suitable template for further mutagenesis to
produce additional variants.
[0154] The generation of new DsRed variants is likely to involve
both random and directed mutagenesis. For directed mutagenesis
studies, it is worth noting that five of the substitutions present
in DsRed.T4 (R2A, H41T, N42Q, A145P, and T217A) replace a given
residue with a residue that is more generally conserved in the
family of DsRed homologs. Thus, sequence comparisons between DsRed
and its relatives can suggest mutations that are likely to produce
useful variants.
IV. Rapidly Maturing Variants of the Discosoma Red Fluorescent
Protein (DsRed)
[0155] This section describes the multi-step mutagenesis strategy
that was used to obtain the optimized DsRed variants. An overview
is provided in Supplementary Table 2.
[0156] One of the original N42H-containing mutants produced
brighter colony fluorescence than the other two. This increased
brightness was due to a second mutation: H41L. Residue 41 is a
threonine in several homologues of DsRed, and we found that an H41T
substitution gives slightly brighter colonies than H41L. In the
context of N42Q, H41T causes no significant change in the
properties of the purified protein (not shown) but appears to yield
a further increase in the maturation rate. Thus, after Round 1 of
the mutagenesis we had incorporated the two substitutions H41T and
N42Q (Supplementary Table 1). The Round 1 variant generates a
diffuse high-molecular weight band when analyzed by nondenaturing
SDS-PAGE (Supplementary FIG. 4A), suggesting that it is still
tetrameric.
[0157] Additional rounds of mutagenesis were under-taken to
accelerate the maturation further. Using the Round 1 variant as a
template, we obtained three mutants that produced brighter E. coli
colonies after one day of growth. All three mutants contained the
V44A substitution. In addition to accelerating chromophore
formation, V44A reduces the blue excitation and green emission
relative to the Round 1 variant (not shown). One of the three V44A
mutants also contained a T21S substitution, which further
diminishes the blue excitation and green emission (not shown).
Thus, the Round 2 variant contained the four substitutions T21S,
H41T, N42Q and V44A (Supplementary Table 2). Round 3 of the
muta-genesis produced several mutants with a further increase in
colony fluorescence. Surprisingly, the relevant mutation did not
alter the DsRed protein itself, but instead was a
proline-to-leucine codon change at position -4 in the linker
between the hexahistidine tag and the initiator methionine. This
result indicates that sequences appended to the N terminus of DsRed
can affect protein folding and/or chromophore maturation. The
P(-4)L substitution was incorporated to yield the Round 3 variant
(Supplementary Table 2).
[0158] When purifying the fluorescent proteins, we noticed that
DsRed and its variants were inefficiently extracted from E. coli
cells under lysis conditions that extract most of the EGFP. This
observation fits with reports that DsRed aggregates within cells.
Round 4 of the mutagenesis was designed to reduce this aggregation.
We devised an assay in which mutant bacterial clones were grown in
96-well plates, lysed with a detergent buffer, and spun to separate
the extracted proteins from the bacterial pellets. The mutants of
interest showed an increased ratio of soluble to insoluble red
fluorescence. Of the more than 25 such mutant proteins identified,
nearly all had a reduction in the net charge near the N terminus.
After testing a number of mutant combinations, we incorporated the
trio of substitutions R2A, K5E and N6D to yield the Round 4 variant
(Supplementary Table 2).
[0159] To compare the solubilities of the different DsRed variants,
we expressed each protein in E. coli, lysed the cells in detergent
buffer, and quantified the percentage of the protein molecules that
were extracted (Supplementary FIG. 4B). Virtually 100% of the EGFP
molecules are solubilized under these conditions. Only .about.25%
of the DsRed1 molecules are solubilized. DsRed2 is substantially
more soluble (.about.55%) than DsRed1. The Round 3 variant is also
more soluble (.about.52%) than DsRed1, but the Round 4 variant
shows even higher to solubility (.about.73%). When analyzed by
nondenaturing SDS-PAGE, the Round 3 variant generates a diffuse
band that may reflect the formation of higher-order oligomers
whereas the Round 4 variant generates a sharp band at the position
predicted for a tetramer (Supplementary FIG. 4A). These results
suggest that reducing the net charge near the N terminus of DsRed
suppresses aggregation of the tetramers.
