U.S. patent application number 14/171235 was filed with the patent office on 2014-07-24 for modified polynucleotides for treating arylsulfatase a protein deficiency.
This patent application is currently assigned to MODERNA THERAPEUTICS, INC.. The applicant listed for this patent is MODERNA THERAPEUTICS, INC.. Invention is credited to Stephane Bancel, Tirtha Chakraborty, Antonin de Fougerolles, Susan Whoriskey.
Application Number | 20140206755 14/171235 |
Document ID | / |
Family ID | 49235350 |
Filed Date | 2014-07-24 |
United States Patent
Application |
20140206755 |
Kind Code |
A1 |
Bancel; Stephane ; et
al. |
July 24, 2014 |
MODIFIED POLYNUCLEOTIDES FOR TREATING ARYLSULFATASE A PROTEIN
DEFICIENCY
Abstract
The invention relates to compositions and methods for the
preparation, manufacture and therapeutic use of polynucleotides,
primary transcripts and mmRNA molecules.
Inventors: |
Bancel; Stephane;
(Cambridge, MA) ; Chakraborty; Tirtha; (Medford,
MA) ; de Fougerolles; Antonin; (Waterloo, BE)
; Whoriskey; Susan; (Belmont, MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
MODERNA THERAPEUTICS, INC. |
CAMBRIDGE |
MA |
US |
|
|
Assignee: |
MODERNA THERAPEUTICS, INC.
CAMBRIDGE
MA
|
Family ID: |
49235350 |
Appl. No.: |
14/171235 |
Filed: |
February 3, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13791910 |
Mar 9, 2013 |
|
|
|
14171235 |
|
|
|
|
61618862 |
Apr 2, 2012 |
|
|
|
61681645 |
Aug 10, 2012 |
|
|
|
61737130 |
Dec 14, 2012 |
|
|
|
61618866 |
Apr 2, 2012 |
|
|
|
61681647 |
Aug 10, 2012 |
|
|
|
61737134 |
Dec 14, 2012 |
|
|
|
61618868 |
Apr 2, 2012 |
|
|
|
61681648 |
Aug 10, 2012 |
|
|
|
61737135 |
Dec 14, 2012 |
|
|
|
61618870 |
Apr 2, 2012 |
|
|
|
61681649 |
Aug 10, 2012 |
|
|
|
61737139 |
Dec 14, 2012 |
|
|
|
61618873 |
Apr 2, 2012 |
|
|
|
61681650 |
Aug 10, 2012 |
|
|
|
61737147 |
Dec 14, 2012 |
|
|
|
61618878 |
Apr 2, 2012 |
|
|
|
61681654 |
Aug 10, 2012 |
|
|
|
61737152 |
Dec 14, 2012 |
|
|
|
61618885 |
Apr 2, 2012 |
|
|
|
61681658 |
Aug 10, 2012 |
|
|
|
61737155 |
Dec 14, 2012 |
|
|
|
61618896 |
Apr 2, 2012 |
|
|
|
61668157 |
Jul 5, 2012 |
|
|
|
61681661 |
Aug 10, 2012 |
|
|
|
61737160 |
Dec 14, 2012 |
|
|
|
61618911 |
Apr 2, 2012 |
|
|
|
61681667 |
Aug 10, 2012 |
|
|
|
61737168 |
Dec 14, 2012 |
|
|
|
61618922 |
Apr 2, 2012 |
|
|
|
61681675 |
Aug 10, 2012 |
|
|
|
61737174 |
Dec 14, 2012 |
|
|
|
61618935 |
Apr 2, 2012 |
|
|
|
61681687 |
Aug 10, 2012 |
|
|
|
61737184 |
Dec 14, 2012 |
|
|
|
61618945 |
Apr 2, 2012 |
|
|
|
61681696 |
Aug 10, 2012 |
|
|
|
61737191 |
Dec 14, 2012 |
|
|
|
61618953 |
Apr 2, 2012 |
|
|
|
61681704 |
Aug 10, 2012 |
|
|
|
61737203 |
Dec 14, 2012 |
|
|
|
61681720 |
Aug 10, 2012 |
|
|
|
61737213 |
Dec 14, 2012 |
|
|
|
61681742 |
Aug 10, 2012 |
|
|
|
61618961 |
Apr 2, 2012 |
|
|
|
61648286 |
May 17, 2012 |
|
|
|
61618957 |
Apr 2, 2012 |
|
|
|
61648244 |
May 17, 2012 |
|
|
|
61681712 |
Aug 10, 2012 |
|
|
|
61696381 |
Sep 4, 2012 |
|
|
|
61709303 |
Oct 3, 2012 |
|
|
|
61712490 |
Oct 11, 2012 |
|
|
|
Current U.S.
Class: |
514/44R ;
435/196; 536/23.2 |
Current CPC
Class: |
A61K 38/1816 20130101;
A61P 9/00 20180101; C12N 15/85 20130101; C12P 21/00 20130101; C12P
21/005 20130101; A61P 17/06 20180101; C07K 14/005 20130101; C07K
14/4723 20130101; C07H 21/02 20130101; C07K 14/435 20130101; C07K
14/515 20130101; C12Y 304/21007 20130101; A61K 47/543 20170801;
C07K 14/525 20130101; C12N 9/6443 20130101; A61K 38/191 20130101;
A61P 17/00 20180101; C12N 9/0091 20130101; C12N 9/2402 20130101;
C12Y 304/21022 20130101; A61K 9/1271 20130101; A61K 48/005
20130101; C07K 14/56 20130101; C12N 9/6437 20130101; A61K 38/212
20130101; A61P 17/14 20180101; A61P 19/10 20180101; A61P 21/04
20180101; A61P 25/18 20180101; A61P 31/18 20180101; C07K 16/00
20130101; A61K 38/4846 20130101; A61P 7/04 20180101; A61P 17/08
20180101; A61P 27/02 20180101; A61K 9/5153 20130101; A61P 1/04
20180101; A61P 7/00 20180101; A61P 35/04 20180101; C07K 16/40
20130101; A61P 1/00 20180101; C07K 14/47 20130101; C07K 14/4705
20130101; C07K 14/62 20130101; A61K 38/00 20130101; C07K 14/705
20130101; C12N 9/1241 20130101; A61K 38/45 20130101; A61P 15/00
20180101; C07K 14/4713 20130101; A61K 31/7115 20130101; C12N 9/1051
20130101; C12N 9/2445 20130101; C12Y 603/02019 20130101; A61K 38/17
20130101; C12N 9/644 20130101; C12Y 304/21027 20130101; C07K 14/61
20130101; C12Y 403/02001 20130101; A61K 9/145 20130101; A61P 3/00
20180101; A61P 31/12 20180101; A61P 37/06 20180101; C07K 14/4746
20130101; C07K 14/485 20130101; A61P 19/00 20180101; A61P 25/02
20180101; A61K 9/5123 20130101; A61P 25/28 20180101; A61P 25/30
20180101; C07K 14/475 20130101; C12N 9/93 20130101; C12N 15/52
20130101; A61P 13/00 20180101; C12N 15/87 20130101; Y02A 50/30
20180101; A61P 3/06 20180101; A61K 48/0033 20130101; A61P 13/12
20180101; A61P 35/02 20180101; C07K 14/495 20130101; A61K 48/0075
20130101; A61P 7/06 20180101; A61P 9/10 20180101; A61P 17/02
20180101; A61P 21/00 20180101; A61K 48/0066 20130101; A61P 17/04
20180101; A61P 25/14 20180101; A61P 29/00 20180101; C12N 15/11
20130101; C12Y 116/03001 20130101; A61K 38/177 20130101; A61K
38/1891 20130101; A61P 25/00 20180101; A61P 31/00 20180101; A61P
43/00 20180101; C07K 14/505 20130101; C12N 9/16 20130101; A61P 3/10
20180101; A61P 7/02 20180101; A61P 31/14 20180101; A61P 37/00
20180101; C07K 14/5418 20130101; A61P 31/04 20180101; C07K 14/43595
20130101; C07K 16/2863 20130101; C12N 9/6435 20130101; C12Y
207/07012 20130101; A61K 9/5146 20130101; A61P 11/00 20180101; A61P
25/24 20180101; A61P 37/02 20180101; A61P 31/10 20180101; A61P
35/00 20180101; C07K 16/2887 20130101; C12N 9/6451 20130101; A61P
19/02 20180101; C07K 14/745 20130101; C12N 9/0069 20130101; C12N
9/88 20130101; A61K 38/193 20130101; A61P 37/08 20180101; C12P
13/04 20130101; A61P 5/00 20180101; C07K 14/535 20130101; C12Y
113/12007 20130101 |
Class at
Publication: |
514/44.R ;
536/23.2; 435/196 |
International
Class: |
A61K 48/00 20060101
A61K048/00; C12N 9/16 20060101 C12N009/16 |
Foreign Application Data
Date |
Code |
Application Number |
Dec 14, 2012 |
US |
PCT/US2012/069610 |
Claims
1. A method of producing a polypeptide of interest in a mammalian
cell or tissue comprising contacting said mammalian cell or tissue
with a modified mRNA, wherein said modified mRNA encodes a member
selected from the group consisting of arylsulfatase A (SEQ ID NO:
37905), arylsulfatase A (SEQ ID NO: 37906), arylsulfatase A (SEQ ID
NO: 37907), arylsulfatase A (SEQ ID NO: 37908), arylsulfatase A
(SEQ ID NO: 37909), arylsulfatase A (SEQ ID NO: 37910) and
arylsulfatase A (SEQ ID NO: 37911), and wherein said modified mRNA
comprises modifications selected from the group consisting of: (a)
5-methylcytosine and 2-thiouridine, (b) pseudouridine and
5-methylcytosine, and (c) 1-methylpseudouridine.
2. The method of claim 1, wherein the modified mRNA comprises the
modification 1-methylpseudouridine and further comprises the
modification 5-methylcytosine.
3. The method of claim 1, wherein the modified mRNA comprises the
modifications 5-methylcytosine and 2-thiouridine, wherein 25% of
the cytosine residues in the modified mRNA are 5-methylcytosines
and 25% of the uridine residues in the modified mRNA are
2-thiouridine.
4. The method of claim 1, wherein at least one of the 5'
untranslated region or the 3' untranslated region of the modified
mRNA is not derived from beta-globin.
5. A modified mRNA encoding a polypeptide of interest, said
polypeptide of interest selected from the group consisting of
arylsulfatase A (SEQ ID NO: 37905), arylsulfatase A (SEQ ID NO:
37906), arylsulfatase A (SEQ ID NO: 37907), arylsulfatase A (SEQ ID
NO: 37908), arylsulfatase A (SEQ ID NO: 37909), arylsulfatase A
(SEQ ID NO: 37910) and arylsulfatase A (SEQ ID NO: 37911), and
wherein said modified mRNA comprises modifications selected from
the group consisting of: (a) 5-methylcytosine and 2-thiouridine,
(b) pseudouridine and 5-methylcytosine, and (c)
1-methylpseudouridine.
6. The modified mRNA of claim 5, wherein the modified mRNA
comprises the modification 1-methylpseudouridine and further
comprises the modification 5-methylcytosine.
7. The modified mRNA of claim 5, wherein the modified mRNA
comprises the modifications 5-methylcytosine and 2-thiouridine,
wherein 25% of the cytosine residues in the modified mRNA are
5-methylcytosines and 25% of the uridine residues in the modified
mRNA are 2-thiouridine.
8. The modified mRNA of claim 5, wherein at least one of the 5'
untranslated region or the 3' untranslated region of the modified
mRNA is not derived from beta-globin.
9. A method of treating a disease or disorder associated with a
polypeptide deficiency in a mammalian subject comprising
administering to said subject the modified mRNA of claim 5.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. patent
application Ser. No. 13/791,910, filed Mar. 9, 2013, entitled
Modified Polynucleotides for the Production of Proteins Associated
with Human Disease which claims priority to U.S. Provisional Patent
Application No. 61/681,742, filed, Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Oncology-Related Proteins and
Peptides, U.S. Provisional Patent Application No. 61/737,224, filed
Dec. 14, 2012, entitled Terminally Optimized Modified RNAs,
International Application No PCT/US2012/069610, filed Dec. 14,
2012, entitled Modified Nucleoside, Nucleotide, and Nucleic Acid
Compositions, U.S. Provisional Patent Application No. 61/618,862,
filed Apr. 2, 2012, entitled Modified Polynucleotides for the
Production of Biologics, U.S. Provisional Patent Application No.
61/681,645, filed Aug. 10, 2012, entitled Modified Polynucleotides
for the Production of Biologics, U.S. Provisional Patent
Application No. 61/737,130, filed Dec. 14, 2012, entitled Modified
Polynucleotides for the Production of Biologics, U.S. Provisional
Patent Application No. 61/618,866, filed Apr. 2, 2012, entitled
Modified Polynucleotides for the Production of Antibodies, U.S.
Provisional Patent Application No. 61/681,647, filed Aug. 10, 2012,
entitled Modified Polynucleotides for the Production of Antibodies,
U.S. Provisional Patent Application No. 61/737,134, filed Dec. 14,
2012, entitled Modified Polynucleotides for the Production of
Antibodies, U.S. Provisional Patent Application No. 61/618,868,
filed Apr. 2, 2012, entitled Modified Polynucleotides for the
Production of Vaccines, U.S. Provisional Patent Application No.
61/681,648, filed Aug. 10, 2012, entitled Modified Polynucleotides
for the Production of Vaccines, U.S. Provisional Patent Application
No. 61/737,135, filed Dec. 14, 2012, entitled Modified
Polynucleotides for the Production of Vaccines, U.S. Provisional
Patent Application No. 61/618,870, filed Apr. 2, 2012, entitled
Modified Polynucleotides for the Production of Therapeutic Proteins
and Peptides, U.S. Provisional Patent Application No. 61/681,649,
filed Aug. 10, 2012, entitled Modified Polynucleotides for the
Production of Therapeutic Proteins and Peptides, U.S. Provisional
Patent Application No. 61/737,139, filed Dec. 14, 2012, Modified
Polynucleotides for the Production of Therapeutic Proteins and
Peptides, U.S. Provisional Patent Application No. 61/618,873, filed
Apr. 2, 2012, entitled Modified Polynucleotides for the Production
of Secreted Proteins, U.S. Provisional Patent Application No.
61/681,650, filed Aug. 10, 2012, entitled Modified Polynucleotides
for the Production of Secreted Proteins, U.S. Provisional Patent
Application No. 61/737,147, filed Dec. 14, 2012, entitled Modified
Polynucleotides for the Production of Secreted Proteins, U.S.
Provisional Patent Application No. 61/618,878, filed Apr. 2, 2012,
entitled Modified Polynucleotides for the Production of Plasma
Membrane Proteins, U.S. Provisional Patent Application No.
61/681,654, filed Aug. 10, 2012, entitled Modified Polynucleotides
for the Production of Plasma Membrane Proteins, U.S. Provisional
Patent Application No. 61/737,152, filed Dec. 14, 2012, entitled
Modified Polynucleotides for the Production of Plasma Membrane
Proteins, U.S. Provisional Patent Application No. 61/618,885, filed
Apr. 2, 2012, entitled Modified Polynucleotides for the Production
of Cytoplasmic and Cytoskeletal Proteins, U.S. Provisional Patent
Application No. 61/681,658, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Cytoplasmic and Cytoskeletal
Proteins, U.S. Provisional Patent Application No. 61/737,155, filed
Dec. 14, 2012, entitled Modified Polynucleotides for the Production
of Cytoplasmic and Cytoskeletal Proteins, U.S. Provisional Patent
Application No. 61/618,896, filed Apr. 2, 2012, entitled Modified
Polynucleotides for the Production of Intracellular Membrane Bound
Proteins, U.S. Provisional Patent Application No. 61/668,157, filed
Jul. 5, 2012, entitled Modified Polynucleotides for the Production
of Intracellular Membrane Bound Proteins, U.S. Provisional Patent
Application No. 61/681,661, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Intracellular Membrane Bound
Proteins, U.S. Provisional Patent Application No. 61/737,160, filed
Dec. 14, 2012, entitled Modified Polynucleotides for the Production
of Intracellular Membrane Bound Proteins, U.S. Provisional Patent
Application No. 61/618,911, filed Apr. 2, 2012, entitled Modified
Polynucleotides for the Production of Nuclear Proteins, U.S.
Provisional Patent Application No. 61/681,667, filed Aug. 10, 2012,
entitled Modified Polynucleotides for the Production of Nuclear
Proteins, U.S. Provisional Patent Application No. 61/737,168, filed
Dec. 14, 2012, entitled Modified Polynucleotides for the Production
of Nuclear Proteins, U.S. Provisional Patent Application No.
61/618,922, filed Apr. 2, 2012, entitled Modified Polynucleotides
for the Production of Proteins, U.S. Provisional Patent Application
No. 61/681,675, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Proteins, U.S. Provisional
Patent Application No. 61/737,174, filed Dec. 14, 2012, entitled
Modified Polynucleotides for the Production of Proteins, U.S.
Provisional Patent Application No. 61/618,935, filed Apr. 2, 2012,
entitled Modified Polynucleotides for the Production of Proteins
Associated with Human Disease, U.S. Provisional Patent Application
No. 61/681,687, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Proteins Associated with
Human Disease, U.S. Provisional Patent Application No. 61/737,184,
filed Dec. 14, 2012, entitled Modified Polynucleotides for the
Production of Proteins Associated with Human Disease, U.S.
Provisional Patent Application No. 61/618,945, filed Apr. 2, 2012,
entitled Modified Polynucleotides for the Production of Proteins
Associated with Human Disease, U.S. Provisional Patent Application
No. 61/681,696, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Proteins Associated with
Human Disease, U.S. Provisional Patent Application No. 61/737,191,
filed Dec. 14, 2012, entitled Modified Polynucleotides for the
Production of Proteins Associated with Human Disease, U.S.
Provisional Patent Application No. 61/618,953, filed Apr. 2, 2012,
entitled Modified Polynucleotides for the Production of Proteins
Associated with Human Disease, U.S. Provisional Patent Application
No. 61/681,704, filed Aug. 10, 2012, entitled Modified
Polynucleotides for the Production of Proteins Associated with
Human Disease, U.S. Provisional Patent Application No. 61/737,203,
filed Dec. 14, 2012, entitled Modified Polynucleotides for the
Production of Proteins Associated with Human Disease, U.S.
Provisional Patent Application No. 61/618,961, filed Apr. 2, 2012,
entitled Dosing Methods for Modified mRNA, U.S. Provisional Patent
Application No. 61/648,286, filed May 17, 2012, entitled Dosing
Methods for Modified mRNA, the contents of each of which are herein
incorporated by reference in its entirety.
[0002] This application is also related to International
Publication No. PCT/US2012/58519, filed Oct. 3, 2012, entitled
Modified Nucleosides, Nucleotides, and Nucleic Acids, and Uses
Thereof and International Publication No. PCT/US2012/69610, filed
Dec. 14, 2012, entitled Modified Nucleoside, Nucleotide, and
Nucleic Acid Compositions.
[0003] The instant application is also related to co-pending
applications, each filed concurrently herewith on Mar. 9, 2013 and
having Attorney Docket Number M300.20, (PCT/US13/030,062) entitled
Modified Polynucleotides for the Production of Biologics and
Proteins Associated with Human Disease; Attorney Docket Number
M304.20 (PCT/US13/030,064), entitled Modified Polynucleotides for
the Production of Secreted Proteins; Attorney Docket Number M305.20
(PCT/US13/030059), entitled Modified Polynucleotides for the
Production of Membrane Proteins; Attorney Docket Number M306.20
(PCT/US13/030,066), entitled Modified Polynucleotides for the
Production of Cytoplasmic and Cytoskeletal Proteins; Attorney
Docket Number M308.20 (PCT/US13/030,067), entitled Modified
Polynucleotides for the Production of Nuclear Proteins; Attorney
Docket Number M309.20 (PCT/US13/030,060), entitled Modified
Polynucleotides for the Production of Proteins; Attorney Docket
Number M301.20 (PCT/US13/030,063), entitled Modified
Polynucleotides; Attorney Docket Number MNC1.20 (PCT/US13/030,068),
entitled Modified Polynucleotides for the Production of Cosmetic
Proteins and Peptides and Attorney Docket Number MNC2.20
(PCT/US13/030,070), entitled Modified Polynucleotides for the
Production of Oncology-Related Proteins and Peptides, the contents
of each of which are herein incorporated by reference in its
entirety.
REFERENCE TO SEQUENCE LISTING
[0004] The instant application contains a "lengthy" Sequence
Listing which has been submitted via CD-R in lieu of a printed
paper copy, and is hereby incorporated by reference in its
entirety. This contains a sequence listing text file as part of the
originally filed subject matter as follows: File name:
M310.TR1-2-2030.1310USCON7_SL.txt; File size: 674,697,216 bytes;
Date created: Jan. 31, 2014. These CD-Rs are labeled "CRF," "Copy
1," and "Copy 2," respectively, and each contain only one identical
file, as identified immediately above. The machine-readable format
of each CD-R is IBM-PC and the operating system of each compact
disc is MS-Windows.
REFERENCE TO LENGTHY TABLE
[0005] The specification includes a lengthy Table 6. Lengthy Table
6 has been submitted via EFS-Web in electronic format as follows:
File name: M310TBL.txt, Date created: Feb. 3, 2014; File size:
4,411,723 Bytes and is incorporated herein by reference in its
entirety. Please refer to the end of the specification for access
instructions.
TABLE-US-LTS-CD-00001 LENGTHY TABLES The patent application
contains a lengthy table section. A copy of the table is available
in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140206755A1).
An electronic copy of the table will also be available from the
USPTO upon request and payment of the fee set forth in 37 CFR
1.19(b)(3).
FIELD OF THE INVENTION
[0006] The invention relates to compositions, methods, processes,
kits and devices for the design, preparation, manufacture and/or
formulation of polynucleotides, primary constructs and modified
mRNA molecules (mmRNA).
BACKGROUND OF THE INVENTION
[0007] There are multiple problems with prior methodologies of
effecting protein expression. For example, introduced DNA can
integrate into host cell genomic DNA at some frequency, resulting
in alterations and/or damage to the host cell genomic DNA.
Alternatively, the heterologous deoxyribonucleic acid (DNA)
introduced into a cell can be inherited by daughter cells (whether
or not the heterologous DNA has integrated into the chromosome) or
by offspring.
[0008] In addition, assuming proper delivery and no damage or
integration into the host genome, there are multiple steps which
must occur before the encoded protein is made. Once inside the
cell, DNA must be transported into the nucleus where it is
transcribed into RNA. The RNA transcribed from DNA must then enter
the cytoplasm where it is translated into protein. Not only do the
multiple processing steps from administered DNA to protein create
lag times before the generation of the functional protein, each
step represents an opportunity for error and damage to the cell.
Further, it is known to be difficult to obtain DNA expression in
cells as DNA frequently enters a cell but is not expressed or not
expressed at reasonable rates or concentrations. This can be a
particular problem when DNA is introduced into primary cells or
modified cell lines.
[0009] In the early 1990's Bloom and colleagues successfully
rescued vasopressin-deficient rats by injecting in
vitro-transcribed vasopressin mRNA into the hypothalamus (Science
255: 996-998; 1992). However, the low levels of translation and the
immunogenicity of the molecules hampered the development of mRNA as
a therapeutic and efforts have since focused on alternative
applications that could instead exploit these pitfalls, i.e.
immunization with mRNAs coding for cancer antigens.
[0010] Others have investigated the use of mRNA to deliver a
polypeptide of interest and shown that certain chemical
modifications of mRNA molecules, particularly pseudouridine and
5-methyl-cytosine, have reduced immunostimulatory effect.
[0011] These studies are disclosed in, for example, Ribostem
Limited in United Kingdom patent application serial number
0316089.2 filed on Jul. 9, 2003 now abandoned, PCT application
number PCT/GB2004/002981 filed on Jul. 9, 2004 published as
WO2005005622, U.S. patent application national phase entry Ser. No.
10/563,897 filed on Jun. 8, 2006 published as US20060247195 now
abandoned, and European patent application national phase entry
serial number EP2004743322 filed on Jul. 9, 2004 published as
EP1646714 now withdrawn; Novozymes, Inc. in PCT application number
PCT/US2007/88060 filed on Dec. 19, 2007 published as WO2008140615,
U.S. patent application national phase entry Ser. No. 12/520,072
filed on Jul. 2, 2009 published as US20100028943 and European
patent application national phase entry serial number EP2007874376
filed on Jul. 7, 2009 published as EP2104739; University of
Rochester in PCT application number PCT/US2006/46120 filed on Dec.
4, 2006 published as WO2007064952 and U.S. patent application Ser.
No. 11/606,995 filed on Dec. 1, 2006 published as US20070141030;
BioNTech AG in European patent application serial number
EP2007024312 filed Dec. 14, 2007 now abandoned, PCT application
number PCT/EP2008/01059 filed on Dec. 12, 2008 published as
WO2009077134, European patent application national phase entry
serial number EP2008861423 filed on Jun. 2, 2010 published as
EP2240572, U.S. patent application national phase entry Ser. No.
12/735,060 filed Nov. 24, 2010 published as US20110065103, German
patent application serial number DE 10 2005 046 490 filed Sep. 28,
2005, PCT application PCT/EP2006/0448 filed Sep. 28, 2006 published
as WO2007036366, national phase European patent EP1934345 published
Mar. 21, 2012 and national phase U.S. patent application Ser. No.
11/992,638 filed Aug. 14, 2009 published as 20100129877; Immune
Disease Institute Inc. in U.S. patent application Ser. No.
13/088,009 filed Apr. 15, 2011 published as US20120046346 and PCT
application PCT/US2011/32679 filed Apr. 15, 2011 published as
WO20110130624; Shire Human Genetic Therapeutics in U.S. patent
application Ser. No. 12/957,340 filed on Nov. 20, 2010 published as
US20110244026; Sequitur Inc. in PCT application PCT/US1998/019492
filed on Sep. 18, 1998 published as WO1999014346; The Scripps
Research Institute in PCT application number PCT/US2010/00567 filed
on Feb. 24, 2010 published as WO2010098861, and U.S. patent
application national phase entry Ser. No. 13/203,229 filed Nov. 3,
2011 published as US20120053333; Ludwig-Maximillians University in
PCT application number PCT/EP2010/004681 filed on Jul. 30, 2010
published as WO2011012316; Cellscript Inc. in U.S. Pat. No.
8,039,214 filed Jun. 30, 2008 and granted Oct. 18, 2011, U.S.
patent application Ser. No. 12/962,498 filed on Dec. 7, 2010
published as US20110143436, Ser. No. 12/962,468 filed on Dec. 7,
2010 published as US20110143397, Ser. No. 13/237,451 filed on Sep.
20, 2011 published as US20120009649, and PCT applications
PCT/US2010/59305 filed Dec. 7, 2010 published as WO2011071931 and
PCT/US2010/59317 filed on Dec. 7, 2010 published as WO2011071936;
The Trustees of the University of Pennsylvania in PCT application
number PCT/US2006/32372 filed on Aug. 21, 2006 published as
WO2007024708, and U.S. patent application national phase entry Ser.
No. 11/990,646 filed on Mar. 27, 2009 published as US20090286852;
Curevac GMBH in German patent application serial numbers DE10 2001
027 283.9 filed Jun. 5, 2001, DE10 2001 062 480.8 filed Dec. 19,
2001, and DE 20 2006 051 516 filed Oct. 31, 2006 all abandoned,
European patent numbers EP1392341 granted Mar. 30, 2005 and
EP1458410 granted Jan. 2, 2008, PCT application numbers
PCT/EP2002/06180 filed Jun. 5, 2002 published as WO2002098443,
PCT/EP2002/14577 filed on Dec. 19, 2002 published as WO2003051401,
PCT/EP2007/09469 filed on Dec. 31, 2007 published as WO2008052770,
PCT/EP2008/03033 filed on Apr. 16, 2008 published as WO2009127230,
PCT/EP2006/004784 filed on May 19, 2005 published as WO2006122828,
PCT/EP2008/00081 filed on Jan. 9, 2007 published as WO2008083949,
and U.S. patent application Ser. No. 10/729,830 filed on Dec. 5,
2003 published as US20050032730, Ser. No. 10/870,110 filed on Jun.
18, 2004 published as US20050059624, Ser. No. 11/914,945 filed on
Jul. 7, 2008 published as US20080267873, Ser. No. 12/446,912 filed
on Oct. 27, 2009 published as US2010047261 now abandoned, Ser. No.
12/522,214 filed on Jan. 4, 2010 published as US20100189729, Ser.
No. 12/787,566 filed on May 26, 2010 published as US20110077287,
Ser. No. 12/787,755 filed on May 26, 2010 published as
US20100239608, Ser. No. 13/185,119 filed on Jul. 18, 2011 published
as US20110269950, and Ser. No. 13/106,548 filed on May 12, 2011
published as US20110311472 all of which are herein incorporated by
reference in their entirety.
[0012] Notwithstanding these reports which are limited to a
selection of chemical modifications including pseudouridine and
5-methyl-cytosine, there remains a need in the art for therapeutic
modalities to address the myriad of barriers surrounding the
efficacious modulation of intracellular translation and processing
of nucleic acids encoding polypeptides or fragments thereof.
[0013] To this end, the inventors have shown that certain modified
mRNA sequences have the potential as therapeutics with benefits
beyond just evading, avoiding or diminishing the immune response.
Such studies are detailed in published co-pending applications
International Application PCT/US2011/046861 filed Aug. 5, 2011 and
PCT/US2011/054636 filed Oct. 3, 2011, International Application
number PCT/US2011/054617 filed Oct. 3, 2011, the contents of which
are incorporated herein by reference in their entirety.
[0014] The present invention addresses this need by providing
nucleic acid based compounds or polynucleotides which encode a
polypeptide of interest (e.g., modified mRNA or mmRNA) and which
have structural and/or chemical features that avoid one or more of
the problems in the art, for example, features which are useful for
optimizing formulation and delivery of nucleic acid-based
therapeutics while retaining structural and functional integrity,
overcoming the threshold of expression, improving expression rates,
half life and/or protein concentrations, optimizing protein
localization, and avoiding deleterious bio-responses such as the
immune response and/or degradation pathways.
SUMMARY OF THE INVENTION
[0015] Described herein are compositions, methods, processes, kits
and devices for the design, preparation, manufacture and/or
formulation of modified mRNA (mmRNA) molecules.
[0016] The details of various embodiments of the invention are set
forth in the description below. Other features, objects, and
advantages of the invention will be apparent from the description
and the drawings, and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0017] The foregoing and other objects, features and advantages
will be apparent from the following description of particular
embodiments of the invention, as illustrated in the accompanying
drawings in which like reference characters refer to the same parts
throughout the different views. The drawings are not necessarily to
scale, emphasis instead being placed upon illustrating the
principles of various embodiments of the invention.
[0018] FIG. 1 is a schematic of a primary construct of the present
invention.
[0019] FIG. 2 illustrates lipid structures in the prior art useful
in the present invention. Shown are the structures for 98N12-5
(TETA5-LAP), DLin-DMA, DLin-K-DMA
(2,2-Dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane),
DLin-KC2-DMA, DLin-MC3-DMA and C12-200.
[0020] FIG. 3 is a representative plasmid useful in the IVT
reactions taught herein. The plasmid contains Insert 64818,
designed by the instant inventors.
[0021] FIG. 4 is a gel profile of modified mRNA encapsulated in
PLGA microspheres.
[0022] FIG. 5 is a histogram of Factor IX protein production PLGA
formulation Factor IX modified mRNA.
[0023] FIG. 6 is a histogram showing VEGF protein production in
human keratinocyte cells after transfection of modified mRNA at a
range of doses. FIG. 6A shows protein production after transfection
of modified mRNA comprising natural nucleoside triphosphate (NTP).
FIG. 6B shows protein production after transfection of modified
mRNA fully modified with pseudouridine (Pseudo-U) and
5-methylcytosine (5mC). FIG. 6C shows protein production after
transfection of modified mRNA fully modified with
N1-methyl-pseudouridine (N1-methyl-Pseudo-U) and 5-methylcytosine
(5mC).
[0024] FIG. 7 is a histogram of VEGF protein production in HEK293
cells.
[0025] FIG. 8 is a histogram of VEGF expression and IFN-alpha
induction after transfection of VEGF modified mRNA in peripheral
blood mononuclear cells (PBMC). FIG. 8A shows VEGF expression. FIG.
8B shows IFN-alpha induction.
[0026] FIG. 9 is a histogram of VEGF protein production in HeLa
cells from VEGF modified mRNA.
[0027] FIG. 10 is a histogram of VEGF protein production from
lipoplexed VEGF modified mRNA in mice.
[0028] FIG. 11 is a histogram of G-CSF protein production in HeLa
cells from G-CSF modified mRNA.
[0029] FIG. 12 is a histogram of Factor IX protein production in
HeLa cell supernatant from Factor IX modified mRNA.
DETAILED DESCRIPTION
[0030] It is of great interest in the fields of therapeutics,
diagnostics, reagents and for biological assays to be able to
deliver a nucleic acid, e.g., a ribonucleic acid (RNA) inside a
cell, whether in vitro, in vivo, in situ or ex vivo, such as to
cause intracellular translation of the nucleic acid and production
of an encoded polypeptide of interest. Of particular importance is
the delivery and function of a non-integrative polynucleotide.
[0031] Described herein are compositions (including pharmaceutical
compositions) and methods for the design, preparation, manufacture
and/or formulation of polynucleotides encoding one or more
polypeptides of interest. Also provided are systems, processes,
devices and kits for the selection, design and/or utilization of
the polynucleotides encoding the polypeptides of interest described
herein.
[0032] According to the present invention, these polynucleotides
are preferably modified as to avoid the deficiencies of other
polypeptide-encoding molecules of the art. Hence these
polynucleotides are referred to as modified mRNA or mmRNA.
[0033] The use of modified polynucleotides in the fields of
antibodies, viruses, veterinary applications and a variety of in
vivo settings has been explored by the inventors and these studies
are disclosed in for example, co-pending and co-owned U.S.
provisional patent application Ser. Nos. 61/470,451 filed Mar. 31,
2011 teaching in vivo applications of mmRNA; 61/517,784 filed on
Apr. 26, 2011 teaching engineered nucleic acids for the production
of antibody polypeptides; 61/519,158 filed May 17, 2011 teaching
veterinary applications of mmRNA technology; 61/533, 537 filed on
Sep. 12, 2011 teaching antimicrobial applications of mmRNA
technology; 61/533,554 filed on Sep. 12, 2011 teaching viral
applications of mmRNA technology, 61/542,533 filed on Oct. 3, 2011
teaching various chemical modifications for use in mmRNA
technology; 61/570,690 filed on Dec. 14, 2011 teaching mobile
devices for use in making or using mmRNA technology; 61/570,708
filed on Dec. 14, 2011 teaching the use of mmRNA in acute care
situations; [0034] 61/576,651 filed on Dec. 16, 2011 teaching
terminal modification architecture for mmRNA; 61/576,705 filed on
Dec. 16, 2011 teaching delivery methods using lipidoids for mmRNA;
61/578,271 filed on Dec. 21, 2011 teaching methods to increase the
viability of organs or tissues using mmRNA; 61/581,322 filed on
Dec. 29, 2011 teaching mmRNA encoding cell penetrating peptides;
61/581,352 filed on Dec. 29, 2011 teaching the incorporation of
cytotoxic nucleosides in mmRNA and 61/631,729 filed on Jan. 10,
2012 teaching methods of using mmRNA for crossing the blood brain
barrier; all of which are herein incorporated by reference in their
entirety.
[0035] Provided herein, in part, are polynucleotides, primary
constructs and/or mmRNA encoding polypeptides of interest which
have been designed to improve one or more of the stability and/or
clearance in tissues, receptor uptake and/or kinetics, cellular
access by the compositions, engagement with translational
machinery, mRNA half-life, translation efficiency, immune evasion,
protein production capacity, secretion efficiency (when
applicable), accessibility to circulation, protein half-life and/or
modulation of a cell's status, function and/or activity.
I. COMPOSITIONS OF THE INVENTION (mmRNA)
[0036] The present invention provides nucleic acid molecules,
specifically polynucleotides, primary constructs and/or mmRNA which
encode one or more polypeptides of interest. The term "nucleic
acid," in its broadest sense, includes any compound and/or
substance that comprise a polymer of nucleotides. These polymers
are often referred to as polynucleotides. Exemplary nucleic acids
or polynucleotides of the invention include, but are not limited
to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs),
threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide
nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA
having a .beta.-D-ribo configuration, .alpha.-LNA having an
.alpha.-L-ribo configuration (a diastereomer of LNA), 2'-amino-LNA
having a 2'-amino functionalization, and 2'-amino-.alpha.-LNA
having a 2'-amino functionalization) or hybrids thereof.
[0037] In preferred embodiments, the nucleic acid molecule is a
messenger RNA (mRNA). As used herein, the term "messenger RNA"
(mRNA) refers to any polynucleotide which encodes a polypeptide of
interest and which is capable of being translated to produce the
encoded polypeptide of interest in vitro, in vivo, in situ or ex
vivo.
[0038] Traditionally, the basic components of an mRNA molecule
include at least a coding region, a 5'UTR, a 3'UTR, a 5' cap and a
poly-A tail. Building on this wild type modular structure, the
present invention expands the scope of functionality of traditional
mRNA molecules by providing polynucleotides or primary RNA
constructs which maintain a modular organization, but which
comprise one or more structural and/or chemical modifications or
alterations which impart useful properties to the polynucleotide
including, in some embodiments, the lack of a substantial induction
of the innate immune response of a cell into which the
polynucleotide is introduced. As such, modified mRNA molecules of
the present invention are termed "mmRNA." As used herein, a
"structural" feature or modification is one in which two or more
linked nucleotides are inserted, deleted, duplicated, inverted or
randomized in a polynucleotide, primary construct or mmRNA without
significant chemical modification to the nucleotides themselves.
Because chemical bonds will necessarily be broken and reformed to
effect a structural modification, structural modifications are of a
chemical nature and hence are chemical modifications. However,
structural modifications will result in a different sequence of
nucleotides. For example, the polynucleotide "ATCG" may be
chemically modified to "AT-5meC-G". The same polynucleotide may be
structurally modified from "ATCG" to "ATCCCG". Here, the
dinucleotide "CC" has been inserted, resulting in a structural
modification to the polynucleotide.
mmRNA Architecture
[0039] The mmRNA of the present invention are distinguished from
wild type mRNA in their functional and/or structural design
features which serve to, as evidenced herein, overcome existing
problems of effective polypeptide production using nucleic
acid-based therapeutics.
[0040] FIG. 1 shows a representative polynucleotide primary
construct 100 of the present invention. As used herein, the term
"primary construct" or "primary mRNA construct" refers to a
polynucleotide transcript which encodes one or more polypeptides of
interest and which retains sufficient structural and/or chemical
features to allow the polypeptide of interest encoded therein to be
translated. Primary constructs may be polynucleotides of the
invention. When structurally or chemically modified, the primary
construct may be referred to as an mmRNA.
[0041] Returning to FIG. 1, the primary construct 100 here contains
a first region of linked nucleotides 102 that is flanked by a first
flanking region 104 and a second flaking region 106. As used
herein, the "first region" may be referred to as a "coding region"
or "region encoding" or simply the "first region." This first
region may include, but is not limited to, the encoded polypeptide
of interest. The polypeptide of interest may comprise at its 5'
terminus one or more signal sequences encoded by a signal sequence
region 103. The flanking region 104 may comprise a region of linked
nucleotides comprising one or more complete or incomplete 5' UTRs
sequences. The flanking region 104 may also comprise a 5' terminal
cap 108. The second flanking region 106 may comprise a region of
linked nucleotides comprising one or more complete or incomplete 3'
UTRs. The flanking region 106 may also comprise a 3' tailing
sequence 110.
[0042] Bridging the 5' terminus of the first region 102 and the
first flanking region 104 is a first operational region 105.
Traditionally this operational region comprises a Start codon. The
operational region may alternatively comprise any translation
initiation sequence or signal including a Start codon.
[0043] Bridging the 3' terminus of the first region 102 and the
second flanking region 106 is a second operational region 107.
Traditionally this operational region comprises a Stop codon. The
operational region may alternatively comprise any translation
initiation sequence or signal including a Stop codon. According to
the present invention, multiple serial stop codons may also be
used.
[0044] Generally, the shortest length of the first region of the
primary construct of the present invention can be the length of a
nucleic acid sequence that is sufficient to encode for a dipeptide,
a tripeptide, a tetrapeptide, a pentapeptide, a hexapeptide, a
heptapeptide, an octapeptide, a nonapeptide, or a decapeptide. In
another embodiment, the length may be sufficient to encode a
peptide of 2-30 amino acids, e.g. 5-30, 10-30, 2-25, 5-25, 10-25,
or 10-20 amino acids. The length may be sufficient to encode for a
peptide of at least 11, 12, 13, 14, 15, 17, 20, 25 or 30 amino
acids, or a peptide that is no longer than 40 amino acids, e.g. no
longer than 35, 30, 25, 20, 17, 15, 14, 13, 12, 11 or 10 amino
acids. Examples of dipeptides that the polynucleotide sequences can
encode or include, but are not limited to, carnosine and
anserine.
[0045] Generally, the length of the first region encoding the
polypeptide of interest of the present invention is greater than
about 30 nucleotides in length (e.g., at least or greater than
about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180,
200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000,
1,100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900,
2,000, 2,500, and 3,000, 4,000, 5,000, 6,000, 7,000, 8,000, 9,000,
10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000,
90,000 or up to and including 100,000 nucleotides). As used herein,
the "first region" may be referred to as a "coding region" or
"region encoding" or simply the "first region."
[0046] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes from about 30 to about 100,000 nucleotides (e.g.,
from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from
30 to 1,000, from 30 to 1,500, from 30 to 3,000, from 30 to 5,000,
from 30 to 7,000, from 30 to 10,000, from 30 to 25,000, from 30 to
50,000, from 30 to 70,000, from 100 to 250, from 100 to 500, from
100 to 1,000, from 100 to 1,500, from 100 to 3,000, from 100 to
5,000, from 100 to 7,000, from 100 to 10,000, from 100 to 25,000,
from 100 to 50,000, from 100 to 70,000, from 100 to 100,000, from
500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to
3,000, from 500 to 5,000, from 500 to 7,000, from 500 to 10,000,
from 500 to 25,000, from 500 to 50,000, from 500 to 70,000, from
500 to 100,000, from 1,000 to 1,500, from 1,000 to 2,000, from
1,000 to 3,000, from 1,000 to 5,000, from 1,000 to 7,000, from
1,000 to 10,000, from 1,000 to 25,000, from 1,000 to 50,000, from
1,000 to 70,000, from 1,000 to 100,000, from 1,500 to 3,000, from
1,500 to 5,000, from 1,500 to 7,000, from 1,500 to 10,000, from
1,500 to 25,000, from 1,500 to 50,000, from 1,500 to 70,000, from
1,500 to 100,000, from 2,000 to 3,000, from 2,000 to 5,000, from
2,000 to 7,000, from 2,000 to 10,000, from 2,000 to 25,000, from
2,000 to 50,000, from 2,000 to 70,000, and from 2,000 to
100,000).
[0047] According to the present invention, the first and second
flanking regions may range independently from 15-1,000 nucleotides
in length (e.g., greater than 30, 40, 45, 50, 55, 60, 70, 80, 90,
100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600,
700, 800, and 900 nucleotides or at least 30, 40, 45, 50, 55, 60,
70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450,
500, 600, 700, 800, 900, and 1,000 nucleotides).
[0048] According to the present invention, the tailing sequence may
range from absent to 500 nucleotides in length (e.g., at least 60,
70, 80, 90, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, or
500 nucleotides). Where the tailing region is a polyA tail, the
length may be determined in units of or as a function of polyA
Binding Protein binding. In this embodiment, the polyA tail is long
enough to bind at least 4 monomers of PolyA Binding Protein. PolyA
Binding Protein monomers bind to stretches of approximately 38
nucleotides. As such, it has been observed that polyA tails of
about 80 nucleotides and 160 nucleotides are functional.
[0049] According to the present invention, the capping region may
comprise a single cap or a series of nucleotides forming the cap.
In this embodiment the capping region may be from 1 to 10, e.g.
2-9, 3-8, 4-7, 1-5, 5-10, or at least 2, or 10 or fewer nucleotides
in length. In some embodiments, the cap is absent.
[0050] According to the present invention, the first and second
operational regions may range from 3 to 40, e.g., 5-30, 10-20, 15,
or at least 4, or 30 or fewer nucleotides in length and may
comprise, in addition to a Start and/or Stop codon, one or more
signal and/or restriction sequences.
Cyclic mmRNA
[0051] According to the present invention, a primary construct or
mmRNA may be cyclized, or concatemerized, to generate a translation
competent molecule to assist interactions between poly-A binding
proteins and 5'-end binding proteins. The mechanism of cyclization
or concatemerization may occur through at least 3 different routes:
1) chemical, 2) enzymatic, and 3) ribozyme catalyzed. The newly
formed 5'-/3'-linkage may be intramolecular or intermolecular.
[0052] In the first route, the 5'-end and the 3'-end of the nucleic
acid contain chemically reactive groups that, when close together,
form a new covalent linkage between the 5'-end and the 3'-end of
the molecule. The 5'-end may contain an NHS-ester reactive group
and the 3'-end may contain a 3'-amino-terminated nucleotide such
that in an organic solvent the 3'-amino-terminated nucleotide on
the 3'-end of a synthetic mRNA molecule will undergo a nucleophilic
attack on the 5'--NHS-ester moiety forming a new 5'-/3'-amide
bond.
[0053] In the second route, T4 RNA ligase may be used to
enzymatically link a 5'-phosphorylated nucleic acid molecule to the
3'-hydroxyl group of a nucleic acid forming a new phosphorodiester
linkage. In an example reaction, 1 .mu.g of a nucleic acid molecule
is incubated at 37.degree. C. for 1 hour with 1-10 units of T4 RNA
ligase (New England Biolabs, Ipswich, Mass.) according to the
manufacturer's protocol. The ligation reaction may occur in the
presence of a split oligonucleotide capable of base-pairing with
both the 5'- and 3'-region in juxtaposition to assist the enzymatic
ligation reaction.
[0054] In the third route, either the 5'- or 3'-end of the cDNA
template encodes a ligase ribozyme sequence such that during in
vitro transcription, the resultant nucleic acid molecule can
contain an active ribozyme sequence capable of ligating the 5'-end
of a nucleic acid molecule to the 3'-end of a nucleic acid
molecule. The ligase ribozyme may be derived from the Group I
Intron, Group I Intron, Hepatitis Delta Virus, Hairpin ribozyme or
may be selected by SELEX (systematic evolution of ligands by
exponential enrichment). The ribozyme ligase reaction may take 1 to
24 hours at temperatures between 0 and 37.degree. C.
mmRNA Multimers
[0055] According to the present invention, multiple distinct
polynucleotides, primary constructs or mmRNA may be linked together
through the 3'-end using nucleotides which are modified at the
3'-terminus. Chemical conjugation may be used to control the
stoichiometry of delivery into cells. For example, the glyoxylate
cycle enzymes, isocitrate lyase and malate synthase, may be
supplied into HepG2 cells at a 1:1 ratio to alter cellular fatty
acid metabolism. This ratio may be controlled by chemically linking
polynucleotides, primary constructs or mmRNA using a 3'-azido
terminated nucleotide on one polynucleotide, primary construct or
mmRNA species and a C5-ethynyl or alkynyl-containing nucleotide on
the opposite polynucleotide, primary construct or mmRNA species.
The modified nucleotide is added post-transcriptionally using
terminal transferase (New England Biolabs, Ipswich, Mass.)
according to the manufacturer's protocol. After the addition of the
3'-modified nucleotide, the two polynucleotide, primary construct
or mmRNA species may be combined in an aqueous solution, in the
presence or absence of copper, to form a new covalent linkage via a
click chemistry mechanism as described in the literature.
[0056] In another example, more than two polynucleotides may be
linked together using a functionalized linker molecule. For
example, a functionalized saccharide molecule may be chemically
modified to contain multiple chemical reactive groups (SH--,
NH.sub.2--, N.sub.3, etc. . . . ) to react with the cognate moiety
on a 3'-functionalized mRNA molecule (i.e., a 3'-maleimide ester,
3'--NHS-ester, alkynyl). The number of reactive groups on the
modified saccharide can be controlled in a stoichiometric fashion
to directly control the stoichiometric ratio of conjugated
polynucleotide, primary construct or mmRNA.
mmRNA Conjugates and Combinations
[0057] In order to further enhance protein production, primary
constructs or mmRNA of the present invention can be designed to be
conjugated to other polynucleotides, dyes, intercalating agents
(e.g. acridines), cross-linkers (e.g. psoralene, mitomycin C),
porphyrins (TPPC4, texaphyrin, Sapphyrin), polycyclic aromatic
hydrocarbons (e.g., phenazine, dihydrophenazine), artificial
endonucleases (e.g. EDTA), alkylating agents, phosphate, amino,
mercapto, PEG (e.g., PEG-40K), MPEG, [MPEG].sub.2, polyamino,
alkyl, substituted alkyl, radiolabeled markers, enzymes, haptens
(e.g. biotin), transport/absorption facilitators (e.g., aspirin,
vitamin E, folic acid), synthetic ribonucleases, proteins, e.g.,
glycoproteins, or peptides, e.g., molecules having a specific
affinity for a co-ligand, or antibodies e.g., an antibody, that
binds to a specified cell type such as a cancer cell, endothelial
cell, or bone cell, hormones and hormone receptors, non-peptidic
species, such as lipids, lectins, carbohydrates, vitamins,
cofactors, or a drug.
[0058] Conjugation may result in increased stability and/or half
life and may be particularly useful in targeting the
polynucleotides, primary constructs or mmRNA to specific sites in
the cell, tissue or organism.
[0059] According to the present invention, the mmRNA or primary
constructs may be administered with, or further encode one or more
of RNAi agents, siRNAs, shRNAs, miRNAs, miRNA binding sites,
antisense RNAs, ribozymes, catalytic DNA, tRNA, RNAs that induce
triple helix formation, aptamers or vectors, and the like.
Bifunctional mmRNA
[0060] In one embodiment of the invention are bifunctional
polynucleotides (e.g., bifunctional primary constructs or
bifunctional mmRNA). As the name implies, bifunctional
polynucleotides are those having or capable of at least two
functions. These molecules may also by convention be referred to as
multi-functional.
[0061] The multiple functionalities of bifunctional polynucleotides
may be encoded by the RNA (the function may not manifest until the
encoded product is translated) or may be a property of the
polynucleotide itself. It may be structural or chemical.
Bifunctional modified polynucleotides may comprise a function that
is covalently or electrostatically associated with the
polynucleotides. Further, the two functions may be provided in the
context of a complex of a mmRNA and another molecule.
[0062] Bifunctional polynucleotides may encode peptides which are
anti-proliferative. These peptides may be linear, cyclic,
constrained or random coil. They may function as aptamers,
signaling molecules, ligands or mimics or mimetics thereof.
Anti-proliferative peptides may, as translated, be from 3 to 50
amino acids in length. They may be 5-40, 10-30, or approximately 15
amino acids long. They may be single chain, multichain or branched
and may form complexes, aggregates or any multi-unit structure once
translated.
Noncoding Polynucleotides and Primary Constructs
[0063] As described herein, provided are polynucleotides and
primary constructs having sequences that are partially or
substantially not translatable, e.g., having a noncoding region.
Such noncoding region may be the "first region" of the primary
construct. Alternatively, the noncoding region may be a region
other than the first region. Such molecules are generally not
translated, but can exert an effect on protein production by one or
more of binding to and sequestering one or more translational
machinery components such as a ribosomal protein or a transfer RNA
(tRNA), thereby effectively reducing protein expression in the cell
or modulating one or more pathways or cascades in a cell which in
turn alters protein levels. The polynucleotide or primary construct
may contain or encode one or more long noncoding RNA (lncRNA, or
lincRNA) or portion thereof, a small nucleolar RNA (sno-RNA), micro
RNA (miRNA), small interfering RNA (siRNA) or Piwi-interacting RNA
(piRNA).
Polypeptides of Interest
[0064] According to the present invention, the primary construct is
designed to encode one or more polypeptides of interest or
fragments thereof. A polypeptide of interest may include, but is
not limited to, whole polypeptides, a plurality of polypeptides or
fragments of polypeptides, which independently may be encoded by
one or more nucleic acids, a plurality of nucleic acids, fragments
of nucleic acids or variants of any of the aforementioned. As used
herein, the term "polypeptides of interest" refer to any
polypeptide which is selected to be encoded in the primary
construct of the present invention. As used herein, "polypeptide"
means a polymer of amino acid residues (natural or unnatural)
linked together most often by peptide bonds. The term, as used
herein, refers to proteins, polypeptides, and peptides of any size,
structure, or function. In some instances the polypeptide encoded
is smaller than about 50 amino acids and the polypeptide is then
termed a peptide. If the polypeptide is a peptide, it will be at
least about 2, 3, 4, or at least 5 amino acid residues long. Thus,
polypeptides include gene products, naturally occurring
polypeptides, synthetic polypeptides, homologs, orthologs,
paralogs, fragments and other equivalents, variants, and analogs of
the foregoing. A polypeptide may be a single molecule or may be a
multi-molecular complex such as a dimer, trimer or tetramer. They
may also comprise single chain or multichain polypeptides such as
antibodies or insulin and may be associated or linked. Most
commonly disulfide linkages are found in multichain polypeptides.
The term polypeptide may also apply to amino acid polymers in which
one or more amino acid residues are an artificial chemical analogue
of a corresponding naturally occurring amino acid.
[0065] The term "polypeptide variant" refers to molecules which
differ in their amino acid sequence from a native or reference
sequence. The amino acid sequence variants may possess
substitutions, deletions, and/or insertions at certain positions
within the amino acid sequence, as compared to a native or
reference sequence. Ordinarily, variants will possess at least
about 50% identity (homology) to a native or reference sequence,
and preferably, they will be at least about 80%, more preferably at
least about 90% identical (homologous) to a native or reference
sequence.
[0066] In some embodiments "variant mimics" are provided. As used
herein, the term "variant mimic" is one which contains one or more
amino acids which would mimic an activated sequence. For example,
glutamate may serve as a mimic for phosphoro-threonine and/or
phosphoro-serine. Alternatively, variant mimics may result in
deactivation or in an inactivated product containing the mimic,
e.g., phenylalanine may act as an inactivating substitution for
tyrosine; or alanine may act as an inactivating substitution for
serine.
[0067] "Homology" as it applies to amino acid sequences is defined
as the percentage of residues in the candidate amino acid sequence
that are identical with the residues in the amino acid sequence of
a second sequence after aligning the sequences and introducing
gaps, if necessary, to achieve the maximum percent homology.
Methods and computer programs for the alignment are well known in
the art. It is understood that homology depends on a calculation of
percent identity but may differ in value due to gaps and penalties
introduced in the calculation.
[0068] By "homologs" as it applies to polypeptide sequences means
the corresponding sequence of other species having substantial
identity to a second sequence of a second species.
[0069] "Analogs" is meant to include polypeptide variants which
differ by one or more amino acid alterations, e.g., substitutions,
additions or deletions of amino acid residues that still maintain
one or more of the properties of the parent or starting
polypeptide.
[0070] The present invention contemplates several types of
compositions which are polypeptide based including variants and
derivatives. These include substitutional, insertional, deletion
and covalent variants and derivatives. The term "derivative" is
used synonymously with the term "variant" but generally refers to a
molecule that has been modified and/or changed in any way relative
to a reference molecule or starting molecule.
[0071] As such, mmRNA encoding polypeptides containing
substitutions, insertions and/or additions, deletions and covalent
modifications with respect to reference sequences, in particular
the polypeptide sequences disclosed herein, are included within the
scope of this invention. For example, sequence tags or amino acids,
such as one or more lysines, can be added to the peptide sequences
of the invention (e.g., at the N-terminal or C-terminal ends).
Sequence tags can be used for peptide purification or localization.
Lysines can be used to increase peptide solubility or to allow for
biotinylation. Alternatively, amino acid residues located at the
carboxy and amino terminal regions of the amino acid sequence of a
peptide or protein may optionally be deleted providing for
truncated sequences. Certain amino acids (e.g., C-terminal or
N-terminal residues) may alternatively be deleted depending on the
use of the sequence, as for example, expression of the sequence as
part of a larger sequence which is soluble, or linked to a solid
support.
[0072] "Substitutional variants" when referring to polypeptides are
those that have at least one amino acid residue in a native or
starting sequence removed and a different amino acid inserted in
its place at the same position. The substitutions may be single,
where only one amino acid in the molecule has been substituted, or
they may be multiple, where two or more amino acids have been
substituted in the same molecule.
[0073] As used herein the term "conservative amino acid
substitution" refers to the substitution of an amino acid that is
normally present in the sequence with a different amino acid of
similar size, charge, or polarity. Examples of conservative
substitutions include the substitution of a non-polar (hydrophobic)
residue such as isoleucine, valine and leucine for another
non-polar residue. Likewise, examples of conservative substitutions
include the substitution of one polar (hydrophilic) residue for
another such as between arginine and lysine, between glutamine and
asparagine, and between glycine and serine. Additionally, the
substitution of a basic residue such as lysine, arginine or
histidine for another, or the substitution of one acidic residue
such as aspartic acid or glutamic acid for another acidic residue
are additional examples of conservative substitutions. Examples of
non-conservative substitutions include the substitution of a
non-polar (hydrophobic) amino acid residue such as isoleucine,
valine, leucine, alanine, methionine for a polar (hydrophilic)
residue such as cysteine, glutamine, glutamic acid or lysine and/or
a polar residue for a non-polar residue.
[0074] "Insertional variants" when referring to polypeptides are
those with one or more amino acids inserted immediately adjacent to
an amino acid at a particular position in a native or starting
sequence. "Immediately adjacent" to an amino acid means connected
to either the alpha-carboxy or alpha-amino functional group of the
amino acid.
[0075] "Deletional variants" when referring to polypeptides are
those with one or more amino acids in the native or starting amino
acid sequence removed. Ordinarily, deletional variants will have
one or more amino acids deleted in a particular region of the
molecule.
[0076] "Covalent derivatives" when referring to polypeptides
include modifications of a native or starting protein with an
organic proteinaceous or non-proteinaceous derivatizing agent,
and/or post-translational modifications. Covalent modifications are
traditionally introduced by reacting targeted amino acid residues
of the protein with an organic derivatizing agent that is capable
of reacting with selected side-chains or terminal residues, or by
harnessing mechanisms of post-translational modifications that
function in selected recombinant host cells. The resultant covalent
derivatives are useful in programs directed at identifying residues
important for biological activity, for immunoassays, or for the
preparation of anti-protein antibodies for immunoaffinity
purification of the recombinant glycoprotein. Such modifications
are within the ordinary skill in the art and are performed without
undue experimentation.
[0077] Certain post-translational modifications are the result of
the action of recombinant host cells on the expressed polypeptide.
Glutaminyl and asparaginyl residues are frequently
post-translationally deamidated to the corresponding glutamyl and
aspartyl residues. Alternatively, these residues are deamidated
under mildly acidic conditions. Either form of these residues may
be present in the polypeptides produced in accordance with the
present invention.
[0078] Other post-translational modifications include hydroxylation
of proline and lysine, phosphorylation of hydroxyl groups of seryl
or threonyl residues, methylation of the alpha-amino groups of
lysine, arginine, and histidine side chains (T. E. Creighton,
Proteins: Structure and Molecular Properties, W.H. Freeman &
Co., San Francisco, pp. 79-86 (1983)).
[0079] "Features" when referring to polypeptides are defined as
distinct amino acid sequence-based components of a molecule.
Features of the polypeptides encoded by the mmRNA of the present
invention include surface manifestations, local conformational
shape, folds, loops, half-loops, domains, half-domains, sites,
termini or any combination thereof.
[0080] As used herein when referring to polypeptides the term
"surface manifestation" refers to a polypeptide based component of
a protein appearing on an outermost surface.
[0081] As used herein when referring to polypeptides the term
"local conformational shape" means a polypeptide based structural
manifestation of a protein which is located within a definable
space of the protein.
[0082] As used herein when referring to polypeptides the term
"fold" refers to the resultant conformation of an amino acid
sequence upon energy minimization. A fold may occur at the
secondary or tertiary level of the folding process. Examples of
secondary level folds include beta sheets and alpha helices.
Examples of tertiary folds include domains and regions formed due
to aggregation or separation of energetic forces. Regions formed in
this way include hydrophobic and hydrophilic pockets, and the
like.
[0083] As used herein the term "turn" as it relates to protein
conformation means a bend which alters the direction of the
backbone of a peptide or polypeptide and may involve one, two,
three or more amino acid residues.
[0084] As used herein when referring to polypeptides the term
"loop" refers to a structural feature of a polypeptide which may
serve to reverse the direction of the backbone of a peptide or
polypeptide. Where the loop is found in a polypeptide and only
alters the direction of the backbone, it may comprise four or more
amino acid residues. Oliva et al. have identified at least 5
classes of protein loops (J. Mol Biol 266 (4): 814-830; 1997).
Loops may be open or closed. Closed loops or "cyclic" loops may
comprise 2, 3, 4, 5, 6, 7, 8, 9, 10 or more amino acids between the
bridging moieties. Such bridging moieties may comprise a
cysteine-cysteine bridge (Cys-Cys) typical in polypeptides having
disulfide bridges or alternatively bridging moieties may be
non-protein based such as the dibromozylyl agents used herein.
[0085] As used herein when referring to polypeptides the term
"half-loop" refers to a portion of an identified loop having at
least half the number of amino acid resides as the loop from which
it is derived. It is understood that loops may not always contain
an even number of amino acid residues. Therefore, in those cases
where a loop contains or is identified to comprise an odd number of
amino acids, a half-loop of the odd-numbered loop will comprise the
whole number portion or next whole number portion of the loop
(number of amino acids of the loop/2+/-0.5 amino acids). For
example, a loop identified as a 7 amino acid loop could produce
half-loops of 3 amino acids or 4 amino acids (7/2=3.5+/-0.5 being 3
or 4).
[0086] As used herein when referring to polypeptides the term
"domain" refers to a motif of a polypeptide having one or more
identifiable structural or functional characteristics or properties
(e.g., binding capacity, serving as a site for protein-protein
interactions).
[0087] As used herein when referring to polypeptides the term
"half-domain" means a portion of an identified domain having at
least half the number of amino acid resides as the domain from
which it is derived. It is understood that domains may not always
contain an even number of amino acid residues. Therefore, in those
cases where a domain contains or is identified to comprise an odd
number of amino acids, a half-domain of the odd-numbered domain
will comprise the whole number portion or next whole number portion
of the domain (number of amino acids of the domain/2+/-0.5 amino
acids). For example, a domain identified as a 7 amino acid domain
could produce half-domains of 3 amino acids or 4 amino acids
(7/2=3.5+/-0.5 being 3 or 4). It is also understood that
sub-domains may be identified within domains or half-domains, these
subdomains possessing less than all of the structural or functional
properties identified in the domains or half domains from which
they were derived. It is also understood that the amino acids that
comprise any of the domain types herein need not be contiguous
along the backbone of the polypeptide (i.e., nonadjacent amino
acids may fold structurally to produce a domain, half-domain or
subdomain).
[0088] As used herein when referring to polypeptides the terms
"site" as it pertains to amino acid based embodiments is used
synonymously with "amino acid residue" and "amino acid side chain."
A site represents a position within a peptide or polypeptide that
may be modified, manipulated, altered, derivatized or varied within
the polypeptide based molecules of the present invention.
[0089] As used herein the terms "termini" or "terminus" when
referring to polypeptides refers to an extremity of a peptide or
polypeptide. Such extremity is not limited only to the first or
final site of the peptide or polypeptide but may include additional
amino acids in the terminal regions. The polypeptide based
molecules of the present invention may be characterized as having
both an N-terminus (terminated by an amino acid with a free amino
group (NH2)) and a C-terminus (terminated by an amino acid with a
free carboxyl group (COOH)). Proteins of the invention are in some
cases made up of multiple polypeptide chains brought together by
disulfide bonds or by non-covalent forces (multimers, oligomers).
These sorts of proteins will have multiple N- and C-termini.
Alternatively, the termini of the polypeptides may be modified such
that they begin or end, as the case may be, with a non-polypeptide
based moiety such as an organic conjugate.
[0090] Once any of the features have been identified or defined as
a desired component of a polypeptide to be encoded by the primary
construct or mmRNA of the invention, any of several manipulations
and/or modifications of these features may be performed by moving,
swapping, inverting, deleting, randomizing or duplicating.
Furthermore, it is understood that manipulation of features may
result in the same outcome as a modification to the molecules of
the invention. For example, a manipulation which involved deleting
a domain would result in the alteration of the length of a molecule
just as modification of a nucleic acid to encode less than a full
length molecule would.
[0091] Modifications and manipulations can be accomplished by
methods known in the art such as, but not limited to, site directed
mutagenesis. The resulting modified molecules may then be tested
for activity using in vitro or in vivo assays such as those
described herein or any other suitable screening assay known in the
art.
[0092] According to the present invention, the polypeptides may
comprise a consensus sequence which is discovered through rounds of
experimentation. As used herein a "consensus" sequence is a single
sequence which represents a collective population of sequences
allowing for variability at one or more sites.
[0093] As recognized by those skilled in the art, protein
fragments, functional protein domains, and homologous proteins are
also considered to be within the scope of polypeptides of interest
of this invention. For example, provided herein is any protein
fragment (meaning a polypeptide sequence at least one amino acid
residue shorter than a reference polypeptide sequence but otherwise
identical) of a reference protein 10, 20, 30, 40, 50, 60, 70, 80,
90, 100 or greater than 100 amino acids in length. In another
example, any protein that includes a stretch of about 20, about 30,
about 40, about 50, or about 100 amino acids which are about 40%,
about 50%, about 60%, about 70%, about 80%, about 90%, about 95%,
or about 100% identical to any of the sequences described herein
can be utilized in accordance with the invention. In certain
embodiments, a polypeptide to be utilized in accordance with the
invention includes 2, 3, 4, 5, 6, 7, 8, 9, 10, or more mutations as
shown in any of the sequences provided or referenced herein.
Encoded Polypeptides
[0094] The primary constructs or mmRNA of the present invention may
be designed to encode polypeptides of interest selected from any of
several target categories including, but not limited to, biologics,
antibodies, vaccines, therapeutic proteins or peptides, cell
penetrating peptides, secreted proteins, plasma membrane proteins,
cytoplasmic or cytoskeletal proteins, intracellular membrane bound
proteins, nuclear proteins, proteins associated with human disease,
targeting moieties or those proteins encoded by the human genome
for which no therapeutic indication has been identified but which
nonetheless have utility in areas of research and discovery.
[0095] In one embodiment primary constructs or mmRNA may encode
variant polypeptides which have a certain identity with a reference
polypeptide sequence. As used herein, a "reference polypeptide
sequence" refers to a starting polypeptide sequence. Reference
sequences may be wild type sequences or any sequence to which
reference is made in the design of another sequence. A "reference
polypeptide sequence" may, e.g., be any one of SEQ ID NOs:
35608-71005 as disclosed herein, e.g., any of SEQ ID NOs 35608,
35609, 35610, 35611, 35612, 35613, 35614, 35615, 35616, 35617,
35618, 35619, 35620, 35621, 35622, 35623, 35624, 35625, 35626,
35627, 35628, 35629, 35630, 35631, 35632, 35633, 35634, 35635,
35636, 35637, 35638, 35639, 35640, 35641, 35642, 35643, 35644,
35645, 35646, 35647, 35648, 35649, 35650, 35651, 35652, 35653,
35654, 35655, 35656, 35657, 35658, 35659, 35660, 35661, 35662,
35663, 35664, 35665, 35666, 35667, 35668, 35669, 35670, 35671,
35672, 35673, 35674, 35675, 35676, 35677, 35678, 35679, 35680,
35681, 35682, 35683, 35684, 35685, 35686, 35687, 35688, 35689,
35690, 35691, 35692, 35693, 35694, 35695, 35696, 35697, 35698,
35699, 35700, 35701, 35702, 35703, 35704, 35705, 35706, 35707,
35708, 35709, 35710, 35711, 35712, 35713, 35714, 35715, 35716,
35717, 35718, 35719, 35720, 35721, 35722, 35723, 35724, 35725,
35726, 35727, 35728, 35729, 35730, 35731, 35732, 35733, 35734,
35735, 35736, 35737, 35738, 35739, 35740, 35741, 35742, 35743,
35744, 35745, 35746, 35747, 35748, 35749, 35750, 35751, 35752,
35753, 35754, 35755, 35756, 35757, 35758, 35759, 35760, 35761,
35762, 35763, 35764, 35765, 35766, 35767, 35768, 35769, 35770,
35771, 35772, 35773, 35774, 35775, 35776, 35777, 35778, 35779,
35780, 35781, 35782, 35783, 35784, 35785, 35786, 35787, 35788,
35789, 35790, 35791, 35792, 35793, 35794, 35795, 35796, 35797,
35798, 35799, 35800, 35801, 35802, 35803, 35804, 35805, 35806,
35807, 35808, 35809, 35810, 35811, 35812, 35813, 35814, 35815,
35816, 35817, 35818, 35819, 35820, 35821, 35822, 35823, 35824,
35825, 35826, 35827, 35828, 35829, 35830, 35831, 35832, 35833,
35834, 35835, 35836, 35837, 35838, 35839, 35840, 35841, 35842,
35843, 35844, 35845, 35846, 35847, 35848, 35849, 35850, 35851,
35852, 35853, 35854, 35855, 35856, 35857, 35858, 35859, 35860,
35861, 35862, 35863, 35864, 35865, 35866, 35867, 35868, 35869,
35870, 35871, 35872, 35873, 35874, 35875, 35876, 35877, 35878,
35879, 35880, 35881, 35882, 35883, 35884, 35885, 35886, 35887,
35888, 35889, 35890, 35891, 35892, 35893, 35894, 35895, 35896,
35897, 35898, 35899, 35900, 35901, 35902, 35903, 35904, 35905,
35906, 35907, 35908, 35909, 35910, 35911, 35912, 35913, 35914,
35915, 35916, 35917, 35918, 35919, 35920, 35921, 35922, 35923,
35924, 35925, 35926, 35927, 35928, 35929, 35930, 35931, 35932,
35933, 35934, 35935, 35936, 35937, 35938, 35939, 35940, 35941,
35942, 35943, 35944, 35945, 35946, 35947, 35948, 35949, 35950,
35951, 35952, 35953, 35954, 35955, 35956, 35957, 35958, 35959,
35960, 35961, 35962, 35963, 35964, 35965, 35966, 35967, 35968,
35969, 35970, 35971, 35972, 35973, 35974, 35975, 35976, 35977,
35978, 35979, 35980, 35981, 35982, 35983, 35984, 35985, 35986,
35987, 35988, 35989, 35990, 35991, 35992, 35993, 35994, 35995,
35996, 35997, 35998, 35999, 36000, 36001, 36002, 36003, 36004,
36005, 36006, 36007, 36008, 36009, 36010, 36011, 36012, 36013,
36014, 36015, 36016, 36017, 36018, 36019, 36020, 36021, 36022,
36023, 36024, 36025, 36026, 36027, 36028, 36029, 36030, 36031,
36032, 36033, 36034, 36035, 36036, 36037, 36038, 36039, 36040,
36041, 36042, 36043, 36044, 36045, 36046, 36047, 36048, 36049,
36050, 36051, 36052, 36053, 36054, 36055, 36056, 36057, 36058,
36059, 36060, 36061, 36062, 36063, 36064, 36065, 36066, 36067,
36068, 36069, 36070, 36071, 36072, 36073, 36074, 36075, 36076,
36077, 36078, 36079, 36080, 36081, 36082, 36083, 36084, 36085,
36086, 36087, 36088, 36089, 36090, 36091, 36092, 36093, 36094,
36095, 36096, 36097, 36098, 36099, 36100, 36101, 36102, 36103,
36104, 36105, 36106, 36107, 36108, 36109, 36110, 36111, 36112,
36113, 36114, 36115, 36116, 36117, 36118, 36119, 36120, 36121,
36122, 36123, 36124, 36125, 36126, 36127, 36128, 36129, 36130,
36131, 36132, 36133, 36134, 36135, 36136, 36137, 36138, 36139,
36140, 36141, 36142, 36143, 36144, 36145, 36146, 36147, 36148,
36149, 36150, 36151, 36152, 36153, 36154, 36155, 36156, 36157,
36158, 36159, 36160, 36161, 36162, 36163, 36164, 36165, 36166,
36167, 36168, 36169, 36170, 36171, 36172, 36173, 36174, 36175,
36176, 36177, 36178, 36179, 36180, 36181, 36182, 36183, 36184,
36185, 36186, 36187, 36188, 36189, 36190, 36191, 36192, 36193,
36194, 36195, 36196, 36197, 36198, 36199, 36200, 36201, 36202,
36203, 36204, 36205, 36206, 36207, 36208, 36209, 36210, 36211,
36212, 36213, 36214, 36215, 36216, 36217, 36218, 36219, 36220,
36221, 36222, 36223, 36224, 36225, 36226, 36227, 36228, 36229,
36230, 36231, 36232, 36233, 36234, 36235, 36236, 36237, 36238,
36239, 36240, 36241, 36242, 36243, 36244, 36245, 36246, 36247,
36248, 36249, 36250, 36251, 36252, 36253, 36254, 36255, 36256,
36257, 36258, 36259, 36260, 36261, 36262, 36263, 36264, 36265,
36266, 36267, 36268, 36269, 36270, 36271, 36272, 36273, 36274,
36275, 36276, 36277, 36278, 36279, 36280, 36281, 36282, 36283,
36284, 36285, 36286, 36287, 36288, 36289, 36290, 36291, 36292,
36293, 36294, 36295, 36296, 36297, 36298, 36299, 36300, 36301,
36302, 36303, 36304, 36305, 36306, 36307, 36308, 36309, 36310,
36311, 36312, 36313, 36314, 36315, 36316, 36317, 36318, 36319,
36320, 36321, 36322, 36323, 36324, 36325, 36326, 36327, 36328,
36329, 36330, 36331, 36332, 36333, 36334, 36335, 36336, 36337,
36338, 36339, 36340, 36341, 36342, 36343, 36344, 36345, 36346,
36347, 36348, 36349, 36350, 36351, 36352, 36353, 36354, 36355,
36356, 36357, 36358, 36359, 36360, 36361, 36362, 36363, 36364,
36365, 36366, 36367, 36368, 36369, 36370, 36371, 36372, 36373,
36374, 36375, 36376, 36377, 36378, 36379, 36380, 36381, 36382,
36383, 36384, 36385, 36386, 36387, 36388, 36389, 36390, 36391,
36392, 36393, 36394, 36395, 36396, 36397, 36398, 36399, 36400,
36401, 36402, 36403, 36404, 36405, 36406, 36407, 36408, 36409,
36410, 36411, 36412, 36413, 36414, 36415, 36416, 36417, 36418,
36419, 36420, 36421, 36422, 36423, 36424, 36425, 36426, 36427,
36428, 36429, 36430, 36431, 36432, 36433, 36434, 36435, 36436,
36437, 36438, 36439, 36440, 36441, 36442, 36443, 36444, 36445,
36446, 36447, 36448, 36449, 36450, 36451, 36452, 36453, 36454,
36455, 36456, 36457, 36458, 36459, 36460, 36461, 36462, 36463,
36464, 36465, 36466, 36467, 36468, 36469, 36470, 36471, 36472,
36473, 36474, 36475, 36476, 36477, 36478, 36479, 36480, 36481,
36482, 36483, 36484, 36485, 36486, 36487, 36488, 36489, 36490,
36491, 36492, 36493, 36494, 36495, 36496, 36497, 36498, 36499,
36500, 36501, 36502, 36503, 36504, 36505, 36506, 36507, 36508,
36509, 36510, 36511, 36512, 36513, 36514, 36515, 36516, 36517,
36518, 36519, 36520, 36521, 36522, 36523, 36524, 36525, 36526,
36527, 36528, 36529, 36530, 36531, 36532, 36533, 36534, 36535,
36536, 36537, 36538, 36539, 36540, 36541, 36542, 36543, 36544,
36545, 36546, 36547, 36548, 36549, 36550, 36551, 36552, 36553,
36554, 36555, 36556, 36557, 36558, 36559, 36560, 36561, 36562,
36563, 36564, 36565, 36566, 36567, 36568, 36569, 36570, 36571,
36572, 36573, 36574, 36575, 36576, 36577, 36578, 36579, 36580,
36581, 36582, 36583, 36584, 36585, 36586, 36587, 36588, 36589,
36590, 36591, 36592, 36593, 36594, 36595, 36596, 36597, 36598,
36599, 36600, 36601, 36602, 36603, 36604, 36605, 36606, 36607,
36608, 36609, 36610, 36611, 36612, 36613, 36614, 36615, 36616,
36617, 36618, 36619, 36620, 36621, 36622, 36623, 36624, 36625,
36626, 36627, 36628, 36629, 36630, 36631, 36632, 36633, 36634,
36635, 36636, 36637, 36638, 36639, 36640, 36641, 36642, 36643,
36644, 36645, 36646, 36647, 36648, 36649, 36650, 36651, 36652,
36653, 36654, 36655, 36656, 36657, 36658, 36659, 36660, 36661,
36662, 36663, 36664, 36665, 36666, 36667, 36668, 36669, 36670,
36671, 36672, 36673, 36674, 36675, 36676, 36677, 36678, 36679,
36680, 36681, 36682, 36683, 36684, 36685, 36686, 36687, 36688,
36689, 36690, 36691, 36692, 36693, 36694, 36695, 36696, 36697,
36698, 36699, 36700, 36701, 36702, 36703, 36704, 36705, 36706,
36707, 36708, 36709, 36710, 36711, 36712, 36713, 36714, 36715,
36716, 36717, 36718, 36719, 36720, 36721, 36722, 36723, 36724,
36725, 36726, 36727, 36728, 36729, 36730, 36731, 36732, 36733,
36734, 36735, 36736, 36737, 36738, 36739, 36740, 36741, 36742,
36743, 36744, 36745, 36746, 36747, 36748, 36749, 36750, 36751,
36752, 36753, 36754, 36755, 36756, 36757, 36758, 36759, 36760,
36761, 36762, 36763, 36764, 36765, 36766, 36767, 36768, 36769,
36770, 36771, 36772, 36773, 36774, 36775, 36776, 36777, 36778,
36779, 36780, 36781, 36782, 36783, 36784, 36785, 36786, 36787,
36788, 36789, 36790, 36791, 36792, 36793, 36794, 36795, 36796,
36797, 36798, 36799, 36800, 36801, 36802, 36803, 36804, 36805,
36806, 36807, 36808, 36809, 36810, 36811, 36812, 36813, 36814,
36815, 36816, 36817, 36818, 36819, 36820, 36821, 36822, 36823,
36824, 36825, 36826, 36827, 36828, 36829, 36830, 36831, 36832,
36833, 36834, 36835, 36836, 36837, 36838, 36839, 36840, 36841,
36842, 36843, 36844, 36845, 36846, 36847, 36848, 36849, 36850,
36851, 36852, 36853, 36854, 36855, 36856, 36857, 36858, 36859,
36860, 36861, 36862, 36863, 36864, 36865, 36866, 36867, 36868,
36869, 36870, 36871, 36872, 36873, 36874, 36875, 36876, 36877,
36878, 36879, 36880, 36881, 36882, 36883, 36884, 36885, 36886,
36887, 36888, 36889, 36890, 36891, 36892, 36893, 36894, 36895,
36896, 36897, 36898, 36899, 36900, 36901, 36902, 36903, 36904,
36905, 36906, 36907, 36908, 36909, 36910, 36911, 36912, 36913,
36914, 36915, 36916, 36917, 36918, 36919, 36920, 36921, 36922,
36923, 36924, 36925, 36926, 36927, 36928, 36929, 36930, 36931,
36932, 36933, 36934, 36935, 36936, 36937, 36938, 36939, 36940,
36941, 36942, 36943, 36944, 36945, 36946, 36947, 36948, 36949,
36950, 36951, 36952, 36953, 36954, 36955, 36956, 36957, 36958,
36959, 36960, 36961, 36962, 36963, 36964, 36965, 36966, 36967,
36968, 36969, 36970, 36971, 36972, 36973, 36974, 36975, 36976,
36977, 36978, 36979, 36980, 36981, 36982, 36983, 36984, 36985,
36986, 36987, 36988, 36989, 36990, 36991, 36992, 36993, 36994,
36995, 36996, 36997, 36998, 36999, 37000, 37001, 37002, 37003,
37004, 37005, 37006, 37007, 37008, 37009, 37010, 37011, 37012,
37013, 37014, 37015, 37016, 37017, 37018, 37019, 37020, 37021,
37022, 37023, 37024, 37025, 37026, 37027, 37028, 37029, 37030,
37031, 37032, 37033, 37034, 37035, 37036, 37037, 37038, 37039,
37040, 37041, 37042, 37043, 37044, 37045, 37046, 37047, 37048,
37049, 37050, 37051, 37052, 37053, 37054, 37055, 37056, 37057,
37058, 37059, 37060, 37061, 37062, 37063, 37064, 37065, 37066,
37067, 37068, 37069, 37070, 37071, 37072, 37073, 37074, 37075,
37076, 37077, 37078, 37079, 37080, 37081, 37082, 37083, 37084,
37085, 37086, 37087, 37088, 37089, 37090, 37091, 37092, 37093,
37094, 37095, 37096, 37097, 37098, 37099, 37100, 37101, 37102,
37103, 37104, 37105, 37106, 37107, 37108, 37109, 37110, 37111,
37112, 37113, 37114, 37115, 37116, 37117, 37118, 37119, 37120,
37121, 37122, 37123, 37124, 37125, 37126, 37127, 37128, 37129,
37130, 37131, 37132, 37133, 37134, 37135, 37136, 37137, 37138,
37139, 37140, 37141, 37142, 37143, 37144, 37145, 37146, 37147,
37148, 37149, 37150, 37151, 37152, 37153, 37154, 37155, 37156,
37157, 37158, 37159, 37160, 37161, 37162, 37163, 37164, 37165,
37166, 37167, 37168, 37169, 37170, 37171, 37172, 37173, 37174,
37175, 37176, 37177, 37178, 37179, 37180, 37181, 37182, 37183,
37184, 37185, 37186, 37187, 37188, 37189, 37190, 37191, 37192,
37193, 37194, 37195, 37196, 37197, 37198, 37199, 37200, 37201,
37202, 37203, 37204, 37205, 37206, 37207, 37208, 37209, 37210,
37211, 37212, 37213, 37214, 37215, 37216, 37217, 37218, 37219,
37220, 37221, 37222, 37223, 37224, 37225, 37226, 37227, 37228,
37229, 37230, 37231, 37232, 37233, 37234, 37235, 37236, 37237,
37238, 37239, 37240, 37241, 37242, 37243, 37244, 37245, 37246,
37247, 37248, 37249, 37250, 37251, 37252, 37253, 37254, 37255,
37256, 37257, 37258, 37259, 37260, 37261, 37262, 37263, 37264,
37265, 37266, 37267, 37268, 37269, 37270, 37271, 37272, 37273,
37274, 37275, 37276, 37277, 37278, 37279, 37280, 37281, 37282,
37283, 37284, 37285, 37286, 37287, 37288, 37289, 37290, 37291,
37292, 37293, 37294, 37295, 37296, 37297, 37298, 37299, 37300,
37301, 37302, 37303, 37304, 37305, 37306, 37307, 37308, 37309,
37310, 37311, 37312, 37313, 37314, 37315, 37316, 37317, 37318,
37319, 37320, 37321, 37322, 37323, 37324, 37325, 37326, 37327,
37328, 37329, 37330, 37331, 37332, 37333, 37334, 37335, 37336,
37337, 37338, 37339, 37340, 37341, 37342, 37343, 37344, 37345,
37346, 37347, 37348, 37349, 37350, 37351, 37352, 37353, 37354,
37355, 37356, 37357, 37358, 37359, 37360, 37361, 37362, 37363,
37364, 37365, 37366, 37367, 37368, 37369, 37370, 37371, 37372,
37373, 37374, 37375, 37376, 37377, 37378, 37379, 37380, 37381,
37382, 37383, 37384, 37385, 37386, 37387, 37388, 37389, 37390,
37391, 37392, 37393, 37394, 37395, 37396, 37397, 37398, 37399,
37400, 37401, 37402, 37403, 37404, 37405, 37406, 37407, 37408,
37409, 37410, 37411, 37412, 37413, 37414, 37415, 37416, 37417,
37418, 37419, 37420, 37421, 37422, 37423, 37424, 37425, 37426,
37427, 37428, 37429, 37430, 37431, 37432, 37433, 37434, 37435,
37436, 37437, 37438, 37439, 37440, 37441, 37442, 37443, 37444,
37445, 37446, 37447, 37448, 37449, 37450, 37451, 37452, 37453,
37454, 37455, 37456, 37457, 37458, 37459, 37460, 37461, 37462,
37463, 37464, 37465, 37466, 37467, 37468, 37469, 37470, 37471,
37472, 37473, 37474, 37475, 37476, 37477, 37478, 37479, 37480,
37481, 37482, 37483, 37484, 37485, 37486, 37487, 37488, 37489,
37490, 37491, 37492, 37493, 37494, 37495, 37496, 37497, 37498,
37499, 37500, 37501, 37502, 37503, 37504, 37505, 37506, 37507,
37508, 37509, 37510, 37511, 37512, 37513, 37514, 37515, 37516,
37517, 37518, 37519, 37520, 37521, 37522, 37523, 37524, 37525,
37526, 37527, 37528, 37529, 37530, 37531, 37532, 37533, 37534,
37535, 37536, 37537, 37538, 37539, 37540, 37541, 37542, 37543,
37544, 37545, 37546, 37547, 37548, 37549, 37550, 37551, 37552,
37553, 37554, 37555, 37556, 37557, 37558, 37559, 37560, 37561,
37562, 37563, 37564, 37565, 37566, 37567, 37568, 37569, 37570,
37571, 37572, 37573, 37574, 37575, 37576, 37577, 37578, 37579,
37580, 37581, 37582, 37583, 37584, 37585, 37586, 37587, 37588,
37589, 37590, 37591, 37592, 37593, 37594, 37595, 37596, 37597,
37598, 37599, 37600, 37601, 37602, 37603, 37604, 37605, 37606,
37607, 37608, 37609, 37610, 37611, 37612, 37613, 37614, 37615,
37616, 37617, 37618, 37619, 37620, 37621, 37622, 37623, 37624,
37625, 37626, 37627, 37628, 37629, 37630, 37631, 37632, 37633,
37634, 37635, 37636, 37637, 37638, 37639, 37640, 37641, 37642,
37643, 37644, 37645, 37646, 37647, 37648, 37649, 37650, 37651,
37652, 37653, 37654, 37655, 37656, 37657, 37658, 37659, 37660,
37661, 37662, 37663, 37664, 37665, 37666, 37667, 37668, 37669,
37670, 37671, 37672, 37673, 37674, 37675, 37676, 37677, 37678,
37679, 37680, 37681, 37682, 37683, 37684, 37685, 37686, 37687,
37688, 37689, 37690, 37691, 37692, 37693, 37694, 37695, 37696,
37697, 37698, 37699, 37700, 37701, 37702, 37703, 37704, 37705,
37706, 37707, 37708, 37709, 37710, 37711, 37712, 37713, 37714,
37715, 37716, 37717, 37718, 37719, 37720, 37721, 37722, 37723,
37724, 37725, 37726, 37727, 37728, 37729, 37730, 37731, 37732,
37733, 37734, 37735, 37736, 37737, 37738, 37739, 37740, 37741,
37742, 37743, 37744, 37745, 37746, 37747, 37748, 37749, 37750,
37751, 37752, 37753, 37754, 37755, 37756, 37757, 37758, 37759,
37760, 37761, 37762, 37763, 37764, 37765, 37766, 37767, 37768,
37769, 37770, 37771, 37772, 37773, 37774, 37775, 37776, 37777,
37778, 37779, 37780, 37781, 37782, 37783, 37784, 37785, 37786,
37787, 37788, 37789, 37790, 37791, 37792, 37793, 37794, 37795,
37796, 37797, 37798, 37799, 37800, 37801, 37802, 37803, 37804,
37805, 37806, 37807, 37808, 37809, 37810, 37811, 37812, 37813,
37814, 37815, 37816, 37817, 37818, 37819, 37820, 37821, 37822,
37823, 37824, 37825, 37826, 37827, 37828, 37829, 37830, 37831,
37832, 37833, 37834, 37835, 37836, 37837, 37838, 37839, 37840,
37841, 37842, 37843, 37844, 37845, 37846, 37847, 37848, 37849,
37850, 37851, 37852, 37853, 37854, 37855, 37856, 37857, 37858,
37859, 37860, 37861, 37862, 37863, 37864, 37865, 37866, 37867,
37868, 37869, 37870, 37871, 37872, 37873, 37874, 37875, 37876,
37877, 37878, 37879, 37880, 37881, 37882, 37883, 37884, 37885,
37886, 37887, 37888, 37889, 37890, 37891, 37892, 37893, 37894,
37895, 37896, 37897, 37898, 37899, 37900, 37901, 37902, 37903,
37904, 37905, 37906, 37907, 37908, 37909, 37910, 37911, 37912,
37913, 37914, 37915, 37916, 37917, 37918, 37919, 37920, 37921,
37922, 37923, 37924, 37925, 37926, 37927, 37928, 37929, 37930,
37931, 37932, 37933, 37934, 37935, 37936, 37937, 37938, 37939,
37940, 37941, 37942, 37943, 37944, 37945, 37946, 37947, 37948,
37949, 37950, 37951, 37952, 37953, 37954, 37955, 37956, 37957,