TABLE-US-00005 SUPPLEMENTARY TABLE 2 Relevant mutations in DsRed
Mutations Final Round of obtained mutations mutagenesis Goal of
mutagenesis or examined incorporated 1 Accelerating maturation
N42H, N42Q N42Q H41L, H41T H41T 2 Accelerating maturation, V44A
V44A reducing green emission T21S T21S 3 Accelerating maturation
P(-4)L P(-4)L.sup.a 4 Enhancing solubility R2H, R2L, R2A R2A.sup.b
K5E, K5Q, K5M K5E N6D N6D 5 Reducing green emission T217A
T217A.sup.c 6 Reducing green emission C117S, C117A C117S.sup.d
A145P, A145S A145P.sup.d .sup.aThe proline codon at position -4
relative to the start codon was contributed by the multiple cloning
site in the pDsRed1-N1 vector. .sup.bThe R2A substitution also
eliminates the extra valine codon that is present after the start
codon in DsRed1. .sup.cT217A is present in DsRed.T1 and DsRed.T4,
but not in DsRed.T3. .sup.dDsRed.T1 contains C117S but not A145P,
whereas DsRed.T3 and DsRed.T4 contain A145P but not C117S.
[0160] The Round 4 variant still gives a noticeable bleed-through
fluorescence with GFP filter sets (not shown). Therefore, we
undertook Round 5 of the mutagenesis to reduce the green emission
further. Flow cytometry was used to select E. coli cells that
showed bright fluorescence with an increased ratio of red to green
emission. All seven of the resulting mutants contained a T217A
substitution. In addition to reducing the blue excitation and green
emission, T217A reverses the slight spectral red-shift observed
with N42Q (see FIG. 4A in the main text). T217A was incorporated to
yield the Round 5 variant (Supplementary Table 2).
[0161] Finally, we took advantage of fortuitous observations from
unrelated mutagenesis experiments. The C117S substitution further
reduces the blue excitation and green emission. Thus, the optimized
variant designated DsRed.T1 contains the following substitutions:
P(-4)L, R2A, K5E, N6D, T21S, H41T, N42Q, V44A, C117S and T217A. The
A145P substitution is similar to C117S in its effect on the
fluorescence spectra, but in some DsRed mutant backgrounds, colony
fluorescence is slightly decreased by C117S and slightly increased
by A145P (not shown). Therefore, we created a second optimized
variant called DsRed.T4, which is identical to DsRed.T1 except that
the C117S substitution has been replaced with A145P. Subsequent
analysis revealed that the advantages conferred by T217A are
accom-panied by a modest decrease in brightness, so we created a
third optimized mutant called DsRed.T3, which is identical to
DsRed.T4 except that DsRed.T3 lacks the T217A substitution.
[0162] The blue excitation and green emission are reduced by the
T21S, V44A, C117S, A145P and T217A substitutions. Val44 and Thr217
face the interior of the DsRed protein and are close to residue 42,
indicating that the V44A and T217A substitutions relieve the steric
constraints caused by N42Q. By contrast, Thr21, Cys117 and Ala145
face the surface of the DsRed monomer, so T21S, C117S and A145P are
indicated as altering the overall packing of the protein. T21S and
A145P may influence DsRed structure by modifying the tetramer
interfaces.
[0163] It is evident from the above results and discussion that the
present invention provides an important new class of fluorescent
proteins that rapidly mature. As such, the subject invention
represents a significant contribution to the art.
[0164] All publications and patent applications cited in this
specification are herein incorporated by reference as if each
individual publication or patent application were specifically and
individually indicated to be incorporated by reference. The
citation of any publication is for its disclosure prior to the
filing date and should not be construed as an admission that the
present invention is not entitled to antedate such publication by
virtue of prior invention.
[0165] Although the foregoing invention has been described in some
detail by way of illustration and example for purposes of clarity
of understanding, it is readily apparent to those of ordinary skill
in the art in light of the teachings of this invention that certain
changes and modifications may be made thereto without departing
from the spirit or scope of the appended claims.