37958, 37959, 37960, 37961, 37962, 37963, 37964, 37965, 37966,
37967, 37968, 37969, 37970, 37971, 37972, 37973, 37974, 37975,
37976, 37977, 37978, 37979, 37980, 37981, 37982, 37983, 37984,
37985, 37986, 37987, 37988, 37989, 37990, 37991, 37992, 37993,
37994, 37995, 37996, 37997, 37998, 37999, 38000, 38001, 38002,
38003, 38004, 38005, 38006, 38007, 38008, 38009, 38010, 38011,
38012, 38013, 38014, 38015, 38016, 38017, 38018, 38019, 38020,
38021, 38022, 38023, 38024, 38025, 38026, 38027, 38028, 38029,
38030, 38031, 38032, 38033, 38034, 38035, 38036, 38037, 38038,
38039, 38040, 38041, 38042, 38043, 38044, 38045, 38046, 38047,
38048, 38049, 38050, 38051, 38052, 38053, 38054, 38055, 38056,
38057, 38058, 38059, 38060, 38061, 38062, 38063, 38064, 38065,
38066, 38067, 38068, 38069, 38070, 38071, 38072, 38073, 38074,
38075, 38076, 38077, 38078, 38079, 38080, 38081, 38082, 38083,
38084, 38085, 38086, 38087, 38088, 38089, 38090, 38091, 38092,
38093, 38094, 38095, 38096, 38097, 38098, 38099, 38100, 38101,
38102, 38103, 38104, 38105, 38106, 38107, 38108, 38109, 38110,
38111, 38112, 38113, 38114, 38115, 38116, 38117, 38118, 38119,
38120, 38121, 38122, 38123, 38124, 38125, 38126, 38127, 38128,
38129, 38130, 38131, 38132, 38133, 38134, 38135, 38136, 38137,
38138, 38139, 38140, 38141, 38142, 38143, 38144, 38145, 38146,
38147, 38148, 38149, 38150, 38151, 38152, 38153, 38154, 38155,
38156, 38157, 38158, 38159, 38160, 38161, 38162, 38163, 38164,
38165, 38166, 38167, 38168, 38169, 38170, 38171, 38172, 38173,
38174, 38175, 38176, 38177, 38178, 38179, 38180, 38181, 38182,
38183, 38184, 38185, 38186, 38187, 38188, 38189, 38190, 38191,
38192, 38193, 38194, 38195, 38196, 38197, 38198, 38199, 38200,
38201, 38202, 38203, 38204, 38205, 38206, 38207, 38208, 38209,
38210, 38211, 38212, 38213, 38214, 38215, 38216, 38217, 38218,
38219, 38220, 38221, 38222, 38223, 38224, 38225, 38226, 38227,
38228, 38229, 38230, 38231, 38232, 38233, 38234, 38235, 38236,
38237, 38238, 38239, 38240, 38241, 38242, 38243, 38244, 38245,
38246, 38247, 38248, 38249, 38250, 38251, 38252, 38253, 38254,
38255, 38256, 38257, 38258, 38259, 38260, 38261, 38262, 38263,
38264, 38265, 38266, 38267, 38268, 38269, 38270, 38271, 38272,
38273, 38274, 38275, 38276, 38277, 38278, 38279, 38280, 38281,
38282, 38283, 38284, 38285, 38286, 38287, 38288, 38289, 38290,
38291, 38292, 38293, 38294, 38295, 38296, 38297, 38298, 38299,
38300, 38301, 38302, 38303, 38304, 38305, 38306, 38307, 38308,
38309, 38310, 38311, 38312, 38313, 38314, 38315, 38316, 38317,
38318, 38319, 38320, 38321, 38322, 38323, 38324, 38325, 38326,
38327, 38328, 38329, 38330, 38331, 38332, 38333, 38334, 38335,
38336, 38337, 38338, 38339, 38340, 38341, 38342, 38343, 38344,
38345, 38346, 38347, 38348, 38349, 38350, 38351, 38352, 38353,
38354, 38355, 38356, 38357, 38358, 38359, 38360, 38361, 38362,
38363, 38364, 38365, 38366, 38367, 38368, 38369, 38370, 38371,
38372, 38373, 38374, 38375, 38376, 38377, 38378, 38379, 38380,
38381, 38382, 38383, 38384, 38385, 38386, 38387, 38388, 38389,
38390, 38391, 38392, 38393, 38394, 38395, 38396, 38397, 38398,
38399, 38400, 38401, 38402, 38403, 38404, 38405, 38406, 38407,
38408, 38409, 38410, 38411, 38412, 38413, 38414, 38415, 38416,
38417, 38418, 38419, 38420, 38421, 38422, 38423, 38424, 38425,
38426, 38427, 38428, 38429, 38430, 38431, 38432, 38433, 38434,
38435, 38436, 38437, 38438, 38439, 38440, 38441, 38442, 38443,
38444, 38445, 38446, 38447, 38448, 38449, 38450, 38451, 38452,
38453, 38454, 38455, 38456, 38457, 38458, 38459, 38460, 38461,
38462, 38463, 38464, 38465, 38466, 38467, 38468, 38469, 38470,
38471, 38472, 38473, 38474, 38475, 38476, 38477, 38478, 38479,
38480, 38481, 38482, 38483, 38484, 38485, 38486, 38487, 38488,
38489, 38490, 38491, 38492, 38493, 38494, 38495, 38496, 38497,
38498, 38499, 38500, 38501, 38502, 38503, 38504, 38505, 38506,
38507, 38508, 38509, 38510, 38511, 38512, 38513, 38514, 38515,
38516, 38517, 38518, 38519, 38520, 38521, 38522, 38523, 38524,
38525, 38526, 38527, 38528, 38529, 38530, 38531, 38532, 38533,
38534, 38535, 38536, 38537, 38538, 38539, 38540, 38541, 38542,
38543, 38544, 38545, 38546, 38547, 38548, 38549, 38550, 38551,
38552, 38553, 38554, 38555, 38556, 38557, 38558, 38559, 38560,
38561, 38562, 38563, 38564, 38565, 38566, 38567, 38568, 38569,
38570, 38571, 38572, 38573, 38574, 38575, 38576, 38577, 38578,
38579, 38580, 38581, 38582, 38583, 38584, 38585, 38586, 38587,
38588, 38589, 38590, 38591, 38592, 38593, 38594, 38595, 38596,
38597, 38598, 38599, 38600, 38601, 38602, 38603, 38604, 38605,
38606, 38607, 38608, 38609, 38610, 38611, 38612, 38613, 38614,
38615, 38616, 38617, 38618, 38619, 38620, 38621, 38622, 38623,
38624, 38625, 38626, 38627, 38628, 38629, 38630, 38631, 38632,
38633, 38634, 38635, 38636, 38637, 38638, 38639, 38640, 38641,
38642, 38643, 38644, 38645, 38646, 38647, 38648, 38649, 38650,
38651, 38652, 38653, 38654, 38655, 38656, 38657, 38658, 38659,
38660, 38661, 38662, 38663, 38664, 38665, 38666, 38667, 38668,
38669, 38670, 38671, 38672, 38673, 38674, 38675, 38676, 38677,
38678, 38679, 38680, 38681, 38682, 38683, 38684, 38685, 38686,
38687, 38688, 38689, 38690, 38691, 38692, 38693, 38694, 38695,
38696, 38697, 38698, 38699, 38700, 38701, 38702, 38703, 38704,
38705, 38706, 38707, 38708, 38709, 38710, 38711, 38712, 38713,
38714, 38715, 38716, 38717, 38718, 38719, 38720, 38721, 38722,
38723, 38724, 38725, 38726, 38727, 38728, 38729, 38730, 38731,
38732, 38733, 38734, 38735, 38736, 38737, 38738, 38739, 38740,
38741, 38742, 38743, 38744, 38745, 38746, 38747, 38748, 38749,
38750, 38751, 38752, 38753, 38754, 38755, 38756, 38757, 38758,
38759, 38760, 38761, 38762, 38763, 38764, 38765, 38766, 38767,
38768, 38769, 38770, 38771, 38772, 38773, 38774, 38775, 38776,
38777, 38778, 38779, 38780, 38781, 38782, 38783, 38784, 38785,
38786, 38787, 38788, 38789, 38790, 38791, 38792, 38793, 38794,
38795, 38796, 38797, 38798, 38799, 38800, 38801, 38802, 38803,
38804, 38805, 38806, 38807, 38808, 38809, 38810, 38811, 38812,
38813, 38814, 38815, 38816, 38817, 38818, 38819, 38820, 38821,
38822, 38823, 38824, 38825, 38826, 38827, 38828, 38829, 38830,
38831, 38832, 38833, 38834, 38835, 38836, 38837, 38838, 38839,
38840, 38841, 38842, 38843, 38844, 38845, 38846, 38847, 38848,
38849, 38850, 38851, 38852, 38853, 38854, 38855, 38856, 38857,
38858, 38859, 38860, 38861, 38862, 38863, 38864, 38865, 38866,
38867, 38868, 38869, 38870, 38871, 38872, 38873, 38874, 38875,
38876, 38877, 38878, 38879, 38880, 38881, 38882, 38883, 38884,
38885, 38886, 38887, 38888, 38889, 38890, 38891, 38892, 38893,
38894, 38895, 38896, 38897, 38898, 38899, 38900, 38901, 38902,
38903, 38904, 38905, 38906, 38907, 38908, 38909, 38910, 38911,
38912, 38913, 38914, 38915, 38916, 38917, 38918, 38919, 38920,
38921, 38922, 38923, 38924, 38925, 38926, 38927, 38928, 38929,
38930, 38931, 38932, 38933, 38934, 38935, 38936, 38937, 38938,
38939, 38940, 38941, 38942, 38943, 38944, 38945, 38946, 38947,
38948, 38949, 38950, 38951, 38952, 38953, 38954, 38955, 38956,
38957, 38958, 38959, 38960, 38961, 38962, 38963, 38964, 38965,
38966, 38967, 38968, 38969, 38970, 38971, 38972, 38973, 38974,
38975, 38976, 38977, 38978, 38979, 38980, 38981, 38982, 38983,
38984, 38985, 38986, 38987, 38988, 38989, 38990, 38991, 38992,
38993, 38994, 38995, 38996, 38997, 38998, 38999, 39000, 39001,
39002, 39003, 39004, 39005, 39006, 39007, 39008, 39009, 39010,
39011, 39012, 39013, 39014, 39015, 39016, 39017, 39018, 39019,
39020, 39021, 39022, 39023, 39024, 39025, 39026, 39027, 39028,
39029, 39030, 39031, 39032, 39033, 39034, 39035, 39036, 39037,
39038, 39039, 39040, 39041, 39042, 39043, 39044, 39045, 39046,
39047, 39048, 39049, 39050, 39051, 39052, 39053, 39054, 39055,
39056, 39057, 39058, 39059, 39060, 39061, 39062, 39063, 39064,
39065, 39066, 39067, 39068, 39069, 39070, 39071, 39072, 39073,
39074, 39075, 39076, 39077, 39078, 39079, 39080, 39081, 39082,
39083, 39084, 39085, 39086, 39087, 39088, 39089, 39090, 39091,
39092, 39093, 39094, 39095, 39096, 39097, 39098, 39099, 39100,
39101, 39102, 39103, 39104, 39105, 39106, 39107, 39108, 39109,
39110, 39111, 39112, 39113, 39114, 39115, 39116, 39117, 39118,
39119, 39120, 39121, 39122, 39123, 39124, 39125, 39126, 39127,
39128, 39129, 39130, 39131, 39132, 39133, 39134, 39135, 39136,
39137, 39138, 39139, 39140, 39141, 39142, 39143, 39144, 39145,
39146, 39147, 39148, 39149, 39150, 39151, 39152, 39153, 39154,
39155, 39156, 39157, 39158, 39159, 39160, 39161, 39162, 39163,
39164, 39165, 39166, 39167, 39168, 39169, 39170, 39171, 39172,
39173, 39174, 39175, 39176, 39177, 39178, 39179, 39180, 39181,
39182, 39183, 39184, 39185, 39186, 39187, 39188, 39189, 39190,
39191, 39192, 39193, 39194, 39195, 39196, 39197, 39198, 39199,
39200, 39201, 39202, 39203, 39204, 39205, 39206, 39207, 39208,
39209, 39210, 39211, 39212, 39213, 39214, 39215, 39216, 39217,
39218, 39219, 39220, 39221, 39222, 39223, 39224, 39225, 39226,
39227, 39228, 39229, 39230, 39231, 39232, 39233, 39234, 39235,
39236, 39237, 39238, 39239, 39240, 39241, 39242, 39243, 39244,
39245, 39246, 39247, 39248, 39249, 39250, 39251, 39252, 39253,
39254, 39255, 39256, 39257, 39258, 39259, 39260, 39261, 39262,
39263, 39264, 39265, 39266, 39267, 39268, 39269, 39270, 39271,
39272, 39273, 39274, 39275, 39276, 39277, 39278, 39279, 39280,
39281, 39282, 39283, 39284, 39285, 39286, 39287, 39288, 39289,
39290, 39291, 39292, 39293, 39294, 39295, 39296, 39297, 39298,
39299, 39300, 39301, 39302, 39303, 39304, 39305, 39306, 39307,
39308, 39309, 39310, 39311, 39312, 39313, 39314, 39315, 39316,
39317, 39318, 39319, 39320, 39321, 39322, 39323, 39324, 39325,
39326, 39327, 39328, 39329, 39330, 39331, 39332, 39333, 39334,
39335, 39336, 39337, 39338, 39339, 39340, 39341, 39342, 39343,
39344, 39345, 39346, 39347, 39348, 39349, 39350, 39351, 39352,
39353, 39354, 39355, 39356, 39357, 39358, 39359, 39360, 39361,
39362, 39363, 39364, 39365, 39366, 39367, 39368, 39369, 39370,
39371, 39372, 39373, 39374, 39375, 39376, 39377, 39378, 39379,
39380, 39381, 39382, 39383, 39384, 39385, 39386, 39387, 39388,
39389, 39390, 39391, 39392, 39393, 39394, 39395, 39396, 39397,
39398, 39399, 39400, 39401, 39402, 39403, 39404, 39405, 39406,
39407, 39408, 39409, 39410, 39411, 39412, 39413, 39414, 39415,
39416, 39417, 39418, 39419, 39420, 39421, 39422, 39423, 39424,
39425, 39426, 39427, 39428, 39429, 39430, 39431, 39432, 39433,
39434, 39435, 39436, 39437, 39438, 39439, 39440, 39441, 39442,
39443, 39444, 39445, 39446, 39447, 39448, 39449, 39450, 39451,
39452, 39453, 39454, 39455, 39456, 39457, 39458, 39459, 39460,
39461, 39462, 39463, 39464, 39465, 39466, 39467, 39468, 39469,
39470, 39471, 39472, 39473, 39474, 39475, 39476, 39477, 39478,
39479, 39480, 39481, 39482, 39483, 39484, 39485, 39486, 39487,
39488, 39489, 39490, 39491, 39492, 39493, 39494, 39495, 39496,
39497, 39498, 39499, 39500, 39501, 39502, 39503, 39504, 39505,
39506, 39507, 39508, 39509, 39510, 39511, 39512, 39513, 39514,
39515, 39516, 39517, 39518, 39519, 39520, 39521, 39522, 39523,
39524, 39525, 39526, 39527, 39528, 39529, 39530, 39531, 39532,
39533, 39534, 39535, 39536, 39537, 39538, 39539, 39540, 39541,
39542, 39543, 39544, 39545, 39546, 39547, 39548, 39549, 39550,
39551, 39552, 39553, 39554, 39555, 39556, 39557, 39558, 39559,
39560, 39561, 39562, 39563, 39564, 39565, 39566, 39567, 39568,
39569, 39570, 39571, 39572, 39573, 39574, 39575, 39576, 39577,
39578, 39579, 39580, 39581, 39582, 39583, 39584, 39585, 39586,
39587, 39588, 39589, 39590, 39591, 39592, 39593, 39594, 39595,
39596, 39597, 39598, 39599, 39600, 39601, 39602, 39603, 39604,
39605, 39606, 39607, 39608, 39609, 39610, 39611, 39612, 39613,
39614, 39615, 39616, 39617, 39618, 39619, 39620, 39621, 39622,
39623, 39624, 39625, 39626, 39627, 39628, 39629, 39630, 39631,
39632, 39633, 39634, 39635, 39636, 39637, 39638, 39639, 39640,
39641, 39642, 39643, 39644, 39645, 39646, 39647, 39648, 39649,
39650, 39651, 39652, 39653, 39654, 39655, 39656, 39657, 39658,
39659, 39660, 39661, 39662, 39663, 39664, 39665, 39666, 39667,
39668, 39669, 39670, 39671, 39672, 39673, 39674, 39675, 39676,
39677, 39678, 39679, 39680, 39681, 39682, 39683, 39684, 39685,
39686, 39687, 39688, 39689, 39690, 39691, 39692, 39693, 39694,
39695, 39696, 39697, 39698, 39699, 39700, 39701, 39702, 39703,
39704, 39705, 39706, 39707, 39708, 39709, 39710, 39711, 39712,
39713, 39714, 39715, 39716, 39717, 39718, 39719, 39720, 39721,
39722, 39723, 39724, 39725, 39726, 39727, 39728, 39729, 39730,
39731, 39732, 39733, 39734, 39735, 39736, 39737, 39738, 39739,
39740, 39741, 39742, 39743, 39744, 39745, 39746, 39747, 39748,
39749, 39750, 39751, 39752, 39753, 39754, 39755, 39756, 39757,
39758, 39759, 39760, 39761, 39762, 39763, 39764, 39765, 39766,
39767, 39768, 39769, 39770, 39771, 39772, 39773, 39774, 39775,
39776, 39777, 39778, 39779, 39780, 39781, 39782, 39783, 39784,
39785, 39786, 39787, 39788, 39789, 39790, 39791, 39792, 39793,
39794, 39795, 39796, 39797, 39798, 39799, 39800, 39801, 39802,
39803, 39804, 39805, 39806, 39807, 39808, 39809, 39810, 39811,
39812, 39813, 39814, 39815, 39816, 39817, 39818, 39819, 39820,
39821, 39822, 39823, 39824, 39825, 39826, 39827, 39828, 39829,
39830, 39831, 39832, 39833, 39834, 39835, 39836, 39837, 39838,
39839, 39840, 39841, 39842, 39843, 39844, 39845, 39846, 39847,
39848, 39849, 39850, 39851, 39852, 39853, 39854, 39855, 39856,
39857, 39858, 39859, 39860, 39861, 39862, 39863, 39864, 39865,
39866, 39867, 39868, 39869, 39870, 39871, 39872, 39873, 39874,
39875, 39876, 39877, 39878, 39879, 39880, 39881, 39882, 39883,
39884, 39885, 39886, 39887, 39888, 39889, 39890, 39891, 39892,
39893, 39894, 39895, 39896, 39897, 39898, 39899, 39900, 39901,
39902, 39903, 39904, 39905, 39906, 39907, 39908, 39909, 39910,
39911, 39912, 39913, 39914, 39915, 39916, 39917, 39918, 39919,
39920, 39921, 39922, 39923, 39924, 39925, 39926, 39927, 39928,
39929, 39930, 39931, 39932, 39933, 39934, 39935, 39936, 39937,
39938, 39939, 39940, 39941, 39942, 39943, 39944, 39945, 39946,
39947, 39948, 39949, 39950, 39951, 39952, 39953, 39954, 39955,
39956, 39957, 39958, 39959, 39960, 39961, 39962, 39963, 39964,
39965, 39966, 39967, 39968, 39969, 39970, 39971, 39972, 39973,
39974, 39975, 39976, 39977, 39978, 39979, 39980, 39981, 39982,
39983, 39984, 39985, 39986, 39987, 39988, 39989, 39990, 39991,
39992, 39993, 39994, 39995, 39996, 39997, 39998, 39999, 40000,
40001, 40002, 40003, 40004, 40005, 40006, 40007, 40008, 40009,
40010, 40011, 40012, 40013, 40014, 40015, 40016, 40017, 40018,
40019, 40020, 40021, 40022, 40023, 40024, 40025, 40026, 40027,
40028, 40029, 40030, 40031, 40032, 40033, 40034, 40035, 40036,
40037, 40038, 40039, 40040, 40041, 40042, 40043, 40044, 40045,
40046, 40047, 40048, 40049, 40050, 40051, 40052, 40053, 40054,
40055, 40056, 40057, 40058, 40059, 40060, 40061, 40062, 40063,
40064, 40065, 40066, 40067, 40068, 40069, 40070, 40071, 40072,
40073, 40074, 40075, 40076, 40077, 40078, 40079, 40080, 40081,
40082, 40083, 40084, 40085, 40086, 40087, 40088, 40089, 40090,
40091, 40092, 40093, 40094, 40095, 40096, 40097, 40098, 40099,
40100, 40101, 40102, 40103, 40104, 40105, 40106, 40107, 40108,
40109, 40110, 40111, 40112, 40113, 40114, 40115, 40116, 40117,
40118, 40119, 40120, 40121, 40122, 40123, 40124, 40125, 40126,
40127, 40128, 40129, 40130, 40131, 40132, 40133, 40134, 40135,
40136, 40137, 40138, 40139, 40140, 40141, 40142, 40143, 40144,
40145, 40146, 40147, 40148, 40149, 40150, 40151, 40152, 40153,
40154, 40155, 40156, 40157, 40158, 40159, 40160, 40161, 40162,
40163, 40164, 40165, 40166, 40167, 40168, 40169, 40170, 40171,
40172, 40173, 40174, 40175, 40176, 40177, 40178, 40179, 40180,
40181, 40182, 40183, 40184, 40185, 40186, 40187, 40188, 40189,
40190, 40191, 40192, 40193, 40194, 40195, 40196, 40197, 40198,
40199, 40200, 40201, 40202, 40203, 40204, 40205, 40206, 40207,
40208, 40209, 40210, 40211, 40212, 40213, 40214, 40215, 40216,
40217, 40218, 40219, 40220, 40221, 40222, 40223, 40224, 40225,
40226, 40227, 40228, 40229, 40230, 40231, 40232, 40233, 40234,
40235, 40236, 40237, 40238, 40239, 40240, 40241, 40242, 40243,
40244, 40245, 40246, 40247, 40248, 40249, 40250, 40251, 40252,
40253, 40254, 40255, 40256, 40257, 40258, 40259, 40260, 40261,
40262, 40263, 40264, 40265, 40266, 40267, 40268, 40269, 40270,
40271, 40272, 40273, 40274, 40275, 40276, 40277, 40278, 40279,
40280, 40281, 40282, 40283, 40284, 40285, 40286, 40287, 40288,
40289, 40290, 40291, 40292, 40293, 40294, 40295, 40296, 40297,
40298, 40299, 40300, 40301, 40302, 40303, 40304, 40305, 40306,
40307, 40308, 40309, 40310, 40311, 40312, 40313, 40314, 40315,
40316, 40317, 40318, 40319, 40320, 40321, 40322, 40323, 40324,
40325, 40326, 40327, 40328, 40329, 40330, 40331, 40332, 40333,
40334, 40335, 40336, 40337, 40338, 40339, 40340, 40341, 40342,
40343, 40344, 40345, 40346, 40347, 40348, 40349, 40350, 40351,
40352, 40353, 40354, 40355, 40356, 40357, 40358, 40359, 40360,
40361, 40362, 40363, 40364, 40365, 40366, 40367, 40368, 40369,
40370, 40371, 40372, 40373, 40374, 40375, 40376, 40377, 40378,
40379, 40380, 40381, 40382, 40383, 40384, 40385, 40386, 40387,
40388, 40389, 40390, 40391, 40392, 40393, 40394, 40395, 40396,
40397, 40398, 40399, 40400, 40401, 40402, 40403, 40404, 40405,
40406, 40407, 40408, 40409, 40410, 40411, 40412, 40413, 40414,
40415, 40416, 40417, 40418, 40419, 40420, 40421, 40422, 40423,
40424, 40425, 40426, 40427, 40428, 40429, 40430, 40431, 40432,
40433, 40434, 40435, 40436, 40437, 40438, 40439, 40440, 40441,
40442, 40443, 40444, 40445, 40446, 40447, 40448, 40449, 40450,
40451, 40452, 40453, 40454, 40455, 40456, 40457, 40458, 40459,
40460, 40461, 40462, 40463, 40464, 40465, 40466, 40467, 40468,
40469, 40470, 40471, 40472, 40473, 40474, 40475, 40476, 40477,
40478, 40479, 40480, 40481, 40482, 40483, 40484, 40485, 40486,
40487, 40488, 40489, 40490, 40491, 40492, 40493, 40494, 40495,
40496, 40497, 40498, 40499, 40500, 40501, 40502, 40503, 40504,
40505, 40506, 40507, 40508, 40509, 40510, 40511, 40512, 40513,
40514, 40515, 40516, 40517, 40518, 40519, 40520, 40521, 40522,
40523, 40524, 40525, 40526, 40527, 40528, 40529, 40530, 40531,
40532, 40533, 40534, 40535, 40536, 40537, 40538, 40539, 40540,
40541, 40542, 40543, 40544, 40545, 40546, 40547, 40548, 40549,
40550, 40551, 40552, 40553, 40554, 40555, 40556, 40557,
40558, 40559, 40560, 40561, 40562, 40563, 40564, 40565, 40566,
40567, 40568, 40569, 40570, 40571, 40572, 40573, 40574, 40575,
40576, 40577, 40578, 40579, 40580, 40581, 40582, 40583, 40584,
40585, 40586, 40587, 40588, 40589, 40590, 40591, 40592, 40593,
40594, 40595, 40596, 40597, 40598, 40599, 40600, 40601, 40602,
40603, 40604, 40605, 40606, 40607, 40608, 40609, 40610, 40611,
40612, 40613, 40614, 40615, 40616, 40617, 40618, 40619, 40620,
40621, 40622, 40623, 40624, 40625, 40626, 40627, 40628, 40629,
40630, 40631, 40632, 40633, 40634, 40635, 40636, 40637, 40638,
40639, 40640, 40641, 40642, 40643, 40644, 40645, 40646, 40647,
40648, 40649, 40650, 40651, 40652, 40653, 40654, 40655, 40656,
40657, 40658, 40659, 40660, 40661, 40662, 40663, 40664, 40665,
40666, 40667, 40668, 40669, 40670, 40671, 40672, 40673, 40674,
40675, 40676, 40677, 40678, 40679, 40680, 40681, 40682, 40683,
40684, 40685, 40686, 40687, 40688, 40689, 40690, 40691, 40692,
40693, 40694, 40695, 40696, 40697, 40698, 40699, 40700, 40701,
40702, 40703, 40704, 40705, 40706, 40707, 40708, 40709, 40710,
40711, 40712, 40713, 40714, 40715, 40716, 40717, 40718, 40719,
40720, 40721, 40722, 40723, 40724, 40725, 40726, 40727, 40728,
40729, 40730, 40731, 40732, 40733, 40734, 40735, 40736, 40737,
40738, 40739, 40740, 40741, 40742, 40743, 40744, 40745, 40746,
40747, 40748, 40749, 40750, 40751, 40752, 40753, 40754, 40755,
40756, 40757, 40758, 40759, 40760, 40761, 40762, 40763, 40764,
40765, 40766, 40767, 40768, 40769, 40770, 40771, 40772, 40773,
40774, 40775, 40776, 40777, 40778, 40779, 40780, 40781, 40782,
40783, 40784, 40785, 40786, 40787, 40788, 40789, 40790, 40791,
40792, 40793, 40794, 40795, 40796, 40797, 40798, 40799, 40800,
40801, 40802, 40803, 40804, 40805, 40806, 40807, 40808, 40809,
40810, 40811, 40812, 40813, 40814, 40815, 40816, 40817, 40818,
40819, 40820, 40821, 40822, 40823, 40824, 40825, 40826, 40827,
40828, 40829, 40830, 40831, 40832, 40833, 40834, 40835, 40836,
40837, 40838, 40839, 40840, 40841, 40842, 40843, 40844, 40845,
40846, 40847, 40848, 40849, 40850, 40851, 40852, 40853, 40854,
40855, 40856, 40857, 40858, 40859, 40860, 40861, 40862, 40863,
40864, 40865, 40866, 40867, 40868, 40869, 40870, 40871, 40872,
40873, 40874, 40875, 40876, 40877, 40878, 40879, 40880, 40881,
40882, 40883, 40884, 40885, 40886, 40887, 40888, 40889, 40890,
40891, 40892, 40893, 40894, 40895, 40896, 40897, 40898, 40899,
40900, 40901, 40902, 40903, 40904, 40905, 40906, 40907, 40908,
40909, 40910, 40911, 40912, 40913, 40914, 40915, 40916, 40917,
40918, 40919, 40920, 40921, 40922, 40923, 40924, 40925, 40926,
40927, 40928, 40929, 40930, 40931, 40932, 40933, 40934, 40935,
40936, 40937, 40938, 40939, 40940, 40941, 40942, 40943, 40944,
40945, 40946, 40947, 40948, 40949, 40950, 40951, 40952, 40953,
40954, 40955, 40956, 40957, 40958, 40959, 40960, 40961, 40962,
40963, 40964, 40965, 40966, 40967, 40968, 40969, 40970, 40971,
40972, 40973, 40974, 40975, 40976, 40977, 40978, 40979, 40980,
40981, 40982, 40983, 40984, 40985, 40986, 40987, 40988, 40989,
40990, 40991, 40992, 40993, 40994, 40995, 40996, 40997, 40998,
40999, 41000, 41001, 41002, 41003, 41004, 41005, 41006, 41007,
41008, 41009, 41010, 41011, 41012, 41013, 41014, 41015, 41016,
41017, 41018, 41019, 41020, 41021, 41022, 41023, 41024, 41025,
41026, 41027, 41028, 41029, 41030, 41031, 41032, 41033, 41034,
41035, 41036, 41037, 41038, 41039, 41040, 41041, 41042, 41043,
41044, 41045, 41046, 41047, 41048, 41049, 41050, 41051, 41052,
41053, 41054, 41055, 41056, 41057, 41058, 41059, 41060, 41061,
41062, 41063, 41064, 41065, 41066, 41067, 41068, 41069, 41070,
41071, 41072, 41073, 41074, 41075, 41076, 41077, 41078, 41079,
41080, 41081, 41082, 41083, 41084, 41085, 41086, 41087, 41088,
41089, 41090, 41091, 41092, 41093, 41094, 41095, 41096, 41097,
41098, 41099, 41100, 41101, 41102, 41103, 41104, 41105, 41106,
41107, 41108, 41109, 41110, 41111, 41112, 41113, 41114, 41115,
41116, 41117, 41118, 41119, 41120, 41121, 41122, 41123, 41124,
41125, 41126, 41127, 41128, 41129, 41130, 41131, 41132, 41133,
41134, 41135, 41136, 41137, 41138, 41139, 41140, 41141, 41142,
41143, 41144, 41145, 41146, 41147, 41148, 41149, 41150, 41151,
41152, 41153, 41154, 41155, 41156, 41157, 41158, 41159, 41160,
41161, 41162, 41163, 41164, 41165, 41166, 41167, 41168, 41169,
41170, 41171, 41172, 41173, 41174, 41175, 41176, 41177, 41178,
41179, 41180, 41181, 41182, 41183, 41184, 41185, 41186, 41187,
41188, 41189, 41190, 41191, 41192, 41193, 41194, 41195, 41196,
41197, 41198, 41199, 41200, 41201, 41202, 41203, 41204, 41205,
41206, 41207, 41208, 41209, 41210, 41211, 41212, 41213, 41214,
41215, 41216, 41217, 41218, 41219, 41220, 41221, 41222, 41223,
41224, 41225, 41226, 41227, 41228, 41229, 41230, 41231, 41232,
41233, 41234, 41235, 41236, 41237, 41238, 41239, 41240, 41241,
41242, 41243, 41244, 41245, 41246, 41247, 41248, 41249, 41250,
41251, 41252, 41253, 41254, 41255, 41256, 41257, 41258, 41259,
41260, 41261, 41262, 41263, 41264, 41265, 41266, 41267, 41268,
41269, 41270, 41271, 41272, 41273, 41274, 41275, 41276, 41277,
41278, 41279, 41280, 41281, 41282, 41283, 41284, 41285, 41286,
41287, 41288, 41289, 41290, 41291, 41292, 41293, 41294, 41295,
41296, 41297, 41298, 41299, 41300, 41301, 41302, 41303, 41304,
41305, 41306, 41307, 41308, 41309, 41310, 41311, 41312, 41313,
41314, 41315, 41316, 41317, 41318, 41319, 41320, 41321, 41322,
41323, 41324, 41325, 41326, 41327, 41328, 41329, 41330, 41331,
41332, 41333, 41334, 41335, 41336, 41337, 41338, 41339, 41340,
41341, 41342, 41343, 41344, 41345, 41346, 41347, 41348, 41349,
41350, 41351, 41352, 41353, 41354, 41355, 41356, 41357, 41358,
41359, 41360, 41361, 41362, 41363, 41364, 41365, 41366, 41367,
41368, 41369, 41370, 41371, 41372, 41373, 41374, 41375, 41376,
41377, 41378, 41379, 41380, 41381, 41382, 41383, 41384, 41385,
41386, 41387, 41388, 41389, 41390, 41391, 41392, 41393, 41394,
41395, 41396, 41397, 41398, 41399, 41400, 41401, 41402, 41403,
41404, 41405, 41406, 41407, 41408, 41409, 41410, 41411, 41412,
41413, 41414, 41415, 41416, 41417, 41418, 41419, 41420, 41421,
41422, 41423, 41424, 41425, 41426, 41427, 41428, 41429, 41430,
41431, 41432, 41433, 41434, 41435, 41436, 41437, 41438, 41439,
41440, 41441, 41442, 41443, 41444, 41445, 41446, 41447, 41448,
41449, 41450, 41451, 41452, 41453, 41454, 41455, 41456, 41457,
41458, 41459, 41460, 41461, 41462, 41463, 41464, 41465, 41466,
41467, 41468, 41469, 41470, 41471, 41472, 41473, 41474, 41475,
41476, 41477, 41478, 41479, 41480, 41481, 41482, 41483, 41484,
41485, 41486, 41487, 41488, 41489, 41490, 41491, 41492, 41493,
41494, 41495, 41496, 41497, 41498, 41499, 41500, 41501, 41502,
41503, 41504, 41505, 41506, 41507, 41508, 41509, 41510, 41511,
41512, 41513, 41514, 41515, 41516, 41517, 41518, 41519, 41520,
41521, 41522, 41523, 41524, 41525, 41526, 41527, 41528, 41529,
41530, 41531, 41532, 41533, 41534, 41535, 41536, 41537, 41538,
41539, 41540, 41541, 41542, 41543, 41544, 41545, 41546, 41547,
41548, 41549, 41550, 41551, 41552, 41553, 41554, 41555, 41556,
41557, 41558, 41559, 41560, 41561, 41562, 41563, 41564, 41565,
41566, 41567, 41568, 41569, 41570, 41571, 41572, 41573, 41574,
41575, 41576, 41577, 41578, 41579, 41580, 41581, 41582, 41583,
41584, 41585, 41586, 41587, 41588, 41589, 41590, 41591, 41592,
41593, 41594, 41595, 41596, 41597, 41598, 41599, 41600, 41601,
41602, 41603, 41604, 41605, 41606, 41607, 41608, 41609, 41610,
41611, 41612, 41613, 41614, 41615, 41616, 41617, 41618, 41619,
41620, 41621, 41622, 41623, 41624, 41625, 41626, 41627, 41628,
41629, 41630, 41631, 41632, 41633, 41634, 41635, 41636, 41637,
41638, 41639, 41640, 41641, 41642, 41643, 41644, 41645, 41646,
41647, 41648, 41649, 41650, 41651, 41652, 41653, 41654, 41655,
41656, 41657, 41658, 41659, 41660, 41661, 41662, 41663, 41664,
41665, 41666, 41667, 41668, 41669, 41670, 41671, 41672, 41673,
41674, 41675, 41676, 41677, 41678, 41679, 41680, 41681, 41682,
41683, 41684, 41685, 41686, 41687, 41688, 41689, 41690, 41691,
41692, 41693, 41694, 41695, 41696, 41697, 41698, 41699, 41700,
41701, 41702, 41703, 41704, 41705, 41706, 41707, 41708, 41709,
41710, 41711, 41712, 41713, 41714, 41715, 41716, 41717, 41718,
41719, 41720, 41721, 41722, 41723, 41724, 41725, 41726, 41727,
41728, 41729, 41730, 41731, 41732, 41733, 41734, 41735, 41736,
41737, 41738, 41739, 41740, 41741, 41742, 41743, 41744, 41745,
41746, 41747, 41748, 41749, 41750, 41751, 41752, 41753, 41754,
41755, 41756, 41757, 41758, 41759, 41760, 41761, 41762, 41763,
41764, 41765, 41766, 41767, 41768, 41769, 41770, 41771, 41772,
41773, 41774, 41775, 41776, 41777, 41778, 41779, 41780, 41781,
41782, 41783, 41784, 41785, 41786, 41787, 41788, 41789, 41790,
41791, 41792, 41793, 41794, 41795, 41796, 41797, 41798, 41799,
41800, 41801, 41802, 41803, 41804, 41805, 41806, 41807, 41808,
41809, 41810, 41811, 41812, 41813, 41814, 41815, 41816, 41817,
41818, 41819, 41820, 41821, 41822, 41823, 41824, 41825, 41826,
41827, 41828, 41829, 41830, 41831, 41832, 41833, 41834, 41835,
41836, 41837, 41838, 41839, 41840, 41841, 41842, 41843, 41844,
41845, 41846, 41847, 41848, 41849, 41850, 41851, 41852, 41853,
41854, 41855, 41856, 41857, 41858, 41859, 41860, 41861, 41862,
41863, 41864, 41865, 41866, 41867, 41868, 41869, 41870, 41871,
41872, 41873, 41874, 41875, 41876, 41877, 41878, 41879, 41880,
41881, 41882, 41883, 41884, 41885, 41886, 41887, 41888, 41889,
41890, 41891, 41892, 41893, 41894, 41895, 41896, 41897, 41898,
41899, 41900, 41901, 41902, 41903, 41904, 41905, 41906, 41907,
41908, 41909, 41910, 41911, 41912, 41913, 41914, 41915, 41916,
41917, 41918, 41919, 41920, 41921, 41922, 41923, 41924, 41925,
41926, 41927, 41928, 41929, 41930, 41931, 41932, 41933, 41934,
41935, 41936, 41937, 41938, 41939, 41940, 41941, 41942, 41943,
41944, 41945, 41946, 41947, 41948, 41949, 41950, 41951, 41952,
41953, 41954, 41955, 41956, 41957, 41958, 41959, 41960, 41961,
41962, 41963, 41964, 41965, 41966, 41967, 41968, 41969, 41970,
41971, 41972, 41973, 41974, 41975, 41976, 41977, 41978, 41979,
41980, 41981, 41982, 41983, 41984, 41985, 41986, 41987, 41988,
41989, 41990, 41991, 41992, 41993, 41994, 41995, 41996, 41997,
41998, 41999, 42000, 42001, 42002, 42003, 42004, 42005, 42006,
42007, 42008, 42009, 42010, 42011, 42012, 42013, 42014, 42015,
42016, 42017, 42018, 42019, 42020, 42021, 42022, 42023, 42024,
42025, 42026, 42027, 42028, 42029, 42030, 42031, 42032, 42033,
42034, 42035, 42036, 42037, 42038, 42039, 42040, 42041, 42042,
42043, 42044, 42045, 42046, 42047, 42048, 42049, 42050, 42051,
42052, 42053, 42054, 42055, 42056, 42057, 42058, 42059, 42060,
42061, 42062, 42063, 42064, 42065, 42066, 42067, 42068, 42069,
42070, 42071, 42072, 42073, 42074, 42075, 42076, 42077, 42078,
42079, 42080, 42081, 42082, 42083, 42084, 42085, 42086, 42087,
42088, 42089, 42090, 42091, 42092, 42093, 42094, 42095, 42096,
42097, 42098, 42099, 42100, 42101, 42102, 42103, 42104, 42105,
42106, 42107, 42108, 42109, 42110, 42111, 42112, 42113, 42114,
42115, 42116, 42117, 42118, 42119, 42120, 42121, 42122, 42123,
42124, 42125, 42126, 42127, 42128, 42129, 42130, 42131, 42132,
42133, 42134, 42135, 42136, 42137, 42138, 42139, 42140, 42141,
42142, 42143, 42144, 42145, 42146, 42147, 42148, 42149, 42150,
42151, 42152, 42153, 42154, 42155, 42156, 42157, 42158, 42159,
42160, 42161, 42162, 42163, 42164, 42165, 42166, 42167, 42168,
42169, 42170, 42171, 42172, 42173, 42174, 42175, 42176, 42177,
42178, 42179, 42180, 42181, 42182, 42183, 42184, 42185, 42186,
42187, 42188, 42189, 42190, 42191, 42192, 42193, 42194, 42195,
42196, 42197, 42198, 42199, 42200, 42201, 42202, 42203, 42204,
42205, 42206, 42207, 42208, 42209, 42210, 42211, 42212, 42213,
42214, 42215, 42216, 42217, 42218, 42219, 42220, 42221, 42222,
42223, 42224, 42225, 42226, 42227, 42228, 42229, 42230, 42231,
42232, 42233, 42234, 42235, 42236, 42237, 42238, 42239, 42240,
42241, 42242, 42243, 42244, 42245, 42246, 42247, 42248, 42249,
42250, 42251, 42252, 42253, 42254, 42255, 42256, 42257, 42258,
42259, 42260, 42261, 42262, 42263, 42264, 42265, 42266, 42267,
42268, 42269, 42270, 42271, 42272, 42273, 42274, 42275, 42276,
42277, 42278, 42279, 42280, 42281, 42282, 42283, 42284, 42285,
42286, 42287, 42288, 42289, 42290, 42291, 42292, 42293, 42294,
42295, 42296, 42297, 42298, 42299, 42300, 42301, 42302, 42303,
42304, 42305, 42306, 42307, 42308, 42309, 42310, 42311, 42312,
42313, 42314, 42315, 42316, 42317, 42318, 42319, 42320, 42321,
42322, 42323, 42324, 42325, 42326, 42327, 42328, 42329, 42330,
42331, 42332, 42333, 42334, 42335, 42336, 42337, 42338, 42339,
42340, 42341, 42342, 42343, 42344, 42345, 42346, 42347, 42348,
42349, 42350, 42351, 42352, 42353, 42354, 42355, 42356, 42357,
42358, 42359, 42360, 42361, 42362, 42363, 42364, 42365, 42366,
42367, 42368, 42369, 42370, 42371, 42372, 42373, 42374, 42375,
42376, 42377, 42378, 42379, 42380, 42381, 42382, 42383, 42384,
42385, 42386, 42387, 42388, 42389, 42390, 42391, 42392, 42393,
42394, 42395, 42396, 42397, 42398, 42399, 42400, 42401, 42402,
42403, 42404, 42405, 42406, 42407, 42408, 42409, 42410, 42411,
42412, 42413, 42414, 42415, 42416, 42417, 42418, 42419, 42420,
42421, 42422, 42423, 42424, 42425, 42426, 42427, 42428, 42429,
42430, 42431, 42432, 42433, 42434, 42435, 42436, 42437, 42438,
42439, 42440, 42441, 42442, 42443, 42444, 42445, 42446, 42447,
42448, 42449, 42450, 42451, 42452, 42453, 42454, 42455, 42456,
42457, 42458, 42459, 42460, 42461, 42462, 42463, 42464, 42465,
42466, 42467, 42468, 42469, 42470, 42471, 42472, 42473, 42474,
42475, 42476, 42477, 42478, 42479, 42480, 42481, 42482, 42483,
42484, 42485, 42486, 42487, 42488, 42489, 42490, 42491, 42492,
42493, 42494, 42495, 42496, 42497, 42498, 42499, 42500, 42501,
42502, 42503, 42504, 42505, 42506, 42507, 42508, 42509, 42510,
42511, 42512, 42513, 42514, 42515, 42516, 42517, 42518, 42519,
42520, 42521, 42522, 42523, 42524, 42525, 42526, 42527, 42528,
42529, 42530, 42531, 42532, 42533, 42534, 42535, 42536, 42537,
42538, 42539, 42540, 42541, 42542, 42543, 42544, 42545, 42546,
42547, 42548, 42549, 42550, 42551, 42552, 42553, 42554, 42555,
42556, 42557, 42558, 42559, 42560, 42561, 42562, 42563, 42564,
42565, 42566, 42567, 42568, 42569, 42570, 42571, 42572, 42573,
42574, 42575, 42576, 42577, 42578, 42579, 42580, 42581, 42582,
42583, 42584, 42585, 42586, 42587, 42588, 42589, 42590, 42591,
42592, 42593, 42594, 42595, 42596, 42597, 42598, 42599, 42600,
42601, 42602, 42603, 42604, 42605, 42606, 42607, 42608, 42609,
42610, 42611, 42612, 42613, 42614, 42615, 42616, 42617, 42618,
42619, 42620, 42621, 42622, 42623, 42624, 42625, 42626, 42627,
42628, 42629, 42630, 42631, 42632, 42633, 42634, 42635, 42636,
42637, 42638, 42639, 42640, 42641, 42642, 42643, 42644, 42645,
42646, 42647, 42648, 42649, 42650, 42651, 42652, 42653, 42654,
42655, 42656, 42657, 42658, 42659, 42660, 42661, 42662, 42663,
42664, 42665, 42666, 42667, 42668, 42669, 42670, 42671, 42672,
42673, 42674, 42675, 42676, 42677, 42678, 42679, 42680, 42681,
42682, 42683, 42684, 42685, 42686, 42687, 42688, 42689, 42690,
42691, 42692, 42693, 42694, 42695, 42696, 42697, 42698, 42699,
42700, 42701, 42702, 42703, 42704, 42705, 42706, 42707, 42708,
42709, 42710, 42711, 42712, 42713, 42714, 42715, 42716, 42717,
42718, 42719, 42720, 42721, 42722, 42723, 42724, 42725, 42726,
42727, 42728, 42729, 42730, 42731, 42732, 42733, 42734, 42735,
42736, 42737, 42738, 42739, 42740, 42741, 42742, 42743, 42744,
42745, 42746, 42747, 42748, 42749, 42750, 42751, 42752, 42753,
42754, 42755, 42756, 42757, 42758, 42759, 42760, 42761, 42762,
42763, 42764, 42765, 42766, 42767, 42768, 42769, 42770, 42771,
42772, 42773, 42774, 42775, 42776, 42777, 42778, 42779, 42780,
42781, 42782, 42783, 42784, 42785, 42786, 42787, 42788, 42789,
42790, 42791, 42792, 42793, 42794, 42795, 42796, 42797, 42798,
42799, 42800, 42801, 42802, 42803, 42804, 42805, 42806, 42807,
42808, 42809, 42810, 42811, 42812, 42813, 42814, 42815, 42816,
42817, 42818, 42819, 42820, 42821, 42822, 42823, 42824, 42825,
42826, 42827, 42828, 42829, 42830, 42831, 42832, 42833, 42834,
42835, 42836, 42837, 42838, 42839, 42840, 42841, 42842, 42843,
42844, 42845, 42846, 42847, 42848, 42849, 42850, 42851, 42852,
42853, 42854, 42855, 42856, 42857, 42858, 42859, 42860, 42861,
42862, 42863, 42864, 42865, 42866, 42867, 42868, 42869, 42870,
42871, 42872, 42873, 42874, 42875, 42876, 42877, 42878, 42879,
42880, 42881, 42882, 42883, 42884, 42885, 42886, 42887, 42888,
42889, 42890, 42891, 42892, 42893, 42894, 42895, 42896, 42897,
42898, 42899, 42900, 42901, 42902, 42903, 42904, 42905, 42906,
42907, 42908, 42909, 42910, 42911, 42912, 42913, 42914, 42915,
42916, 42917, 42918, 42919, 42920, 42921, 42922, 42923, 42924,
42925, 42926, 42927, 42928, 42929, 42930, 42931, 42932, 42933,
42934, 42935, 42936, 42937, 42938, 42939, 42940, 42941, 42942,
42943, 42944, 42945, 42946, 42947, 42948, 42949, 42950, 42951,
42952, 42953, 42954, 42955, 42956, 42957, 42958, 42959, 42960,
42961, 42962, 42963, 42964, 42965, 42966, 42967, 42968, 42969,
42970, 42971, 42972, 42973, 42974, 42975, 42976, 42977, 42978,
42979, 42980, 42981, 42982, 42983, 42984, 42985, 42986, 42987,
42988, 42989, 42990, 42991, 42992, 42993, 42994, 42995, 42996,
42997, 42998, 42999, 43000, 43001, 43002, 43003, 43004, 43005,
43006, 43007, 43008, 43009, 43010, 43011, 43012, 43013, 43014,
43015, 43016, 43017, 43018, 43019, 43020, 43021, 43022, 43023,
43024, 43025, 43026, 43027, 43028, 43029, 43030, 43031, 43032,
43033, 43034, 43035, 43036, 43037, 43038, 43039, 43040, 43041,
43042, 43043, 43044, 43045, 43046, 43047, 43048, 43049, 43050,
43051, 43052, 43053, 43054, 43055, 43056, 43057, 43058, 43059,
43060, 43061, 43062, 43063, 43064, 43065, 43066, 43067,
43068, 43069, 43070, 43071, 43072, 43073, 43074, 43075, 43076,
43077, 43078, 43079, 43080, 43081, 43082, 43083, 43084, 43085,
43086, 43087, 43088, 43089, 43090, 43091, 43092, 43093, 43094,
43095, 43096, 43097, 43098, 43099, 43100, 43101, 43102, 43103,
43104, 43105, 43106, 43107, 43108, 43109, 43110, 43111, 43112,
43113, 43114, 43115, 43116, 43117, 43118, 43119, 43120, 43121,
43122, 43123, 43124, 43125, 43126, 43127, 43128, 43129, 43130,
43131, 43132, 43133, 43134, 43135, 43136, 43137, 43138, 43139,
43140, 43141, 43142, 43143, 43144, 43145, 43146, 43147, 43148,
43149, 43150, 43151, 43152, 43153, 43154, 43155, 43156, 43157,
43158, 43159, 43160, 43161, 43162, 43163, 43164, 43165, 43166,
43167, 43168, 43169, 43170, 43171, 43172, 43173, 43174, 43175,
43176, 43177, 43178, 43179, 43180, 43181, 43182, 43183, 43184,
43185, 43186, 43187, 43188, 43189, 43190, 43191, 43192, 43193,
43194, 43195, 43196, 43197, 43198, 43199, 43200, 43201, 43202,
43203, 43204, 43205, 43206, 43207, 43208, 43209, 43210, 43211,
43212, 43213, 43214, 43215, 43216, 43217, 43218, 43219, 43220,
43221, 43222, 43223, 43224, 43225, 43226, 43227, 43228, 43229,
43230, 43231, 43232, 43233, 43234, 43235, 43236, 43237, 43238,
43239, 43240, 43241, 43242, 43243, 43244, 43245, 43246, 43247,
43248, 43249, 43250, 43251, 43252, 43253, 43254, 43255, 43256,
43257, 43258, 43259, 43260, 43261, 43262, 43263, 43264, 43265,
43266, 43267, 43268, 43269, 43270, 43271, 43272, 43273, 43274,
43275, 43276, 43277, 43278, 43279, 43280, 43281, 43282, 43283,
43284, 43285, 43286, 43287, 43288, 43289, 43290, 43291, 43292,
43293, 43294, 43295, 43296, 43297, 43298, 43299, 43300, 43301,
43302, 43303, 43304, 43305, 43306, 43307, 43308, 43309, 43310,
43311, 43312, 43313, 43314, 43315, 43316, 43317, 43318, 43319,
43320, 43321, 43322, 43323, 43324, 43325, 43326, 43327, 43328,
43329, 43330, 43331, 43332, 43333, 43334, 43335, 43336, 43337,
43338, 43339, 43340, 43341, 43342, 43343, 43344, 43345, 43346,
43347, 43348, 43349, 43350, 43351, 43352, 43353, 43354, 43355,
43356, 43357, 43358, 43359, 43360, 43361, 43362, 43363, 43364,
43365, 43366, 43367, 43368, 43369, 43370, 43371, 43372, 43373,
43374, 43375, 43376, 43377, 43378, 43379, 43380, 43381, 43382,
43383, 43384, 43385, 43386, 43387, 43388, 43389, 43390, 43391,
43392, 43393, 43394, 43395, 43396, 43397, 43398, 43399, 43400,
43401, 43402, 43403, 43404, 43405, 43406, 43407, 43408, 43409,
43410, 43411, 43412, 43413, 43414, 43415, 43416, 43417, 43418,
43419, 43420, 43421, 43422, 43423, 43424, 43425, 43426, 43427,
43428, 43429, 43430, 43431, 43432, 43433, 43434, 43435, 43436,
43437, 43438, 43439, 43440, 43441, 43442, 43443, 43444, 43445,
43446, 43447, 43448, 43449, 43450, 43451, 43452, 43453, 43454,
43455, 43456, 43457, 43458, 43459, 43460, 43461, 43462, 43463,
43464, 43465, 43466, 43467, 43468, 43469, 43470, 43471, 43472,
43473, 43474, 43475, 43476, 43477, 43478, 43479, 43480, 43481,
43482, 43483, 43484, 43485, 43486, 43487, 43488, 43489, 43490,
43491, 43492, 43493, 43494, 43495, 43496, 43497, 43498, 43499,
43500, 43501, 43502, 43503, 43504, 43505, 43506, 43507, 43508,
43509, 43510, 43511, 43512, 43513, 43514, 43515, 43516, 43517,
43518, 43519, 43520, 43521, 43522, 43523, 43524, 43525, 43526,
43527, 43528, 43529, 43530, 43531, 43532, 43533, 43534, 43535,
43536, 43537, 43538, 43539, 43540, 43541, 43542, 43543, 43544,
43545, 43546, 43547, 43548, 43549, 43550, 43551, 43552, 43553,
43554, 43555, 43556, 43557, 43558, 43559, 43560, 43561, 43562,
43563, 43564, 43565, 43566, 43567, 43568, 43569, 43570, 43571,
43572, 43573, 43574, 43575, 43576, 43577, 43578, 43579, 43580,
43581, 43582, 43583, 43584, 43585, 43586, 43587, 43588, 43589,
43590, 43591, 43592, 43593, 43594, 43595, 43596, 43597, 43598,
43599, 43600, 43601, 43602, 43603, 43604, 43605, 43606, 43607,
43608, 43609, 43610, 43611, 43612, 43613, 43614, 43615, 43616,
43617, 43618, 43619, 43620, 43621, 43622, 43623, 43624, 43625,
43626, 43627, 43628, 43629, 43630, 43631, 43632, 43633, 43634,
43635, 43636, 43637, 43638, 43639, 43640, 43641, 43642, 43643,
43644, 43645, 43646, 43647, 43648, 43649, 43650, 43651, 43652,
43653, 43654, 43655, 43656, 43657, 43658, 43659, 43660, 43661,
43662, 43663, 43664, 43665, 43666, 43667, 43668, 43669, 43670,
43671, 43672, 43673, 43674, 43675, 43676, 43677, 43678, 43679,
43680, 43681, 43682, 43683, 43684, 43685, 43686, 43687, 43688,
43689, 43690, 43691, 43692, 43693, 43694, 43695, 43696, 43697,
43698, 43699, 43700, 43701, 43702, 43703, 43704, 43705, 43706,
43707, 43708, 43709, 43710, 43711, 43712, 43713, 43714, 43715,
43716, 43717, 43718, 43719, 43720, 43721, 43722, 43723, 43724,
43725, 43726, 43727, 43728, 43729, 43730, 43731, 43732, 43733,
43734, 43735, 43736, 43737, 43738, 43739, 43740, 43741, 43742,
43743, 43744, 43745, 43746, 43747, 43748, 43749, 43750, 43751,
43752, 43753, 43754, 43755, 43756, 43757, 43758, 43759, 43760,
43761, 43762, 43763, 43764, 43765, 43766, 43767, 43768, 43769,
43770, 43771, 43772, 43773, 43774, 43775, 43776, 43777, 43778,
43779, 43780, 43781, 43782, 43783, 43784, 43785, 43786, 43787,
43788, 43789, 43790, 43791, 43792, 43793, 43794, 43795, 43796,
43797, 43798, 43799, 43800, 43801, 43802, 43803, 43804, 43805,
43806, 43807, 43808, 43809, 43810, 43811, 43812, 43813, 43814,
43815, 43816, 43817, 43818, 43819, 43820, 43821, 43822, 43823,
43824, 43825, 43826, 43827, 43828, 43829, 43830, 43831, 43832,
43833, 43834, 43835, 43836, 43837, 43838, 43839, 43840, 43841,
43842, 43843, 43844, 43845, 43846, 43847, 43848, 43849, 43850,
43851, 43852, 43853, 43854, 43855, 43856, 43857, 43858, 43859,
43860, 43861, 43862, 43863, 43864, 43865, 43866, 43867, 43868,
43869, 43870, 43871, 43872, 43873, 43874, 43875, 43876, 43877,
43878, 43879, 43880, 43881, 43882, 43883, 43884, 43885, 43886,
43887, 43888, 43889, 43890, 43891, 43892, 43893, 43894, 43895,
43896, 43897, 43898, 43899, 43900, 43901, 43902, 43903, 43904,
43905, 43906, 43907, 43908, 43909, 43910, 43911, 43912, 43913,
43914, 43915, 43916, 43917, 43918, 43919, 43920, 43921, 43922,
43923, 43924, 43925, 43926, 43927, 43928, 43929, 43930, 43931,
43932, 43933, 43934, 43935, 43936, 43937, 43938, 43939, 43940,
43941, 43942, 43943, 43944, 43945, 43946, 43947, 43948, 43949,
43950, 43951, 43952, 43953, 43954, 43955, 43956, 43957, 43958,
43959, 43960, 43961, 43962, 43963, 43964, 43965, 43966, 43967,
43968, 43969, 43970, 43971, 43972, 43973, 43974, 43975, 43976,
43977, 43978, 43979, 43980, 43981, 43982, 43983, 43984, 43985,
43986, 43987, 43988, 43989, 43990, 43991, 43992, 43993, 43994,
43995, 43996, 43997, 43998, 43999, 44000, 44001, 44002, 44003,
44004, 44005, 44006, 44007, 44008, 44009, 44010, 44011, 44012,
44013, 44014, 44015, 44016, 44017, 44018, 44019, 44020, 44021,
44022, 44023, 44024, 44025, 44026, 44027, 44028, 44029, 44030,
44031, 44032, 44033, 44034, 44035, 44036, 44037, 44038, 44039,
44040, 44041, 44042, 44043, 44044, 44045, 44046, 44047, 44048,
44049, 44050, 44051, 44052, 44053, 44054, 44055, 44056, 44057,
44058, 44059, 44060, 44061, 44062, 44063, 44064, 44065, 44066,
44067, 44068, 44069, 44070, 44071, 44072, 44073, 44074, 44075,
44076, 44077, 44078, 44079, 44080, 44081, 44082, 44083, 44084,
44085, 44086, 44087, 44088, 44089, 44090, 44091, 44092, 44093,
44094, 44095, 44096, 44097, 44098, 44099, 44100, 44101, 44102,
44103, 44104, 44105, 44106, 44107, 44108, 44109, 44110, 44111,
44112, 44113, 44114, 44115, 44116, 44117, 44118, 44119, 44120,
44121, 44122, 44123, 44124, 44125, 44126, 44127, 44128, 44129,
44130, 44131, 44132, 44133, 44134, 44135, 44136, 44137, 44138,
44139, 44140, 44141, 44142, 44143, 44144, 44145, 44146, 44147,
44148, 44149, 44150, 44151, 44152, 44153, 44154, 44155, 44156,
44157, 44158, 44159, 44160, 44161, 44162, 44163, 44164, 44165,
44166, 44167, 44168, 44169, 44170, 44171, 44172, 44173, 44174,
44175, 44176, 44177, 44178, 44179, 44180, 44181, 44182, 44183,
44184, 44185, 44186, 44187, 44188, 44189, 44190, 44191, 44192,
44193, 44194, 44195, 44196, 44197, 44198, 44199, 44200, 44201,
44202, 44203, 44204, 44205, 44206, 44207, 44208, 44209, 44210,
44211, 44212, 44213, 44214, 44215, 44216, 44217, 44218, 44219,
44220, 44221, 44222, 44223, 44224, 44225, 44226, 44227, 44228,
44229, 44230, 44231, 44232, 44233, 44234, 44235, 44236, 44237,
44238, 44239, 44240, 44241, 44242, 44243, 44244, 44245, 44246,
44247, 44248, 44249, 44250, 44251, 44252, 44253, 44254, 44255,
44256, 44257, 44258, 44259, 44260, 44261, 44262, 44263, 44264,
44265, 44266, 44267, 44268, 44269, 44270, 44271, 44272, 44273,
44274, 44275, 44276, 44277, 44278, 44279, 44280, 44281, 44282,
44283, 44284, 44285, 44286, 44287, 44288, 44289, 44290, 44291,
44292, 44293, 44294, 44295, 44296, 44297, 44298, 44299, 44300,
44301, 44302, 44303, 44304, 44305, 44306, 44307, 44308, 44309,
44310, 44311, 44312, 44313, 44314, 44315, 44316, 44317, 44318,
44319, 44320, 44321, 44322, 44323, 44324, 44325, 44326, 44327,
44328, 44329, 44330, 44331, 44332, 44333, 44334, 44335, 44336,
44337, 44338, 44339, 44340, 44341, 44342, 44343, 44344, 44345,
44346, 44347, 44348, 44349, 44350, 44351, 44352, 44353, 44354,
44355, 44356, 44357, 44358, 44359, 44360, 44361, 44362, 44363,
44364, 44365, 44366, 44367, 44368, 44369, 44370, 44371, 44372,
44373, 44374, 44375, 44376, 44377, 44378, 44379, 44380, 44381,
44382, 44383, 44384, 44385, 44386, 44387, 44388, 44389, 44390,
44391, 44392, 44393, 44394, 44395, 44396, 44397, 44398, 44399,
44400, 44401, 44402, 44403, 44404, 44405, 44406, 44407, 44408,
44409, 44410, 44411, 44412, 44413, 44414, 44415, 44416, 44417,
44418, 44419, 44420, 44421, 44422, 44423, 44424, 44425, 44426,
44427, 44428, 44429, 44430, 44431, 44432, 44433, 44434, 44435,
44436, 44437, 44438, 44439, 44440, 44441, 44442, 44443, 44444,
44445, 44446, 44447, 44448, 44449, 44450, 44451, 44452, 44453,
44454, 44455, 44456, 44457, 44458, 44459, 44460, 44461, 44462,
44463, 44464, 44465, 44466, 44467, 44468, 44469, 44470, 44471,
44472, 44473, 44474, 44475, 44476, 44477, 44478, 44479, 44480,
44481, 44482, 44483, 44484, 44485, 44486, 44487, 44488, 44489,
44490, 44491, 44492, 44493, 44494, 44495, 44496, 44497, 44498,
44499, 44500, 44501, 44502, 44503, 44504, 44505, 44506, 44507,
44508, 44509, 44510, 44511, 44512, 44513, 44514, 44515, 44516,
44517, 44518, 44519, 44520, 44521, 44522, 44523, 44524, 44525,
44526, 44527, 44528, 44529, 44530, 44531, 44532, 44533, 44534,
44535, 44536, 44537, 44538, 44539, 44540, 44541, 44542, 44543,
44544, 44545, 44546, 44547, 44548, 44549, 44550, 44551, 44552,
44553, 44554, 44555, 44556, 44557, 44558, 44559, 44560, 44561,
44562, 44563, 44564, 44565, 44566, 44567, 44568, 44569, 44570,
44571, 44572, 44573, 44574, 44575, 44576, 44577, 44578, 44579,
44580, 44581, 44582, 44583, 44584, 44585, 44586, 44587, 44588,
44589, 44590, 44591, 44592, 44593, 44594, 44595, 44596, 44597,
44598, 44599, 44600, 44601, 44602, 44603, 44604, 44605, 44606,
44607, 44608, 44609, 44610, 44611, 44612, 44613, 44614, 44615,
44616, 44617, 44618, 44619, 44620, 44621, 44622, 44623, 44624,
44625, 44626, 44627, 44628, 44629, 44630, 44631, 44632, 44633,
44634, 44635, 44636, 44637, 44638, 44639, 44640, 44641, 44642,
44643, 44644, 44645, 44646, 44647, 44648, 44649, 44650, 44651,
44652, 44653, 44654, 44655, 44656, 44657, 44658, 44659, 44660,
44661, 44662, 44663, 44664, 44665, 44666, 44667, 44668, 44669,
44670, 44671, 44672, 44673, 44674, 44675, 44676, 44677, 44678,
44679, 44680, 44681, 44682, 44683, 44684, 44685, 44686, 44687,
44688, 44689, 44690, 44691, 44692, 44693, 44694, 44695, 44696,
44697, 44698, 44699, 44700, 44701, 44702, 44703, 44704, 44705,
44706, 44707, 44708, 44709, 44710, 44711, 44712, 44713, 44714,
44715, 44716, 44717, 44718, 44719, 44720, 44721, 44722, 44723,
44724, 44725, 44726, 44727, 44728, 44729, 44730, 44731, 44732,
44733, 44734, 44735, 44736, 44737, 44738, 44739, 44740, 44741,
44742, 44743, 44744, 44745, 44746, 44747, 44748, 44749, 44750,
44751, 44752, 44753, 44754, 44755, 44756, 44757, 44758, 44759,
44760, 44761, 44762, 44763, 44764, 44765, 44766, 44767, 44768,
44769, 44770, 44771, 44772, 44773, 44774, 44775, 44776, 44777,
44778, 44779, 44780, 44781, 44782, 44783, 44784, 44785, 44786,
44787, 44788, 44789, 44790, 44791, 44792, 44793, 44794, 44795,
44796, 44797, 44798, 44799, 44800, 44801, 44802, 44803, 44804,
44805, 44806, 44807, 44808, 44809, 44810, 44811, 44812, 44813,
44814, 44815, 44816, 44817, 44818, 44819, 44820, 44821, 44822,
44823, 44824, 44825, 44826, 44827, 44828, 44829, 44830, 44831,
44832, 44833, 44834, 44835, 44836, 44837, 44838, 44839, 44840,
44841, 44842, 44843, 44844, 44845, 44846, 44847, 44848, 44849,
44850, 44851, 44852, 44853, 44854, 44855, 44856, 44857, 44858,
44859, 44860, 44861, 44862, 44863, 44864, 44865, 44866, 44867,
44868, 44869, 44870, 44871, 44872, 44873, 44874, 44875, 44876,
44877, 44878, 44879, 44880, 44881, 44882, 44883, 44884, 44885,
44886, 44887, 44888, 44889, 44890, 44891, 44892, 44893, 44894,
44895, 44896, 44897, 44898, 44899, 44900, 44901, 44902, 44903,
44904, 44905, 44906, 44907, 44908, 44909, 44910, 44911, 44912,
44913, 44914, 44915, 44916, 44917, 44918, 44919, 44920, 44921,
44922, 44923, 44924, 44925, 44926, 44927, 44928, 44929, 44930,
44931, 44932, 44933, 44934, 44935, 44936, 44937, 44938, 44939,
44940, 44941, 44942, 44943, 44944, 44945, 44946, 44947, 44948,
44949, 44950, 44951, 44952, 44953, 44954, 44955, 44956, 44957,
44958, 44959, 44960, 44961, 44962, 44963, 44964, 44965, 44966,
44967, 44968, 44969, 44970, 44971, 44972, 44973, 44974, 44975,
44976, 44977, 44978, 44979, 44980, 44981, 44982, 44983, 44984,
44985, 44986, 44987, 44988, 44989, 44990, 44991, 44992, 44993,
44994, 44995, 44996, 44997, 44998, 44999, 45000, 45001, 45002,
45003, 45004, 45005, 45006, 45007, 45008, 45009, 45010, 45011,
45012, 45013, 45014, 45015, 45016, 45017, 45018, 45019, 45020,
45021, 45022, 45023, 45024, 45025, 45026, 45027, 45028, 45029,
45030, 45031, 45032, 45033, 45034, 45035, 45036, 45037, 45038,
45039, 45040, 45041, 45042, 45043, 45044, 45045, 45046, 45047,
45048, 45049, 45050, 45051, 45052, 45053, 45054, 45055, 45056,
45057, 45058, 45059, 45060, 45061, 45062, 45063, 45064, 45065,
45066, 45067, 45068, 45069, 45070, 45071, 45072, 45073, 45074,
45075, 45076, 45077, 45078, 45079, 45080, 45081, 45082, 45083,
45084, 45085, 45086, 45087, 45088, 45089, 45090, 45091, 45092,
45093, 45094, 45095, 45096, 45097, 45098, 45099, 45100, 45101,
45102, 45103, 45104, 45105, 45106, 45107, 45108, 45109, 45110,
45111, 45112, 45113, 45114, 45115, 45116, 45117, 45118, 45119,
45120, 45121, 45122, 45123, 45124, 45125, 45126, 45127, 45128,
45129, 45130, 45131, 45132, 45133, 45134, 45135, 45136, 45137,
45138, 45139, 45140, 45141, 45142, 45143, 45144, 45145, 45146,
45147, 45148, 45149, 45150, 45151, 45152, 45153, 45154, 45155,
45156, 45157, 45158, 45159, 45160, 45161, 45162, 45163, 45164,
45165, 45166, 45167, 45168, 45169, 45170, 45171, 45172, 45173,
45174, 45175, 45176, 45177, 45178, 45179, 45180, 45181, 45182,
45183, 45184, 45185, 45186, 45187, 45188, 45189, 45190, 45191,
45192, 45193, 45194, 45195, 45196, 45197, 45198, 45199, 45200,
45201, 45202, 45203, 45204, 45205, 45206, 45207, 45208, 45209,
45210, 45211, 45212, 45213, 45214, 45215, 45216, 45217, 45218,
45219, 45220, 45221, 45222, 45223, 45224, 45225, 45226, 45227,
45228, 45229, 45230, 45231, 45232, 45233, 45234, 45235, 45236,
45237, 45238, 45239, 45240, 45241, 45242, 45243, 45244, 45245,
45246, 45247, 45248, 45249, 45250, 45251, 45252, 45253, 45254,
45255, 45256, 45257, 45258, 45259, 45260, 45261, 45262, 45263,
45264, 45265, 45266, 45267, 45268, 45269, 45270, 45271, 45272,
45273, 45274, 45275, 45276, 45277, 45278, 45279, 45280, 45281,
45282, 45283, 45284, 45285, 45286, 45287, 45288, 45289, 45290,
45291, 45292, 45293, 45294, 45295, 45296, 45297, 45298, 45299,
45300, 45301, 45302, 45303, 45304, 45305, 45306, 45307, 45308,
45309, 45310, 45311, 45312, 45313, 45314, 45315, 45316, 45317,
45318, 45319, 45320, 45321, 45322, 45323, 45324, 45325, 45326,
45327, 45328, 45329, 45330, 45331, 45332, 45333, 45334, 45335,
45336, 45337, 45338, 45339, 45340, 45341, 45342, 45343, 45344,
45345, 45346, 45347, 45348, 45349, 45350, 45351, 45352, 45353,
45354, 45355, 45356, 45357, 45358, 45359, 45360, 45361, 45362,
45363, 45364, 45365, 45366, 45367, 45368, 45369, 45370, 45371,
45372, 45373, 45374, 45375, 45376, 45377, 45378, 45379, 45380,
45381, 45382, 45383, 45384, 45385, 45386, 45387, 45388, 45389,
45390, 45391, 45392, 45393, 45394, 45395, 45396, 45397, 45398,
45399, 45400, 45401, 45402, 45403, 45404, 45405, 45406, 45407,
45408, 45409, 45410, 45411, 45412, 45413, 45414, 45415, 45416,
45417, 45418, 45419, 45420, 45421, 45422, 45423, 45424, 45425,
45426, 45427, 45428, 45429, 45430, 45431, 45432, 45433, 45434,
45435, 45436, 45437, 45438, 45439, 45440, 45441, 45442, 45443,
45444, 45445, 45446, 45447, 45448, 45449, 45450, 45451, 45452,
45453, 45454, 45455, 45456, 45457, 45458, 45459, 45460, 45461,
45462, 45463, 45464, 45465, 45466, 45467, 45468, 45469, 45470,
45471, 45472, 45473, 45474, 45475, 45476, 45477, 45478, 45479,
45480, 45481, 45482, 45483, 45484, 45485, 45486, 45487, 45488,
45489, 45490, 45491, 45492, 45493, 45494, 45495, 45496, 45497,
45498, 45499, 45500, 45501, 45502, 45503, 45504, 45505, 45506,
45507, 45508, 45509, 45510, 45511, 45512, 45513, 45514, 45515,
45516, 45517, 45518, 45519, 45520, 45521, 45522, 45523, 45524,
45525, 45526, 45527, 45528, 45529, 45530, 45531, 45532, 45533,
45534, 45535, 45536, 45537, 45538, 45539, 45540, 45541, 45542,
45543, 45544, 45545, 45546, 45547, 45548, 45549, 45550, 45551,
45552, 45553, 45554, 45555, 45556, 45557, 45558, 45559, 45560,
45561, 45562, 45563, 45564, 45565, 45566, 45567, 45568, 45569,
45570, 45571, 45572, 45573, 45574, 45575, 45576, 45577,
45578, 45579, 45580, 45581, 45582, 45583, 45584, 45585, 45586,
45587, 45588, 45589, 45590, 45591, 45592, 45593, 45594, 45595,
45596, 45597, 45598, 45599, 45600, 45601, 45602, 45603, 45604,
45605, 45606, 45607, 45608, 45609, 45610, 45611, 45612, 45613,
45614, 45615, 45616, 45617, 45618, 45619, 45620, 45621, 45622,
45623, 45624, 45625, 45626, 45627, 45628, 45629, 45630, 45631,
45632, 45633, 45634, 45635, 45636, 45637, 45638, 45639, 45640,
45641, 45642, 45643, 45644, 45645, 45646, 45647, 45648, 45649,
45650, 45651, 45652, 45653, 45654, 45655, 45656, 45657, 45658,
45659, 45660, 45661, 45662, 45663, 45664, 45665, 45666, 45667,
45668, 45669, 45670, 45671, 45672, 45673, 45674, 45675, 45676,
45677, 45678, 45679, 45680, 45681, 45682, 45683, 45684, 45685,
45686, 45687, 45688, 45689, 45690, 45691, 45692, 45693, 45694,
45695, 45696, 45697, 45698, 45699, 45700, 45701, 45702, 45703,
45704, 45705, 45706, 45707, 45708, 45709, 45710, 45711, 45712,
45713, 45714, 45715, 45716, 45717, 45718, 45719, 45720, 45721,
45722, 45723, 45724, 45725, 45726, 45727, 45728, 45729, 45730,
45731, 45732, 45733, 45734, 45735, 45736, 45737, 45738, 45739,
45740, 45741, 45742, 45743, 45744, 45745, 45746, 45747, 45748,
45749, 45750, 45751, 45752, 45753, 45754, 45755, 45756, 45757,
45758, 45759, 45760, 45761, 45762, 45763, 45764, 45765, 45766,
45767, 45768, 45769, 45770, 45771, 45772, 45773, 45774, 45775,
45776, 45777, 45778, 45779, 45780, 45781, 45782, 45783, 45784,
45785, 45786, 45787, 45788, 45789, 45790, 45791, 45792, 45793,
45794, 45795, 45796, 45797, 45798, 45799, 45800, 45801, 45802,
45803, 45804, 45805, 45806, 45807, 45808, 45809, 45810, 45811,
45812, 45813, 45814, 45815, 45816, 45817, 45818, 45819, 45820,
45821, 45822, 45823, 45824, 45825, 45826, 45827, 45828, 45829,
45830, 45831, 45832, 45833, 45834, 45835, 45836, 45837, 45838,
45839, 45840, 45841, 45842, 45843, 45844, 45845, 45846, 45847,
45848, 45849, 45850, 45851, 45852, 45853, 45854, 45855, 45856,
45857, 45858, 45859, 45860, 45861, 45862, 45863, 45864, 45865,
45866, 45867, 45868, 45869, 45870, 45871, 45872, 45873, 45874,
45875, 45876, 45877, 45878, 45879, 45880, 45881, 45882, 45883,
45884, 45885, 45886, 45887, 45888, 45889, 45890, 45891, 45892,
45893, 45894, 45895, 45896, 45897, 45898, 45899, 45900, 45901,
45902, 45903, 45904, 45905, 45906, 45907, 45908, 45909, 45910,
45911, 45912, 45913, 45914, 45915, 45916, 45917, 45918, 45919,
45920, 45921, 45922, 45923, 45924, 45925, 45926, 45927, 45928,
45929, 45930, 45931, 45932, 45933, 45934, 45935, 45936, 45937,
45938, 45939, 45940, 45941, 45942, 45943, 45944, 45945, 45946,
45947, 45948, 45949, 45950, 45951, 45952, 45953, 45954, 45955,
45956, 45957, 45958, 45959, 45960, 45961, 45962, 45963, 45964,
45965, 45966, 45967, 45968, 45969, 45970, 45971, 45972, 45973,
45974, 45975, 45976, 45977, 45978, 45979, 45980, 45981, 45982,
45983, 45984, 45985, 45986, 45987, 45988, 45989, 45990, 45991,
45992, 45993, 45994, 45995, 45996, 45997, 45998, 45999, 46000,
46001, 46002, 46003, 46004, 46005, 46006, 46007, 46008, 46009,
46010, 46011, 46012, 46013, 46014, 46015, 46016, 46017, 46018,
46019, 46020, 46021, 46022, 46023, 46024, 46025, 46026, 46027,
46028, 46029, 46030, 46031, 46032, 46033, 46034, 46035, 46036,
46037, 46038, 46039, 46040, 46041, 46042, 46043, 46044, 46045,
46046, 46047, 46048, 46049, 46050, 46051, 46052, 46053, 46054,
46055, 46056, 46057, 46058, 46059, 46060, 46061, 46062, 46063,
46064, 46065, 46066, 46067, 46068, 46069, 46070, 46071, 46072,
46073, 46074, 46075, 46076, 46077, 46078, 46079, 46080, 46081,
46082, 46083, 46084, 46085, 46086, 46087, 46088, 46089, 46090,
46091, 46092, 46093, 46094, 46095, 46096, 46097, 46098, 46099,
46100, 46101, 46102, 46103, 46104, 46105, 46106, 46107, 46108,
46109, 46110, 46111, 46112, 46113, 46114, 46115, 46116, 46117,
46118, 46119, 46120, 46121, 46122, 46123, 46124, 46125, 46126,
46127, 46128, 46129, 46130, 46131, 46132, 46133, 46134, 46135,
46136, 46137, 46138, 46139, 46140, 46141, 46142, 46143, 46144,
46145, 46146, 46147, 46148, 46149, 46150, 46151, 46152, 46153,
46154, 46155, 46156, 46157, 46158, 46159, 46160, 46161, 46162,
46163, 46164, 46165, 46166, 46167, 46168, 46169, 46170, 46171,
46172, 46173, 46174, 46175, 46176, 46177, 46178, 46179, 46180,
46181, 46182, 46183, 46184, 46185, 46186, 46187, 46188, 46189,
46190, 46191, 46192, 46193, 46194, 46195, 46196, 46197, 46198,
46199, 46200, 46201, 46202, 46203, 46204, 46205, 46206, 46207,
46208, 46209, 46210, 46211, 46212, 46213, 46214, 46215, 46216,
46217, 46218, 46219, 46220, 46221, 46222, 46223, 46224, 46225,
46226, 46227, 46228, 46229, 46230, 46231, 46232, 46233, 46234,
46235, 46236, 46237, 46238, 46239, 46240, 46241, 46242, 46243,
46244, 46245, 46246, 46247, 46248, 46249, 46250, 46251, 46252,
46253, 46254, 46255, 46256, 46257, 46258, 46259, 46260, 46261,
46262, 46263, 46264, 46265, 46266, 46267, 46268, 46269, 46270,
46271, 46272, 46273, 46274, 46275, 46276, 46277, 46278, 46279,
46280, 46281, 46282, 46283, 46284, 46285, 46286, 46287, 46288,
46289, 46290, 46291, 46292, 46293, 46294, 46295, 46296, 46297,
46298, 46299, 46300, 46301, 46302, 46303, 46304, 46305, 46306,
46307, 46308, 46309, 46310, 46311, 46312, 46313, 46314, 46315,
46316, 46317, 46318, 46319, 46320, 46321, 46322, 46323, 46324,
46325, 46326, 46327, 46328, 46329, 46330, 46331, 46332, 46333,
46334, 46335, 46336, 46337, 46338, 46339, 46340, 46341, 46342,
46343, 46344, 46345, 46346, 46347, 46348, 46349, 46350, 46351,
46352, 46353, 46354, 46355, 46356, 46357, 46358, 46359, 46360,
46361, 46362, 46363, 46364, 46365, 46366, 46367, 46368, 46369,
46370, 46371, 46372, 46373, 46374, 46375, 46376, 46377, 46378,
46379, 46380, 46381, 46382, 46383, 46384, 46385, 46386, 46387,
46388, 46389, 46390, 46391, 46392, 46393, 46394, 46395, 46396,
46397, 46398, 46399, 46400, 46401, 46402, 46403, 46404, 46405,
46406, 46407, 46408, 46409, 46410, 46411, 46412, 46413, 46414,
46415, 46416, 46417, 46418, 46419, 46420, 46421, 46422, 46423,
46424, 46425, 46426, 46427, 46428, 46429, 46430, 46431, 46432,
46433, 46434, 46435, 46436, 46437, 46438, 46439, 46440, 46441,
46442, 46443, 46444, 46445, 46446, 46447, 46448, 46449, 46450,
46451, 46452, 46453, 46454, 46455, 46456, 46457, 46458, 46459,
46460, 46461, 46462, 46463, 46464, 46465, 46466, 46467, 46468,
46469, 46470, 46471, 46472, 46473, 46474, 46475, 46476, 46477,
46478, 46479, 46480, 46481, 46482, 46483, 46484, 46485, 46486,
46487, 46488, 46489, 46490, 46491, 46492, 46493, 46494, 46495,
46496, 46497, 46498, 46499, 46500, 46501, 46502, 46503, 46504,
46505, 46506, 46507, 46508, 46509, 46510, 46511, 46512, 46513,
46514, 46515, 46516, 46517, 46518, 46519, 46520, 46521, 46522,
46523, 46524, 46525, 46526, 46527, 46528, 46529, 46530, 46531,
46532, 46533, 46534, 46535, 46536, 46537, 46538, 46539, 46540,
46541, 46542, 46543, 46544, 46545, 46546, 46547, 46548, 46549,
46550, 46551, 46552, 46553, 46554, 46555, 46556, 46557, 46558,
46559, 46560, 46561, 46562, 46563, 46564, 46565, 46566, 46567,
46568, 46569, 46570, 46571, 46572, 46573, 46574, 46575, 46576,
46577, 46578, 46579, 46580, 46581, 46582, 46583, 46584, 46585,
46586, 46587, 46588, 46589, 46590, 46591, 46592, 46593, 46594,
46595, 46596, 46597, 46598, 46599, 46600, 46601, 46602, 46603,
46604, 46605, 46606, 46607, 46608, 46609, 46610, 46611, 46612,
46613, 46614, 46615, 46616, 46617, 46618, 46619, 46620, 46621,
46622, 46623, 46624, 46625, 46626, 46627, 46628, 46629, 46630,
46631, 46632, 46633, 46634, 46635, 46636, 46637, 46638, 46639,
46640, 46641, 46642, 46643, 46644, 46645, 46646, 46647, 46648,
46649, 46650, 46651, 46652, 46653, 46654, 46655, 46656, 46657,
46658, 46659, 46660, 46661, 46662, 46663, 46664, 46665, 46666,
46667, 46668, 46669, 46670, 46671, 46672, 46673, 46674, 46675,
46676, 46677, 46678, 46679, 46680, 46681, 46682, 46683, 46684,
46685, 46686, 46687, 46688, 46689, 46690, 46691, 46692, 46693,
46694, 46695, 46696, 46697, 46698, 46699, 46700, 46701, 46702,
46703, 46704, 46705, 46706, 46707, 46708, 46709, 46710, 46711,
46712, 46713, 46714, 46715, 46716, 46717, 46718, 46719, 46720,
46721, 46722, 46723, 46724, 46725, 46726, 46727, 46728, 46729,
46730, 46731, 46732, 46733, 46734, 46735, 46736, 46737, 46738,
46739, 46740, 46741, 46742, 46743, 46744, 46745, 46746, 46747,
46748, 46749, 46750, 46751, 46752, 46753, 46754, 46755, 46756,
46757, 46758, 46759, 46760, 46761, 46762, 46763, 46764, 46765,
46766, 46767, 46768, 46769, 46770, 46771, 46772, 46773, 46774,
46775, 46776, 46777, 46778, 46779, 46780, 46781, 46782, 46783,
46784, 46785, 46786, 46787, 46788, 46789, 46790, 46791, 46792,
46793, 46794, 46795, 46796, 46797, 46798, 46799, 46800, 46801,
46802, 46803, 46804, 46805, 46806, 46807, 46808, 46809, 46810,
46811, 46812, 46813, 46814, 46815, 46816, 46817, 46818, 46819,
46820, 46821, 46822, 46823, 46824, 46825, 46826, 46827, 46828,
46829, 46830, 46831, 46832, 46833, 46834, 46835, 46836, 46837,
46838, 46839, 46840, 46841, 46842, 46843, 46844, 46845, 46846,
46847, 46848, 46849, 46850, 46851, 46852, 46853, 46854, 46855,
46856, 46857, 46858, 46859, 46860, 46861, 46862, 46863, 46864,
46865, 46866, 46867, 46868, 46869, 46870, 46871, 46872, 46873,
46874, 46875, 46876, 46877, 46878, 46879, 46880, 46881, 46882,
46883, 46884, 46885, 46886, 46887, 46888, 46889, 46890, 46891,
46892, 46893, 46894, 46895, 46896, 46897, 46898, 46899, 46900,
46901, 46902, 46903, 46904, 46905, 46906, 46907, 46908, 46909,
46910, 46911, 46912, 46913, 46914, 46915, 46916, 46917, 46918,
46919, 46920, 46921, 46922, 46923, 46924, 46925, 46926, 46927,
46928, 46929, 46930, 46931, 46932, 46933, 46934, 46935, 46936,
46937, 46938, 46939, 46940, 46941, 46942, 46943, 46944, 46945,
46946, 46947, 46948, 46949, 46950, 46951, 46952, 46953, 46954,
46955, 46956, 46957, 46958, 46959, 46960, 46961, 46962, 46963,
46964, 46965, 46966, 46967, 46968, 46969, 46970, 46971, 46972,
46973, 46974, 46975, 46976, 46977, 46978, 46979, 46980, 46981,
46982, 46983, 46984, 46985, 46986, 46987, 46988, 46989, 46990,
46991, 46992, 46993, 46994, 46995, 46996, 46997, 46998, 46999,
47000, 47001, 47002, 47003, 47004, 47005, 47006, 47007, 47008,
47009, 47010, 47011, 47012, 47013, 47014, 47015, 47016, 47017,
47018, 47019, 47020, 47021, 47022, 47023, 47024, 47025, 47026,
47027, 47028, 47029, 47030, 47031, 47032, 47033, 47034, 47035,
47036, 47037, 47038, 47039, 47040, 47041, 47042, 47043, 47044,
47045, 47046, 47047, 47048, 47049, 47050, 47051, 47052, 47053,
47054, 47055, 47056, 47057, 47058, 47059, 47060, 47061, 47062,
47063, 47064, 47065, 47066, 47067, 47068, 47069, 47070, 47071,
47072, 47073, 47074, 47075, 47076, 47077, 47078, 47079, 47080,
47081, 47082, 47083, 47084, 47085, 47086, 47087, 47088, 47089,
47090, 47091, 47092, 47093, 47094, 47095, 47096, 47097, 47098,
47099, 47100, 47101, 47102, 47103, 47104, 47105, 47106, 47107,
47108, 47109, 47110, 47111, 47112, 47113, 47114, 47115, 47116,
47117, 47118, 47119, 47120, 47121, 47122, 47123, 47124, 47125,
47126, 47127, 47128, 47129, 47130, 47131, 47132, 47133, 47134,
47135, 47136, 47137, 47138, 47139, 47140, 47141, 47142, 47143,
47144, 47145, 47146, 47147, 47148, 47149, 47150, 47151, 47152,
47153, 47154, 47155, 47156, 47157, 47158, 47159, 47160, 47161,
47162, 47163, 47164, 47165, 47166, 47167, 47168, 47169, 47170,
47171, 47172, 47173, 47174, 47175, 47176, 47177, 47178, 47179,
47180, 47181, 47182, 47183, 47184, 47185, 47186, 47187, 47188,
47189, 47190, 47191, 47192, 47193, 47194, 47195, 47196, 47197,
47198, 47199, 47200, 47201, 47202, 47203, 47204, 47205, 47206,
47207, 47208, 47209, 47210, 47211, 47212, 47213, 47214, 47215,
47216, 47217, 47218, 47219, 47220, 47221, 47222, 47223, 47224,
47225, 47226, 47227, 47228, 47229, 47230, 47231, 47232, 47233,
47234, 47235, 47236, 47237, 47238, 47239, 47240, 47241, 47242,
47243, 47244, 47245, 47246, 47247, 47248, 47249, 47250, 47251,
47252, 47253, 47254, 47255, 47256, 47257, 47258, 47259, 47260,
47261, 47262, 47263, 47264, 47265, 47266, 47267, 47268, 47269,
47270, 47271, 47272, 47273, 47274, 47275, 47276, 47277, 47278,
47279, 47280, 47281, 47282, 47283, 47284, 47285, 47286, 47287,
47288, 47289, 47290, 47291, 47292, 47293, 47294, 47295, 47296,
47297, 47298, 47299, 47300, 47301, 47302, 47303, 47304, 47305,
47306, 47307, 47308, 47309, 47310, 47311, 47312, 47313, 47314,
47315, 47316, 47317, 47318, 47319, 47320, 47321, 47322, 47323,
47324, 47325, 47326, 47327, 47328, 47329, 47330, 47331, 47332,
47333, 47334, 47335, 47336, 47337, 47338, 47339, 47340, 47341,
47342, 47343, 47344, 47345, 47346, 47347, 47348, 47349, 47350,
47351, 47352, 47353, 47354, 47355, 47356, 47357, 47358, 47359,
47360, 47361, 47362, 47363, 47364, 47365, 47366, 47367, 47368,
47369, 47370, 47371, 47372, 47373, 47374, 47375, 47376, 47377,
47378, 47379, 47380, 47381, 47382, 47383, 47384, 47385, 47386,
47387, 47388, 47389, 47390, 47391, 47392, 47393, 47394, 47395,
47396, 47397, 47398, 47399, 47400, 47401, 47402, 47403, 47404,
47405, 47406, 47407, 47408, 47409, 47410, 47411, 47412, 47413,
47414, 47415, 47416, 47417, 47418, 47419, 47420, 47421, 47422,
47423, 47424, 47425, 47426, 47427, 47428, 47429, 47430, 47431,
47432, 47433, 47434, 47435, 47436, 47437, 47438, 47439, 47440,
47441, 47442, 47443, 47444, 47445, 47446, 47447, 47448, 47449,
47450, 47451, 47452, 47453, 47454, 47455, 47456, 47457, 47458,
47459, 47460, 47461, 47462, 47463, 47464, 47465, 47466, 47467,
47468, 47469, 47470, 47471, 47472, 47473, 47474, 47475, 47476,
47477, 47478, 47479, 47480, 47481, 47482, 47483, 47484, 47485,
47486, 47487, 47488, 47489, 47490, 47491, 47492, 47493, 47494,
47495, 47496, 47497, 47498, 47499, 47500, 47501, 47502, 47503,
47504, 47505, 47506, 47507, 47508, 47509, 47510, 47511, 47512,
47513, 47514, 47515, 47516, 47517, 47518, 47519, 47520, 47521,
47522, 47523, 47524, 47525, 47526, 47527, 47528, 47529, 47530,
47531, 47532, 47533, 47534, 47535, 47536, 47537, 47538, 47539,
47540, 47541, 47542, 47543, 47544, 47545, 47546, 47547, 47548,
47549, 47550, 47551, 47552, 47553, 47554, 47555, 47556, 47557,
47558, 47559, 47560, 47561, 47562, 47563, 47564, 47565, 47566,
47567, 47568, 47569, 47570, 47571, 47572, 47573, 47574, 47575,
47576, 47577, 47578, 47579, 47580, 47581, 47582, 47583, 47584,
47585, 47586, 47587, 47588, 47589, 47590, 47591, 47592, 47593,
47594, 47595, 47596, 47597, 47598, 47599, 47600, 47601, 47602,
47603, 47604, 47605, 47606, 47607, 47608, 47609, 47610, 47611,
47612, 47613, 47614, 47615, 47616, 47617, 47618, 47619, 47620,
47621, 47622, 47623, 47624, 47625, 47626, 47627, 47628, 47629,
47630, 47631, 47632, 47633, 47634, 47635, 47636, 47637, 47638,
47639, 47640, 47641, 47642, 47643, 47644, 47645, 47646, 47647,
47648, 47649, 47650, 47651, 47652, 47653, 47654, 47655, 47656,
47657, 47658, 47659, 47660, 47661, 47662, 47663, 47664, 47665,
47666, 47667, 47668, 47669, 47670, 47671, 47672, 47673, 47674,
47675, 47676, 47677, 47678, 47679, 47680, 47681, 47682, 47683,
47684, 47685, 47686, 47687, 47688, 47689, 47690, 47691, 47692,
47693, 47694, 47695, 47696, 47697, 47698, 47699, 47700, 47701,
47702, 47703, 47704, 47705, 47706, 47707, 47708, 47709, 47710,
47711, 47712, 47713, 47714, 47715, 47716, 47717, 47718, 47719,
47720, 47721, 47722, 47723, 47724, 47725, 47726, 47727, 47728,
47729, 47730, 47731, 47732, 47733, 47734, 47735, 47736, 47737,
47738, 47739, 47740, 47741, 47742, 47743, 47744, 47745, 47746,
47747, 47748, 47749, 47750, 47751, 47752, 47753, 47754, 47755,
47756, 47757, 47758, 47759, 47760, 47761, 47762, 47763, 47764,
47765, 47766, 47767, 47768, 47769, 47770, 47771, 47772, 47773,
47774, 47775, 47776, 47777, 47778, 47779, 47780, 47781, 47782,
47783, 47784, 47785, 47786, 47787, 47788, 47789, 47790, 47791,
47792, 47793, 47794, 47795, 47796, 47797, 47798, 47799, 47800,
47801, 47802, 47803, 47804, 47805, 47806, 47807, 47808, 47809,
47810, 47811, 47812, 47813, 47814, 47815, 47816, 47817, 47818,
47819, 47820, 47821, 47822, 47823, 47824, 47825, 47826, 47827,
47828, 47829, 47830, 47831, 47832, 47833, 47834, 47835, 47836,
47837, 47838, 47839, 47840, 47841, 47842, 47843, 47844, 47845,
47846, 47847, 47848, 47849, 47850, 47851, 47852, 47853, 47854,
47855, 47856, 47857, 47858, 47859, 47860, 47861, 47862, 47863,
47864, 47865, 47866, 47867, 47868, 47869, 47870, 47871, 47872,
47873, 47874, 47875, 47876, 47877, 47878, 47879, 47880, 47881,
47882, 47883, 47884, 47885, 47886, 47887, 47888, 47889, 47890,
47891, 47892, 47893, 47894, 47895, 47896, 47897, 47898, 47899,
47900, 47901, 47902, 47903, 47904, 47905, 47906, 47907, 47908,
47909, 47910, 47911, 47912, 47913, 47914, 47915, 47916, 47917,
47918, 47919, 47920, 47921, 47922, 47923, 47924, 47925, 47926,
47927, 47928, 47929, 47930, 47931, 47932, 47933, 47934, 47935,
47936, 47937, 47938, 47939, 47940, 47941, 47942, 47943, 47944,
47945, 47946, 47947, 47948, 47949, 47950, 47951, 47952, 47953,
47954, 47955, 47956, 47957, 47958, 47959, 47960, 47961, 47962,
47963, 47964, 47965, 47966, 47967, 47968, 47969, 47970, 47971,
47972, 47973, 47974, 47975, 47976, 47977, 47978, 47979, 47980,
47981, 47982, 47983, 47984, 47985, 47986, 47987, 47988, 47989,
47990, 47991, 47992, 47993, 47994, 47995, 47996, 47997, 47998,
47999, 48000, 48001, 48002, 48003, 48004, 48005, 48006, 48007,
48008, 48009, 48010, 48011, 48012, 48013, 48014, 48015, 48016,
48017, 48018, 48019, 48020, 48021, 48022, 48023, 48024, 48025,
48026, 48027, 48028, 48029, 48030, 48031, 48032, 48033, 48034,
48035, 48036, 48037, 48038, 48039, 48040, 48041, 48042, 48043,
48044, 48045, 48046, 48047, 48048, 48049, 48050, 48051, 48052,
48053, 48054, 48055, 48056, 48057, 48058, 48059, 48060, 48061,
48062, 48063, 48064, 48065, 48066, 48067, 48068, 48069, 48070,
48071, 48072, 48073, 48074, 48075, 48076, 48077, 48078, 48079,
48080, 48081, 48082, 48083, 48084, 48085, 48086, 48087,
48088, 48089, 48090, 48091, 48092, 48093, 48094, 48095, 48096,
48097, 48098, 48099, 48100, 48101, 48102, 48103, 48104, 48105,
48106, 48107, 48108, 48109, 48110, 48111, 48112, 48113, 48114,
48115, 48116, 48117, 48118, 48119, 48120, 48121, 48122, 48123,
48124, 48125, 48126, 48127, 48128, 48129, 48130, 48131, 48132,
48133, 48134, 48135, 48136, 48137, 48138, 48139, 48140, 48141,
48142, 48143, 48144, 48145, 48146, 48147, 48148, 48149, 48150,
48151, 48152, 48153, 48154, 48155, 48156, 48157, 48158, 48159,
48160, 48161, 48162, 48163, 48164, 48165, 48166, 48167, 48168,
48169, 48170, 48171, 48172, 48173, 48174, 48175, 48176, 48177,
48178, 48179, 48180, 48181, 48182, 48183, 48184, 48185, 48186,
48187, 48188, 48189, 48190, 48191, 48192, 48193, 48194, 48195,
48196, 48197, 48198, 48199, 48200, 48201, 48202, 48203, 48204,
48205, 48206, 48207, 48208, 48209, 48210, 48211, 48212, 48213,
48214, 48215, 48216, 48217, 48218, 48219, 48220, 48221, 48222,
48223, 48224, 48225, 48226, 48227, 48228, 48229, 48230, 48231,
48232, 48233, 48234, 48235, 48236, 48237, 48238, 48239, 48240,
48241, 48242, 48243, 48244, 48245, 48246, 48247, 48248, 48249,
48250, 48251, 48252, 48253, 48254, 48255, 48256, 48257, 48258,
48259, 48260, 48261, 48262, 48263, 48264, 48265, 48266, 48267,
48268, 48269, 48270, 48271, 48272, 48273, 48274, 48275, 48276,
48277, 48278, 48279, 48280, 48281, 48282, 48283, 48284, 48285,
48286, 48287, 48288, 48289, 48290, 48291, 48292, 48293, 48294,
48295, 48296, 48297, 48298, 48299, 48300, 48301, 48302, 48303,
48304, 48305, 48306, 48307, 48308, 48309, 48310, 48311, 48312,
48313, 48314, 48315, 48316, 48317, 48318, 48319, 48320, 48321,
48322, 48323, 48324, 48325, 48326, 48327, 48328, 48329, 48330,
48331, 48332, 48333, 48334, 48335, 48336, 48337, 48338, 48339,
48340, 48341, 48342, 48343, 48344, 48345, 48346, 48347, 48348,
48349, 48350, 48351, 48352, 48353, 48354, 48355, 48356, 48357,
48358, 48359, 48360, 48361, 48362, 48363, 48364, 48365, 48366,
48367, 48368, 48369, 48370, 48371, 48372, 48373, 48374, 48375,
48376, 48377, 48378, 48379, 48380, 48381, 48382, 48383, 48384,
48385, 48386, 48387, 48388, 48389, 48390, 48391, 48392, 48393,
48394, 48395, 48396, 48397, 48398, 48399, 48400, 48401, 48402,
48403, 48404, 48405, 48406, 48407, 48408, 48409, 48410, 48411,
48412, 48413, 48414, 48415, 48416, 48417, 48418, 48419, 48420,
48421, 48422, 48423, 48424, 48425, 48426, 48427, 48428, 48429,
48430, 48431, 48432, 48433, 48434, 48435, 48436, 48437, 48438,
48439, 48440, 48441, 48442, 48443, 48444, 48445, 48446, 48447,
48448, 48449, 48450, 48451, 48452, 48453, 48454, 48455, 48456,
48457, 48458, 48459, 48460, 48461, 48462, 48463, 48464, 48465,
48466, 48467, 48468, 48469, 48470, 48471, 48472, 48473, 48474,
48475, 48476, 48477, 48478, 48479, 48480, 48481, 48482, 48483,
48484, 48485, 48486, 48487, 48488, 48489, 48490, 48491, 48492,
48493, 48494, 48495, 48496, 48497, 48498, 48499, 48500, 48501,
48502, 48503, 48504, 48505, 48506, 48507, 48508, 48509, 48510,
48511, 48512, 48513, 48514, 48515, 48516, 48517, 48518, 48519,
48520, 48521, 48522, 48523, 48524, 48525, 48526, 48527, 48528,
48529, 48530, 48531, 48532, 48533, 48534, 48535, 48536, 48537,
48538, 48539, 48540, 48541, 48542, 48543, 48544, 48545, 48546,
48547, 48548, 48549, 48550, 48551, 48552, 48553, 48554, 48555,
48556, 48557, 48558, 48559, 48560, 48561, 48562, 48563, 48564,
48565, 48566, 48567, 48568, 48569, 48570, 48571, 48572, 48573,
48574, 48575, 48576, 48577, 48578, 48579, 48580, 48581, 48582,
48583, 48584, 48585, 48586, 48587, 48588, 48589, 48590, 48591,
48592, 48593, 48594, 48595, 48596, 48597, 48598, 48599, 48600,
48601, 48602, 48603, 48604, 48605, 48606, 48607, 48608, 48609,
48610, 48611, 48612, 48613, 48614, 48615, 48616, 48617, 48618,
48619, 48620, 48621, 48622, 48623, 48624, 48625, 48626, 48627,
48628, 48629, 48630, 48631, 48632, 48633, 48634, 48635, 48636,
48637, 48638, 48639, 48640, 48641, 48642, 48643, 48644, 48645,
48646, 48647, 48648, 48649, 48650, 48651, 48652, 48653, 48654,
48655, 48656, 48657, 48658, 48659, 48660, 48661, 48662, 48663,
48664, 48665, 48666, 48667, 48668, 48669, 48670, 48671, 48672,
48673, 48674, 48675, 48676, 48677, 48678, 48679, 48680, 48681,
48682, 48683, 48684, 48685, 48686, 48687, 48688, 48689, 48690,
48691, 48692, 48693, 48694, 48695, 48696, 48697, 48698, 48699,
48700, 48701, 48702, 48703, 48704, 48705, 48706, 48707, 48708,