Sequence CWU 1
1
31678DNADiscosoma 1atgaggtctt ccaagaatgt tatcaaggag ttcatgaggt
ttaaggttcg catggaagga 60acggtcaatg ggcacgagtt tgaaatagaa ggcgaaggag
aggggaggcc atacgaaggc 120cacaataccg taaagcttaa ggtaaccaag
gggggacctt tgccatttgc ttgggatatt 180ttgtcaccac aatttcagta
tggaagcaag gtatatgtca agcaccctgc cgacatacca 240gactataaaa
agctgtcatt tcctgaagga tttaaatggg aaagggtcat gaactttgaa
300gacggtggcg tcgttactgt aacccaggat tccagtttgc aggatggctg
tttcatctac 360aaggtcaagt tcattggcgt gaactttcct tccgatggac
ctgttatgca aaagaagaca 420atgggctggg aagccagcac tgagcgtttg
tatcctcgtg atggcgtgtt gaaaggagag 480attcataagg ctctgaagct
gaaagacggt ggtcattacc tagttgaatt caaaagtatt 540tacatggcaa
agaagcctgt gcagctacca gggtactact atgttgactc caaactggat
600ataacaagcc acaacgaaga ctatacaatc gttgagcagt atgaaagaac
cgagggacgc 660caccatctgt tcctttaa 6782225PRTDiscosoma 2Met Arg Ser
Ser Lys Asn Val Ile Lys Glu Phe Met Arg Phe Lys Val1 5 10 15Arg Met
Glu Gly Thr Val Asn Gly His Glu Phe Glu Ile Glu Gly Glu 20 25 30Gly
Glu Gly Arg Pro Tyr Glu Gly His Asn Thr Val Lys Leu Lys Val 35 40
45Thr Lys Gly Gly Pro Leu Pro Phe Ala Trp Asp Ile Leu Ser Pro Gln
50 55 60Phe Gln Tyr Gly Ser Lys Val Tyr Val Lys His Pro Ala Asp Ile
Pro65 70 75 80Asp Tyr Lys Lys Leu Ser Phe Pro Glu Gly Phe Lys Trp
Glu Arg Val 85 90 95Met Asn Phe Glu Asp Gly Gly Val Val Thr Val Thr
Gln Asp Ser Ser 100 105 110Leu Gln Asp Gly Cys Phe Ile Tyr Lys Val
Lys Phe Ile Gly Val Asn 115 120 125Phe Pro Ser Asp Gly Pro Val Met
Gln Lys Lys Thr Met Gly Trp Glu 130 135 140Ala Ser Thr Glu Arg Leu
Tyr Pro Arg Asp Gly Val Leu Lys Gly Glu145 150 155 160Ile His Lys
Ala Leu Lys Leu Lys Asp Gly Gly His Tyr Leu Val Glu 165 170 175Phe
Lys Ser Ile Tyr Met Ala Lys Lys Pro Val Gln Leu Pro Gly Tyr 180 185
190Tyr Tyr Val Asp Ser Lys Leu Asp Ile Thr Ser His Asn Glu Asp Tyr
195 200 205Thr Ile Val Glu Gln Tyr Glu Arg Thr Glu Gly Arg His His
Leu Phe 210 215 220Leu2253704DNADiscosoma 3ggatccacta gtcgccacca
tggcctcctc cgaggacgtc atcaaggagt tcatgcgctt 60caaggtgcgc atggagggct
ccgtgaacgg ccacgagttc gagatcgagg gcgagggcga 120gggccgcccc
tacgagggca cccagaccgc caagctgaag gtgaccaagg gcggccccct
180gcccttcgcc tgggacatcc tgtcccccca gttccagtac ggctccaagg
tgtacgtgaa 240gcaccccgcc gacatccccg actacaagaa gctgtccttc
cccgagggct tcaagtggga 300gcgcgtgatg aacttcgagg acggcggcgt
ggtgaccgtg acccaggact cctccctgca 360ggacggctcc ttcatctaca
aggtgaagtt catcggcgtg aacttcccct ccgacggccc 420cgtaatgcag
aagaagacta tgggctggga ggcctccacc gagcgcctgt acccccgcga
480cggcgtgctg aagggcgaga tccacaaggc cctgaagctg aaggacggcg
gccactacct 540ggtggagttc aagtccatct acatggccaa gaagcccgtg
cagctgcccg gctactacta 600cgtggactcc aagctggaca tcacctccca
caacgaggac tacaccatcg tggagcagta 660cgagcgcgcc gagggccgcc
accacctgtt cctgtagcgg ccgc 704
* * * * *