48709, 48710, 48711, 48712, 48713, 48714, 48715, 48716, 48717,
48718, 48719, 48720, 48721, 48722, 48723, 48724, 48725, 48726,
48727, 48728, 48729, 48730, 48731, 48732, 48733, 48734, 48735,
48736, 48737, 48738, 48739, 48740, 48741, 48742, 48743, 48744,
48745, 48746, 48747, 48748, 48749, 48750, 48751, 48752, 48753,
48754, 48755, 48756, 48757, 48758, 48759, 48760, 48761, 48762,
48763, 48764, 48765, 48766, 48767, 48768, 48769, 48770, 48771,
48772, 48773, 48774, 48775, 48776, 48777, 48778, 48779, 48780,
48781, 48782, 48783, 48784, 48785, 48786, 48787, 48788, 48789,
48790, 48791, 48792, 48793, 48794, 48795, 48796, 48797, 48798,
48799, 48800, 48801, 48802, 48803, 48804, 48805, 48806, 48807,
48808, 48809, 48810, 48811, 48812, 48813, 48814, 48815, 48816,
48817, 48818, 48819, 48820, 48821, 48822, 48823, 48824, 48825,
48826, 48827, 48828, 48829, 48830, 48831, 48832, 48833, 48834,
48835, 48836, 48837, 48838, 48839, 48840, 48841, 48842, 48843,
48844, 48845, 48846, 48847, 48848, 48849, 48850, 48851, 48852,
48853, 48854, 48855, 48856, 48857, 48858, 48859, 48860, 48861,
48862, 48863, 48864, 48865, 48866, 48867, 48868, 48869, 48870,
48871, 48872, 48873, 48874, 48875, 48876, 48877, 48878, 48879,
48880, 48881, 48882, 48883, 48884, 48885, 48886, 48887, 48888,
48889, 48890, 48891, 48892, 48893, 48894, 48895, 48896, 48897,
48898, 48899, 48900, 48901, 48902, 48903, 48904, 48905, 48906,
48907, 48908, 48909, 48910, 48911, 48912, 48913, 48914, 48915,
48916, 48917, 48918, 48919, 48920, 48921, 48922, 48923, 48924,
48925, 48926, 48927, 48928, 48929, 48930, 48931, 48932, 48933,
48934, 48935, 48936, 48937, 48938, 48939, 48940, 48941, 48942,
48943, 48944, 48945, 48946, 48947, 48948, 48949, 48950, 48951,
48952, 48953, 48954, 48955, 48956, 48957, 48958, 48959, 48960,
48961, 48962, 48963, 48964, 48965, 48966, 48967, 48968, 48969,
48970, 48971, 48972, 48973, 48974, 48975, 48976, 48977, 48978,
48979, 48980, 48981, 48982, 48983, 48984, 48985, 48986, 48987,
48988, 48989, 48990, 48991, 48992, 48993, 48994, 48995, 48996,
48997, 48998, 48999, 49000, 49001, 49002, 49003, 49004, 49005,
49006, 49007, 49008, 49009, 49010, 49011, 49012, 49013, 49014,
49015, 49016, 49017, 49018, 49019, 49020, 49021, 49022, 49023,
49024, 49025, 49026, 49027, 49028, 49029, 49030, 49031, 49032,
49033, 49034, 49035, 49036, 49037, 49038, 49039, 49040, 49041,
49042, 49043, 49044, 49045, 49046, 49047, 49048, 49049, 49050,
49051, 49052, 49053, 49054, 49055, 49056, 49057, 49058, 49059,
49060, 49061, 49062, 49063, 49064, 49065, 49066, 49067, 49068,
49069, 49070, 49071, 49072, 49073, 49074, 49075, 49076, 49077,
49078, 49079, 49080, 49081, 49082, 49083, 49084, 49085, 49086,
49087, 49088, 49089, 49090, 49091, 49092, 49093, 49094, 49095,
49096, 49097, 49098, 49099, 49100, 49101, 49102, 49103, 49104,
49105, 49106, 49107, 49108, 49109, 49110, 49111, 49112, 49113,
49114, 49115, 49116, 49117, 49118, 49119, 49120, 49121, 49122,
49123, 49124, 49125, 49126, 49127, 49128, 49129, 49130, 49131,
49132, 49133, 49134, 49135, 49136, 49137, 49138, 49139, 49140,
49141, 49142, 49143, 49144, 49145, 49146, 49147, 49148, 49149,
49150, 49151, 49152, 49153, 49154, 49155, 49156, 49157, 49158,
49159, 49160, 49161, 49162, 49163, 49164, 49165, 49166, 49167,
49168, 49169, 49170, 49171, 49172, 49173, 49174, 49175, 49176,
49177, 49178, 49179, 49180, 49181, 49182, 49183, 49184, 49185,
49186, 49187, 49188, 49189, 49190, 49191, 49192, 49193, 49194,
49195, 49196, 49197, 49198, 49199, 49200, 49201, 49202, 49203,
49204, 49205, 49206, 49207, 49208, 49209, 49210, 49211, 49212,
49213, 49214, 49215, 49216, 49217, 49218, 49219, 49220, 49221,
49222, 49223, 49224, 49225, 49226, 49227, 49228, 49229, 49230,
49231, 49232, 49233, 49234, 49235, 49236, 49237, 49238, 49239,
49240, 49241, 49242, 49243, 49244, 49245, 49246, 49247, 49248,
49249, 49250, 49251, 49252, 49253, 49254, 49255, 49256, 49257,
49258, 49259, 49260, 49261, 49262, 49263, 49264, 49265, 49266,
49267, 49268, 49269, 49270, 49271, 49272, 49273, 49274, 49275,
49276, 49277, 49278, 49279, 49280, 49281, 49282, 49283, 49284,
49285, 49286, 49287, 49288, 49289, 49290, 49291, 49292, 49293,
49294, 49295, 49296, 49297, 49298, 49299, 49300, 49301, 49302,
49303, 49304, 49305, 49306, 49307, 49308, 49309, 49310, 49311,
49312, 49313, 49314, 49315, 49316, 49317, 49318, 49319, 49320,
49321, 49322, 49323, 49324, 49325, 49326, 49327, 49328, 49329,
49330, 49331, 49332, 49333, 49334, 49335, 49336, 49337, 49338,
49339, 49340, 49341, 49342, 49343, 49344, 49345, 49346, 49347,
49348, 49349, 49350, 49351, 49352, 49353, 49354, 49355, 49356,
49357, 49358, 49359, 49360, 49361, 49362, 49363, 49364, 49365,
49366, 49367, 49368, 49369, 49370, 49371, 49372, 49373, 49374,
49375, 49376, 49377, 49378, 49379, 49380, 49381, 49382, 49383,
49384, 49385, 49386, 49387, 49388, 49389, 49390, 49391, 49392,
49393, 49394, 49395, 49396, 49397, 49398, 49399, 49400, 49401,
49402, 49403, 49404, 49405, 49406, 49407, 49408, 49409, 49410,
49411, 49412, 49413, 49414, 49415, 49416, 49417, 49418, 49419,
49420, 49421, 49422, 49423, 49424, 49425, 49426, 49427, 49428,
49429, 49430, 49431, 49432, 49433, 49434, 49435, 49436, 49437,
49438, 49439, 49440, 49441, 49442, 49443, 49444, 49445, 49446,
49447, 49448, 49449, 49450, 49451, 49452, 49453, 49454, 49455,
49456, 49457, 49458, 49459, 49460, 49461, 49462, 49463, 49464,
49465, 49466, 49467, 49468, 49469, 49470, 49471, 49472, 49473,
49474, 49475, 49476, 49477, 49478, 49479, 49480, 49481, 49482,
49483, 49484, 49485, 49486, 49487, 49488, 49489, 49490, 49491,
49492, 49493, 49494, 49495, 49496, 49497, 49498, 49499, 49500,
49501, 49502, 49503, 49504, 49505, 49506, 49507, 49508, 49509,
49510, 49511, 49512, 49513, 49514, 49515, 49516, 49517, 49518,
49519, 49520, 49521, 49522, 49523, 49524, 49525, 49526, 49527,
49528, 49529, 49530, 49531, 49532, 49533, 49534, 49535, 49536,
49537, 49538, 49539, 49540, 49541, 49542, 49543, 49544, 49545,
49546, 49547, 49548, 49549, 49550, 49551, 49552, 49553, 49554,
49555, 49556, 49557, 49558, 49559, 49560, 49561, 49562, 49563,
49564, 49565, 49566, 49567, 49568, 49569, 49570, 49571, 49572,
49573, 49574, 49575, 49576, 49577, 49578, 49579, 49580, 49581,
49582, 49583, 49584, 49585, 49586, 49587, 49588, 49589, 49590,
49591, 49592, 49593, 49594, 49595, 49596, 49597, 49598, 49599,
49600, 49601, 49602, 49603, 49604, 49605, 49606, 49607, 49608,
49609, 49610, 49611, 49612, 49613, 49614, 49615, 49616, 49617,
49618, 49619, 49620, 49621, 49622, 49623, 49624, 49625, 49626,
49627, 49628, 49629, 49630, 49631, 49632, 49633, 49634, 49635,
49636, 49637, 49638, 49639, 49640, 49641, 49642, 49643, 49644,
49645, 49646, 49647, 49648, 49649, 49650, 49651, 49652, 49653,
49654, 49655, 49656, 49657, 49658, 49659, 49660, 49661, 49662,
49663, 49664, 49665, 49666, 49667, 49668, 49669, 49670, 49671,
49672, 49673, 49674, 49675, 49676, 49677, 49678, 49679, 49680,
49681, 49682, 49683, 49684, 49685, 49686, 49687, 49688, 49689,
49690, 49691, 49692, 49693, 49694, 49695, 49696, 49697, 49698,
49699, 49700, 49701, 49702, 49703, 49704, 49705, 49706, 49707,
49708, 49709, 49710, 49711, 49712, 49713, 49714, 49715, 49716,
49717, 49718, 49719, 49720, 49721, 49722, 49723, 49724, 49725,
49726, 49727, 49728, 49729, 49730, 49731, 49732, 49733, 49734,
49735, 49736, 49737, 49738, 49739, 49740, 49741, 49742, 49743,
49744, 49745, 49746, 49747, 49748, 49749, 49750, 49751, 49752,
49753, 49754, 49755, 49756, 49757, 49758, 49759, 49760, 49761,
49762, 49763, 49764, 49765, 49766, 49767, 49768, 49769, 49770,
49771, 49772, 49773, 49774, 49775, 49776, 49777, 49778, 49779,
49780, 49781, 49782, 49783, 49784, 49785, 49786, 49787, 49788,
49789, 49790, 49791, 49792, 49793, 49794, 49795, 49796, 49797,
49798, 49799, 49800, 49801, 49802, 49803, 49804, 49805, 49806,
49807, 49808, 49809, 49810, 49811, 49812, 49813, 49814, 49815,
49816, 49817, 49818, 49819, 49820, 49821, 49822, 49823, 49824,
49825, 49826, 49827, 49828, 49829, 49830, 49831, 49832, 49833,
49834, 49835, 49836, 49837, 49838, 49839, 49840, 49841, 49842,
49843, 49844, 49845, 49846, 49847, 49848, 49849, 49850, 49851,
49852, 49853, 49854, 49855, 49856, 49857, 49858, 49859, 49860,
49861, 49862, 49863, 49864, 49865, 49866, 49867, 49868, 49869,
49870, 49871, 49872, 49873, 49874, 49875, 49876, 49877, 49878,
49879, 49880, 49881, 49882, 49883, 49884, 49885, 49886, 49887,
49888, 49889, 49890, 49891, 49892, 49893, 49894, 49895, 49896,
49897, 49898, 49899, 49900, 49901, 49902, 49903, 49904, 49905,
49906, 49907, 49908, 49909, 49910, 49911, 49912, 49913, 49914,
49915, 49916, 49917, 49918, 49919, 49920, 49921, 49922, 49923,
49924, 49925, 49926, 49927, 49928, 49929, 49930, 49931, 49932,
49933, 49934, 49935, 49936, 49937, 49938, 49939, 49940, 49941,
49942, 49943, 49944, 49945, 49946, 49947, 49948, 49949, 49950,
49951, 49952, 49953, 49954, 49955, 49956, 49957, 49958, 49959,
49960, 49961, 49962, 49963, 49964, 49965, 49966, 49967, 49968,
49969, 49970, 49971, 49972, 49973, 49974, 49975, 49976, 49977,
49978, 49979, 49980, 49981, 49982, 49983, 49984, 49985, 49986,
49987, 49988, 49989, 49990, 49991, 49992, 49993, 49994, 49995,
49996, 49997, 49998, 49999, 50000, 50001, 50002, 50003, 50004,
50005, 50006, 50007, 50008, 50009, 50010, 50011, 50012, 50013,
50014, 50015, 50016, 50017, 50018, 50019, 50020, 50021, 50022,
50023, 50024, 50025, 50026, 50027, 50028, 50029, 50030, 50031,
50032, 50033, 50034, 50035, 50036, 50037, 50038, 50039, 50040,
50041, 50042, 50043, 50044, 50045, 50046, 50047, 50048, 50049,
50050, 50051, 50052, 50053, 50054, 50055, 50056, 50057, 50058,
50059, 50060, 50061, 50062, 50063, 50064, 50065, 50066, 50067,
50068, 50069, 50070, 50071, 50072, 50073, 50074, 50075, 50076,
50077, 50078, 50079, 50080, 50081, 50082, 50083, 50084, 50085,
50086, 50087, 50088, 50089, 50090, 50091, 50092, 50093, 50094,
50095, 50096, 50097, 50098, 50099, 50100, 50101, 50102, 50103,
50104, 50105, 50106, 50107, 50108, 50109, 50110, 50111, 50112,
50113, 50114, 50115, 50116, 50117, 50118, 50119, 50120, 50121,
50122, 50123, 50124, 50125, 50126, 50127, 50128, 50129, 50130,
50131, 50132, 50133, 50134, 50135, 50136, 50137, 50138, 50139,
50140, 50141, 50142, 50143, 50144, 50145, 50146, 50147, 50148,
50149, 50150, 50151, 50152, 50153, 50154, 50155, 50156, 50157,
50158, 50159, 50160, 50161, 50162, 50163, 50164, 50165, 50166,
50167, 50168, 50169, 50170, 50171, 50172, 50173, 50174, 50175,
50176, 50177, 50178, 50179, 50180, 50181, 50182, 50183, 50184,
50185, 50186, 50187, 50188, 50189, 50190, 50191, 50192, 50193,
50194, 50195, 50196, 50197, 50198, 50199, 50200, 50201, 50202,
50203, 50204, 50205, 50206, 50207, 50208, 50209, 50210, 50211,
50212, 50213, 50214, 50215, 50216, 50217, 50218, 50219, 50220,
50221, 50222, 50223, 50224, 50225, 50226, 50227, 50228, 50229,
50230, 50231, 50232, 50233, 50234, 50235, 50236, 50237, 50238,
50239, 50240, 50241, 50242, 50243, 50244, 50245, 50246, 50247,
50248, 50249, 50250, 50251, 50252, 50253, 50254, 50255, 50256,
50257, 50258, 50259, 50260, 50261, 50262, 50263, 50264, 50265,
50266, 50267, 50268, 50269, 50270, 50271, 50272, 50273, 50274,
50275, 50276, 50277, 50278, 50279, 50280, 50281, 50282, 50283,
50284, 50285, 50286, 50287, 50288, 50289, 50290, 50291, 50292,
50293, 50294, 50295, 50296, 50297, 50298, 50299, 50300, 50301,
50302, 50303, 50304, 50305, 50306, 50307, 50308, 50309, 50310,
50311, 50312, 50313, 50314, 50315, 50316, 50317, 50318, 50319,
50320, 50321, 50322, 50323, 50324, 50325, 50326, 50327, 50328,
50329, 50330, 50331, 50332, 50333, 50334, 50335, 50336, 50337,
50338, 50339, 50340, 50341, 50342, 50343, 50344, 50345, 50346,
50347, 50348, 50349, 50350, 50351, 50352, 50353, 50354, 50355,
50356, 50357, 50358, 50359, 50360, 50361, 50362, 50363, 50364,
50365, 50366, 50367, 50368, 50369, 50370, 50371, 50372, 50373,
50374, 50375, 50376, 50377, 50378, 50379, 50380, 50381, 50382,
50383, 50384, 50385, 50386, 50387, 50388, 50389, 50390, 50391,
50392, 50393, 50394, 50395, 50396, 50397, 50398, 50399, 50400,
50401, 50402, 50403, 50404, 50405, 50406, 50407, 50408, 50409,
50410, 50411, 50412, 50413, 50414, 50415, 50416, 50417, 50418,
50419, 50420, 50421, 50422, 50423, 50424, 50425, 50426, 50427,
50428, 50429, 50430, 50431, 50432, 50433, 50434, 50435, 50436,
50437, 50438, 50439, 50440, 50441, 50442, 50443, 50444, 50445,
50446, 50447, 50448, 50449, 50450, 50451, 50452, 50453, 50454,
50455, 50456, 50457, 50458, 50459, 50460, 50461, 50462, 50463,
50464, 50465, 50466, 50467, 50468, 50469, 50470, 50471, 50472,
50473, 50474, 50475, 50476, 50477, 50478, 50479, 50480, 50481,
50482, 50483, 50484, 50485, 50486, 50487, 50488, 50489, 50490,
50491, 50492, 50493, 50494, 50495, 50496, 50497, 50498, 50499,
50500, 50501, 50502, 50503, 50504, 50505, 50506, 50507, 50508,
50509, 50510, 50511, 50512, 50513, 50514, 50515, 50516, 50517,
50518, 50519, 50520, 50521, 50522, 50523, 50524, 50525, 50526,
50527, 50528, 50529, 50530, 50531, 50532, 50533, 50534, 50535,
50536, 50537, 50538, 50539, 50540, 50541, 50542, 50543, 50544,
50545, 50546, 50547, 50548, 50549, 50550, 50551, 50552, 50553,
50554, 50555, 50556, 50557, 50558, 50559, 50560, 50561, 50562,
50563, 50564, 50565, 50566, 50567, 50568, 50569, 50570, 50571,
50572, 50573, 50574, 50575, 50576, 50577, 50578, 50579, 50580,
50581, 50582, 50583, 50584, 50585, 50586, 50587, 50588, 50589,
50590, 50591, 50592, 50593, 50594, 50595, 50596, 50597,
50598, 50599, 50600, 50601, 50602, 50603, 50604, 50605, 50606,
50607, 50608, 50609, 50610, 50611, 50612, 50613, 50614, 50615,
50616, 50617, 50618, 50619, 50620, 50621, 50622, 50623, 50624,
50625, 50626, 50627, 50628, 50629, 50630, 50631, 50632, 50633,
50634, 50635, 50636, 50637, 50638, 50639, 50640, 50641, 50642,
50643, 50644, 50645, 50646, 50647, 50648, 50649, 50650, 50651,
50652, 50653, 50654, 50655, 50656, 50657, 50658, 50659, 50660,
50661, 50662, 50663, 50664, 50665, 50666, 50667, 50668, 50669,
50670, 50671, 50672, 50673, 50674, 50675, 50676, 50677, 50678,
50679, 50680, 50681, 50682, 50683, 50684, 50685, 50686, 50687,
50688, 50689, 50690, 50691, 50692, 50693, 50694, 50695, 50696,
50697, 50698, 50699, 50700, 50701, 50702, 50703, 50704, 50705,
50706, 50707, 50708, 50709, 50710, 50711, 50712, 50713, 50714,
50715, 50716, 50717, 50718, 50719, 50720, 50721, 50722, 50723,
50724, 50725, 50726, 50727, 50728, 50729, 50730, 50731, 50732,
50733, 50734, 50735, 50736, 50737, 50738, 50739, 50740, 50741,
50742, 50743, 50744, 50745, 50746, 50747, 50748, 50749, 50750,
50751, 50752, 50753, 50754, 50755, 50756, 50757, 50758, 50759,
50760, 50761, 50762, 50763, 50764, 50765, 50766, 50767, 50768,
50769, 50770, 50771, 50772, 50773, 50774, 50775, 50776, 50777,
50778, 50779, 50780, 50781, 50782, 50783, 50784, 50785, 50786,
50787, 50788, 50789, 50790, 50791, 50792, 50793, 50794, 50795,
50796, 50797, 50798, 50799, 50800, 50801, 50802, 50803, 50804,
50805, 50806, 50807, 50808, 50809, 50810, 50811, 50812, 50813,
50814, 50815, 50816, 50817, 50818, 50819, 50820, 50821, 50822,
50823, 50824, 50825, 50826, 50827, 50828, 50829, 50830, 50831,
50832, 50833, 50834, 50835, 50836, 50837, 50838, 50839, 50840,
50841, 50842, 50843, 50844, 50845, 50846, 50847, 50848, 50849,
50850, 50851, 50852, 50853, 50854, 50855, 50856, 50857, 50858,
50859, 50860, 50861, 50862, 50863, 50864, 50865, 50866, 50867,
50868, 50869, 50870, 50871, 50872, 50873, 50874, 50875, 50876,
50877, 50878, 50879, 50880, 50881, 50882, 50883, 50884, 50885,
50886, 50887, 50888, 50889, 50890, 50891, 50892, 50893, 50894,
50895, 50896, 50897, 50898, 50899, 50900, 50901, 50902, 50903,
50904, 50905, 50906, 50907, 50908, 50909, 50910, 50911, 50912,
50913, 50914, 50915, 50916, 50917, 50918, 50919, 50920, 50921,
50922, 50923, 50924, 50925, 50926, 50927, 50928, 50929, 50930,
50931, 50932, 50933, 50934, 50935, 50936, 50937, 50938, 50939,
50940, 50941, 50942, 50943, 50944, 50945, 50946, 50947, 50948,
50949, 50950, 50951, 50952, 50953, 50954, 50955, 50956, 50957,
50958, 50959, 50960, 50961, 50962, 50963, 50964, 50965, 50966,
50967, 50968, 50969, 50970, 50971, 50972, 50973, 50974, 50975,
50976, 50977, 50978, 50979, 50980, 50981, 50982, 50983, 50984,
50985, 50986, 50987, 50988, 50989, 50990, 50991, 50992, 50993,
50994, 50995, 50996, 50997, 50998, 50999, 51000, 51001, 51002,
51003, 51004, 51005, 51006, 51007, 51008, 51009, 51010, 51011,
51012, 51013, 51014, 51015, 51016, 51017, 51018, 51019, 51020,
51021, 51022, 51023, 51024, 51025, 51026, 51027, 51028, 51029,
51030, 51031, 51032, 51033, 51034, 51035, 51036, 51037, 51038,
51039, 51040, 51041, 51042, 51043, 51044, 51045, 51046, 51047,
51048, 51049, 51050, 51051, 51052, 51053, 51054, 51055, 51056,
51057, 51058, 51059, 51060, 51061, 51062, 51063, 51064, 51065,
51066, 51067, 51068, 51069, 51070, 51071, 51072, 51073, 51074,
51075, 51076, 51077, 51078, 51079, 51080, 51081, 51082, 51083,
51084, 51085, 51086, 51087, 51088, 51089, 51090, 51091, 51092,
51093, 51094, 51095, 51096, 51097, 51098, 51099, 51100, 51101,
51102, 51103, 51104, 51105, 51106, 51107, 51108, 51109, 51110,
51111, 51112, 51113, 51114, 51115, 51116, 51117, 51118, 51119,
51120, 51121, 51122, 51123, 51124, 51125, 51126, 51127, 51128,
51129, 51130, 51131, 51132, 51133, 51134, 51135, 51136, 51137,
51138, 51139, 51140, 51141, 51142, 51143, 51144, 51145, 51146,
51147, 51148, 51149, 51150, 51151, 51152, 51153, 51154, 51155,
51156, 51157, 51158, 51159, 51160, 51161, 51162, 51163, 51164,
51165, 51166, 51167, 51168, 51169, 51170, 51171, 51172, 51173,
51174, 51175, 51176, 51177, 51178, 51179, 51180, 51181, 51182,
51183, 51184, 51185, 51186, 51187, 51188, 51189, 51190, 51191,
51192, 51193, 51194, 51195, 51196, 51197, 51198, 51199, 51200,
51201, 51202, 51203, 51204, 51205, 51206, 51207, 51208, 51209,
51210, 51211, 51212, 51213, 51214, 51215, 51216, 51217, 51218,
51219, 51220, 51221, 51222, 51223, 51224, 51225, 51226, 51227,
51228, 51229, 51230, 51231, 51232, 51233, 51234, 51235, 51236,
51237, 51238, 51239, 51240, 51241, 51242, 51243, 51244, 51245,
51246, 51247, 51248, 51249, 51250, 51251, 51252, 51253, 51254,
51255, 51256, 51257, 51258, 51259, 51260, 51261, 51262, 51263,
51264, 51265, 51266, 51267, 51268, 51269, 51270, 51271, 51272,
51273, 51274, 51275, 51276, 51277, 51278, 51279, 51280, 51281,
51282, 51283, 51284, 51285, 51286, 51287, 51288, 51289, 51290,
51291, 51292, 51293, 51294, 51295, 51296, 51297, 51298, 51299,
51300, 51301, 51302, 51303, 51304, 51305, 51306, 51307, 51308,
51309, 51310, 51311, 51312, 51313, 51314, 51315, 51316, 51317,
51318, 51319, 51320, 51321, 51322, 51323, 51324, 51325, 51326,
51327, 51328, 51329, 51330, 51331, 51332, 51333, 51334, 51335,
51336, 51337, 51338, 51339, 51340, 51341, 51342, 51343, 51344,
51345, 51346, 51347, 51348, 51349, 51350, 51351, 51352, 51353,
51354, 51355, 51356, 51357, 51358, 51359, 51360, 51361, 51362,
51363, 51364, 51365, 51366, 51367, 51368, 51369, 51370, 51371,
51372, 51373, 51374, 51375, 51376, 51377, 51378, 51379, 51380,
51381, 51382, 51383, 51384, 51385, 51386, 51387, 51388, 51389,
51390, 51391, 51392, 51393, 51394, 51395, 51396, 51397, 51398,
51399, 51400, 51401, 51402, 51403, 51404, 51405, 51406, 51407,
51408, 51409, 51410, 51411, 51412, 51413, 51414, 51415, 51416,
51417, 51418, 51419, 51420, 51421, 51422, 51423, 51424, 51425,
51426, 51427, 51428, 51429, 51430, 51431, 51432, 51433, 51434,
51435, 51436, 51437, 51438, 51439, 51440, 51441, 51442, 51443,
51444, 51445, 51446, 51447, 51448, 51449, 51450, 51451, 51452,
51453, 51454, 51455, 51456, 51457, 51458, 51459, 51460, 51461,
51462, 51463, 51464, 51465, 51466, 51467, 51468, 51469, 51470,
51471, 51472, 51473, 51474, 51475, 51476, 51477, 51478, 51479,
51480, 51481, 51482, 51483, 51484, 51485, 51486, 51487, 51488,
51489, 51490, 51491, 51492, 51493, 51494, 51495, 51496, 51497,
51498, 51499, 51500, 51501, 51502, 51503, 51504, 51505, 51506,
51507, 51508, 51509, 51510, 51511, 51512, 51513, 51514, 51515,
51516, 51517, 51518, 51519, 51520, 51521, 51522, 51523, 51524,
51525, 51526, 51527, 51528, 51529, 51530, 51531, 51532, 51533,
51534, 51535, 51536, 51537, 51538, 51539, 51540, 51541, 51542,
51543, 51544, 51545, 51546, 51547, 51548, 51549, 51550, 51551,
51552, 51553, 51554, 51555, 51556, 51557, 51558, 51559, 51560,
51561, 51562, 51563, 51564, 51565, 51566, 51567, 51568, 51569,
51570, 51571, 51572, 51573, 51574, 51575, 51576, 51577, 51578,
51579, 51580, 51581, 51582, 51583, 51584, 51585, 51586, 51587,
51588, 51589, 51590, 51591, 51592, 51593, 51594, 51595, 51596,
51597, 51598, 51599, 51600, 51601, 51602, 51603, 51604, 51605,
51606, 51607, 51608, 51609, 51610, 51611, 51612, 51613, 51614,
51615, 51616, 51617, 51618, 51619, 51620, 51621, 51622, 51623,
51624, 51625, 51626, 51627, 51628, 51629, 51630, 51631, 51632,
51633, 51634, 51635, 51636, 51637, 51638, 51639, 51640, 51641,
51642, 51643, 51644, 51645, 51646, 51647, 51648, 51649, 51650,
51651, 51652, 51653, 51654, 51655, 51656, 51657, 51658, 51659,
51660, 51661, 51662, 51663, 51664, 51665, 51666, 51667, 51668,
51669, 51670, 51671, 51672, 51673, 51674, 51675, 51676, 51677,
51678, 51679, 51680, 51681, 51682, 51683, 51684, 51685, 51686,
51687, 51688, 51689, 51690, 51691, 51692, 51693, 51694, 51695,
51696, 51697, 51698, 51699, 51700, 51701, 51702, 51703, 51704,
51705, 51706, 51707, 51708, 51709, 51710, 51711, 51712, 51713,
51714, 51715, 51716, 51717, 51718, 51719, 51720, 51721, 51722,
51723, 51724, 51725, 51726, 51727, 51728, 51729, 51730, 51731,
51732, 51733, 51734, 51735, 51736, 51737, 51738, 51739, 51740,
51741, 51742, 51743, 51744, 51745, 51746, 51747, 51748, 51749,
51750, 51751, 51752, 51753, 51754, 51755, 51756, 51757, 51758,
51759, 51760, 51761, 51762, 51763, 51764, 51765, 51766, 51767,
51768, 51769, 51770, 51771, 51772, 51773, 51774, 51775, 51776,
51777, 51778, 51779, 51780, 51781, 51782, 51783, 51784, 51785,
51786, 51787, 51788, 51789, 51790, 51791, 51792, 51793, 51794,
51795, 51796, 51797, 51798, 51799, 51800, 51801, 51802, 51803,
51804, 51805, 51806, 51807, 51808, 51809, 51810, 51811, 51812,
51813, 51814, 51815, 51816, 51817, 51818, 51819, 51820, 51821,
51822, 51823, 51824, 51825, 51826, 51827, 51828, 51829, 51830,
51831, 51832, 51833, 51834, 51835, 51836, 51837, 51838, 51839,
51840, 51841, 51842, 51843, 51844, 51845, 51846, 51847, 51848,
51849, 51850, 51851, 51852, 51853, 51854, 51855, 51856, 51857,
51858, 51859, 51860, 51861, 51862, 51863, 51864, 51865, 51866,
51867, 51868, 51869, 51870, 51871, 51872, 51873, 51874, 51875,
51876, 51877, 51878, 51879, 51880, 51881, 51882, 51883, 51884,
51885, 51886, 51887, 51888, 51889, 51890, 51891, 51892, 51893,
51894, 51895, 51896, 51897, 51898, 51899, 51900, 51901, 51902,
51903, 51904, 51905, 51906, 51907, 51908, 51909, 51910, 51911,
51912, 51913, 51914, 51915, 51916, 51917, 51918, 51919, 51920,
51921, 51922, 51923, 51924, 51925, 51926, 51927, 51928, 51929,
51930, 51931, 51932, 51933, 51934, 51935, 51936, 51937, 51938,
51939, 51940, 51941, 51942, 51943, 51944, 51945, 51946, 51947,
51948, 51949, 51950, 51951, 51952, 51953, 51954, 51955, 51956,
51957, 51958, 51959, 51960, 51961, 51962, 51963, 51964, 51965,
51966, 51967, 51968, 51969, 51970, 51971, 51972, 51973, 51974,
51975, 51976, 51977, 51978, 51979, 51980, 51981, 51982, 51983,
51984, 51985, 51986, 51987, 51988, 51989, 51990, 51991, 51992,
51993, 51994, 51995, 51996, 51997, 51998, 51999, 52000, 52001,
52002, 52003, 52004, 52005, 52006, 52007, 52008, 52009, 52010,
52011, 52012, 52013, 52014, 52015, 52016, 52017, 52018, 52019,
52020, 52021, 52022, 52023, 52024, 52025, 52026, 52027, 52028,
52029, 52030, 52031, 52032, 52033, 52034, 52035, 52036, 52037,
52038, 52039, 52040, 52041, 52042, 52043, 52044, 52045, 52046,
52047, 52048, 52049, 52050, 52051, 52052, 52053, 52054, 52055,
52056, 52057, 52058, 52059, 52060, 52061, 52062, 52063, 52064,
52065, 52066, 52067, 52068, 52069, 52070, 52071, 52072, 52073,
52074, 52075, 52076, 52077, 52078, 52079, 52080, 52081, 52082,
52083, 52084, 52085, 52086, 52087, 52088, 52089, 52090, 52091,
52092, 52093, 52094, 52095, 52096, 52097, 52098, 52099, 52100,
52101, 52102, 52103, 52104, 52105, 52106, 52107, 52108, 52109,
52110, 52111, 52112, 52113, 52114, 52115, 52116, 52117, 52118,
52119, 52120, 52121, 52122, 52123, 52124, 52125, 52126, 52127,
52128, 52129, 52130, 52131, 52132, 52133, 52134, 52135, 52136,
52137, 52138, 52139, 52140, 52141, 52142, 52143, 52144, 52145,
52146, 52147, 52148, 52149, 52150, 52151, 52152, 52153, 52154,
52155, 52156, 52157, 52158, 52159, 52160, 52161, 52162, 52163,
52164, 52165, 52166, 52167, 52168, 52169, 52170, 52171, 52172,
52173, 52174, 52175, 52176, 52177, 52178, 52179, 52180, 52181,
52182, 52183, 52184, 52185, 52186, 52187, 52188, 52189, 52190,
52191, 52192, 52193, 52194, 52195, 52196, 52197, 52198, 52199,
52200, 52201, 52202, 52203, 52204, 52205, 52206, 52207, 52208,
52209, 52210, 52211, 52212, 52213, 52214, 52215, 52216, 52217,
52218, 52219, 52220, 52221, 52222, 52223, 52224, 52225, 52226,
52227, 52228, 52229, 52230, 52231, 52232, 52233, 52234, 52235,
52236, 52237, 52238, 52239, 52240, 52241, 52242, 52243, 52244,
52245, 52246, 52247, 52248, 52249, 52250, 52251, 52252, 52253,
52254, 52255, 52256, 52257, 52258, 52259, 52260, 52261, 52262,
52263, 52264, 52265, 52266, 52267, 52268, 52269, 52270, 52271,
52272, 52273, 52274, 52275, 52276, 52277, 52278, 52279, 52280,
52281, 52282, 52283, 52284, 52285, 52286, 52287, 52288, 52289,
52290, 52291, 52292, 52293, 52294, 52295, 52296, 52297, 52298,
52299, 52300, 52301, 52302, 52303, 52304, 52305, 52306, 52307,
52308, 52309, 52310, 52311, 52312, 52313, 52314, 52315, 52316,
52317, 52318, 52319, 52320, 52321, 52322, 52323, 52324, 52325,
52326, 52327, 52328, 52329, 52330, 52331, 52332, 52333, 52334,
52335, 52336, 52337, 52338, 52339, 52340, 52341, 52342, 52343,
52344, 52345, 52346, 52347, 52348, 52349, 52350, 52351, 52352,
52353, 52354, 52355, 52356, 52357, 52358, 52359, 52360, 52361,
52362, 52363, 52364, 52365, 52366, 52367, 52368, 52369, 52370,
52371, 52372, 52373, 52374, 52375, 52376, 52377, 52378, 52379,
52380, 52381, 52382, 52383, 52384, 52385, 52386, 52387, 52388,
52389, 52390, 52391, 52392, 52393, 52394, 52395, 52396, 52397,
52398, 52399, 52400, 52401, 52402, 52403, 52404, 52405, 52406,
52407, 52408, 52409, 52410, 52411, 52412, 52413, 52414, 52415,
52416, 52417, 52418, 52419, 52420, 52421, 52422, 52423, 52424,
52425, 52426, 52427, 52428, 52429, 52430, 52431, 52432, 52433,
52434, 52435, 52436, 52437, 52438, 52439, 52440, 52441, 52442,
52443, 52444, 52445, 52446, 52447, 52448, 52449, 52450, 52451,
52452, 52453, 52454, 52455, 52456, 52457, 52458, 52459, 52460,
52461, 52462, 52463, 52464, 52465, 52466, 52467, 52468, 52469,
52470, 52471, 52472, 52473, 52474, 52475, 52476, 52477, 52478,
52479, 52480, 52481, 52482, 52483, 52484, 52485, 52486, 52487,
52488, 52489, 52490, 52491, 52492, 52493, 52494, 52495, 52496,
52497, 52498, 52499, 52500, 52501, 52502, 52503, 52504, 52505,
52506, 52507, 52508, 52509, 52510, 52511, 52512, 52513, 52514,
52515, 52516, 52517, 52518, 52519, 52520, 52521, 52522, 52523,
52524, 52525, 52526, 52527, 52528, 52529, 52530, 52531, 52532,
52533, 52534, 52535, 52536, 52537, 52538, 52539, 52540, 52541,
52542, 52543, 52544, 52545, 52546, 52547, 52548, 52549, 52550,
52551, 52552, 52553, 52554, 52555, 52556, 52557, 52558, 52559,
52560, 52561, 52562, 52563, 52564, 52565, 52566, 52567, 52568,
52569, 52570, 52571, 52572, 52573, 52574, 52575, 52576, 52577,
52578, 52579, 52580, 52581, 52582, 52583, 52584, 52585, 52586,
52587, 52588, 52589, 52590, 52591, 52592, 52593, 52594, 52595,
52596, 52597, 52598, 52599, 52600, 52601, 52602, 52603, 52604,
52605, 52606, 52607, 52608, 52609, 52610, 52611, 52612, 52613,
52614, 52615, 52616, 52617, 52618, 52619, 52620, 52621, 52622,
52623, 52624, 52625, 52626, 52627, 52628, 52629, 52630, 52631,
52632, 52633, 52634, 52635, 52636, 52637, 52638, 52639, 52640,
52641, 52642, 52643, 52644, 52645, 52646, 52647, 52648, 52649,
52650, 52651, 52652, 52653, 52654, 52655, 52656, 52657, 52658,
52659, 52660, 52661, 52662, 52663, 52664, 52665, 52666, 52667,
52668, 52669, 52670, 52671, 52672, 52673, 52674, 52675, 52676,
52677, 52678, 52679, 52680, 52681, 52682, 52683, 52684, 52685,
52686, 52687, 52688, 52689, 52690, 52691, 52692, 52693, 52694,
52695, 52696, 52697, 52698, 52699, 52700, 52701, 52702, 52703,
52704, 52705, 52706, 52707, 52708, 52709, 52710, 52711, 52712,
52713, 52714, 52715, 52716, 52717, 52718, 52719, 52720, 52721,
52722, 52723, 52724, 52725, 52726, 52727, 52728, 52729, 52730,
52731, 52732, 52733, 52734, 52735, 52736, 52737, 52738, 52739,
52740, 52741, 52742, 52743, 52744, 52745, 52746, 52747, 52748,
52749, 52750, 52751, 52752, 52753, 52754, 52755, 52756, 52757,
52758, 52759, 52760, 52761, 52762, 52763, 52764, 52765, 52766,
52767, 52768, 52769, 52770, 52771, 52772, 52773, 52774, 52775,
52776, 52777, 52778, 52779, 52780, 52781, 52782, 52783, 52784,
52785, 52786, 52787, 52788, 52789, 52790, 52791, 52792, 52793,
52794, 52795, 52796, 52797, 52798, 52799, 52800, 52801, 52802,
52803, 52804, 52805, 52806, 52807, 52808, 52809, 52810, 52811,
52812, 52813, 52814, 52815, 52816, 52817, 52818, 52819, 52820,
52821, 52822, 52823, 52824, 52825, 52826, 52827, 52828, 52829,
52830, 52831, 52832, 52833, 52834, 52835, 52836, 52837, 52838,
52839, 52840, 52841, 52842, 52843, 52844, 52845, 52846, 52847,
52848, 52849, 52850, 52851, 52852, 52853, 52854, 52855, 52856,
52857, 52858, 52859, 52860, 52861, 52862, 52863, 52864, 52865,
52866, 52867, 52868, 52869, 52870, 52871, 52872, 52873, 52874,
52875, 52876, 52877, 52878, 52879, 52880, 52881, 52882, 52883,
52884, 52885, 52886, 52887, 52888, 52889, 52890, 52891, 52892,
52893, 52894, 52895, 52896, 52897, 52898, 52899, 52900, 52901,
52902, 52903, 52904, 52905, 52906, 52907, 52908, 52909, 52910,
52911, 52912, 52913, 52914, 52915, 52916, 52917, 52918, 52919,
52920, 52921, 52922, 52923, 52924, 52925, 52926, 52927, 52928,
52929, 52930, 52931, 52932, 52933, 52934, 52935, 52936, 52937,
52938, 52939, 52940, 52941, 52942, 52943, 52944, 52945, 52946,
52947, 52948, 52949, 52950, 52951, 52952, 52953, 52954, 52955,
52956, 52957, 52958, 52959, 52960, 52961, 52962, 52963, 52964,
52965, 52966, 52967, 52968, 52969, 52970, 52971, 52972, 52973,
52974, 52975, 52976, 52977, 52978, 52979, 52980, 52981, 52982,
52983, 52984, 52985, 52986, 52987, 52988, 52989, 52990, 52991,
52992, 52993, 52994, 52995, 52996, 52997, 52998, 52999, 53000,
53001, 53002, 53003, 53004, 53005, 53006, 53007, 53008, 53009,
53010, 53011, 53012, 53013, 53014, 53015, 53016, 53017, 53018,
53019, 53020, 53021, 53022, 53023, 53024, 53025, 53026, 53027,
53028, 53029, 53030, 53031, 53032, 53033, 53034, 53035, 53036,
53037, 53038, 53039, 53040, 53041, 53042, 53043, 53044, 53045,
53046, 53047, 53048, 53049, 53050, 53051, 53052, 53053, 53054,
53055, 53056, 53057, 53058, 53059, 53060, 53061, 53062, 53063,
53064, 53065, 53066, 53067, 53068, 53069, 53070, 53071, 53072,
53073, 53074, 53075, 53076, 53077, 53078, 53079, 53080, 53081,
53082, 53083, 53084, 53085, 53086, 53087, 53088, 53089, 53090,
53091, 53092, 53093, 53094, 53095, 53096, 53097, 53098, 53099,
53100, 53101, 53102, 53103, 53104, 53105, 53106, 53107,
53108, 53109, 53110, 53111, 53112, 53113, 53114, 53115, 53116,
53117, 53118, 53119, 53120, 53121, 53122, 53123, 53124, 53125,
53126, 53127, 53128, 53129, 53130, 53131, 53132, 53133, 53134,
53135, 53136, 53137, 53138, 53139, 53140, 53141, 53142, 53143,
53144, 53145, 53146, 53147, 53148, 53149, 53150, 53151, 53152,
53153, 53154, 53155, 53156, 53157, 53158, 53159, 53160, 53161,
53162, 53163, 53164, 53165, 53166, 53167, 53168, 53169, 53170,
53171, 53172, 53173, 53174, 53175, 53176, 53177, 53178, 53179,
53180, 53181, 53182, 53183, 53184, 53185, 53186, 53187, 53188,
53189, 53190, 53191, 53192, 53193, 53194, 53195, 53196, 53197,
53198, 53199, 53200, 53201, 53202, 53203, 53204, 53205, 53206,
53207, 53208, 53209, 53210, 53211, 53212, 53213, 53214, 53215,
53216, 53217, 53218, 53219, 53220, 53221, 53222, 53223, 53224,
53225, 53226, 53227, 53228, 53229, 53230, 53231, 53232, 53233,
53234, 53235, 53236, 53237, 53238, 53239, 53240, 53241, 53242,
53243, 53244, 53245, 53246, 53247, 53248, 53249, 53250, 53251,
53252, 53253, 53254, 53255, 53256, 53257, 53258, 53259, 53260,
53261, 53262, 53263, 53264, 53265, 53266, 53267, 53268, 53269,
53270, 53271, 53272, 53273, 53274, 53275, 53276, 53277, 53278,
53279, 53280, 53281, 53282, 53283, 53284, 53285, 53286, 53287,
53288, 53289, 53290, 53291, 53292, 53293, 53294, 53295, 53296,
53297, 53298, 53299, 53300, 53301, 53302, 53303, 53304, 53305,
53306, 53307, 53308, 53309, 53310, 53311, 53312, 53313, 53314,
53315, 53316, 53317, 53318, 53319, 53320, 53321, 53322, 53323,
53324, 53325, 53326, 53327, 53328, 53329, 53330, 53331, 53332,
53333, 53334, 53335, 53336, 53337, 53338, 53339, 53340, 53341,
53342, 53343, 53344, 53345, 53346, 53347, 53348, 53349, 53350,
53351, 53352, 53353, 53354, 53355, 53356, 53357, 53358, 53359,
53360, 53361, 53362, 53363, 53364, 53365, 53366, 53367, 53368,
53369, 53370, 53371, 53372, 53373, 53374, 53375, 53376, 53377,
53378, 53379, 53380, 53381, 53382, 53383, 53384, 53385, 53386,
53387, 53388, 53389, 53390, 53391, 53392, 53393, 53394, 53395,
53396, 53397, 53398, 53399, 53400, 53401, 53402, 53403, 53404,
53405, 53406, 53407, 53408, 53409, 53410, 53411, 53412, 53413,
53414, 53415, 53416, 53417, 53418, 53419, 53420, 53421, 53422,
53423, 53424, 53425, 53426, 53427, 53428, 53429, 53430, 53431,
53432, 53433, 53434, 53435, 53436, 53437, 53438, 53439, 53440,
53441, 53442, 53443, 53444, 53445, 53446, 53447, 53448, 53449,
53450, 53451, 53452, 53453, 53454, 53455, 53456, 53457, 53458,
53459, 53460, 53461, 53462, 53463, 53464, 53465, 53466, 53467,
53468, 53469, 53470, 53471, 53472, 53473, 53474, 53475, 53476,
53477, 53478, 53479, 53480, 53481, 53482, 53483, 53484, 53485,
53486, 53487, 53488, 53489, 53490, 53491, 53492, 53493, 53494,
53495, 53496, 53497, 53498, 53499, 53500, 53501, 53502, 53503,
53504, 53505, 53506, 53507, 53508, 53509, 53510, 53511, 53512,
53513, 53514, 53515, 53516, 53517, 53518, 53519, 53520, 53521,
53522, 53523, 53524, 53525, 53526, 53527, 53528, 53529, 53530,
53531, 53532, 53533, 53534, 53535, 53536, 53537, 53538, 53539,
53540, 53541, 53542, 53543, 53544, 53545, 53546, 53547, 53548,
53549, 53550, 53551, 53552, 53553, 53554, 53555, 53556, 53557,
53558, 53559, 53560, 53561, 53562, 53563, 53564, 53565, 53566,
53567, 53568, 53569, 53570, 53571, 53572, 53573, 53574, 53575,
53576, 53577, 53578, 53579, 53580, 53581, 53582, 53583, 53584,
53585, 53586, 53587, 53588, 53589, 53590, 53591, 53592, 53593,
53594, 53595, 53596, 53597, 53598, 53599, 53600, 53601, 53602,
53603, 53604, 53605, 53606, 53607, 53608, 53609, 53610, 53611,
53612, 53613, 53614, 53615, 53616, 53617, 53618, 53619, 53620,
53621, 53622, 53623, 53624, 53625, 53626, 53627, 53628, 53629,
53630, 53631, 53632, 53633, 53634, 53635, 53636, 53637, 53638,
53639, 53640, 53641, 53642, 53643, 53644, 53645, 53646, 53647,
53648, 53649, 53650, 53651, 53652, 53653, 53654, 53655, 53656,
53657, 53658, 53659, 53660, 53661, 53662, 53663, 53664, 53665,
53666, 53667, 53668, 53669, 53670, 53671, 53672, 53673, 53674,
53675, 53676, 53677, 53678, 53679, 53680, 53681, 53682, 53683,
53684, 53685, 53686, 53687, 53688, 53689, 53690, 53691, 53692,
53693, 53694, 53695, 53696, 53697, 53698, 53699, 53700, 53701,
53702, 53703, 53704, 53705, 53706, 53707, 53708, 53709, 53710,
53711, 53712, 53713, 53714, 53715, 53716, 53717, 53718, 53719,
53720, 53721, 53722, 53723, 53724, 53725, 53726, 53727, 53728,
53729, 53730, 53731, 53732, 53733, 53734, 53735, 53736, 53737,
53738, 53739, 53740, 53741, 53742, 53743, 53744, 53745, 53746,
53747, 53748, 53749, 53750, 53751, 53752, 53753, 53754, 53755,
53756, 53757, 53758, 53759, 53760, 53761, 53762, 53763, 53764,
53765, 53766, 53767, 53768, 53769, 53770, 53771, 53772, 53773,
53774, 53775, 53776, 53777, 53778, 53779, 53780, 53781, 53782,
53783, 53784, 53785, 53786, 53787, 53788, 53789, 53790, 53791,
53792, 53793, 53794, 53795, 53796, 53797, 53798, 53799, 53800,
53801, 53802, 53803, 53804, 53805, 53806, 53807, 53808, 53809,
53810, 53811, 53812, 53813, 53814, 53815, 53816, 53817, 53818,
53819, 53820, 53821, 53822, 53823, 53824, 53825, 53826, 53827,
53828, 53829, 53830, 53831, 53832, 53833, 53834, 53835, 53836,
53837, 53838, 53839, 53840, 53841, 53842, 53843, 53844, 53845,
53846, 53847, 53848, 53849, 53850, 53851, 53852, 53853, 53854,
53855, 53856, 53857, 53858, 53859, 53860, 53861, 53862, 53863,
53864, 53865, 53866, 53867, 53868, 53869, 53870, 53871, 53872,
53873, 53874, 53875, 53876, 53877, 53878, 53879, 53880, 53881,
53882, 53883, 53884, 53885, 53886, 53887, 53888, 53889, 53890,
53891, 53892, 53893, 53894, 53895, 53896, 53897, 53898, 53899,
53900, 53901, 53902, 53903, 53904, 53905, 53906, 53907, 53908,
53909, 53910, 53911, 53912, 53913, 53914, 53915, 53916, 53917,
53918, 53919, 53920, 53921, 53922, 53923, 53924, 53925, 53926,
53927, 53928, 53929, 53930, 53931, 53932, 53933, 53934, 53935,
53936, 53937, 53938, 53939, 53940, 53941, 53942, 53943, 53944,
53945, 53946, 53947, 53948, 53949, 53950, 53951, 53952, 53953,
53954, 53955, 53956, 53957, 53958, 53959, 53960, 53961, 53962,
53963, 53964, 53965, 53966, 53967, 53968, 53969, 53970, 53971,
53972, 53973, 53974, 53975, 53976, 53977, 53978, 53979, 53980,
53981, 53982, 53983, 53984, 53985, 53986, 53987, 53988, 53989,
53990, 53991, 53992, 53993, 53994, 53995, 53996, 53997, 53998,
53999, 54000, 54001, 54002, 54003, 54004, 54005, 54006, 54007,
54008, 54009, 54010, 54011, 54012, 54013, 54014, 54015, 54016,
54017, 54018, 54019, 54020, 54021, 54022, 54023, 54024, 54025,
54026, 54027, 54028, 54029, 54030, 54031, 54032, 54033, 54034,
54035, 54036, 54037, 54038, 54039, 54040, 54041, 54042, 54043,
54044, 54045, 54046, 54047, 54048, 54049, 54050, 54051, 54052,
54053, 54054, 54055, 54056, 54057, 54058, 54059, 54060, 54061,
54062, 54063, 54064, 54065, 54066, 54067, 54068, 54069, 54070,
54071, 54072, 54073, 54074, 54075, 54076, 54077, 54078, 54079,
54080, 54081, 54082, 54083, 54084, 54085, 54086, 54087, 54088,
54089, 54090, 54091, 54092, 54093, 54094, 54095, 54096, 54097,
54098, 54099, 54100, 54101, 54102, 54103, 54104, 54105, 54106,
54107, 54108, 54109, 54110, 54111, 54112, 54113, 54114, 54115,
54116, 54117, 54118, 54119, 54120, 54121, 54122, 54123, 54124,
54125, 54126, 54127, 54128, 54129, 54130, 54131, 54132, 54133,
54134, 54135, 54136, 54137, 54138, 54139, 54140, 54141, 54142,
54143, 54144, 54145, 54146, 54147, 54148, 54149, 54150, 54151,
54152, 54153, 54154, 54155, 54156, 54157, 54158, 54159, 54160,
54161, 54162, 54163, 54164, 54165, 54166, 54167, 54168, 54169,
54170, 54171, 54172, 54173, 54174, 54175, 54176, 54177, 54178,
54179, 54180, 54181, 54182, 54183, 54184, 54185, 54186, 54187,
54188, 54189, 54190, 54191, 54192, 54193, 54194, 54195, 54196,
54197, 54198, 54199, 54200, 54201, 54202, 54203, 54204, 54205,
54206, 54207, 54208, 54209, 54210, 54211, 54212, 54213, 54214,
54215, 54216, 54217, 54218, 54219, 54220, 54221, 54222, 54223,
54224, 54225, 54226, 54227, 54228, 54229, 54230, 54231, 54232,
54233, 54234, 54235, 54236, 54237, 54238, 54239, 54240, 54241,
54242, 54243, 54244, 54245, 54246, 54247, 54248, 54249, 54250,
54251, 54252, 54253, 54254, 54255, 54256, 54257, 54258, 54259,
54260, 54261, 54262, 54263, 54264, 54265, 54266, 54267, 54268,
54269, 54270, 54271, 54272, 54273, 54274, 54275, 54276, 54277,
54278, 54279, 54280, 54281, 54282, 54283, 54284, 54285, 54286,
54287, 54288, 54289, 54290, 54291, 54292, 54293, 54294, 54295,
54296, 54297, 54298, 54299, 54300, 54301, 54302, 54303, 54304,
54305, 54306, 54307, 54308, 54309, 54310, 54311, 54312, 54313,
54314, 54315, 54316, 54317, 54318, 54319, 54320, 54321, 54322,
54323, 54324, 54325, 54326, 54327, 54328, 54329, 54330, 54331,
54332, 54333, 54334, 54335, 54336, 54337, 54338, 54339, 54340,
54341, 54342, 54343, 54344, 54345, 54346, 54347, 54348, 54349,
54350, 54351, 54352, 54353, 54354, 54355, 54356, 54357, 54358,
54359, 54360, 54361, 54362, 54363, 54364, 54365, 54366, 54367,
54368, 54369, 54370, 54371, 54372, 54373, 54374, 54375, 54376,
54377, 54378, 54379, 54380, 54381, 54382, 54383, 54384, 54385,
54386, 54387, 54388, 54389, 54390, 54391, 54392, 54393, 54394,
54395, 54396, 54397, 54398, 54399, 54400, 54401, 54402, 54403,
54404, 54405, 54406, 54407, 54408, 54409, 54410, 54411, 54412,
54413, 54414, 54415, 54416, 54417, 54418, 54419, 54420, 54421,
54422, 54423, 54424, 54425, 54426, 54427, 54428, 54429, 54430,
54431, 54432, 54433, 54434, 54435, 54436, 54437, 54438, 54439,
54440, 54441, 54442, 54443, 54444, 54445, 54446, 54447, 54448,
54449, 54450, 54451, 54452, 54453, 54454, 54455, 54456, 54457,
54458, 54459, 54460, 54461, 54462, 54463, 54464, 54465, 54466,
54467, 54468, 54469, 54470, 54471, 54472, 54473, 54474, 54475,
54476, 54477, 54478, 54479, 54480, 54481, 54482, 54483, 54484,
54485, 54486, 54487, 54488, 54489, 54490, 54491, 54492, 54493,
54494, 54495, 54496, 54497, 54498, 54499, 54500, 54501, 54502,
54503, 54504, 54505, 54506, 54507, 54508, 54509, 54510, 54511,
54512, 54513, 54514, 54515, 54516, 54517, 54518, 54519, 54520,
54521, 54522, 54523, 54524, 54525, 54526, 54527, 54528, 54529,
54530, 54531, 54532, 54533, 54534, 54535, 54536, 54537, 54538,
54539, 54540, 54541, 54542, 54543, 54544, 54545, 54546, 54547,
54548, 54549, 54550, 54551, 54552, 54553, 54554, 54555, 54556,
54557, 54558, 54559, 54560, 54561, 54562, 54563, 54564, 54565,
54566, 54567, 54568, 54569, 54570, 54571, 54572, 54573, 54574,
54575, 54576, 54577, 54578, 54579, 54580, 54581, 54582, 54583,
54584, 54585, 54586, 54587, 54588, 54589, 54590, 54591, 54592,
54593, 54594, 54595, 54596, 54597, 54598, 54599, 54600, 54601,
54602, 54603, 54604, 54605, 54606, 54607, 54608, 54609, 54610,
54611, 54612, 54613, 54614, 54615, 54616, 54617, 54618, 54619,
54620, 54621, 54622, 54623, 54624, 54625, 54626, 54627, 54628,
54629, 54630, 54631, 54632, 54633, 54634, 54635, 54636, 54637,
54638, 54639, 54640, 54641, 54642, 54643, 54644, 54645, 54646,
54647, 54648, 54649, 54650, 54651, 54652, 54653, 54654, 54655,
54656, 54657, 54658, 54659, 54660, 54661, 54662, 54663, 54664,
54665, 54666, 54667, 54668, 54669, 54670, 54671, 54672, 54673,
54674, 54675, 54676, 54677, 54678, 54679, 54680, 54681, 54682,
54683, 54684, 54685, 54686, 54687, 54688, 54689, 54690, 54691,
54692, 54693, 54694, 54695, 54696, 54697, 54698, 54699, 54700,
54701, 54702, 54703, 54704, 54705, 54706, 54707, 54708, 54709,
54710, 54711, 54712, 54713, 54714, 54715, 54716, 54717, 54718,
54719, 54720, 54721, 54722, 54723, 54724, 54725, 54726, 54727,
54728, 54729, 54730, 54731, 54732, 54733, 54734, 54735, 54736,
54737, 54738, 54739, 54740, 54741, 54742, 54743, 54744, 54745,
54746, 54747, 54748, 54749, 54750, 54751, 54752, 54753, 54754,
54755, 54756, 54757, 54758, 54759, 54760, 54761, 54762, 54763,
54764, 54765, 54766, 54767, 54768, 54769, 54770, 54771, 54772,
54773, 54774, 54775, 54776, 54777, 54778, 54779, 54780, 54781,
54782, 54783, 54784, 54785, 54786, 54787, 54788, 54789, 54790,
54791, 54792, 54793, 54794, 54795, 54796, 54797, 54798, 54799,
54800, 54801, 54802, 54803, 54804, 54805, 54806, 54807, 54808,
54809, 54810, 54811, 54812, 54813, 54814, 54815, 54816, 54817,
54818, 54819, 54820, 54821, 54822, 54823, 54824, 54825, 54826,
54827, 54828, 54829, 54830, 54831, 54832, 54833, 54834, 54835,
54836, 54837, 54838, 54839, 54840, 54841, 54842, 54843, 54844,
54845, 54846, 54847, 54848, 54849, 54850, 54851, 54852, 54853,
54854, 54855, 54856, 54857, 54858, 54859, 54860, 54861, 54862,
54863, 54864, 54865, 54866, 54867, 54868, 54869, 54870, 54871,
54872, 54873, 54874, 54875, 54876, 54877, 54878, 54879, 54880,
54881, 54882, 54883, 54884, 54885, 54886, 54887, 54888, 54889,
54890, 54891, 54892, 54893, 54894, 54895, 54896, 54897, 54898,
54899, 54900, 54901, 54902, 54903, 54904, 54905, 54906, 54907,
54908, 54909, 54910, 54911, 54912, 54913, 54914, 54915, 54916,
54917, 54918, 54919, 54920, 54921, 54922, 54923, 54924, 54925,
54926, 54927, 54928, 54929, 54930, 54931, 54932, 54933, 54934,
54935, 54936, 54937, 54938, 54939, 54940, 54941, 54942, 54943,
54944, 54945, 54946, 54947, 54948, 54949, 54950, 54951, 54952,
54953, 54954, 54955, 54956, 54957, 54958, 54959, 54960, 54961,
54962, 54963, 54964, 54965, 54966, 54967, 54968, 54969, 54970,
54971, 54972, 54973, 54974, 54975, 54976, 54977, 54978, 54979,
54980, 54981, 54982, 54983, 54984, 54985, 54986, 54987, 54988,
54989, 54990, 54991, 54992, 54993, 54994, 54995, 54996, 54997,
54998, 54999, 55000, 55001, 55002, 55003, 55004, 55005, 55006,
55007, 55008, 55009, 55010, 55011, 55012, 55013, 55014, 55015,
55016, 55017, 55018, 55019, 55020, 55021, 55022, 55023, 55024,
55025, 55026, 55027, 55028, 55029, 55030, 55031, 55032, 55033,
55034, 55035, 55036, 55037, 55038, 55039, 55040, 55041, 55042,
55043, 55044, 55045, 55046, 55047, 55048, 55049, 55050, 55051,
55052, 55053, 55054, 55055, 55056, 55057, 55058, 55059, 55060,
55061, 55062, 55063, 55064, 55065, 55066, 55067, 55068, 55069,
55070, 55071, 55072, 55073, 55074, 55075, 55076, 55077, 55078,
55079, 55080, 55081, 55082, 55083, 55084, 55085, 55086, 55087,
55088, 55089, 55090, 55091, 55092, 55093, 55094, 55095, 55096,
55097, 55098, 55099, 55100, 55101, 55102, 55103, 55104, 55105,
55106, 55107, 55108, 55109, 55110, 55111, 55112, 55113, 55114,
55115, 55116, 55117, 55118, 55119, 55120, 55121, 55122, 55123,
55124, 55125, 55126, 55127, 55128, 55129, 55130, 55131, 55132,
55133, 55134, 55135, 55136, 55137, 55138, 55139, 55140, 55141,
55142, 55143, 55144, 55145, 55146, 55147, 55148, 55149, 55150,
55151, 55152, 55153, 55154, 55155, 55156, 55157, 55158, 55159,
55160, 55161, 55162, 55163, 55164, 55165, 55166, 55167, 55168,
55169, 55170, 55171, 55172, 55173, 55174, 55175, 55176, 55177,
55178, 55179, 55180, 55181, 55182, 55183, 55184, 55185, 55186,
55187, 55188, 55189, 55190, 55191, 55192, 55193, 55194, 55195,
55196, 55197, 55198, 55199, 55200, 55201, 55202, 55203, 55204,
55205, 55206, 55207, 55208, 55209, 55210, 55211, 55212, 55213,
55214, 55215, 55216, 55217, 55218, 55219, 55220, 55221, 55222,
55223, 55224, 55225, 55226, 55227, 55228, 55229, 55230, 55231,
55232, 55233, 55234, 55235, 55236, 55237, 55238, 55239, 55240,
55241, 55242, 55243, 55244, 55245, 55246, 55247, 55248, 55249,
55250, 55251, 55252, 55253, 55254, 55255, 55256, 55257, 55258,
55259, 55260, 55261, 55262, 55263, 55264, 55265, 55266, 55267,
55268, 55269, 55270, 55271, 55272, 55273, 55274, 55275, 55276,
55277, 55278, 55279, 55280, 55281, 55282, 55283, 55284, 55285,
55286, 55287, 55288, 55289, 55290, 55291, 55292, 55293, 55294,
55295, 55296, 55297, 55298, 55299, 55300, 55301, 55302, 55303,
55304, 55305, 55306, 55307, 55308, 55309, 55310, 55311, 55312,
55313, 55314, 55315, 55316, 55317, 55318, 55319, 55320, 55321,
55322, 55323, 55324, 55325, 55326, 55327, 55328, 55329, 55330,
55331, 55332, 55333, 55334, 55335, 55336, 55337, 55338, 55339,
55340, 55341, 55342, 55343, 55344, 55345, 55346, 55347, 55348,
55349, 55350, 55351, 55352, 55353, 55354, 55355, 55356, 55357,
55358, 55359, 55360, 55361, 55362, 55363, 55364, 55365, 55366,
55367, 55368, 55369, 55370, 55371, 55372, 55373, 55374, 55375,
55376, 55377, 55378, 55379, 55380, 55381, 55382, 55383, 55384,
55385, 55386, 55387, 55388, 55389, 55390, 55391, 55392, 55393,
55394, 55395, 55396, 55397, 55398, 55399, 55400, 55401, 55402,
55403, 55404, 55405, 55406, 55407, 55408, 55409, 55410, 55411,
55412, 55413, 55414, 55415, 55416, 55417, 55418, 55419, 55420,
55421, 55422, 55423, 55424, 55425, 55426, 55427, 55428, 55429,
55430, 55431, 55432, 55433, 55434, 55435, 55436, 55437, 55438,
55439, 55440, 55441, 55442, 55443, 55444, 55445, 55446, 55447,
55448, 55449, 55450, 55451, 55452, 55453, 55454, 55455, 55456,
55457, 55458, 55459, 55460, 55461, 55462, 55463, 55464, 55465,
55466, 55467, 55468, 55469, 55470, 55471, 55472, 55473, 55474,
55475, 55476, 55477, 55478, 55479, 55480, 55481, 55482, 55483,
55484, 55485, 55486, 55487, 55488, 55489, 55490, 55491, 55492,
55493, 55494, 55495, 55496, 55497, 55498, 55499, 55500, 55501,
55502, 55503, 55504, 55505, 55506, 55507, 55508, 55509, 55510,
55511, 55512, 55513, 55514, 55515, 55516, 55517, 55518, 55519,
55520, 55521, 55522, 55523, 55524, 55525, 55526, 55527, 55528,
55529, 55530, 55531, 55532, 55533, 55534, 55535, 55536, 55537,
55538, 55539, 55540, 55541, 55542, 55543, 55544, 55545, 55546,
55547, 55548, 55549, 55550, 55551, 55552, 55553, 55554, 55555,
55556, 55557, 55558, 55559, 55560, 55561, 55562, 55563, 55564,
55565, 55566, 55567, 55568, 55569, 55570, 55571, 55572, 55573,
55574, 55575, 55576, 55577, 55578, 55579, 55580, 55581, 55582,
55583, 55584, 55585, 55586, 55587, 55588, 55589, 55590, 55591,
55592, 55593, 55594, 55595, 55596, 55597, 55598, 55599, 55600,
55601, 55602, 55603, 55604, 55605, 55606, 55607, 55608, 55609,
55610, 55611, 55612, 55613, 55614, 55615, 55616, 55617,
55618, 55619, 55620, 55621, 55622, 55623, 55624, 55625, 55626,
55627, 55628, 55629, 55630, 55631, 55632, 55633, 55634, 55635,
55636, 55637, 55638, 55639, 55640, 55641, 55642, 55643, 55644,
55645, 55646, 55647, 55648, 55649, 55650, 55651, 55652, 55653,
55654, 55655, 55656, 55657, 55658, 55659, 55660, 55661, 55662,
55663, 55664, 55665, 55666, 55667, 55668, 55669, 55670, 55671,
55672, 55673, 55674, 55675, 55676, 55677, 55678, 55679, 55680,
55681, 55682, 55683, 55684, 55685, 55686, 55687, 55688, 55689,
55690, 55691, 55692, 55693, 55694, 55695, 55696, 55697, 55698,
55699, 55700, 55701, 55702, 55703, 55704, 55705, 55706, 55707,
55708, 55709, 55710, 55711, 55712, 55713, 55714, 55715, 55716,
55717, 55718, 55719, 55720, 55721, 55722, 55723, 55724, 55725,
55726, 55727, 55728, 55729, 55730, 55731, 55732, 55733, 55734,
55735, 55736, 55737, 55738, 55739, 55740, 55741, 55742, 55743,
55744, 55745, 55746, 55747, 55748, 55749, 55750, 55751, 55752,
55753, 55754, 55755, 55756, 55757, 55758, 55759, 55760, 55761,
55762, 55763, 55764, 55765, 55766, 55767, 55768, 55769, 55770,
55771, 55772, 55773, 55774, 55775, 55776, 55777, 55778, 55779,
55780, 55781, 55782, 55783, 55784, 55785, 55786, 55787, 55788,
55789, 55790, 55791, 55792, 55793, 55794, 55795, 55796, 55797,
55798, 55799, 55800, 55801, 55802, 55803, 55804, 55805, 55806,
55807, 55808, 55809, 55810, 55811, 55812, 55813, 55814, 55815,
55816, 55817, 55818, 55819, 55820, 55821, 55822, 55823, 55824,
55825, 55826, 55827, 55828, 55829, 55830, 55831, 55832, 55833,
55834, 55835, 55836, 55837, 55838, 55839, 55840, 55841, 55842,
55843, 55844, 55845, 55846, 55847, 55848, 55849, 55850, 55851,
55852, 55853, 55854, 55855, 55856, 55857, 55858, 55859, 55860,
55861, 55862, 55863, 55864, 55865, 55866, 55867, 55868, 55869,
55870, 55871, 55872, 55873, 55874, 55875, 55876, 55877, 55878,
55879, 55880, 55881, 55882, 55883, 55884, 55885, 55886, 55887,
55888, 55889, 55890, 55891, 55892, 55893, 55894, 55895, 55896,
55897, 55898, 55899, 55900, 55901, 55902, 55903, 55904, 55905,
55906, 55907, 55908, 55909, 55910, 55911, 55912, 55913, 55914,
55915, 55916, 55917, 55918, 55919, 55920, 55921, 55922, 55923,
55924, 55925, 55926, 55927, 55928, 55929, 55930, 55931, 55932,
55933, 55934, 55935, 55936, 55937, 55938, 55939, 55940, 55941,
55942, 55943, 55944, 55945, 55946, 55947, 55948, 55949, 55950,
55951, 55952, 55953, 55954, 55955, 55956, 55957, 55958, 55959,
55960, 55961, 55962, 55963, 55964, 55965, 55966, 55967, 55968,
55969, 55970, 55971, 55972, 55973, 55974, 55975, 55976, 55977,
55978, 55979, 55980, 55981, 55982, 55983, 55984, 55985, 55986,
55987, 55988, 55989, 55990, 55991, 55992, 55993, 55994, 55995,
55996, 55997, 55998, 55999, 56000, 56001, 56002, 56003, 56004,
56005, 56006, 56007, 56008, 56009, 56010, 56011, 56012, 56013,
56014, 56015, 56016, 56017, 56018, 56019, 56020, 56021, 56022,
56023, 56024, 56025, 56026, 56027, 56028, 56029, 56030, 56031,
56032, 56033, 56034, 56035, 56036, 56037, 56038, 56039, 56040,
56041, 56042, 56043, 56044, 56045, 56046, 56047, 56048, 56049,
56050, 56051, 56052, 56053, 56054, 56055, 56056, 56057, 56058,
56059, 56060, 56061, 56062, 56063, 56064, 56065, 56066, 56067,
56068, 56069, 56070, 56071, 56072, 56073, 56074, 56075, 56076,
56077, 56078, 56079, 56080, 56081, 56082, 56083, 56084, 56085,
56086, 56087, 56088, 56089, 56090, 56091, 56092, 56093, 56094,
56095, 56096, 56097, 56098, 56099, 56100, 56101, 56102, 56103,
56104, 56105, 56106, 56107, 56108, 56109, 56110, 56111, 56112,
56113, 56114, 56115, 56116, 56117, 56118, 56119, 56120, 56121,
56122, 56123, 56124, 56125, 56126, 56127, 56128, 56129, 56130,
56131, 56132, 56133, 56134, 56135, 56136, 56137, 56138, 56139,
56140, 56141, 56142, 56143, 56144, 56145, 56146, 56147, 56148,
56149, 56150, 56151, 56152, 56153, 56154, 56155, 56156, 56157,
56158, 56159, 56160, 56161, 56162, 56163, 56164, 56165, 56166,
56167, 56168, 56169, 56170, 56171, 56172, 56173, 56174, 56175,
56176, 56177, 56178, 56179, 56180, 56181, 56182, 56183, 56184,
56185, 56186, 56187, 56188, 56189, 56190, 56191, 56192, 56193,
56194, 56195, 56196, 56197, 56198, 56199, 56200, 56201, 56202,
56203, 56204, 56205, 56206, 56207, 56208, 56209, 56210, 56211,
56212, 56213, 56214, 56215, 56216, 56217, 56218, 56219, 56220,
56221, 56222, 56223, 56224, 56225, 56226, 56227, 56228, 56229,
56230, 56231, 56232, 56233, 56234, 56235, 56236, 56237, 56238,
56239, 56240, 56241, 56242, 56243, 56244, 56245, 56246, 56247,
56248, 56249, 56250, 56251, 56252, 56253, 56254, 56255, 56256,
56257, 56258, 56259, 56260, 56261, 56262, 56263, 56264, 56265,
56266, 56267, 56268, 56269, 56270, 56271, 56272, 56273, 56274,
56275, 56276, 56277, 56278, 56279, 56280, 56281, 56282, 56283,
56284, 56285, 56286, 56287, 56288, 56289, 56290, 56291, 56292,
56293, 56294, 56295, 56296, 56297, 56298, 56299, 56300, 56301,
56302, 56303, 56304, 56305, 56306, 56307, 56308, 56309, 56310,
56311, 56312, 56313, 56314, 56315, 56316, 56317, 56318, 56319,
56320, 56321, 56322, 56323, 56324, 56325, 56326, 56327, 56328,
56329, 56330, 56331, 56332, 56333, 56334, 56335, 56336, 56337,
56338, 56339, 56340, 56341, 56342, 56343, 56344, 56345, 56346,
56347, 56348, 56349, 56350, 56351, 56352, 56353, 56354, 56355,
56356, 56357, 56358, 56359, 56360, 56361, 56362, 56363, 56364,
56365, 56366, 56367, 56368, 56369, 56370, 56371, 56372, 56373,
56374, 56375, 56376, 56377, 56378, 56379, 56380, 56381, 56382,
56383, 56384, 56385, 56386, 56387, 56388, 56389, 56390, 56391,
56392, 56393, 56394, 56395, 56396, 56397, 56398, 56399, 56400,
56401, 56402, 56403, 56404, 56405, 56406, 56407, 56408, 56409,
56410, 56411, 56412, 56413, 56414, 56415, 56416, 56417, 56418,
56419, 56420, 56421, 56422, 56423, 56424, 56425, 56426, 56427,
56428, 56429, 56430, 56431, 56432, 56433, 56434, 56435, 56436,
56437, 56438, 56439, 56440, 56441, 56442, 56443, 56444, 56445,
56446, 56447, 56448, 56449, 56450, 56451, 56452, 56453, 56454,
56455, 56456, 56457, 56458, 56459, 56460, 56461, 56462, 56463,
56464, 56465, 56466, 56467, 56468, 56469, 56470, 56471, 56472,
56473, 56474, 56475, 56476, 56477, 56478, 56479, 56480, 56481,
56482, 56483, 56484, 56485, 56486, 56487, 56488, 56489, 56490,
56491, 56492, 56493, 56494, 56495, 56496, 56497, 56498, 56499,
56500, 56501, 56502, 56503, 56504, 56505, 56506, 56507, 56508,
56509, 56510, 56511, 56512, 56513, 56514, 56515, 56516, 56517,
56518, 56519, 56520, 56521, 56522, 56523, 56524, 56525, 56526,
56527, 56528, 56529, 56530, 56531, 56532, 56533, 56534, 56535,
56536, 56537, 56538, 56539, 56540, 56541, 56542, 56543, 56544,
56545, 56546, 56547, 56548, 56549, 56550, 56551, 56552, 56553,
56554, 56555, 56556, 56557, 56558, 56559, 56560, 56561, 56562,
56563, 56564, 56565, 56566, 56567, 56568, 56569, 56570, 56571,
56572, 56573, 56574, 56575, 56576, 56577, 56578, 56579, 56580,
56581, 56582, 56583, 56584, 56585, 56586, 56587, 56588, 56589,
56590, 56591, 56592, 56593, 56594, 56595, 56596, 56597, 56598,
56599, 56600, 56601, 56602, 56603, 56604, 56605, 56606, 56607,
56608, 56609, 56610, 56611, 56612, 56613, 56614, 56615, 56616,
56617, 56618, 56619, 56620, 56621, 56622, 56623, 56624, 56625,
56626, 56627, 56628, 56629, 56630, 56631, 56632, 56633, 56634,
56635, 56636, 56637, 56638, 56639, 56640, 56641, 56642, 56643,
56644, 56645, 56646, 56647, 56648, 56649, 56650, 56651, 56652,
56653, 56654, 56655, 56656, 56657, 56658, 56659, 56660, 56661,
56662, 56663, 56664, 56665, 56666, 56667, 56668, 56669, 56670,
56671, 56672, 56673, 56674, 56675, 56676, 56677, 56678, 56679,
56680, 56681, 56682, 56683, 56684, 56685, 56686, 56687, 56688,
56689, 56690, 56691, 56692, 56693, 56694, 56695, 56696, 56697,
56698, 56699, 56700, 56701, 56702, 56703, 56704, 56705, 56706,
56707, 56708, 56709, 56710, 56711, 56712, 56713, 56714, 56715,
56716, 56717, 56718, 56719, 56720, 56721, 56722, 56723, 56724,
56725, 56726, 56727, 56728, 56729, 56730, 56731, 56732, 56733,
56734, 56735, 56736, 56737, 56738, 56739, 56740, 56741, 56742,
56743, 56744, 56745, 56746, 56747, 56748, 56749, 56750, 56751,
56752, 56753, 56754, 56755, 56756, 56757, 56758, 56759, 56760,
56761, 56762, 56763, 56764, 56765, 56766, 56767, 56768, 56769,
56770, 56771, 56772, 56773, 56774, 56775, 56776, 56777, 56778,
56779, 56780, 56781, 56782, 56783, 56784, 56785, 56786, 56787,
56788, 56789, 56790, 56791, 56792, 56793, 56794, 56795, 56796,
56797, 56798, 56799, 56800, 56801, 56802, 56803, 56804, 56805,
56806, 56807, 56808, 56809, 56810, 56811, 56812, 56813, 56814,
56815, 56816, 56817, 56818, 56819, 56820, 56821, 56822, 56823,
56824, 56825, 56826, 56827, 56828, 56829, 56830, 56831, 56832,
56833, 56834, 56835, 56836, 56837, 56838, 56839, 56840, 56841,
56842, 56843, 56844, 56845, 56846, 56847, 56848, 56849, 56850,
56851, 56852, 56853, 56854, 56855, 56856, 56857, 56858, 56859,
56860, 56861, 56862, 56863, 56864, 56865, 56866, 56867, 56868,
56869, 56870, 56871, 56872, 56873, 56874, 56875, 56876, 56877,
56878, 56879, 56880, 56881, 56882, 56883, 56884, 56885, 56886,
56887, 56888, 56889, 56890, 56891, 56892, 56893, 56894, 56895,
56896, 56897, 56898, 56899, 56900, 56901, 56902, 56903, 56904,
56905, 56906, 56907, 56908, 56909, 56910, 56911, 56912, 56913,
56914, 56915, 56916, 56917, 56918, 56919, 56920, 56921, 56922,
56923, 56924, 56925, 56926, 56927, 56928, 56929, 56930, 56931,
56932, 56933, 56934, 56935, 56936, 56937, 56938, 56939, 56940,
56941, 56942, 56943, 56944, 56945, 56946, 56947, 56948, 56949,
56950, 56951, 56952, 56953, 56954, 56955, 56956, 56957, 56958,
56959, 56960, 56961, 56962, 56963, 56964, 56965, 56966, 56967,
56968, 56969, 56970, 56971, 56972, 56973, 56974, 56975, 56976,
56977, 56978, 56979, 56980, 56981, 56982, 56983, 56984, 56985,
56986, 56987, 56988, 56989, 56990, 56991, 56992, 56993, 56994,
56995, 56996, 56997, 56998, 56999, 57000, 57001, 57002, 57003,
57004, 57005, 57006, 57007, 57008, 57009, 57010, 57011, 57012,
57013, 57014, 57015, 57016, 57017, 57018, 57019, 57020, 57021,
57022, 57023, 57024, 57025, 57026, 57027, 57028, 57029, 57030,
57031, 57032, 57033, 57034, 57035, 57036, 57037, 57038, 57039,
57040, 57041, 57042, 57043, 57044, 57045, 57046, 57047, 57048,
57049, 57050, 57051, 57052, 57053, 57054, 57055, 57056, 57057,
57058, 57059, 57060, 57061, 57062, 57063, 57064, 57065, 57066,
57067, 57068, 57069, 57070, 57071, 57072, 57073, 57074, 57075,
57076, 57077, 57078, 57079, 57080, 57081, 57082, 57083, 57084,
57085, 57086, 57087, 57088, 57089, 57090, 57091, 57092, 57093,
57094, 57095, 57096, 57097, 57098, 57099, 57100, 57101, 57102,
57103, 57104, 57105, 57106, 57107, 57108, 57109, 57110, 57111,
57112, 57113, 57114, 57115, 57116, 57117, 57118, 57119, 57120,
57121, 57122, 57123, 57124, 57125, 57126, 57127, 57128, 57129,
57130, 57131, 57132, 57133, 57134, 57135, 57136, 57137, 57138,
57139, 57140, 57141, 57142, 57143, 57144, 57145, 57146, 57147,
57148, 57149, 57150, 57151, 57152, 57153, 57154, 57155, 57156,
57157, 57158, 57159, 57160, 57161, 57162, 57163, 57164, 57165,
57166, 57167, 57168, 57169, 57170, 57171, 57172, 57173, 57174,
57175, 57176, 57177, 57178, 57179, 57180, 57181, 57182, 57183,
57184, 57185, 57186, 57187, 57188, 57189, 57190, 57191, 57192,
57193, 57194, 57195, 57196, 57197, 57198, 57199, 57200, 57201,
57202, 57203, 57204, 57205, 57206, 57207, 57208, 57209, 57210,
57211, 57212, 57213, 57214, 57215, 57216, 57217, 57218, 57219,
57220, 57221, 57222, 57223, 57224, 57225, 57226, 57227, 57228,
57229, 57230, 57231, 57232, 57233, 57234, 57235, 57236, 57237,
57238, 57239, 57240, 57241, 57242, 57243, 57244, 57245, 57246,
57247, 57248, 57249, 57250, 57251, 57252, 57253, 57254, 57255,
57256, 57257, 57258, 57259, 57260, 57261, 57262, 57263, 57264,
57265, 57266, 57267, 57268, 57269, 57270, 57271, 57272, 57273,
57274, 57275, 57276, 57277, 57278, 57279, 57280, 57281, 57282,
57283, 57284, 57285, 57286, 57287, 57288, 57289, 57290, 57291,
57292, 57293, 57294, 57295, 57296, 57297, 57298, 57299, 57300,
57301, 57302, 57303, 57304, 57305, 57306, 57307, 57308, 57309,
57310, 57311, 57312, 57313, 57314, 57315, 57316, 57317, 57318,
57319, 57320, 57321, 57322, 57323, 57324, 57325, 57326, 57327,
57328, 57329, 57330, 57331, 57332, 57333, 57334, 57335, 57336,
57337, 57338, 57339, 57340, 57341, 57342, 57343, 57344, 57345,
57346, 57347, 57348, 57349, 57350, 57351, 57352, 57353, 57354,
57355, 57356, 57357, 57358, 57359, 57360, 57361, 57362, 57363,
57364, 57365, 57366, 57367, 57368, 57369, 57370, 57371, 57372,
57373, 57374, 57375, 57376, 57377, 57378, 57379, 57380, 57381,
57382, 57383, 57384, 57385, 57386, 57387, 57388, 57389, 57390,
57391, 57392, 57393, 57394, 57395, 57396, 57397, 57398, 57399,
57400, 57401, 57402, 57403, 57404, 57405, 57406, 57407, 57408,
57409, 57410, 57411, 57412, 57413, 57414, 57415, 57416, 57417,
57418, 57419, 57420, 57421, 57422, 57423, 57424, 57425, 57426,
57427, 57428, 57429, 57430, 57431, 57432, 57433, 57434, 57435,
57436, 57437, 57438, 57439, 57440, 57441, 57442, 57443, 57444,
57445, 57446, 57447, 57448, 57449, 57450, 57451, 57452, 57453,
57454, 57455, 57456, 57457, 57458, 57459, 57460, 57461, 57462,
57463, 57464, 57465, 57466, 57467, 57468, 57469, 57470, 57471,
57472, 57473, 57474, 57475, 57476, 57477, 57478, 57479, 57480,
57481, 57482, 57483, 57484, 57485, 57486, 57487, 57488, 57489,
57490, 57491, 57492, 57493, 57494, 57495, 57496, 57497, 57498,
57499, 57500, 57501, 57502, 57503, 57504, 57505, 57506, 57507,
57508, 57509, 57510, 57511, 57512, 57513, 57514, 57515, 57516,
57517, 57518, 57519, 57520, 57521, 57522, 57523, 57524, 57525,
57526, 57527, 57528, 57529, 57530, 57531, 57532, 57533, 57534,
57535, 57536, 57537, 57538, 57539, 57540, 57541, 57542, 57543,
57544, 57545, 57546, 57547, 57548, 57549, 57550, 57551, 57552,
57553, 57554, 57555, 57556, 57557, 57558, 57559, 57560, 57561,
57562, 57563, 57564, 57565, 57566, 57567, 57568, 57569, 57570,
57571, 57572, 57573, 57574, 57575, 57576, 57577, 57578, 57579,
57580, 57581, 57582, 57583, 57584, 57585, 57586, 57587, 57588,
57589, 57590, 57591, 57592, 57593, 57594, 57595, 57596, 57597,
57598, 57599, 57600, 57601, 57602, 57603, 57604, 57605, 57606,
57607, 57608, 57609, 57610, 57611, 57612, 57613, 57614, 57615,
57616, 57617, 57618, 57619, 57620, 57621, 57622, 57623, 57624,
57625, 57626, 57627, 57628, 57629, 57630, 57631, 57632, 57633,
57634, 57635, 57636, 57637, 57638, 57639, 57640, 57641, 57642,
57643, 57644, 57645, 57646, 57647, 57648, 57649, 57650, 57651,
57652, 57653, 57654, 57655, 57656, 57657, 57658, 57659, 57660,
57661, 57662, 57663, 57664, 57665, 57666, 57667, 57668, 57669,
57670, 57671, 57672, 57673, 57674, 57675, 57676, 57677, 57678,
57679, 57680, 57681, 57682, 57683, 57684, 57685, 57686, 57687,
57688, 57689, 57690, 57691, 57692, 57693, 57694, 57695, 57696,
57697, 57698, 57699, 57700, 57701, 57702, 57703, 57704, 57705,
57706, 57707, 57708, 57709, 57710, 57711, 57712, 57713, 57714,
57715, 57716, 57717, 57718, 57719, 57720, 57721, 57722, 57723,
57724, 57725, 57726, 57727, 57728, 57729, 57730, 57731, 57732,
57733, 57734, 57735, 57736, 57737, 57738, 57739, 57740, 57741,
57742, 57743, 57744, 57745, 57746, 57747, 57748, 57749, 57750,
57751, 57752, 57753, 57754, 57755, 57756, 57757, 57758, 57759,
57760, 57761, 57762, 57763, 57764, 57765, 57766, 57767, 57768,
57769, 57770, 57771, 57772, 57773, 57774, 57775, 57776, 57777,
57778, 57779, 57780, 57781, 57782, 57783, 57784, 57785, 57786,
57787, 57788, 57789, 57790, 57791, 57792, 57793, 57794, 57795,
57796, 57797, 57798, 57799, 57800, 57801, 57802, 57803, 57804,
57805, 57806, 57807, 57808, 57809, 57810, 57811, 57812, 57813,
57814, 57815, 57816, 57817, 57818, 57819, 57820, 57821, 57822,
57823, 57824, 57825, 57826, 57827, 57828, 57829, 57830, 57831,
57832, 57833, 57834, 57835, 57836, 57837, 57838, 57839, 57840,
57841, 57842, 57843, 57844, 57845, 57846, 57847, 57848, 57849,
57850, 57851, 57852, 57853, 57854, 57855, 57856, 57857, 57858,
57859, 57860, 57861, 57862, 57863, 57864, 57865, 57866, 57867,
57868, 57869, 57870, 57871, 57872, 57873, 57874, 57875, 57876,
57877, 57878, 57879, 57880, 57881, 57882, 57883, 57884, 57885,
57886, 57887, 57888, 57889, 57890, 57891, 57892, 57893, 57894,
57895, 57896, 57897, 57898, 57899, 57900, 57901, 57902, 57903,
57904, 57905, 57906, 57907, 57908, 57909, 57910, 57911, 57912,
57913, 57914, 57915, 57916, 57917, 57918, 57919, 57920, 57921,
57922, 57923, 57924, 57925, 57926, 57927, 57928, 57929, 57930,
57931, 57932, 57933, 57934, 57935, 57936, 57937, 57938, 57939,
57940, 57941, 57942, 57943, 57944, 57945, 57946, 57947, 57948,
57949, 57950, 57951, 57952, 57953, 57954, 57955, 57956, 57957,
57958, 57959, 57960, 57961, 57962, 57963, 57964, 57965, 57966,
57967, 57968, 57969, 57970, 57971, 57972, 57973, 57974, 57975,
57976, 57977, 57978, 57979, 57980, 57981, 57982, 57983, 57984,
57985, 57986, 57987, 57988, 57989, 57990, 57991, 57992, 57993,
57994, 57995, 57996, 57997, 57998, 57999, 58000, 58001, 58002,
58003, 58004, 58005, 58006, 58007, 58008, 58009, 58010, 58011,
58012, 58013, 58014, 58015, 58016, 58017, 58018, 58019, 58020,
58021, 58022, 58023, 58024, 58025, 58026, 58027, 58028, 58029,
58030, 58031, 58032, 58033, 58034, 58035, 58036, 58037, 58038,
58039, 58040, 58041, 58042, 58043, 58044, 58045, 58046, 58047,
58048, 58049, 58050, 58051, 58052, 58053, 58054, 58055, 58056,
58057, 58058, 58059, 58060, 58061, 58062, 58063, 58064, 58065,
58066, 58067, 58068, 58069, 58070, 58071, 58072, 58073, 58074,
58075, 58076, 58077, 58078, 58079, 58080, 58081, 58082, 58083,
58084, 58085, 58086, 58087, 58088, 58089, 58090, 58091, 58092,
58093, 58094, 58095, 58096, 58097, 58098, 58099, 58100, 58101,
58102, 58103, 58104, 58105, 58106, 58107, 58108, 58109, 58110,
58111, 58112, 58113, 58114, 58115, 58116, 58117, 58118, 58119,
58120, 58121, 58122, 58123, 58124, 58125, 58126, 58127,
58128, 58129, 58130, 58131, 58132, 58133, 58134, 58135, 58136,
58137, 58138, 58139, 58140, 58141, 58142, 58143, 58144, 58145,
58146, 58147, 58148, 58149, 58150, 58151, 58152, 58153, 58154,
58155, 58156, 58157, 58158, 58159, 58160, 58161, 58162, 58163,
58164, 58165, 58166, 58167, 58168, 58169, 58170, 58171, 58172,
58173, 58174, 58175, 58176, 58177, 58178, 58179, 58180, 58181,
58182, 58183, 58184, 58185, 58186, 58187, 58188, 58189, 58190,
58191, 58192, 58193, 58194, 58195, 58196, 58197, 58198, 58199,
58200, 58201, 58202, 58203, 58204, 58205, 58206, 58207, 58208,
58209, 58210, 58211, 58212, 58213, 58214, 58215, 58216, 58217,
58218, 58219, 58220, 58221, 58222, 58223, 58224, 58225, 58226,
58227, 58228, 58229, 58230, 58231, 58232, 58233, 58234, 58235,
58236, 58237, 58238, 58239, 58240, 58241, 58242, 58243, 58244,
58245, 58246, 58247, 58248, 58249, 58250, 58251, 58252, 58253,
58254, 58255, 58256, 58257, 58258, 58259, 58260, 58261, 58262,
58263, 58264, 58265, 58266, 58267, 58268, 58269, 58270, 58271,
58272, 58273, 58274, 58275, 58276, 58277, 58278, 58279, 58280,
58281, 58282, 58283, 58284, 58285, 58286, 58287, 58288, 58289,
58290, 58291, 58292, 58293, 58294, 58295, 58296, 58297, 58298,
58299, 58300, 58301, 58302, 58303, 58304, 58305, 58306, 58307,
58308, 58309, 58310, 58311, 58312, 58313, 58314, 58315, 58316,
58317, 58318, 58319, 58320, 58321, 58322, 58323, 58324, 58325,
58326, 58327, 58328, 58329, 58330, 58331, 58332, 58333, 58334,
58335, 58336, 58337, 58338, 58339, 58340, 58341, 58342, 58343,
58344, 58345, 58346, 58347, 58348, 58349, 58350, 58351, 58352,
58353, 58354, 58355, 58356, 58357, 58358, 58359, 58360, 58361,
58362, 58363, 58364, 58365, 58366, 58367, 58368, 58369, 58370,
58371, 58372, 58373, 58374, 58375, 58376, 58377, 58378, 58379,
58380, 58381, 58382, 58383, 58384, 58385, 58386, 58387, 58388,
58389, 58390, 58391, 58392, 58393, 58394, 58395, 58396, 58397,
58398, 58399, 58400, 58401, 58402, 58403, 58404, 58405, 58406,
58407, 58408, 58409, 58410, 58411, 58412, 58413, 58414, 58415,
58416, 58417, 58418, 58419, 58420, 58421, 58422, 58423, 58424,
58425, 58426, 58427, 58428, 58429, 58430, 58431, 58432, 58433,
58434, 58435, 58436, 58437, 58438, 58439, 58440, 58441, 58442,
58443, 58444, 58445, 58446, 58447, 58448, 58449, 58450, 58451,
58452, 58453, 58454, 58455, 58456, 58457, 58458, 58459, 58460,
58461, 58462, 58463, 58464, 58465, 58466, 58467, 58468, 58469,
58470, 58471, 58472, 58473, 58474, 58475, 58476, 58477, 58478,
58479, 58480, 58481, 58482, 58483, 58484, 58485, 58486, 58487,
58488, 58489, 58490, 58491, 58492, 58493, 58494, 58495, 58496,
58497, 58498, 58499, 58500, 58501, 58502, 58503, 58504, 58505,
58506, 58507, 58508, 58509, 58510, 58511, 58512, 58513, 58514,
58515, 58516, 58517, 58518, 58519, 58520, 58521, 58522, 58523,
58524, 58525, 58526, 58527, 58528, 58529, 58530, 58531, 58532,
58533, 58534, 58535, 58536, 58537, 58538, 58539, 58540, 58541,
58542, 58543, 58544, 58545, 58546, 58547, 58548, 58549, 58550,
58551, 58552, 58553, 58554, 58555, 58556, 58557, 58558, 58559,
58560, 58561, 58562, 58563, 58564, 58565, 58566, 58567, 58568,
58569, 58570, 58571, 58572, 58573, 58574, 58575, 58576, 58577,
58578, 58579, 58580, 58581, 58582, 58583, 58584, 58585, 58586,
58587, 58588, 58589, 58590, 58591, 58592, 58593, 58594, 58595,
58596, 58597, 58598, 58599, 58600, 58601, 58602, 58603, 58604,
58605, 58606, 58607, 58608, 58609, 58610, 58611, 58612, 58613,
58614, 58615, 58616, 58617, 58618, 58619, 58620, 58621, 58622,
58623, 58624, 58625, 58626, 58627, 58628, 58629, 58630, 58631,
58632, 58633, 58634, 58635, 58636, 58637, 58638, 58639, 58640,
58641, 58642, 58643, 58644, 58645, 58646, 58647, 58648, 58649,
58650, 58651, 58652, 58653, 58654, 58655, 58656, 58657, 58658,
58659, 58660, 58661, 58662, 58663, 58664, 58665, 58666, 58667,
58668, 58669, 58670, 58671, 58672, 58673, 58674, 58675, 58676,
58677, 58678, 58679, 58680, 58681, 58682, 58683, 58684, 58685,
58686, 58687, 58688, 58689, 58690, 58691, 58692, 58693, 58694,
58695, 58696, 58697, 58698, 58699, 58700, 58701, 58702, 58703,
58704, 58705, 58706, 58707, 58708, 58709, 58710, 58711, 58712,
58713, 58714, 58715, 58716, 58717, 58718, 58719, 58720, 58721,
58722, 58723, 58724, 58725, 58726, 58727, 58728, 58729, 58730,
58731, 58732, 58733, 58734, 58735, 58736, 58737, 58738, 58739,
58740, 58741, 58742, 58743, 58744, 58745, 58746, 58747, 58748,
58749, 58750, 58751, 58752, 58753, 58754, 58755, 58756, 58757,
58758, 58759, 58760, 58761, 58762, 58763, 58764, 58765, 58766,
58767, 58768, 58769, 58770, 58771, 58772, 58773, 58774, 58775,
58776, 58777, 58778, 58779, 58780, 58781, 58782, 58783, 58784,
58785, 58786, 58787, 58788, 58789, 58790, 58791, 58792, 58793,
58794, 58795, 58796, 58797, 58798, 58799, 58800, 58801, 58802,
58803, 58804, 58805, 58806, 58807, 58808, 58809, 58810, 58811,
58812, 58813, 58814, 58815, 58816, 58817, 58818, 58819, 58820,
58821, 58822, 58823, 58824, 58825, 58826, 58827, 58828, 58829,
58830, 58831, 58832, 58833, 58834, 58835, 58836, 58837, 58838,
58839, 58840, 58841, 58842, 58843, 58844, 58845, 58846, 58847,
58848, 58849, 58850, 58851, 58852, 58853, 58854, 58855, 58856,
58857, 58858, 58859, 58860, 58861, 58862, 58863, 58864, 58865,
58866, 58867, 58868, 58869, 58870, 58871, 58872, 58873, 58874,
58875, 58876, 58877, 58878, 58879, 58880, 58881, 58882, 58883,
58884, 58885, 58886, 58887, 58888, 58889, 58890, 58891, 58892,
58893, 58894, 58895, 58896, 58897, 58898, 58899, 58900, 58901,
58902, 58903, 58904, 58905, 58906, 58907, 58908, 58909, 58910,
58911, 58912, 58913, 58914, 58915, 58916, 58917, 58918, 58919,
58920, 58921, 58922, 58923, 58924, 58925, 58926, 58927, 58928,
58929, 58930, 58931, 58932, 58933, 58934, 58935, 58936, 58937,
58938, 58939, 58940, 58941, 58942, 58943, 58944, 58945, 58946,
58947, 58948, 58949, 58950, 58951, 58952, 58953, 58954, 58955,
58956, 58957, 58958, 58959, 58960, 58961, 58962, 58963, 58964,
58965, 58966, 58967, 58968, 58969, 58970, 58971, 58972, 58973,
58974, 58975, 58976, 58977, 58978, 58979, 58980, 58981, 58982,
58983, 58984, 58985, 58986, 58987, 58988, 58989, 58990, 58991,
58992, 58993, 58994, 58995, 58996, 58997, 58998, 58999, 59000,
59001, 59002, 59003, 59004, 59005, 59006, 59007, 59008, 59009,
59010, 59011, 59012, 59013, 59014, 59015, 59016, 59017, 59018,
59019, 59020, 59021, 59022, 59023, 59024, 59025, 59026, 59027,
59028, 59029, 59030, 59031, 59032, 59033, 59034, 59035, 59036,
59037, 59038, 59039, 59040, 59041, 59042, 59043, 59044, 59045,
59046, 59047, 59048, 59049, 59050, 59051, 59052, 59053, 59054,
59055, 59056, 59057, 59058, 59059, 59060, 59061, 59062, 59063,
59064, 59065, 59066, 59067, 59068, 59069, 59070, 59071, 59072,
59073, 59074, 59075, 59076, 59077, 59078, 59079, 59080, 59081,
59082, 59083, 59084, 59085, 59086, 59087, 59088, 59089, 59090,
59091, 59092, 59093, 59094, 59095, 59096, 59097, 59098, 59099,
59100, 59101, 59102, 59103, 59104, 59105, 59106, 59107, 59108,
59109, 59110, 59111, 59112, 59113, 59114, 59115, 59116, 59117,
59118, 59119, 59120, 59121, 59122, 59123, 59124, 59125, 59126,
59127, 59128, 59129, 59130, 59131, 59132, 59133, 59134, 59135,
59136, 59137, 59138, 59139, 59140, 59141, 59142, 59143, 59144,
59145, 59146, 59147, 59148, 59149, 59150, 59151, 59152, 59153,
59154, 59155, 59156, 59157, 59158, 59159, 59160, 59161, 59162,
59163, 59164, 59165, 59166, 59167, 59168, 59169, 59170, 59171,
59172, 59173, 59174, 59175, 59176, 59177, 59178, 59179, 59180,
59181, 59182, 59183, 59184, 59185, 59186, 59187, 59188, 59189,
59190, 59191, 59192, 59193, 59194, 59195, 59196, 59197, 59198,
59199, 59200, 59201, 59202, 59203, 59204, 59205, 59206, 59207,
59208, 59209, 59210, 59211, 59212, 59213, 59214, 59215, 59216,
59217, 59218, 59219, 59220, 59221, 59222, 59223, 59224, 59225,
59226, 59227, 59228, 59229, 59230, 59231, 59232, 59233, 59234,
59235, 59236, 59237, 59238, 59239, 59240, 59241, 59242, 59243,
59244, 59245, 59246, 59247, 59248, 59249, 59250, 59251, 59252,
59253, 59254, 59255, 59256, 59257, 59258, 59259, 59260, 59261,
59262, 59263, 59264, 59265, 59266, 59267, 59268, 59269, 59270,
59271, 59272, 59273, 59274, 59275, 59276, 59277, 59278, 59279,
59280, 59281, 59282, 59283, 59284, 59285, 59286, 59287, 59288,
59289, 59290, 59291, 59292, 59293, 59294, 59295, 59296, 59297,
59298, 59299, 59300, 59301, 59302, 59303, 59304, 59305, 59306,
59307, 59308, 59309, 59310, 59311, 59312, 59313, 59314, 59315,
59316, 59317, 59318, 59319, 59320, 59321, 59322, 59323, 59324,
59325, 59326, 59327, 59328, 59329, 59330, 59331, 59332, 59333,
59334, 59335, 59336, 59337, 59338, 59339, 59340, 59341, 59342,
59343, 59344, 59345, 59346, 59347, 59348, 59349, 59350, 59351,
59352, 59353, 59354, 59355, 59356, 59357, 59358, 59359, 59360,
59361, 59362, 59363, 59364, 59365, 59366, 59367, 59368, 59369,
59370, 59371, 59372, 59373, 59374, 59375, 59376, 59377, 59378,
59379, 59380, 59381, 59382, 59383, 59384, 59385, 59386, 59387,
59388, 59389, 59390, 59391, 59392, 59393, 59394, 59395, 59396,
59397, 59398, 59399, 59400, 59401, 59402, 59403, 59404, 59405,
59406, 59407, 59408, 59409, 59410, 59411, 59412, 59413, 59414,
59415, 59416, 59417, 59418, 59419, 59420, 59421, 59422, 59423,
59424, 59425, 59426, 59427, 59428, 59429, 59430, 59431, 59432,
59433, 59434, 59435, 59436, 59437, 59438, 59439, 59440, 59441,
59442, 59443, 59444, 59445, 59446, 59447, 59448, 59449, 59450,
59451, 59452, 59453, 59454, 59455, 59456, 59457, 59458, 59459,
59460, 59461, 59462, 59463, 59464, 59465, 59466, 59467, 59468,
59469, 59470, 59471, 59472, 59473, 59474, 59475, 59476, 59477,
59478, 59479, 59480, 59481, 59482, 59483, 59484, 59485, 59486,
59487, 59488, 59489, 59490, 59491, 59492, 59493, 59494, 59495,
59496, 59497, 59498, 59499, 59500, 59501, 59502, 59503, 59504,
59505, 59506, 59507, 59508, 59509, 59510, 59511, 59512, 59513,
59514, 59515, 59516, 59517, 59518, 59519, 59520, 59521, 59522,
59523, 59524, 59525, 59526, 59527, 59528, 59529, 59530, 59531,
59532, 59533, 59534, 59535, 59536, 59537, 59538, 59539, 59540,
59541, 59542, 59543, 59544, 59545, 59546, 59547, 59548, 59549,
59550, 59551, 59552, 59553, 59554, 59555, 59556, 59557, 59558,
59559, 59560, 59561, 59562, 59563, 59564, 59565, 59566, 59567,
59568, 59569, 59570, 59571, 59572, 59573, 59574, 59575, 59576,
59577, 59578, 59579, 59580, 59581, 59582, 59583, 59584, 59585,
59586, 59587, 59588, 59589, 59590, 59591, 59592, 59593, 59594,
59595, 59596, 59597, 59598, 59599, 59600, 59601, 59602, 59603,
59604, 59605, 59606, 59607, 59608, 59609, 59610, 59611, 59612,
59613, 59614, 59615, 59616, 59617, 59618, 59619, 59620, 59621,
59622, 59623, 59624, 59625, 59626, 59627, 59628, 59629, 59630,
59631, 59632, 59633, 59634, 59635, 59636, 59637, 59638, 59639,
59640, 59641, 59642, 59643, 59644, 59645, 59646, 59647, 59648,
59649, 59650, 59651, 59652, 59653, 59654, 59655, 59656, 59657,
59658, 59659, 59660, 59661, 59662, 59663, 59664, 59665, 59666,
59667, 59668, 59669, 59670, 59671, 59672, 59673, 59674, 59675,
59676, 59677, 59678, 59679, 59680, 59681, 59682, 59683, 59684,
59685, 59686, 59687, 59688, 59689, 59690, 59691, 59692, 59693,
59694, 59695, 59696, 59697, 59698, 59699, 59700, 59701, 59702,
59703, 59704, 59705, 59706, 59707, 59708, 59709, 59710, 59711,
59712, 59713, 59714, 59715, 59716, 59717, 59718, 59719, 59720,
59721, 59722, 59723, 59724, 59725, 59726, 59727, 59728, 59729,
59730, 59731, 59732, 59733, 59734, 59735, 59736, 59737, 59738,
59739, 59740, 59741, 59742, 59743, 59744, 59745, 59746, 59747,
59748, 59749, 59750, 59751, 59752, 59753, 59754, 59755, 59756,
59757, 59758, 59759, 59760, 59761, 59762, 59763, 59764, 59765,
59766, 59767, 59768, 59769, 59770, 59771, 59772, 59773, 59774,
59775, 59776, 59777, 59778, 59779, 59780, 59781, 59782, 59783,
59784, 59785, 59786, 59787, 59788, 59789, 59790, 59791, 59792,
59793, 59794, 59795, 59796, 59797, 59798, 59799, 59800, 59801,
59802, 59803, 59804, 59805, 59806, 59807, 59808, 59809, 59810,
59811, 59812, 59813, 59814, 59815, 59816, 59817, 59818, 59819,
59820, 59821, 59822, 59823, 59824, 59825, 59826, 59827, 59828,
59829, 59830, 59831, 59832, 59833, 59834, 59835, 59836, 59837,
59838, 59839, 59840, 59841, 59842, 59843, 59844, 59845, 59846,
59847, 59848, 59849, 59850, 59851, 59852, 59853, 59854, 59855,
59856, 59857, 59858, 59859, 59860, 59861, 59862, 59863, 59864,
59865, 59866, 59867, 59868, 59869, 59870, 59871, 59872, 59873,
59874, 59875, 59876, 59877, 59878, 59879, 59880, 59881, 59882,
59883, 59884, 59885, 59886, 59887, 59888, 59889, 59890, 59891,
59892, 59893, 59894, 59895, 59896, 59897, 59898, 59899, 59900,
59901, 59902, 59903, 59904, 59905, 59906, 59907, 59908, 59909,
59910, 59911, 59912, 59913, 59914, 59915, 59916, 59917, 59918,
59919, 59920, 59921, 59922, 59923, 59924, 59925, 59926, 59927,
59928, 59929, 59930, 59931, 59932, 59933, 59934, 59935, 59936,
59937, 59938, 59939, 59940, 59941, 59942, 59943, 59944, 59945,
59946, 59947, 59948, 59949, 59950, 59951, 59952, 59953, 59954,
59955, 59956, 59957, 59958, 59959, 59960, 59961, 59962, 59963,
59964, 59965, 59966, 59967, 59968, 59969, 59970, 59971, 59972,
59973, 59974, 59975, 59976, 59977, 59978, 59979, 59980, 59981,
59982, 59983, 59984, 59985, 59986, 59987, 59988, 59989, 59990,
59991, 59992, 59993, 59994, 59995, 59996, 59997, 59998, 59999,
60000, 60001, 60002, 60003, 60004, 60005, 60006, 60007, 60008,
60009, 60010, 60011, 60012, 60013, 60014, 60015, 60016, 60017,
60018, 60019, 60020, 60021, 60022, 60023, 60024, 60025, 60026,
60027, 60028, 60029, 60030, 60031, 60032, 60033, 60034, 60035,
60036, 60037, 60038, 60039, 60040, 60041, 60042, 60043, 60044,
60045, 60046, 60047, 60048, 60049, 60050, 60051, 60052, 60053,
60054, 60055, 60056, 60057, 60058, 60059, 60060, 60061, 60062,
60063, 60064, 60065, 60066, 60067, 60068, 60069, 60070, 60071,
60072, 60073, 60074, 60075, 60076, 60077, 60078, 60079, 60080,
60081, 60082, 60083, 60084, 60085, 60086, 60087, 60088, 60089,
60090, 60091, 60092, 60093, 60094, 60095, 60096, 60097, 60098,
60099, 60100, 60101, 60102, 60103, 60104, 60105, 60106, 60107,
60108, 60109, 60110, 60111, 60112, 60113, 60114, 60115, 60116,
60117, 60118, 60119, 60120, 60121, 60122, 60123, 60124, 60125,
60126, 60127, 60128, 60129, 60130, 60131, 60132, 60133, 60134,
60135, 60136, 60137, 60138, 60139, 60140, 60141, 60142, 60143,
60144, 60145, 60146, 60147, 60148, 60149, 60150, 60151, 60152,
60153, 60154, 60155, 60156, 60157, 60158, 60159, 60160, 60161,
60162, 60163, 60164, 60165, 60166, 60167, 60168, 60169, 60170,
60171, 60172, 60173, 60174, 60175, 60176, 60177, 60178, 60179,
60180, 60181, 60182, 60183, 60184, 60185, 60186, 60187, 60188,
60189, 60190, 60191, 60192, 60193, 60194, 60195, 60196, 60197,
60198, 60199, 60200, 60201, 60202, 60203, 60204, 60205, 60206,
60207, 60208, 60209, 60210, 60211, 60212, 60213, 60214, 60215,
60216, 60217, 60218, 60219, 60220, 60221, 60222, 60223, 60224,
60225, 60226, 60227, 60228, 60229, 60230, 60231, 60232, 60233,
60234, 60235, 60236, 60237, 60238, 60239, 60240, 60241, 60242,
60243, 60244, 60245, 60246, 60247, 60248, 60249, 60250, 60251,
60252, 60253, 60254, 60255, 60256, 60257, 60258, 60259, 60260,
60261, 60262, 60263, 60264, 60265, 60266, 60267, 60268, 60269,
60270, 60271, 60272, 60273, 60274, 60275, 60276, 60277, 60278,
60279, 60280, 60281, 60282, 60283, 60284, 60285, 60286, 60287,
60288, 60289, 60290, 60291, 60292, 60293, 60294, 60295, 60296,
60297, 60298, 60299, 60300, 60301, 60302, 60303, 60304, 60305,
60306, 60307, 60308, 60309, 60310, 60311, 60312, 60313, 60314,
60315, 60316, 60317, 60318, 60319, 60320, 60321, 60322, 60323,
60324, 60325, 60326, 60327, 60328, 60329, 60330, 60331, 60332,
60333, 60334, 60335, 60336, 60337, 60338, 60339, 60340, 60341,
60342, 60343, 60344, 60345, 60346, 60347, 60348, 60349, 60350,
60351, 60352, 60353, 60354, 60355, 60356, 60357, 60358, 60359,
60360, 60361, 60362, 60363, 60364, 60365, 60366, 60367, 60368,
60369, 60370, 60371, 60372, 60373, 60374, 60375, 60376, 60377,
60378, 60379, 60380, 60381, 60382, 60383, 60384, 60385, 60386,
60387, 60388, 60389, 60390, 60391, 60392, 60393, 60394, 60395,
60396, 60397, 60398, 60399, 60400, 60401, 60402, 60403, 60404,
60405, 60406, 60407, 60408, 60409, 60410, 60411, 60412, 60413,
60414, 60415, 60416, 60417, 60418, 60419, 60420, 60421, 60422,
60423, 60424, 60425, 60426, 60427, 60428, 60429, 60430, 60431,
60432, 60433, 60434, 60435, 60436, 60437, 60438, 60439, 60440,
60441, 60442, 60443, 60444, 60445, 60446, 60447, 60448, 60449,
60450, 60451, 60452, 60453, 60454, 60455, 60456, 60457, 60458,
60459, 60460, 60461, 60462, 60463, 60464, 60465, 60466, 60467,
60468, 60469, 60470, 60471, 60472, 60473, 60474, 60475, 60476,
60477, 60478, 60479, 60480, 60481, 60482, 60483, 60484, 60485,
60486, 60487, 60488, 60489, 60490, 60491, 60492, 60493, 60494,
60495, 60496, 60497, 60498, 60499, 60500, 60501, 60502, 60503,
60504, 60505, 60506, 60507, 60508, 60509, 60510, 60511, 60512,
60513, 60514, 60515, 60516, 60517, 60518, 60519, 60520, 60521,
60522, 60523, 60524, 60525, 60526, 60527, 60528, 60529, 60530,
60531, 60532, 60533, 60534, 60535, 60536, 60537, 60538, 60539,
60540, 60541, 60542, 60543, 60544, 60545, 60546, 60547, 60548,
60549, 60550, 60551, 60552, 60553, 60554, 60555, 60556, 60557,
60558, 60559, 60560, 60561, 60562, 60563, 60564, 60565, 60566,
60567, 60568, 60569, 60570, 60571, 60572, 60573, 60574, 60575,
60576, 60577, 60578, 60579, 60580, 60581, 60582, 60583, 60584,
60585, 60586, 60587, 60588, 60589, 60590, 60591, 60592, 60593,
60594, 60595, 60596, 60597, 60598, 60599, 60600, 60601, 60602,
60603, 60604, 60605, 60606, 60607, 60608, 60609, 60610, 60611,
60612, 60613, 60614, 60615, 60616, 60617, 60618, 60619, 60620,
60621, 60622, 60623, 60624, 60625, 60626, 60627, 60628, 60629,
60630, 60631, 60632, 60633, 60634, 60635, 60636, 60637,
60638, 60639, 60640, 60641, 60642, 60643, 60644, 60645, 60646,
60647, 60648, 60649, 60650, 60651, 60652, 60653, 60654, 60655,
60656, 60657, 60658, 60659, 60660, 60661, 60662, 60663, 60664,
60665, 60666, 60667, 60668, 60669, 60670, 60671, 60672, 60673,
60674, 60675, 60676, 60677, 60678, 60679, 60680, 60681, 60682,
60683, 60684, 60685, 60686, 60687, 60688, 60689, 60690, 60691,
60692, 60693, 60694, 60695, 60696, 60697, 60698, 60699, 60700,
60701, 60702, 60703, 60704, 60705, 60706, 60707, 60708, 60709,
60710, 60711, 60712, 60713, 60714, 60715, 60716, 60717, 60718,
60719, 60720, 60721, 60722, 60723, 60724, 60725, 60726, 60727,
60728, 60729, 60730, 60731, 60732, 60733, 60734, 60735, 60736,
60737, 60738, 60739, 60740, 60741, 60742, 60743, 60744, 60745,
60746, 60747, 60748, 60749, 60750, 60751, 60752, 60753, 60754,
60755, 60756, 60757, 60758, 60759, 60760, 60761, 60762, 60763,
60764, 60765, 60766, 60767, 60768, 60769, 60770, 60771, 60772,
60773, 60774, 60775, 60776, 60777, 60778, 60779, 60780, 60781,
60782, 60783, 60784, 60785, 60786, 60787, 60788, 60789, 60790,
60791, 60792, 60793, 60794, 60795, 60796, 60797, 60798, 60799,
60800, 60801, 60802, 60803, 60804, 60805, 60806, 60807, 60808,
60809, 60810, 60811, 60812, 60813, 60814, 60815, 60816, 60817,
60818, 60819, 60820, 60821, 60822, 60823, 60824, 60825, 60826,
60827, 60828, 60829, 60830, 60831, 60832, 60833, 60834, 60835,
60836, 60837, 60838, 60839, 60840, 60841, 60842, 60843, 60844,
60845, 60846, 60847, 60848, 60849, 60850, 60851, 60852, 60853,
60854, 60855, 60856, 60857, 60858, 60859, 60860, 60861, 60862,
60863, 60864, 60865, 60866, 60867, 60868, 60869, 60870, 60871,
60872, 60873, 60874, 60875, 60876, 60877, 60878, 60879, 60880,
60881, 60882, 60883, 60884, 60885, 60886, 60887, 60888, 60889,
60890, 60891, 60892, 60893, 60894, 60895, 60896, 60897, 60898,
60899, 60900, 60901, 60902, 60903, 60904, 60905, 60906, 60907,
60908, 60909, 60910, 60911, 60912, 60913, 60914, 60915, 60916,
60917, 60918, 60919, 60920, 60921, 60922, 60923, 60924, 60925,
60926, 60927, 60928, 60929, 60930, 60931, 60932, 60933, 60934,
60935, 60936, 60937, 60938, 60939, 60940, 60941, 60942, 60943,
60944, 60945, 60946, 60947, 60948, 60949, 60950, 60951, 60952,
60953, 60954, 60955, 60956, 60957, 60958, 60959, 60960, 60961,
60962, 60963, 60964, 60965, 60966, 60967, 60968, 60969, 60970,
60971, 60972, 60973, 60974, 60975, 60976, 60977, 60978, 60979,
60980, 60981, 60982, 60983, 60984, 60985, 60986, 60987, 60988,
60989, 60990, 60991, 60992, 60993, 60994, 60995, 60996, 60997,
60998, 60999, 61000, 61001, 61002, 61003, 61004, 61005, 61006,
61007, 61008, 61009, 61010, 61011, 61012, 61013, 61014, 61015,
61016, 61017, 61018, 61019, 61020, 61021, 61022, 61023, 61024,
61025, 61026, 61027, 61028, 61029, 61030, 61031, 61032, 61033,
61034, 61035, 61036, 61037, 61038, 61039, 61040, 61041, 61042,
61043, 61044, 61045, 61046, 61047, 61048, 61049, 61050, 61051,
61052, 61053, 61054, 61055, 61056, 61057, 61058, 61059, 61060,
61061, 61062, 61063, 61064, 61065, 61066, 61067, 61068, 61069,
61070, 61071, 61072, 61073, 61074, 61075, 61076, 61077, 61078,
61079, 61080, 61081, 61082, 61083, 61084, 61085, 61086, 61087,
61088, 61089, 61090, 61091, 61092, 61093, 61094, 61095, 61096,
61097, 61098, 61099, 61100, 61101, 61102, 61103, 61104, 61105,
61106, 61107, 61108, 61109, 61110, 61111, 61112, 61113, 61114,
61115, 61116, 61117, 61118, 61119, 61120, 61121, 61122, 61123,
61124, 61125, 61126, 61127, 61128, 61129, 61130, 61131, 61132,
61133, 61134, 61135, 61136, 61137, 61138, 61139, 61140, 61141,
61142, 61143, 61144, 61145, 61146, 61147, 61148, 61149, 61150,
61151, 61152, 61153, 61154, 61155, 61156, 61157, 61158, 61159,
61160, 61161, 61162, 61163, 61164, 61165, 61166, 61167, 61168,
61169, 61170, 61171, 61172, 61173, 61174, 61175, 61176, 61177,
61178, 61179, 61180, 61181, 61182, 61183, 61184, 61185, 61186,
61187, 61188, 61189, 61190, 61191, 61192, 61193, 61194, 61195,
61196, 61197, 61198, 61199, 61200, 61201, 61202, 61203, 61204,
61205, 61206, 61207, 61208, 61209, 61210, 61211, 61212, 61213,
61214, 61215, 61216, 61217, 61218, 61219, 61220, 61221, 61222,
61223, 61224, 61225, 61226, 61227, 61228, 61229, 61230, 61231,
61232, 61233, 61234, 61235, 61236, 61237, 61238, 61239, 61240,
61241, 61242, 61243, 61244, 61245, 61246, 61247, 61248, 61249,
61250, 61251, 61252, 61253, 61254, 61255, 61256, 61257, 61258,
61259, 61260, 61261, 61262, 61263, 61264, 61265, 61266, 61267,
61268, 61269, 61270, 61271, 61272, 61273, 61274, 61275, 61276,
61277, 61278, 61279, 61280, 61281, 61282, 61283, 61284, 61285,
61286, 61287, 61288, 61289, 61290, 61291, 61292, 61293, 61294,
61295, 61296, 61297, 61298, 61299, 61300, 61301, 61302, 61303,
61304, 61305, 61306, 61307, 61308, 61309, 61310, 61311, 61312,
61313, 61314, 61315, 61316, 61317, 61318, 61319, 61320, 61321,
61322, 61323, 61324, 61325, 61326, 61327, 61328, 61329, 61330,
61331, 61332, 61333, 61334, 61335, 61336, 61337, 61338, 61339,
61340, 61341, 61342, 61343, 61344, 61345, 61346, 61347, 61348,
61349, 61350, 61351, 61352, 61353, 61354, 61355, 61356, 61357,
61358, 61359, 61360, 61361, 61362, 61363, 61364, 61365, 61366,
61367, 61368, 61369, 61370, 61371, 61372, 61373, 61374, 61375,
61376, 61377, 61378, 61379, 61380, 61381, 61382, 61383, 61384,
61385, 61386, 61387, 61388, 61389, 61390, 61391, 61392, 61393,
61394, 61395, 61396, 61397, 61398, 61399, 61400, 61401, 61402,
61403, 61404, 61405, 61406, 61407, 61408, 61409, 61410, 61411,
61412, 61413, 61414, 61415, 61416, 61417, 61418, 61419, 61420,
61421, 61422, 61423, 61424, 61425, 61426, 61427, 61428, 61429,
61430, 61431, 61432, 61433, 61434, 61435, 61436, 61437, 61438,
61439, 61440, 61441, 61442, 61443, 61444, 61445, 61446, 61447,
61448, 61449, 61450, 61451, 61452, 61453, 61454, 61455, 61456,
61457, 61458, 61459, 61460, 61461, 61462, 61463, 61464, 61465,
61466, 61467, 61468, 61469, 61470, 61471, 61472, 61473, 61474,
61475, 61476, 61477, 61478, 61479, 61480, 61481, 61482, 61483,
61484, 61485, 61486, 61487, 61488, 61489, 61490, 61491, 61492,
61493, 61494, 61495, 61496, 61497, 61498, 61499, 61500, 61501,
61502, 61503, 61504, 61505, 61506, 61507, 61508, 61509, 61510,
61511, 61512, 61513, 61514, 61515, 61516, 61517, 61518, 61519,
61520, 61521, 61522, 61523, 61524, 61525, 61526, 61527, 61528,
61529, 61530, 61531, 61532, 61533, 61534, 61535, 61536, 61537,
61538, 61539, 61540, 61541, 61542, 61543, 61544, 61545, 61546,
61547, 61548, 61549, 61550, 61551, 61552, 61553, 61554, 61555,
61556, 61557, 61558, 61559, 61560, 61561, 61562, 61563, 61564,
61565, 61566, 61567, 61568, 61569, 61570, 61571, 61572, 61573,
61574, 61575, 61576, 61577, 61578, 61579, 61580, 61581, 61582,
61583, 61584, 61585, 61586, 61587, 61588, 61589, 61590, 61591,
61592, 61593, 61594, 61595, 61596, 61597, 61598, 61599, 61600,
61601, 61602, 61603, 61604, 61605, 61606, 61607, 61608, 61609,
61610, 61611, 61612, 61613, 61614, 61615, 61616, 61617, 61618,
61619, 61620, 61621, 61622, 61623, 61624, 61625, 61626, 61627,
61628, 61629, 61630, 61631, 61632, 61633, 61634, 61635, 61636,
61637, 61638, 61639, 61640, 61641, 61642, 61643, 61644, 61645,
61646, 61647, 61648, 61649, 61650, 61651, 61652, 61653, 61654,
61655, 61656, 61657, 61658, 61659, 61660, 61661, 61662, 61663,
61664, 61665, 61666, 61667, 61668, 61669, 61670, 61671, 61672,
61673, 61674, 61675, 61676, 61677, 61678, 61679, 61680, 61681,
61682, 61683, 61684, 61685, 61686, 61687, 61688, 61689, 61690,
61691, 61692, 61693, 61694, 61695, 61696, 61697, 61698, 61699,
61700, 61701, 61702, 61703, 61704, 61705, 61706, 61707, 61708,
61709, 61710, 61711, 61712, 61713, 61714, 61715, 61716, 61717,
61718, 61719, 61720, 61721, 61722, 61723, 61724, 61725, 61726,
61727, 61728, 61729, 61730, 61731, 61732, 61733, 61734, 61735,
61736, 61737, 61738, 61739, 61740, 61741, 61742, 61743, 61744,
61745, 61746, 61747, 61748, 61749, 61750, 61751, 61752, 61753,
61754, 61755, 61756, 61757, 61758, 61759, 61760, 61761, 61762,
61763, 61764, 61765, 61766, 61767, 61768, 61769, 61770, 61771,
61772, 61773, 61774, 61775, 61776, 61777, 61778, 61779, 61780,
61781, 61782, 61783, 61784, 61785, 61786, 61787, 61788, 61789,
61790, 61791, 61792, 61793, 61794, 61795, 61796, 61797, 61798,
61799, 61800, 61801, 61802, 61803, 61804, 61805, 61806, 61807,
61808, 61809, 61810, 61811, 61812, 61813, 61814, 61815, 61816,
61817, 61818, 61819, 61820, 61821, 61822, 61823, 61824, 61825,
61826, 61827, 61828, 61829, 61830, 61831, 61832, 61833, 61834,
61835, 61836, 61837, 61838, 61839, 61840, 61841, 61842, 61843,
61844, 61845, 61846, 61847, 61848, 61849, 61850, 61851, 61852,
61853, 61854, 61855, 61856, 61857, 61858, 61859, 61860, 61861,
61862, 61863, 61864, 61865, 61866, 61867, 61868, 61869, 61870,
61871, 61872, 61873, 61874, 61875, 61876, 61877, 61878, 61879,
61880, 61881, 61882, 61883, 61884, 61885, 61886, 61887, 61888,
61889, 61890, 61891, 61892, 61893, 61894, 61895, 61896, 61897,
61898, 61899, 61900, 61901, 61902, 61903, 61904, 61905, 61906,
61907, 61908, 61909, 61910, 61911, 61912, 61913, 61914, 61915,
61916, 61917, 61918, 61919, 61920, 61921, 61922, 61923, 61924,
61925, 61926, 61927, 61928, 61929, 61930, 61931, 61932, 61933,
61934, 61935, 61936, 61937, 61938, 61939, 61940, 61941, 61942,
61943, 61944, 61945, 61946, 61947, 61948, 61949, 61950, 61951,
61952, 61953, 61954, 61955, 61956, 61957, 61958, 61959, 61960,
61961, 61962, 61963, 61964, 61965, 61966, 61967, 61968, 61969,
61970, 61971, 61972, 61973, 61974, 61975, 61976, 61977, 61978,
61979, 61980, 61981, 61982, 61983, 61984, 61985, 61986, 61987,
61988, 61989, 61990, 61991, 61992, 61993, 61994, 61995, 61996,
61997, 61998, 61999, 62000, 62001, 62002, 62003, 62004, 62005,
62006, 62007, 62008, 62009, 62010, 62011, 62012, 62013, 62014,
62015, 62016, 62017, 62018, 62019, 62020, 62021, 62022, 62023,
62024, 62025, 62026, 62027, 62028, 62029, 62030, 62031, 62032,
62033, 62034, 62035, 62036, 62037, 62038, 62039, 62040, 62041,
62042, 62043, 62044, 62045, 62046, 62047, 62048, 62049, 62050,
62051, 62052, 62053, 62054, 62055, 62056, 62057, 62058, 62059,
62060, 62061, 62062, 62063, 62064, 62065, 62066, 62067, 62068,
62069, 62070, 62071, 62072, 62073, 62074, 62075, 62076, 62077,
62078, 62079, 62080, 62081, 62082, 62083, 62084, 62085, 62086,
62087, 62088, 62089, 62090, 62091, 62092, 62093, 62094, 62095,
62096, 62097, 62098, 62099, 62100, 62101, 62102, 62103, 62104,
62105, 62106, 62107, 62108, 62109, 62110, 62111, 62112, 62113,
62114, 62115, 62116, 62117, 62118, 62119, 62120, 62121, 62122,
62123, 62124, 62125, 62126, 62127, 62128, 62129, 62130, 62131,
62132, 62133, 62134, 62135, 62136, 62137, 62138, 62139, 62140,
62141, 62142, 62143, 62144, 62145, 62146, 62147, 62148, 62149,
62150, 62151, 62152, 62153, 62154, 62155, 62156, 62157, 62158,
62159, 62160, 62161, 62162, 62163, 62164, 62165, 62166, 62167,
62168, 62169, 62170, 62171, 62172, 62173, 62174, 62175, 62176,
62177, 62178, 62179, 62180, 62181, 62182, 62183, 62184, 62185,
62186, 62187, 62188, 62189, 62190, 62191, 62192, 62193, 62194,
62195, 62196, 62197, 62198, 62199, 62200, 62201, 62202, 62203,
62204, 62205, 62206, 62207, 62208, 62209, 62210, 62211, 62212,
62213, 62214, 62215, 62216, 62217, 62218, 62219, 62220, 62221,
62222, 62223, 62224, 62225, 62226, 62227, 62228, 62229, 62230,
62231, 62232, 62233, 62234, 62235, 62236, 62237, 62238, 62239,
62240, 62241, 62242, 62243, 62244, 62245, 62246, 62247, 62248,
62249, 62250, 62251, 62252, 62253, 62254, 62255, 62256, 62257,
62258, 62259, 62260, 62261, 62262, 62263, 62264, 62265, 62266,
62267, 62268, 62269, 62270, 62271, 62272, 62273, 62274, 62275,
62276, 62277, 62278, 62279, 62280, 62281, 62282, 62283, 62284,
62285, 62286, 62287, 62288, 62289, 62290, 62291, 62292, 62293,
62294, 62295, 62296, 62297, 62298, 62299, 62300, 62301, 62302,
62303, 62304, 62305, 62306, 62307, 62308, 62309, 62310, 62311,
62312, 62313, 62314, 62315, 62316, 62317, 62318, 62319, 62320,
62321, 62322, 62323, 62324, 62325, 62326, 62327, 62328, 62329,
62330, 62331, 62332, 62333, 62334, 62335, 62336, 62337, 62338,
62339, 62340, 62341, 62342, 62343, 62344, 62345, 62346, 62347,
62348, 62349, 62350, 62351, 62352, 62353, 62354, 62355, 62356,
62357, 62358, 62359, 62360, 62361, 62362, 62363, 62364, 62365,
62366, 62367, 62368, 62369, 62370, 62371, 62372, 62373, 62374,
62375, 62376, 62377, 62378, 62379, 62380, 62381, 62382, 62383,
62384, 62385, 62386, 62387, 62388, 62389, 62390, 62391, 62392,
62393, 62394, 62395, 62396, 62397, 62398, 62399, 62400, 62401,
62402, 62403, 62404, 62405, 62406, 62407, 62408, 62409, 62410,
62411, 62412, 62413, 62414, 62415, 62416, 62417, 62418, 62419,
62420, 62421, 62422, 62423, 62424, 62425, 62426, 62427, 62428,
62429, 62430, 62431, 62432, 62433, 62434, 62435, 62436, 62437,
62438, 62439, 62440, 62441, 62442, 62443, 62444, 62445, 62446,
62447, 62448, 62449, 62450, 62451, 62452, 62453, 62454, 62455,
62456, 62457, 62458, 62459, 62460, 62461, 62462, 62463, 62464,
62465, 62466, 62467, 62468, 62469, 62470, 62471, 62472, 62473,
62474, 62475, 62476, 62477, 62478, 62479, 62480, 62481, 62482,
62483, 62484, 62485, 62486, 62487, 62488, 62489, 62490, 62491,
62492, 62493, 62494, 62495, 62496, 62497, 62498, 62499, 62500,
62501, 62502, 62503, 62504, 62505, 62506, 62507, 62508, 62509,
62510, 62511, 62512, 62513, 62514, 62515, 62516, 62517, 62518,
62519, 62520, 62521, 62522, 62523, 62524, 62525, 62526, 62527,
62528, 62529, 62530, 62531, 62532, 62533, 62534, 62535, 62536,
62537, 62538, 62539, 62540, 62541, 62542, 62543, 62544, 62545,
62546, 62547, 62548, 62549, 62550, 62551, 62552, 62553, 62554,
62555, 62556, 62557, 62558, 62559, 62560, 62561, 62562, 62563,
62564, 62565, 62566, 62567, 62568, 62569, 62570, 62571, 62572,
62573, 62574, 62575, 62576, 62577, 62578, 62579, 62580, 62581,
62582, 62583, 62584, 62585, 62586, 62587, 62588, 62589, 62590,
62591, 62592, 62593, 62594, 62595, 62596, 62597, 62598, 62599,
62600, 62601, 62602, 62603, 62604, 62605, 62606, 62607, 62608,
62609, 62610, 62611, 62612, 62613, 62614, 62615, 62616, 62617,
62618, 62619, 62620, 62621, 62622, 62623, 62624, 62625, 62626,
62627, 62628, 62629, 62630, 62631, 62632, 62633, 62634, 62635,
62636, 62637, 62638, 62639, 62640, 62641, 62642, 62643, 62644,
62645, 62646, 62647, 62648, 62649, 62650, 62651, 62652, 62653,
62654, 62655, 62656, 62657, 62658, 62659, 62660, 62661, 62662,
62663, 62664, 62665, 62666, 62667, 62668, 62669, 62670, 62671,
62672, 62673, 62674, 62675, 62676, 62677, 62678, 62679, 62680,
62681, 62682, 62683, 62684, 62685, 62686, 62687, 62688, 62689,
62690, 62691, 62692, 62693, 62694, 62695, 62696, 62697, 62698,
62699, 62700, 62701, 62702, 62703, 62704, 62705, 62706, 62707,
62708, 62709, 62710, 62711, 62712, 62713, 62714, 62715, 62716,
62717, 62718, 62719, 62720, 62721, 62722, 62723, 62724, 62725,
62726, 62727, 62728, 62729, 62730, 62731, 62732, 62733, 62734,
62735, 62736, 62737, 62738, 62739, 62740, 62741, 62742, 62743,
62744, 62745, 62746, 62747, 62748, 62749, 62750, 62751, 62752,
62753, 62754, 62755, 62756, 62757, 62758, 62759, 62760, 62761,
62762, 62763, 62764, 62765, 62766, 62767, 62768, 62769, 62770,
62771, 62772, 62773, 62774, 62775, 62776, 62777, 62778, 62779,
62780, 62781, 62782, 62783, 62784, 62785, 62786, 62787, 62788,
62789, 62790, 62791, 62792, 62793, 62794, 62795, 62796, 62797,
62798, 62799, 62800, 62801, 62802, 62803, 62804, 62805, 62806,
62807, 62808, 62809, 62810, 62811, 62812, 62813, 62814, 62815,
62816, 62817, 62818, 62819, 62820, 62821, 62822, 62823, 62824,
62825, 62826, 62827, 62828, 62829, 62830, 62831, 62832, 62833,
62834, 62835, 62836, 62837, 62838, 62839, 62840, 62841, 62842,
62843, 62844, 62845, 62846, 62847, 62848, 62849, 62850, 62851,
62852, 62853, 62854, 62855, 62856, 62857, 62858, 62859, 62860,
62861, 62862, 62863, 62864, 62865, 62866, 62867, 62868, 62869,
62870, 62871, 62872, 62873, 62874, 62875, 62876, 62877, 62878,
62879, 62880, 62881, 62882, 62883, 62884, 62885, 62886, 62887,
62888, 62889, 62890, 62891, 62892, 62893, 62894, 62895, 62896,
62897, 62898, 62899, 62900, 62901, 62902, 62903, 62904, 62905,
62906, 62907, 62908, 62909, 62910, 62911, 62912, 62913, 62914,
62915, 62916, 62917, 62918, 62919, 62920, 62921, 62922, 62923,
62924, 62925, 62926, 62927, 62928, 62929, 62930, 62931, 62932,
62933, 62934, 62935, 62936, 62937, 62938, 62939, 62940, 62941,
62942, 62943, 62944, 62945, 62946, 62947, 62948, 62949, 62950,
62951, 62952, 62953, 62954, 62955, 62956, 62957, 62958, 62959,
62960, 62961, 62962, 62963, 62964, 62965, 62966, 62967, 62968,
62969, 62970, 62971, 62972, 62973, 62974, 62975, 62976, 62977,
62978, 62979, 62980, 62981, 62982, 62983, 62984, 62985, 62986,
62987, 62988, 62989, 62990, 62991, 62992, 62993, 62994, 62995,
62996, 62997, 62998, 62999, 63000, 63001, 63002, 63003, 63004,
63005, 63006, 63007, 63008, 63009, 63010, 63011, 63012, 63013,
63014, 63015, 63016, 63017, 63018, 63019, 63020, 63021, 63022,
63023, 63024, 63025, 63026, 63027, 63028, 63029, 63030, 63031,
63032, 63033, 63034, 63035, 63036, 63037, 63038, 63039, 63040,
63041, 63042, 63043, 63044, 63045, 63046, 63047, 63048, 63049,
63050, 63051, 63052, 63053, 63054, 63055, 63056, 63057, 63058,
63059, 63060, 63061, 63062, 63063, 63064, 63065, 63066, 63067,
63068, 63069, 63070, 63071, 63072, 63073, 63074, 63075, 63076,
63077, 63078, 63079, 63080, 63081, 63082, 63083, 63084, 63085,
63086, 63087, 63088, 63089, 63090, 63091, 63092, 63093, 63094,
63095, 63096, 63097, 63098, 63099, 63100, 63101, 63102, 63103,
63104, 63105, 63106, 63107, 63108, 63109, 63110, 63111, 63112,
63113, 63114, 63115, 63116, 63117, 63118, 63119, 63120, 63121,
63122, 63123, 63124, 63125, 63126, 63127, 63128, 63129, 63130,
63131, 63132, 63133, 63134, 63135, 63136, 63137, 63138, 63139,
63140, 63141, 63142, 63143, 63144, 63145, 63146, 63147,
63148, 63149, 63150, 63151, 63152, 63153, 63154, 63155, 63156,
63157, 63158, 63159, 63160, 63161, 63162, 63163, 63164, 63165,
63166, 63167, 63168, 63169, 63170, 63171, 63172, 63173, 63174,
63175, 63176, 63177, 63178, 63179, 63180, 63181, 63182, 63183,
63184, 63185, 63186, 63187, 63188, 63189, 63190, 63191, 63192,
63193, 63194, 63195, 63196, 63197, 63198, 63199, 63200, 63201,
63202, 63203, 63204, 63205, 63206, 63207, 63208, 63209, 63210,
63211, 63212, 63213, 63214, 63215, 63216, 63217, 63218, 63219,
63220, 63221, 63222, 63223, 63224, 63225, 63226, 63227, 63228,
63229, 63230, 63231, 63232, 63233, 63234, 63235, 63236, 63237,
63238, 63239, 63240, 63241, 63242, 63243, 63244, 63245, 63246,
63247, 63248, 63249, 63250, 63251, 63252, 63253, 63254, 63255,
63256, 63257, 63258, 63259, 63260, 63261, 63262, 63263, 63264,
63265, 63266, 63267, 63268, 63269, 63270, 63271, 63272, 63273,
63274, 63275, 63276, 63277, 63278, 63279, 63280, 63281, 63282,
63283, 63284, 63285, 63286, 63287, 63288, 63289, 63290, 63291,
63292, 63293, 63294, 63295, 63296, 63297, 63298, 63299, 63300,
63301, 63302, 63303, 63304, 63305, 63306, 63307, 63308, 63309,
63310, 63311, 63312, 63313, 63314, 63315, 63316, 63317, 63318,
63319, 63320, 63321, 63322, 63323, 63324, 63325, 63326, 63327,
63328, 63329, 63330, 63331, 63332, 63333, 63334, 63335, 63336,
63337, 63338, 63339, 63340, 63341, 63342, 63343, 63344, 63345,
63346, 63347, 63348, 63349, 63350, 63351, 63352, 63353, 63354,
63355, 63356, 63357, 63358, 63359, 63360, 63361, 63362, 63363,
63364, 63365, 63366, 63367, 63368, 63369, 63370, 63371, 63372,
63373, 63374, 63375, 63376, 63377, 63378, 63379, 63380, 63381,
63382, 63383, 63384, 63385, 63386, 63387, 63388, 63389, 63390,
63391, 63392, 63393, 63394, 63395, 63396, 63397, 63398, 63399,
63400, 63401, 63402, 63403, 63404, 63405, 63406, 63407, 63408,
63409, 63410, 63411, 63412, 63413, 63414, 63415, 63416, 63417,
63418, 63419, 63420, 63421, 63422, 63423, 63424, 63425, 63426,
63427, 63428, 63429, 63430, 63431, 63432, 63433, 63434, 63435,
63436, 63437, 63438, 63439, 63440, 63441, 63442, 63443, 63444,
63445, 63446, 63447, 63448, 63449, 63450, 63451, 63452, 63453,
63454, 63455, 63456, 63457, 63458, 63459, 63460, 63461, 63462,
63463, 63464, 63465, 63466, 63467, 63468, 63469, 63470, 63471,
63472, 63473, 63474, 63475, 63476, 63477, 63478, 63479, 63480,
63481, 63482, 63483, 63484, 63485, 63486, 63487, 63488, 63489,
63490, 63491, 63492, 63493, 63494, 63495, 63496, 63497, 63498,
63499, 63500, 63501, 63502, 63503, 63504, 63505, 63506, 63507,
63508, 63509, 63510, 63511, 63512, 63513, 63514, 63515, 63516,
63517, 63518, 63519, 63520, 63521, 63522, 63523, 63524, 63525,
63526, 63527, 63528, 63529, 63530, 63531, 63532, 63533, 63534,
63535, 63536, 63537, 63538, 63539, 63540, 63541, 63542, 63543,
63544, 63545, 63546, 63547, 63548, 63549, 63550, 63551, 63552,
63553, 63554, 63555, 63556, 63557, 63558, 63559, 63560, 63561,
63562, 63563, 63564, 63565, 63566, 63567, 63568, 63569, 63570,
63571, 63572, 63573, 63574, 63575, 63576, 63577, 63578, 63579,
63580, 63581, 63582, 63583, 63584, 63585, 63586, 63587, 63588,
63589, 63590, 63591, 63592, 63593, 63594, 63595, 63596, 63597,
63598, 63599, 63600, 63601, 63602, 63603, 63604, 63605, 63606,
63607, 63608, 63609, 63610, 63611, 63612, 63613, 63614, 63615,
63616, 63617, 63618, 63619, 63620, 63621, 63622, 63623, 63624,
63625, 63626, 63627, 63628, 63629, 63630, 63631, 63632, 63633,
63634, 63635, 63636, 63637, 63638, 63639, 63640, 63641, 63642,
63643, 63644, 63645, 63646, 63647, 63648, 63649, 63650, 63651,
63652, 63653, 63654, 63655, 63656, 63657, 63658, 63659, 63660,
63661, 63662, 63663, 63664, 63665, 63666, 63667, 63668, 63669,
63670, 63671, 63672, 63673, 63674, 63675, 63676, 63677, 63678,
63679, 63680, 63681, 63682, 63683, 63684, 63685, 63686, 63687,
63688, 63689, 63690, 63691, 63692, 63693, 63694, 63695, 63696,
63697, 63698, 63699, 63700, 63701, 63702, 63703, 63704, 63705,
63706, 63707, 63708, 63709, 63710, 63711, 63712, 63713, 63714,
63715, 63716, 63717, 63718, 63719, 63720, 63721, 63722, 63723,
63724, 63725, 63726, 63727, 63728, 63729, 63730, 63731, 63732,
63733, 63734, 63735, 63736, 63737, 63738, 63739, 63740, 63741,
63742, 63743, 63744, 63745, 63746, 63747, 63748, 63749, 63750,
63751, 63752, 63753, 63754, 63755, 63756, 63757, 63758, 63759,
63760, 63761, 63762, 63763, 63764, 63765, 63766, 63767, 63768,
63769, 63770, 63771, 63772, 63773, 63774, 63775, 63776, 63777,
63778, 63779, 63780, 63781, 63782, 63783, 63784, 63785, 63786,
63787, 63788, 63789, 63790, 63791, 63792, 63793, 63794, 63795,
63796, 63797, 63798, 63799, 63800, 63801, 63802, 63803, 63804,
63805, 63806, 63807, 63808, 63809, 63810, 63811, 63812, 63813,
63814, 63815, 63816, 63817, 63818, 63819, 63820, 63821, 63822,
63823, 63824, 63825, 63826, 63827, 63828, 63829, 63830, 63831,
63832, 63833, 63834, 63835, 63836, 63837, 63838, 63839, 63840,
63841, 63842, 63843, 63844, 63845, 63846, 63847, 63848, 63849,
63850, 63851, 63852, 63853, 63854, 63855, 63856, 63857, 63858,
63859, 63860, 63861, 63862, 63863, 63864, 63865, 63866, 63867,
63868, 63869, 63870, 63871, 63872, 63873, 63874, 63875, 63876,
63877, 63878, 63879, 63880, 63881, 63882, 63883, 63884, 63885,
63886, 63887, 63888, 63889, 63890, 63891, 63892, 63893, 63894,
63895, 63896, 63897, 63898, 63899, 63900, 63901, 63902, 63903,
63904, 63905, 63906, 63907, 63908, 63909, 63910, 63911, 63912,
63913, 63914, 63915, 63916, 63917, 63918, 63919, 63920, 63921,
63922, 63923, 63924, 63925, 63926, 63927, 63928, 63929, 63930,
63931, 63932, 63933, 63934, 63935, 63936, 63937, 63938, 63939,
63940, 63941, 63942, 63943, 63944, 63945, 63946, 63947, 63948,
63949, 63950, 63951, 63952, 63953, 63954, 63955, 63956, 63957,
63958, 63959, 63960, 63961, 63962, 63963, 63964, 63965, 63966,
63967, 63968, 63969, 63970, 63971, 63972, 63973, 63974, 63975,
63976, 63977, 63978, 63979, 63980, 63981, 63982, 63983, 63984,
63985, 63986, 63987, 63988, 63989, 63990, 63991, 63992, 63993,
63994, 63995, 63996, 63997, 63998, 63999, 64000, 64001, 64002,
64003, 64004, 64005, 64006, 64007, 64008, 64009, 64010, 64011,
64012, 64013, 64014, 64015, 64016, 64017, 64018, 64019, 64020,
64021, 64022, 64023, 64024, 64025, 64026, 64027, 64028, 64029,
64030, 64031, 64032, 64033, 64034, 64035, 64036, 64037, 64038,
64039, 64040, 64041, 64042, 64043, 64044, 64045, 64046, 64047,
64048, 64049, 64050, 64051, 64052, 64053, 64054, 64055, 64056,
64057, 64058, 64059, 64060, 64061, 64062, 64063, 64064, 64065,
64066, 64067, 64068, 64069, 64070, 64071, 64072, 64073, 64074,
64075, 64076, 64077, 64078, 64079, 64080, 64081, 64082, 64083,
64084, 64085, 64086, 64087, 64088, 64089, 64090, 64091, 64092,
64093, 64094, 64095, 64096, 64097, 64098, 64099, 64100, 64101,
64102, 64103, 64104, 64105, 64106, 64107, 64108, 64109, 64110,
64111, 64112, 64113, 64114, 64115, 64116, 64117, 64118, 64119,
64120, 64121, 64122, 64123, 64124, 64125, 64126, 64127, 64128,
64129, 64130, 64131, 64132, 64133, 64134, 64135, 64136, 64137,
64138, 64139, 64140, 64141, 64142, 64143, 64144, 64145, 64146,
64147, 64148, 64149, 64150, 64151, 64152, 64153, 64154, 64155,
64156, 64157, 64158, 64159, 64160, 64161, 64162, 64163, 64164,
64165, 64166, 64167, 64168, 64169, 64170, 64171, 64172, 64173,
64174, 64175, 64176, 64177, 64178, 64179, 64180, 64181, 64182,
64183, 64184, 64185, 64186, 64187, 64188, 64189, 64190, 64191,
64192, 64193, 64194, 64195, 64196, 64197, 64198, 64199, 64200,
64201, 64202, 64203, 64204, 64205, 64206, 64207, 64208, 64209,
64210, 64211, 64212, 64213, 64214, 64215, 64216, 64217, 64218,
64219, 64220, 64221, 64222, 64223, 64224, 64225, 64226, 64227,
64228, 64229, 64230, 64231, 64232, 64233, 64234, 64235, 64236,
64237, 64238, 64239, 64240, 64241, 64242, 64243, 64244, 64245,
64246, 64247, 64248, 64249, 64250, 64251, 64252, 64253, 64254,
64255, 64256, 64257, 64258, 64259, 64260, 64261, 64262, 64263,
64264, 64265, 64266, 64267, 64268, 64269, 64270, 64271, 64272,
64273, 64274, 64275, 64276, 64277, 64278, 64279, 64280, 64281,
64282, 64283, 64284, 64285, 64286, 64287, 64288, 64289, 64290,
64291, 64292, 64293, 64294, 64295, 64296, 64297, 64298, 64299,
64300, 64301, 64302, 64303, 64304, 64305, 64306, 64307, 64308,
64309, 64310, 64311, 64312, 64313, 64314, 64315, 64316, 64317,
64318, 64319, 64320, 64321, 64322, 64323, 64324, 64325, 64326,
64327, 64328, 64329, 64330, 64331, 64332, 64333, 64334, 64335,
64336, 64337, 64338, 64339, 64340, 64341, 64342, 64343, 64344,
64345, 64346, 64347, 64348, 64349, 64350, 64351, 64352, 64353,
64354, 64355, 64356, 64357, 64358, 64359, 64360, 64361, 64362,
64363, 64364, 64365, 64366, 64367, 64368, 64369, 64370, 64371,
64372, 64373, 64374, 64375, 64376, 64377, 64378, 64379, 64380,
64381, 64382, 64383, 64384, 64385, 64386, 64387, 64388, 64389,
64390, 64391, 64392, 64393, 64394, 64395, 64396, 64397, 64398,
64399, 64400, 64401, 64402, 64403, 64404, 64405, 64406, 64407,
64408, 64409, 64410, 64411, 64412, 64413, 64414, 64415, 64416,
64417, 64418, 64419, 64420, 64421, 64422, 64423, 64424, 64425,
64426, 64427, 64428, 64429, 64430, 64431, 64432, 64433, 64434,
64435, 64436, 64437, 64438, 64439, 64440, 64441, 64442, 64443,
64444, 64445, 64446, 64447, 64448, 64449, 64450, 64451, 64452,
64453, 64454, 64455, 64456, 64457, 64458, 64459, 64460, 64461,
64462, 64463, 64464, 64465, 64466, 64467, 64468, 64469, 64470,
64471, 64472, 64473, 64474, 64475, 64476, 64477, 64478, 64479,
64480, 64481, 64482, 64483, 64484, 64485, 64486, 64487, 64488,
64489, 64490, 64491, 64492, 64493, 64494, 64495, 64496, 64497,
64498, 64499, 64500, 64501, 64502, 64503, 64504, 64505, 64506,
64507, 64508, 64509, 64510, 64511, 64512, 64513, 64514, 64515,
64516, 64517, 64518, 64519, 64520, 64521, 64522, 64523, 64524,
64525, 64526, 64527, 64528, 64529, 64530, 64531, 64532, 64533,
64534, 64535, 64536, 64537, 64538, 64539, 64540, 64541, 64542,
64543, 64544, 64545, 64546, 64547, 64548, 64549, 64550, 64551,
64552, 64553, 64554, 64555, 64556, 64557, 64558, 64559, 64560,
64561, 64562, 64563, 64564, 64565, 64566, 64567, 64568, 64569,
64570, 64571, 64572, 64573, 64574, 64575, 64576, 64577, 64578,
64579, 64580, 64581, 64582, 64583, 64584, 64585, 64586, 64587,
64588, 64589, 64590, 64591, 64592, 64593, 64594, 64595, 64596,
64597, 64598, 64599, 64600, 64601, 64602, 64603, 64604, 64605,
64606, 64607, 64608, 64609, 64610, 64611, 64612, 64613, 64614,
64615, 64616, 64617, 64618, 64619, 64620, 64621, 64622, 64623,
64624, 64625, 64626, 64627, 64628, 64629, 64630, 64631, 64632,
64633, 64634, 64635, 64636, 64637, 64638, 64639, 64640, 64641,
64642, 64643, 64644, 64645, 64646, 64647, 64648, 64649, 64650,
64651, 64652, 64653, 64654, 64655, 64656, 64657, 64658, 64659,
64660, 64661, 64662, 64663, 64664, 64665, 64666, 64667, 64668,
64669, 64670, 64671, 64672, 64673, 64674, 64675, 64676, 64677,
64678, 64679, 64680, 64681, 64682, 64683, 64684, 64685, 64686,
64687, 64688, 64689, 64690, 64691, 64692, 64693, 64694, 64695,
64696, 64697, 64698, 64699, 64700, 64701, 64702, 64703, 64704,
64705, 64706, 64707, 64708, 64709, 64710, 64711, 64712, 64713,
64714, 64715, 64716, 64717, 64718, 64719, 64720, 64721, 64722,
64723, 64724, 64725, 64726, 64727, 64728, 64729, 64730, 64731,
64732, 64733, 64734, 64735, 64736, 64737, 64738, 64739, 64740,
64741, 64742, 64743, 64744, 64745, 64746, 64747, 64748, 64749,
64750, 64751, 64752, 64753, 64754, 64755, 64756, 64757, 64758,
64759, 64760, 64761, 64762, 64763, 64764, 64765, 64766, 64767,
64768, 64769, 64770, 64771, 64772, 64773, 64774, 64775, 64776,
64777, 64778, 64779, 64780, 64781, 64782, 64783, 64784, 64785,
64786, 64787, 64788, 64789, 64790, 64791, 64792, 64793, 64794,
64795, 64796, 64797, 64798, 64799, 64800, 64801, 64802, 64803,
64804, 64805, 64806, 64807, 64808, 64809, 64810, 64811, 64812,
64813, 64814, 64815, 64816, 64817, 64818, 64819, 64820, 64821,
64822, 64823, 64824, 64825, 64826, 64827, 64828, 64829, 64830,
64831, 64832, 64833, 64834, 64835, 64836, 64837, 64838, 64839,
64840, 64841, 64842, 64843, 64844, 64845, 64846, 64847, 64848,
64849, 64850, 64851, 64852, 64853, 64854, 64855, 64856, 64857,
64858, 64859, 64860, 64861, 64862, 64863, 64864, 64865, 64866,
64867, 64868, 64869, 64870, 64871, 64872, 64873, 64874, 64875,
64876, 64877, 64878, 64879, 64880, 64881, 64882, 64883, 64884,
64885, 64886, 64887, 64888, 64889, 64890, 64891, 64892, 64893,
64894, 64895, 64896, 64897, 64898, 64899, 64900, 64901, 64902,
64903, 64904, 64905, 64906, 64907, 64908, 64909, 64910, 64911,
64912, 64913, 64914, 64915, 64916, 64917, 64918, 64919, 64920,
64921, 64922, 64923, 64924, 64925, 64926, 64927, 64928, 64929,
64930, 64931, 64932, 64933, 64934, 64935, 64936, 64937, 64938,
64939, 64940, 64941, 64942, 64943, 64944, 64945, 64946, 64947,
64948, 64949, 64950, 64951, 64952, 64953, 64954, 64955, 64956,
64957, 64958, 64959, 64960, 64961, 64962, 64963, 64964, 64965,
64966, 64967, 64968, 64969, 64970, 64971, 64972, 64973, 64974,
64975, 64976, 64977, 64978, 64979, 64980, 64981, 64982, 64983,
64984, 64985, 64986, 64987, 64988, 64989, 64990, 64991, 64992,
64993, 64994, 64995, 64996, 64997, 64998, 64999, 65000, 65001,
65002, 65003, 65004, 65005, 65006, 65007, 65008, 65009, 65010,
65011, 65012, 65013, 65014, 65015, 65016, 65017, 65018, 65019,
65020, 65021, 65022, 65023, 65024, 65025, 65026, 65027, 65028,
65029, 65030, 65031, 65032, 65033, 65034, 65035, 65036, 65037,
65038, 65039, 65040, 65041, 65042, 65043, 65044, 65045, 65046,
65047, 65048, 65049, 65050, 65051, 65052, 65053, 65054, 65055,
65056, 65057, 65058, 65059, 65060, 65061, 65062, 65063, 65064,
65065, 65066, 65067, 65068, 65069, 65070, 65071, 65072, 65073,
65074, 65075, 65076, 65077, 65078, 65079, 65080, 65081, 65082,
65083, 65084, 65085, 65086, 65087, 65088, 65089, 65090, 65091,
65092, 65093, 65094, 65095, 65096, 65097, 65098, 65099, 65100,
65101, 65102, 65103, 65104, 65105, 65106, 65107, 65108, 65109,
65110, 65111, 65112, 65113, 65114, 65115, 65116, 65117, 65118,
65119, 65120, 65121, 65122, 65123, 65124, 65125, 65126, 65127,
65128, 65129, 65130, 65131, 65132, 65133, 65134, 65135, 65136,
65137, 65138, 65139, 65140, 65141, 65142, 65143, 65144, 65145,
65146, 65147, 65148, 65149, 65150, 65151, 65152, 65153, 65154,
65155, 65156, 65157, 65158, 65159, 65160, 65161, 65162, 65163,
65164, 65165, 65166, 65167, 65168, 65169, 65170, 65171, 65172,
65173, 65174, 65175, 65176, 65177, 65178, 65179, 65180, 65181,
65182, 65183, 65184, 65185, 65186, 65187, 65188, 65189, 65190,
65191, 65192, 65193, 65194, 65195, 65196, 65197, 65198, 65199,
65200, 65201, 65202, 65203, 65204, 65205, 65206, 65207, 65208,
65209, 65210, 65211, 65212, 65213, 65214, 65215, 65216, 65217,
65218, 65219, 65220, 65221, 65222, 65223, 65224, 65225, 65226,
65227, 65228, 65229, 65230, 65231, 65232, 65233, 65234, 65235,
65236, 65237, 65238, 65239, 65240, 65241, 65242, 65243, 65244,
65245, 65246, 65247, 65248, 65249, 65250, 65251, 65252, 65253,
65254, 65255, 65256, 65257, 65258, 65259, 65260, 65261, 65262,
65263, 65264, 65265, 65266, 65267, 65268, 65269, 65270, 65271,
65272, 65273, 65274, 65275, 65276, 65277, 65278, 65279, 65280,
65281, 65282, 65283, 65284, 65285, 65286, 65287, 65288, 65289,
65290, 65291, 65292, 65293, 65294, 65295, 65296, 65297, 65298,
65299, 65300, 65301, 65302, 65303, 65304, 65305, 65306, 65307,
65308, 65309, 65310, 65311, 65312, 65313, 65314, 65315, 65316,
65317, 65318, 65319, 65320, 65321, 65322, 65323, 65324, 65325,
65326, 65327, 65328, 65329, 65330, 65331, 65332, 65333, 65334,
65335, 65336, 65337, 65338, 65339, 65340, 65341, 65342, 65343,
65344, 65345, 65346, 65347, 65348, 65349, 65350, 65351, 65352,
65353, 65354, 65355, 65356, 65357, 65358, 65359, 65360, 65361,
65362, 65363, 65364, 65365, 65366, 65367, 65368, 65369, 65370,
65371, 65372, 65373, 65374, 65375, 65376, 65377, 65378, 65379,
65380, 65381, 65382, 65383, 65384, 65385, 65386, 65387, 65388,
65389, 65390, 65391, 65392, 65393, 65394, 65395, 65396, 65397,
65398, 65399, 65400, 65401, 65402, 65403, 65404, 65405, 65406,
65407, 65408, 65409, 65410, 65411, 65412, 65413, 65414, 65415,
65416, 65417, 65418, 65419, 65420, 65421, 65422, 65423, 65424,
65425, 65426, 65427, 65428, 65429, 65430, 65431, 65432, 65433,
65434, 65435, 65436, 65437, 65438, 65439, 65440, 65441, 65442,
65443, 65444, 65445, 65446, 65447, 65448, 65449, 65450, 65451,
65452, 65453, 65454, 65455, 65456, 65457, 65458, 65459, 65460,
65461, 65462, 65463, 65464, 65465, 65466, 65467, 65468, 65469,
65470, 65471, 65472, 65473, 65474, 65475, 65476, 65477, 65478,
65479, 65480, 65481, 65482, 65483, 65484, 65485, 65486, 65487,
65488, 65489, 65490, 65491, 65492, 65493, 65494, 65495, 65496,
65497, 65498, 65499, 65500, 65501, 65502, 65503, 65504, 65505,
65506, 65507, 65508, 65509, 65510, 65511, 65512, 65513, 65514,
65515, 65516, 65517, 65518, 65519, 65520, 65521, 65522, 65523,
65524, 65525, 65526, 65527, 65528, 65529, 65530, 65531, 65532,
65533, 65534, 65535, 65536, 65537, 65538, 65539, 65540, 65541,
65542, 65543, 65544, 65545, 65546, 65547, 65548, 65549, 65550,
65551, 65552, 65553, 65554, 65555, 65556, 65557, 65558, 65559,
65560, 65561, 65562, 65563, 65564, 65565, 65566, 65567, 65568,
65569, 65570, 65571, 65572, 65573, 65574, 65575, 65576, 65577,
65578, 65579, 65580, 65581, 65582, 65583, 65584, 65585, 65586,
65587, 65588, 65589, 65590, 65591, 65592, 65593, 65594, 65595,
65596, 65597, 65598, 65599, 65600, 65601, 65602, 65603, 65604,
65605, 65606, 65607, 65608, 65609, 65610, 65611, 65612, 65613,
65614, 65615, 65616, 65617, 65618, 65619, 65620, 65621, 65622,
65623, 65624, 65625, 65626, 65627, 65628, 65629, 65630, 65631,
65632, 65633, 65634, 65635, 65636, 65637, 65638, 65639, 65640,
65641, 65642, 65643, 65644, 65645, 65646, 65647, 65648, 65649,
65650, 65651, 65652, 65653, 65654, 65655, 65656, 65657,
65658, 65659, 65660, 65661, 65662, 65663, 65664, 65665, 65666,
65667, 65668, 65669, 65670, 65671, 65672, 65673, 65674, 65675,
65676, 65677, 65678, 65679, 65680, 65681, 65682, 65683, 65684,
65685, 65686, 65687, 65688, 65689, 65690, 65691, 65692, 65693,
65694, 65695, 65696, 65697, 65698, 65699, 65700, 65701, 65702,
65703, 65704, 65705, 65706, 65707, 65708, 65709, 65710, 65711,
65712, 65713, 65714, 65715, 65716, 65717, 65718, 65719, 65720,
65721, 65722, 65723, 65724, 65725, 65726, 65727, 65728, 65729,
65730, 65731, 65732, 65733, 65734, 65735, 65736, 65737, 65738,
65739, 65740, 65741, 65742, 65743, 65744, 65745, 65746, 65747,
65748, 65749, 65750, 65751, 65752, 65753, 65754, 65755, 65756,
65757, 65758, 65759, 65760, 65761, 65762, 65763, 65764, 65765,
65766, 65767, 65768, 65769, 65770, 65771, 65772, 65773, 65774,
65775, 65776, 65777, 65778, 65779, 65780, 65781, 65782, 65783,
65784, 65785, 65786, 65787, 65788, 65789, 65790, 65791, 65792,
65793, 65794, 65795, 65796, 65797, 65798, 65799, 65800, 65801,
65802, 65803, 65804, 65805, 65806, 65807, 65808, 65809, 65810,
65811, 65812, 65813, 65814, 65815, 65816, 65817, 65818, 65819,
65820, 65821, 65822, 65823, 65824, 65825, 65826, 65827, 65828,
65829, 65830, 65831, 65832, 65833, 65834, 65835, 65836, 65837,
65838, 65839, 65840, 65841, 65842, 65843, 65844, 65845, 65846,
65847, 65848, 65849, 65850, 65851, 65852, 65853, 65854, 65855,
65856, 65857, 65858, 65859, 65860, 65861, 65862, 65863, 65864,
65865, 65866, 65867, 65868, 65869, 65870, 65871, 65872, 65873,
65874, 65875, 65876, 65877, 65878, 65879, 65880, 65881, 65882,
65883, 65884, 65885, 65886, 65887, 65888, 65889, 65890, 65891,
65892, 65893, 65894, 65895, 65896, 65897, 65898, 65899, 65900,
65901, 65902, 65903, 65904, 65905, 65906, 65907, 65908, 65909,
65910, 65911, 65912, 65913, 65914, 65915, 65916, 65917, 65918,
65919, 65920, 65921, 65922, 65923, 65924, 65925, 65926, 65927,
65928, 65929, 65930, 65931, 65932, 65933, 65934, 65935, 65936,
65937, 65938, 65939, 65940, 65941, 65942, 65943, 65944, 65945,
65946, 65947, 65948, 65949, 65950, 65951, 65952, 65953, 65954,
65955, 65956, 65957, 65958, 65959, 65960, 65961, 65962, 65963,
65964, 65965, 65966, 65967, 65968, 65969, 65970, 65971, 65972,
65973, 65974, 65975, 65976, 65977, 65978, 65979, 65980, 65981,
65982, 65983, 65984, 65985, 65986, 65987, 65988, 65989, 65990,
65991, 65992, 65993, 65994, 65995, 65996, 65997, 65998, 65999,
66000, 66001, 66002, 66003, 66004, 66005, 66006, 66007, 66008,
66009, 66010, 66011, 66012, 66013, 66014, 66015, 66016, 66017,
66018, 66019, 66020, 66021, 66022, 66023, 66024, 66025, 66026,
66027, 66028, 66029, 66030, 66031, 66032, 66033, 66034, 66035,
66036, 66037, 66038, 66039, 66040, 66041, 66042, 66043, 66044,
66045, 66046, 66047, 66048, 66049, 66050, 66051, 66052, 66053,
66054, 66055, 66056, 66057, 66058, 66059, 66060, 66061, 66062,
66063, 66064, 66065, 66066, 66067, 66068, 66069, 66070, 66071,
66072, 66073, 66074, 66075, 66076, 66077, 66078, 66079, 66080,
66081, 66082, 66083, 66084, 66085, 66086, 66087, 66088, 66089,
66090, 66091, 66092, 66093, 66094, 66095, 66096, 66097, 66098,
66099, 66100, 66101, 66102, 66103, 66104, 66105, 66106, 66107,
66108, 66109, 66110, 66111, 66112, 66113, 66114, 66115, 66116,
66117, 66118, 66119, 66120, 66121, 66122, 66123, 66124, 66125,
66126, 66127, 66128, 66129, 66130, 66131, 66132, 66133, 66134,
66135, 66136, 66137, 66138, 66139, 66140, 66141, 66142, 66143,
66144, 66145, 66146, 66147, 66148, 66149, 66150, 66151, 66152,
66153, 66154, 66155, 66156, 66157, 66158, 66159, 66160, 66161,
66162, 66163, 66164, 66165, 66166, 66167, 66168, 66169, 66170,
66171, 66172, 66173, 66174, 66175, 66176, 66177, 66178, 66179,
66180, 66181, 66182, 66183, 66184, 66185, 66186, 66187, 66188,
66189, 66190, 66191, 66192, 66193, 66194, 66195, 66196, 66197,
66198, 66199, 66200, 66201, 66202, 66203, 66204, 66205, 66206,
66207, 66208, 66209, 66210, 66211, 66212, 66213, 66214, 66215,
66216, 66217, 66218, 66219, 66220, 66221, 66222, 66223, 66224,
66225, 66226, 66227, 66228, 66229, 66230, 66231, 66232, 66233,
66234, 66235, 66236, 66237, 66238, 66239, 66240, 66241, 66242,
66243, 66244, 66245, 66246, 66247, 66248, 66249, 66250, 66251,
66252, 66253, 66254, 66255, 66256, 66257, 66258, 66259, 66260,
66261, 66262, 66263, 66264, 66265, 66266, 66267, 66268, 66269,
66270, 66271, 66272, 66273, 66274, 66275, 66276, 66277, 66278,
66279, 66280, 66281, 66282, 66283, 66284, 66285, 66286, 66287,
66288, 66289, 66290, 66291, 66292, 66293, 66294, 66295, 66296,
66297, 66298, 66299, 66300, 66301, 66302, 66303, 66304, 66305,
66306, 66307, 66308, 66309, 66310, 66311, 66312, 66313, 66314,
66315, 66316, 66317, 66318, 66319, 66320, 66321, 66322, 66323,
66324, 66325, 66326, 66327, 66328, 66329, 66330, 66331, 66332,
66333, 66334, 66335, 66336, 66337, 66338, 66339, 66340, 66341,
66342, 66343, 66344, 66345, 66346, 66347, 66348, 66349, 66350,
66351, 66352, 66353, 66354, 66355, 66356, 66357, 66358, 66359,
66360, 66361, 66362, 66363, 66364, 66365, 66366, 66367, 66368,
66369, 66370, 66371, 66372, 66373, 66374, 66375, 66376, 66377,
66378, 66379, 66380, 66381, 66382, 66383, 66384, 66385, 66386,
66387, 66388, 66389, 66390, 66391, 66392, 66393, 66394, 66395,
66396, 66397, 66398, 66399, 66400, 66401, 66402, 66403, 66404,
66405, 66406, 66407, 66408, 66409, 66410, 66411, 66412, 66413,
66414, 66415, 66416, 66417, 66418, 66419, 66420, 66421, 66422,
66423, 66424, 66425, 66426, 66427, 66428, 66429, 66430, 66431,
66432, 66433, 66434, 66435, 66436, 66437, 66438, 66439, 66440,
66441, 66442, 66443, 66444, 66445, 66446, 66447, 66448, 66449,
66450, 66451, 66452, 66453, 66454, 66455, 66456, 66457, 66458,
66459, 66460, 66461, 66462, 66463, 66464, 66465, 66466, 66467,
66468, 66469, 66470, 66471, 66472, 66473, 66474, 66475, 66476,
66477, 66478, 66479, 66480, 66481, 66482, 66483, 66484, 66485,
66486, 66487, 66488, 66489, 66490, 66491, 66492, 66493, 66494,
66495, 66496, 66497, 66498, 66499, 66500, 66501, 66502, 66503,
66504, 66505, 66506, 66507, 66508, 66509, 66510, 66511, 66512,
66513, 66514, 66515, 66516, 66517, 66518, 66519, 66520, 66521,
66522, 66523, 66524, 66525, 66526, 66527, 66528, 66529, 66530,
66531, 66532, 66533, 66534, 66535, 66536, 66537, 66538, 66539,
66540, 66541, 66542, 66543, 66544, 66545, 66546, 66547, 66548,
66549, 66550, 66551, 66552, 66553, 66554, 66555, 66556, 66557,
66558, 66559, 66560, 66561, 66562, 66563, 66564, 66565, 66566,
66567, 66568, 66569, 66570, 66571, 66572, 66573, 66574, 66575,
66576, 66577, 66578, 66579, 66580, 66581, 66582, 66583, 66584,
66585, 66586, 66587, 66588, 66589, 66590, 66591, 66592, 66593,
66594, 66595, 66596, 66597, 66598, 66599, 66600, 66601, 66602,
66603, 66604, 66605, 66606, 66607, 66608, 66609, 66610, 66611,
66612, 66613, 66614, 66615, 66616, 66617, 66618, 66619, 66620,
66621, 66622, 66623, 66624, 66625, 66626, 66627, 66628, 66629,
66630, 66631, 66632, 66633, 66634, 66635, 66636, 66637, 66638,
66639, 66640, 66641, 66642, 66643, 66644, 66645, 66646, 66647,
66648, 66649, 66650, 66651, 66652, 66653, 66654, 66655, 66656,
66657, 66658, 66659, 66660, 66661, 66662, 66663, 66664, 66665,
66666, 66667, 66668, 66669, 66670, 66671, 66672, 66673, 66674,
66675, 66676, 66677, 66678, 66679, 66680, 66681, 66682, 66683,
66684, 66685, 66686, 66687, 66688, 66689, 66690, 66691, 66692,
66693, 66694, 66695, 66696, 66697, 66698, 66699, 66700, 66701,
66702, 66703, 66704, 66705, 66706, 66707, 66708, 66709, 66710,
66711, 66712, 66713, 66714, 66715, 66716, 66717, 66718, 66719,
66720, 66721, 66722, 66723, 66724, 66725, 66726, 66727, 66728,
66729, 66730, 66731, 66732, 66733, 66734, 66735, 66736, 66737,
66738, 66739, 66740, 66741, 66742, 66743, 66744, 66745, 66746,
66747, 66748, 66749, 66750, 66751, 66752, 66753, 66754, 66755,
66756, 66757, 66758, 66759, 66760, 66761, 66762, 66763, 66764,
66765, 66766, 66767, 66768, 66769, 66770, 66771, 66772, 66773,
66774, 66775, 66776, 66777, 66778, 66779, 66780, 66781, 66782,
66783, 66784, 66785, 66786, 66787, 66788, 66789, 66790, 66791,
66792, 66793, 66794, 66795, 66796, 66797, 66798, 66799, 66800,
66801, 66802, 66803, 66804, 66805, 66806, 66807, 66808, 66809,
66810, 66811, 66812, 66813, 66814, 66815, 66816, 66817, 66818,
66819, 66820, 66821, 66822, 66823, 66824, 66825, 66826, 66827,
66828, 66829, 66830, 66831, 66832, 66833, 66834, 66835, 66836,
66837, 66838, 66839, 66840, 66841, 66842, 66843, 66844, 66845,
66846, 66847, 66848, 66849, 66850, 66851, 66852, 66853, 66854,
66855, 66856, 66857, 66858, 66859, 66860, 66861, 66862, 66863,
66864, 66865, 66866, 66867, 66868, 66869, 66870, 66871, 66872,
66873, 66874, 66875, 66876, 66877, 66878, 66879, 66880, 66881,
66882, 66883, 66884, 66885, 66886, 66887, 66888, 66889, 66890,
66891, 66892, 66893, 66894, 66895, 66896, 66897, 66898, 66899,
66900, 66901, 66902, 66903, 66904, 66905, 66906, 66907, 66908,
66909, 66910, 66911, 66912, 66913, 66914, 66915, 66916, 66917,
66918, 66919, 66920, 66921, 66922, 66923, 66924, 66925, 66926,
66927, 66928, 66929, 66930, 66931, 66932, 66933, 66934, 66935,
66936, 66937, 66938, 66939, 66940, 66941, 66942, 66943, 66944,
66945, 66946, 66947, 66948, 66949, 66950, 66951, 66952, 66953,
66954, 66955, 66956, 66957, 66958, 66959, 66960, 66961, 66962,
66963, 66964, 66965, 66966, 66967, 66968, 66969, 66970, 66971,
66972, 66973, 66974, 66975, 66976, 66977, 66978, 66979, 66980,
66981, 66982, 66983, 66984, 66985, 66986, 66987, 66988, 66989,
66990, 66991, 66992, 66993, 66994, 66995, 66996, 66997, 66998,
66999, 67000, 67001, 67002, 67003, 67004, 67005, 67006, 67007,
67008, 67009, 67010, 67011, 67012, 67013, 67014, 67015, 67016,
67017, 67018, 67019, 67020, 67021, 67022, 67023, 67024, 67025,
67026, 67027, 67028, 67029, 67030, 67031, 67032, 67033, 67034,
67035, 67036, 67037, 67038, 67039, 67040, 67041, 67042, 67043,
67044, 67045, 67046, 67047, 67048, 67049, 67050, 67051, 67052,
67053, 67054, 67055, 67056, 67057, 67058, 67059, 67060, 67061,
67062, 67063, 67064, 67065, 67066, 67067, 67068, 67069, 67070,
67071, 67072, 67073, 67074, 67075, 67076, 67077, 67078, 67079,
67080, 67081, 67082, 67083, 67084, 67085, 67086, 67087, 67088,
67089, 67090, 67091, 67092, 67093, 67094, 67095, 67096, 67097,
67098, 67099, 67100, 67101, 67102, 67103, 67104, 67105, 67106,
67107, 67108, 67109, 67110, 67111, 67112, 67113, 67114, 67115,
67116, 67117, 67118, 67119, 67120, 67121, 67122, 67123, 67124,
67125, 67126, 67127, 67128, 67129, 67130, 67131, 67132, 67133,
67134, 67135, 67136, 67137, 67138, 67139, 67140, 67141, 67142,
67143, 67144, 67145, 67146, 67147, 67148, 67149, 67150, 67151,
67152, 67153, 67154, 67155, 67156, 67157, 67158, 67159, 67160,
67161, 67162, 67163, 67164, 67165, 67166, 67167, 67168, 67169,
67170, 67171, 67172, 67173, 67174, 67175, 67176, 67177, 67178,
67179, 67180, 67181, 67182, 67183, 67184, 67185, 67186, 67187,
67188, 67189, 67190, 67191, 67192, 67193, 67194, 67195, 67196,
67197, 67198, 67199, 67200, 67201, 67202, 67203, 67204, 67205,
67206, 67207, 67208, 67209, 67210, 67211, 67212, 67213, 67214,
67215, 67216, 67217, 67218, 67219, 67220, 67221, 67222, 67223,
67224, 67225, 67226, 67227, 67228, 67229, 67230, 67231, 67232,
67233, 67234, 67235, 67236, 67237, 67238, 67239, 67240, 67241,
67242, 67243, 67244, 67245, 67246, 67247, 67248, 67249, 67250,
67251, 67252, 67253, 67254, 67255, 67256, 67257, 67258, 67259,
67260, 67261, 67262, 67263, 67264, 67265, 67266, 67267, 67268,
67269, 67270, 67271, 67272, 67273, 67274, 67275, 67276, 67277,
67278, 67279, 67280, 67281, 67282, 67283, 67284, 67285, 67286,
67287, 67288, 67289, 67290, 67291, 67292, 67293, 67294, 67295,
67296, 67297, 67298, 67299, 67300, 67301, 67302, 67303, 67304,
67305, 67306, 67307, 67308, 67309, 67310, 67311, 67312, 67313,
67314, 67315, 67316, 67317, 67318, 67319, 67320, 67321, 67322,
67323, 67324, 67325, 67326, 67327, 67328, 67329, 67330, 67331,
67332, 67333, 67334, 67335, 67336, 67337, 67338, 67339, 67340,
67341, 67342, 67343, 67344, 67345, 67346, 67347, 67348, 67349,
67350, 67351, 67352, 67353, 67354, 67355, 67356, 67357, 67358,
67359, 67360, 67361, 67362, 67363, 67364, 67365, 67366, 67367,
67368, 67369, 67370, 67371, 67372, 67373, 67374, 67375, 67376,
67377, 67378, 67379, 67380, 67381, 67382, 67383, 67384, 67385,
67386, 67387, 67388, 67389, 67390, 67391, 67392, 67393, 67394,
67395, 67396, 67397, 67398, 67399, 67400, 67401, 67402, 67403,
67404, 67405, 67406, 67407, 67408, 67409, 67410, 67411, 67412,
67413, 67414, 67415, 67416, 67417, 67418, 67419, 67420, 67421,
67422, 67423, 67424, 67425, 67426, 67427, 67428, 67429, 67430,
67431, 67432, 67433, 67434, 67435, 67436, 67437, 67438, 67439,
67440, 67441, 67442, 67443, 67444, 67445, 67446, 67447, 67448,
67449, 67450, 67451, 67452, 67453, 67454, 67455, 67456, 67457,
67458, 67459, 67460, 67461, 67462, 67463, 67464, 67465, 67466,
67467, 67468, 67469, 67470, 67471, 67472, 67473, 67474, 67475,
67476, 67477, 67478, 67479, 67480, 67481, 67482, 67483, 67484,
67485, 67486, 67487, 67488, 67489, 67490, 67491, 67492, 67493,
67494, 67495, 67496, 67497, 67498, 67499, 67500, 67501, 67502,
67503, 67504, 67505, 67506, 67507, 67508, 67509, 67510, 67511,
67512, 67513, 67514, 67515, 67516, 67517, 67518, 67519, 67520,
67521, 67522, 67523, 67524, 67525, 67526, 67527, 67528, 67529,
67530, 67531, 67532, 67533, 67534, 67535, 67536, 67537, 67538,
67539, 67540, 67541, 67542, 67543, 67544, 67545, 67546, 67547,
67548, 67549, 67550, 67551, 67552, 67553, 67554, 67555, 67556,
67557, 67558, 67559, 67560, 67561, 67562, 67563, 67564, 67565,
67566, 67567, 67568, 67569, 67570, 67571, 67572, 67573, 67574,
67575, 67576, 67577, 67578, 67579, 67580, 67581, 67582, 67583,
67584, 67585, 67586, 67587, 67588, 67589, 67590, 67591, 67592,
67593, 67594, 67595, 67596, 67597, 67598, 67599, 67600, 67601,
67602, 67603, 67604, 67605, 67606, 67607, 67608, 67609, 67610,
67611, 67612, 67613, 67614, 67615, 67616, 67617, 67618, 67619,
67620, 67621, 67622, 67623, 67624, 67625, 67626, 67627, 67628,
67629, 67630, 67631, 67632, 67633, 67634, 67635, 67636, 67637,
67638, 67639, 67640, 67641, 67642, 67643, 67644, 67645, 67646,
67647, 67648, 67649, 67650, 67651, 67652, 67653, 67654, 67655,
67656, 67657, 67658, 67659, 67660, 67661, 67662, 67663, 67664,
67665, 67666, 67667, 67668, 67669, 67670, 67671, 67672, 67673,
67674, 67675, 67676, 67677, 67678, 67679, 67680, 67681, 67682,
67683, 67684, 67685, 67686, 67687, 67688, 67689, 67690, 67691,
67692, 67693, 67694, 67695, 67696, 67697, 67698, 67699, 67700,
67701, 67702, 67703, 67704, 67705, 67706, 67707, 67708, 67709,
67710, 67711, 67712, 67713, 67714, 67715, 67716, 67717, 67718,
67719, 67720, 67721, 67722, 67723, 67724, 67725, 67726, 67727,
67728, 67729, 67730, 67731, 67732, 67733, 67734, 67735, 67736,
67737, 67738, 67739, 67740, 67741, 67742, 67743, 67744, 67745,
67746, 67747, 67748, 67749, 67750, 67751, 67752, 67753, 67754,
67755, 67756, 67757, 67758, 67759, 67760, 67761, 67762, 67763,
67764, 67765, 67766, 67767, 67768, 67769, 67770, 67771, 67772,
67773, 67774, 67775, 67776, 67777, 67778, 67779, 67780, 67781,
67782, 67783, 67784, 67785, 67786, 67787, 67788, 67789, 67790,
67791, 67792, 67793, 67794, 67795, 67796, 67797, 67798, 67799,
67800, 67801, 67802, 67803, 67804, 67805, 67806, 67807, 67808,
67809, 67810, 67811, 67812, 67813, 67814, 67815, 67816, 67817,
67818, 67819, 67820, 67821, 67822, 67823, 67824, 67825, 67826,
67827, 67828, 67829, 67830, 67831, 67832, 67833, 67834, 67835,
67836, 67837, 67838, 67839, 67840, 67841, 67842, 67843, 67844,
67845, 67846, 67847, 67848, 67849, 67850, 67851, 67852, 67853,
67854, 67855, 67856, 67857, 67858, 67859, 67860, 67861, 67862,
67863, 67864, 67865, 67866, 67867, 67868, 67869, 67870, 67871,
67872, 67873, 67874, 67875, 67876, 67877, 67878, 67879, 67880,
67881, 67882, 67883, 67884, 67885, 67886, 67887, 67888, 67889,
67890, 67891, 67892, 67893, 67894, 67895, 67896, 67897, 67898,
67899, 67900, 67901, 67902, 67903, 67904, 67905, 67906, 67907,
67908, 67909, 67910, 67911, 67912, 67913, 67914, 67915, 67916,
67917, 67918, 67919, 67920, 67921, 67922, 67923, 67924, 67925,
67926, 67927, 67928, 67929, 67930, 67931, 67932, 67933, 67934,
67935, 67936, 67937, 67938, 67939, 67940, 67941, 67942, 67943,
67944, 67945, 67946, 67947, 67948, 67949, 67950, 67951, 67952,
67953, 67954, 67955, 67956, 67957, 67958, 67959, 67960, 67961,
67962, 67963, 67964, 67965, 67966, 67967, 67968, 67969, 67970,
67971, 67972, 67973, 67974, 67975, 67976, 67977, 67978, 67979,
67980, 67981, 67982, 67983, 67984, 67985, 67986, 67987, 67988,
67989, 67990, 67991, 67992, 67993, 67994, 67995, 67996, 67997,
67998, 67999, 68000, 68001, 68002, 68003, 68004, 68005, 68006,
68007, 68008, 68009, 68010, 68011, 68012, 68013, 68014, 68015,
68016, 68017, 68018, 68019, 68020, 68021, 68022, 68023, 68024,
68025, 68026, 68027, 68028, 68029, 68030, 68031, 68032, 68033,
68034, 68035, 68036, 68037, 68038, 68039, 68040, 68041, 68042,
68043, 68044, 68045, 68046, 68047, 68048, 68049, 68050, 68051,
68052, 68053, 68054, 68055, 68056, 68057, 68058, 68059, 68060,
68061, 68062, 68063, 68064, 68065, 68066, 68067, 68068, 68069,
68070, 68071, 68072, 68073, 68074, 68075, 68076, 68077, 68078,
68079, 68080, 68081, 68082, 68083, 68084, 68085, 68086, 68087,
68088, 68089, 68090, 68091, 68092, 68093, 68094, 68095, 68096,
68097, 68098, 68099, 68100, 68101, 68102, 68103, 68104, 68105,
68106, 68107, 68108, 68109, 68110, 68111, 68112, 68113, 68114,
68115, 68116, 68117, 68118, 68119, 68120, 68121, 68122, 68123,
68124, 68125, 68126, 68127, 68128, 68129, 68130, 68131, 68132,
68133, 68134, 68135, 68136, 68137, 68138, 68139, 68140, 68141,
68142, 68143, 68144, 68145, 68146, 68147, 68148, 68149, 68150,
68151, 68152, 68153, 68154, 68155, 68156, 68157, 68158, 68159,
68160, 68161, 68162, 68163, 68164, 68165, 68166, 68167,
68168, 68169, 68170, 68171, 68172, 68173, 68174, 68175, 68176,
68177, 68178, 68179, 68180, 68181, 68182, 68183, 68184, 68185,
68186, 68187, 68188, 68189, 68190, 68191, 68192, 68193, 68194,
68195, 68196, 68197, 68198, 68199, 68200, 68201, 68202, 68203,
68204, 68205, 68206, 68207, 68208, 68209, 68210, 68211, 68212,
68213, 68214, 68215, 68216, 68217, 68218, 68219, 68220, 68221,
68222, 68223, 68224, 68225, 68226, 68227, 68228, 68229, 68230,
68231, 68232, 68233, 68234, 68235, 68236, 68237, 68238, 68239,
68240, 68241, 68242, 68243, 68244, 68245, 68246, 68247, 68248,
68249, 68250, 68251, 68252, 68253, 68254, 68255, 68256, 68257,
68258, 68259, 68260, 68261, 68262, 68263, 68264, 68265, 68266,
68267, 68268, 68269, 68270, 68271, 68272, 68273, 68274, 68275,
68276, 68277, 68278, 68279, 68280, 68281, 68282, 68283, 68284,
68285, 68286, 68287, 68288, 68289, 68290, 68291, 68292, 68293,
68294, 68295, 68296, 68297, 68298, 68299, 68300, 68301, 68302,
68303, 68304, 68305, 68306, 68307, 68308, 68309, 68310, 68311,
68312, 68313, 68314, 68315, 68316, 68317, 68318, 68319, 68320,
68321, 68322, 68323, 68324, 68325, 68326, 68327, 68328, 68329,
68330, 68331, 68332, 68333, 68334, 68335, 68336, 68337, 68338,
68339, 68340, 68341, 68342, 68343, 68344, 68345, 68346, 68347,
68348, 68349, 68350, 68351, 68352, 68353, 68354, 68355, 68356,
68357, 68358, 68359, 68360, 68361, 68362, 68363, 68364, 68365,
68366, 68367, 68368, 68369, 68370, 68371, 68372, 68373, 68374,
68375, 68376, 68377, 68378, 68379, 68380, 68381, 68382, 68383,
68384, 68385, 68386, 68387, 68388, 68389, 68390, 68391, 68392,
68393, 68394, 68395, 68396, 68397, 68398, 68399, 68400, 68401,
68402, 68403, 68404, 68405, 68406, 68407, 68408, 68409, 68410,
68411, 68412, 68413, 68414, 68415, 68416, 68417, 68418, 68419,
68420, 68421, 68422, 68423, 68424, 68425, 68426, 68427, 68428,
68429, 68430, 68431, 68432, 68433, 68434, 68435, 68436, 68437,
68438, 68439, 68440, 68441, 68442, 68443, 68444, 68445, 68446,
68447, 68448, 68449, 68450, 68451, 68452, 68453, 68454, 68455,
68456, 68457, 68458, 68459, 68460, 68461, 68462, 68463, 68464,
68465, 68466, 68467, 68468, 68469, 68470, 68471, 68472, 68473,
68474, 68475, 68476, 68477, 68478, 68479, 68480, 68481, 68482,
68483, 68484, 68485, 68486, 68487, 68488, 68489, 68490, 68491,
68492, 68493, 68494, 68495, 68496, 68497, 68498, 68499, 68500,
68501, 68502, 68503, 68504, 68505, 68506, 68507, 68508, 68509,
68510, 68511, 68512, 68513, 68514, 68515, 68516, 68517, 68518,
68519, 68520, 68521, 68522, 68523, 68524, 68525, 68526, 68527,
68528, 68529, 68530, 68531, 68532, 68533, 68534, 68535, 68536,
68537, 68538, 68539, 68540, 68541, 68542, 68543, 68544, 68545,
68546, 68547, 68548, 68549, 68550, 68551, 68552, 68553, 68554,
68555, 68556, 68557, 68558, 68559, 68560, 68561, 68562, 68563,
68564, 68565, 68566, 68567, 68568, 68569, 68570, 68571, 68572,
68573, 68574, 68575, 68576, 68577, 68578, 68579, 68580, 68581,
68582, 68583, 68584, 68585, 68586, 68587, 68588, 68589, 68590,
68591, 68592, 68593, 68594, 68595, 68596, 68597, 68598, 68599,
68600, 68601, 68602, 68603, 68604, 68605, 68606, 68607, 68608,
68609, 68610, 68611, 68612, 68613, 68614, 68615, 68616, 68617,
68618, 68619, 68620, 68621, 68622, 68623, 68624, 68625, 68626,
68627, 68628, 68629, 68630, 68631, 68632, 68633, 68634, 68635,
68636, 68637, 68638, 68639, 68640, 68641, 68642, 68643, 68644,
68645, 68646, 68647, 68648, 68649, 68650, 68651, 68652, 68653,
68654, 68655, 68656, 68657, 68658, 68659, 68660, 68661, 68662,
68663, 68664, 68665, 68666, 68667, 68668, 68669, 68670, 68671,
68672, 68673, 68674, 68675, 68676, 68677, 68678, 68679, 68680,
68681, 68682, 68683, 68684, 68685, 68686, 68687, 68688, 68689,
68690, 68691, 68692, 68693, 68694, 68695, 68696, 68697, 68698,
68699, 68700, 68701, 68702, 68703, 68704, 68705, 68706, 68707,
68708, 68709, 68710, 68711, 68712, 68713, 68714, 68715, 68716,
68717, 68718, 68719, 68720, 68721, 68722, 68723, 68724, 68725,
68726, 68727, 68728, 68729, 68730, 68731, 68732, 68733, 68734,
68735, 68736, 68737, 68738, 68739, 68740, 68741, 68742, 68743,
68744, 68745, 68746, 68747, 68748, 68749, 68750, 68751, 68752,
68753, 68754, 68755, 68756, 68757, 68758, 68759, 68760, 68761,
68762, 68763, 68764, 68765, 68766, 68767, 68768, 68769, 68770,
68771, 68772, 68773, 68774, 68775, 68776, 68777, 68778, 68779,
68780, 68781, 68782, 68783, 68784, 68785, 68786, 68787, 68788,
68789, 68790, 68791, 68792, 68793, 68794, 68795, 68796, 68797,
68798, 68799, 68800, 68801, 68802, 68803, 68804, 68805, 68806,
68807, 68808, 68809, 68810, 68811, 68812, 68813, 68814, 68815,
68816, 68817, 68818, 68819, 68820, 68821, 68822, 68823, 68824,
68825, 68826, 68827, 68828, 68829, 68830, 68831, 68832, 68833,
68834, 68835, 68836, 68837, 68838, 68839, 68840, 68841, 68842,
68843, 68844, 68845, 68846, 68847, 68848, 68849, 68850, 68851,
68852, 68853, 68854, 68855, 68856, 68857, 68858, 68859, 68860,
68861, 68862, 68863, 68864, 68865, 68866, 68867, 68868, 68869,
68870, 68871, 68872, 68873, 68874, 68875, 68876, 68877, 68878,
68879, 68880, 68881, 68882, 68883, 68884, 68885, 68886, 68887,
68888, 68889, 68890, 68891, 68892, 68893, 68894, 68895, 68896,
68897, 68898, 68899, 68900, 68901, 68902, 68903, 68904, 68905,
68906, 68907, 68908, 68909, 68910, 68911, 68912, 68913, 68914,
68915, 68916, 68917, 68918, 68919, 68920, 68921, 68922, 68923,
68924, 68925, 68926, 68927, 68928, 68929, 68930, 68931, 68932,
68933, 68934, 68935, 68936, 68937, 68938, 68939, 68940, 68941,
68942, 68943, 68944, 68945, 68946, 68947, 68948, 68949, 68950,
68951, 68952, 68953, 68954, 68955, 68956, 68957, 68958, 68959,
68960, 68961, 68962, 68963, 68964, 68965, 68966, 68967, 68968,
68969, 68970, 68971, 68972, 68973, 68974, 68975, 68976, 68977,
68978, 68979, 68980, 68981, 68982, 68983, 68984, 68985, 68986,
68987, 68988, 68989, 68990, 68991, 68992, 68993, 68994, 68995,
68996, 68997, 68998, 68999, 69000, 69001, 69002, 69003, 69004,
69005, 69006, 69007, 69008, 69009, 69010, 69011, 69012, 69013,
69014, 69015, 69016, 69017, 69018, 69019, 69020, 69021, 69022,
69023, 69024, 69025, 69026, 69027, 69028, 69029, 69030, 69031,
69032, 69033, 69034, 69035, 69036, 69037, 69038, 69039, 69040,
69041, 69042, 69043, 69044, 69045, 69046, 69047, 69048, 69049,
69050, 69051, 69052, 69053, 69054, 69055, 69056, 69057, 69058,
69059, 69060, 69061, 69062, 69063, 69064, 69065, 69066, 69067,
69068, 69069, 69070, 69071, 69072, 69073, 69074, 69075, 69076,
69077, 69078, 69079, 69080, 69081, 69082, 69083, 69084, 69085,
69086, 69087, 69088, 69089, 69090, 69091, 69092, 69093, 69094,
69095, 69096, 69097, 69098, 69099, 69100, 69101, 69102, 69103,
69104, 69105, 69106, 69107, 69108, 69109, 69110, 69111, 69112,
69113, 69114, 69115, 69116, 69117, 69118, 69119, 69120, 69121,
69122, 69123, 69124, 69125, 69126, 69127, 69128, 69129, 69130,
69131, 69132, 69133, 69134, 69135, 69136, 69137, 69138, 69139,
69140, 69141, 69142, 69143, 69144, 69145, 69146, 69147, 69148,
69149, 69150, 69151, 69152, 69153, 69154, 69155, 69156, 69157,
69158, 69159, 69160, 69161, 69162, 69163, 69164, 69165, 69166,
69167, 69168, 69169, 69170, 69171, 69172, 69173, 69174, 69175,
69176, 69177, 69178, 69179, 69180, 69181, 69182, 69183, 69184,
69185, 69186, 69187, 69188, 69189, 69190, 69191, 69192, 69193,
69194, 69195, 69196, 69197, 69198, 69199, 69200, 69201, 69202,
69203, 69204, 69205, 69206, 69207, 69208, 69209, 69210, 69211,
69212, 69213, 69214, 69215, 69216, 69217, 69218, 69219, 69220,
69221, 69222, 69223, 69224, 69225, 69226, 69227, 69228, 69229,
69230, 69231, 69232, 69233, 69234, 69235, 69236, 69237, 69238,
69239, 69240, 69241, 69242, 69243, 69244, 69245, 69246, 69247,
69248, 69249, 69250, 69251, 69252, 69253, 69254, 69255, 69256,
69257, 69258, 69259, 69260, 69261, 69262, 69263, 69264, 69265,
69266, 69267, 69268, 69269, 69270, 69271, 69272, 69273, 69274,
69275, 69276, 69277, 69278, 69279, 69280, 69281, 69282, 69283,
69284, 69285, 69286, 69287, 69288, 69289, 69290, 69291, 69292,
69293, 69294, 69295, 69296, 69297, 69298, 69299, 69300, 69301,
69302, 69303, 69304, 69305, 69306, 69307, 69308, 69309, 69310,
69311, 69312, 69313, 69314, 69315, 69316, 69317, 69318, 69319,
69320, 69321, 69322, 69323, 69324, 69325, 69326, 69327, 69328,
69329, 69330, 69331, 69332, 69333, 69334, 69335, 69336, 69337,
69338, 69339, 69340, 69341, 69342, 69343, 69344, 69345, 69346,
69347, 69348, 69349, 69350, 69351, 69352, 69353, 69354, 69355,
69356, 69357, 69358, 69359, 69360, 69361, 69362, 69363, 69364,
69365, 69366, 69367, 69368, 69369, 69370, 69371, 69372, 69373,
69374, 69375, 69376, 69377, 69378, 69379, 69380, 69381, 69382,
69383, 69384, 69385, 69386, 69387, 69388, 69389, 69390, 69391,
69392, 69393, 69394, 69395, 69396, 69397, 69398, 69399, 69400,
69401, 69402, 69403, 69404, 69405, 69406, 69407, 69408, 69409,
69410, 69411, 69412, 69413, 69414, 69415, 69416, 69417, 69418,
69419, 69420, 69421, 69422, 69423, 69424, 69425, 69426, 69427,
69428, 69429, 69430, 69431, 69432, 69433, 69434, 69435, 69436,
69437, 69438, 69439, 69440, 69441, 69442, 69443, 69444, 69445,
69446, 69447, 69448, 69449, 69450, 69451, 69452, 69453, 69454,
69455, 69456, 69457, 69458, 69459, 69460, 69461, 69462, 69463,
69464, 69465, 69466, 69467, 69468, 69469, 69470, 69471, 69472,
69473, 69474, 69475, 69476, 69477, 69478, 69479, 69480, 69481,
69482, 69483, 69484, 69485, 69486, 69487, 69488, 69489, 69490,
69491, 69492, 69493, 69494, 69495, 69496, 69497, 69498, 69499,
69500, 69501, 69502, 69503, 69504, 69505, 69506, 69507, 69508,
69509, 69510, 69511, 69512, 69513, 69514, 69515, 69516, 69517,
69518, 69519, 69520, 69521, 69522, 69523, 69524, 69525, 69526,
69527, 69528, 69529, 69530, 69531, 69532, 69533, 69534, 69535,
69536, 69537, 69538, 69539, 69540, 69541, 69542, 69543, 69544,
69545, 69546, 69547, 69548, 69549, 69550, 69551, 69552, 69553,
69554, 69555, 69556, 69557, 69558, 69559, 69560, 69561, 69562,
69563, 69564, 69565, 69566, 69567, 69568, 69569, 69570, 69571,
69572, 69573, 69574, 69575, 69576, 69577, 69578, 69579, 69580,
69581, 69582, 69583, 69584, 69585, 69586, 69587, 69588, 69589,
69590, 69591, 69592, 69593, 69594, 69595, 69596, 69597, 69598,
69599, 69600, 69601, 69602, 69603, 69604, 69605, 69606, 69607,
69608, 69609, 69610, 69611, 69612, 69613, 69614, 69615, 69616,
69617, 69618, 69619, 69620, 69621, 69622, 69623, 69624, 69625,
69626, 69627, 69628, 69629, 69630, 69631, 69632, 69633, 69634,
69635, 69636, 69637, 69638, 69639, 69640, 69641, 69642, 69643,
69644, 69645, 69646, 69647, 69648, 69649, 69650, 69651, 69652,
69653, 69654, 69655, 69656, 69657, 69658, 69659, 69660, 69661,
69662, 69663, 69664, 69665, 69666, 69667, 69668, 69669, 69670,
69671, 69672, 69673, 69674, 69675, 69676, 69677, 69678, 69679,
69680, 69681, 69682, 69683, 69684, 69685, 69686, 69687, 69688,
69689, 69690, 69691, 69692, 69693, 69694, 69695, 69696, 69697,
69698, 69699, 69700, 69701, 69702, 69703, 69704, 69705, 69706,
69707, 69708, 69709, 69710, 69711, 69712, 69713, 69714, 69715,
69716, 69717, 69718, 69719, 69720, 69721, 69722, 69723, 69724,
69725, 69726, 69727, 69728, 69729, 69730, 69731, 69732, 69733,
69734, 69735, 69736, 69737, 69738, 69739, 69740, 69741, 69742,
69743, 69744, 69745, 69746, 69747, 69748, 69749, 69750, 69751,
69752, 69753, 69754, 69755, 69756, 69757, 69758, 69759, 69760,
69761, 69762, 69763, 69764, 69765, 69766, 69767, 69768, 69769,
69770, 69771, 69772, 69773, 69774, 69775, 69776, 69777, 69778,
69779, 69780, 69781, 69782, 69783, 69784, 69785, 69786, 69787,
69788, 69789, 69790, 69791, 69792, 69793, 69794, 69795, 69796,
69797, 69798, 69799, 69800, 69801, 69802, 69803, 69804, 69805,
69806, 69807, 69808, 69809, 69810, 69811, 69812, 69813, 69814,
69815, 69816, 69817, 69818, 69819, 69820, 69821, 69822, 69823,
69824, 69825, 69826, 69827, 69828, 69829, 69830, 69831, 69832,
69833, 69834, 69835, 69836, 69837, 69838, 69839, 69840, 69841,
69842, 69843, 69844, 69845, 69846, 69847, 69848, 69849, 69850,
69851, 69852, 69853, 69854, 69855, 69856, 69857, 69858, 69859,
69860, 69861, 69862, 69863, 69864, 69865, 69866, 69867, 69868,
69869, 69870, 69871, 69872, 69873, 69874, 69875, 69876, 69877,
69878, 69879, 69880, 69881, 69882, 69883, 69884, 69885, 69886,
69887, 69888, 69889, 69890, 69891, 69892, 69893, 69894, 69895,
69896, 69897, 69898, 69899, 69900, 69901, 69902, 69903, 69904,
69905, 69906, 69907, 69908, 69909, 69910, 69911, 69912, 69913,
69914, 69915, 69916, 69917, 69918, 69919, 69920, 69921, 69922,
69923, 69924, 69925, 69926, 69927, 69928, 69929, 69930, 69931,
69932, 69933, 69934, 69935, 69936, 69937, 69938, 69939, 69940,
69941, 69942, 69943, 69944, 69945, 69946, 69947, 69948, 69949,
69950, 69951, 69952, 69953, 69954, 69955, 69956, 69957, 69958,
69959, 69960, 69961, 69962, 69963, 69964, 69965, 69966, 69967,
69968, 69969, 69970, 69971, 69972, 69973, 69974, 69975, 69976,
69977, 69978, 69979, 69980, 69981, 69982, 69983, 69984, 69985,
69986, 69987, 69988, 69989, 69990, 69991, 69992, 69993, 69994,
69995, 69996, 69997, 69998, 69999, 70000, 70001, 70002, 70003,
70004, 70005, 70006, 70007, 70008, 70009, 70010, 70011, 70012,
70013, 70014, 70015, 70016, 70017, 70018, 70019, 70020, 70021,
70022, 70023, 70024, 70025, 70026, 70027, 70028, 70029, 70030,
70031, 70032, 70033, 70034, 70035, 70036, 70037, 70038, 70039,
70040, 70041, 70042, 70043, 70044, 70045, 70046, 70047, 70048,
70049, 70050, 70051, 70052, 70053, 70054, 70055, 70056, 70057,
70058, 70059, 70060, 70061, 70062, 70063, 70064, 70065, 70066,
70067, 70068, 70069, 70070, 70071, 70072, 70073, 70074, 70075,
70076, 70077, 70078, 70079, 70080, 70081, 70082, 70083, 70084,
70085, 70086, 70087, 70088, 70089, 70090, 70091, 70092, 70093,
70094, 70095, 70096, 70097, 70098, 70099, 70100, 70101, 70102,
70103, 70104, 70105, 70106, 70107, 70108, 70109, 70110, 70111,
70112, 70113, 70114, 70115, 70116, 70117, 70118, 70119, 70120,
70121, 70122, 70123, 70124, 70125, 70126, 70127, 70128, 70129,
70130, 70131, 70132, 70133, 70134, 70135, 70136, 70137, 70138,
70139, 70140, 70141, 70142, 70143, 70144, 70145, 70146, 70147,
70148, 70149, 70150, 70151, 70152, 70153, 70154, 70155, 70156,
70157, 70158, 70159, 70160, 70161, 70162, 70163, 70164, 70165,
70166, 70167, 70168, 70169, 70170, 70171, 70172, 70173, 70174,
70175, 70176, 70177, 70178, 70179, 70180, 70181, 70182, 70183,
70184, 70185, 70186, 70187, 70188, 70189, 70190, 70191, 70192,
70193, 70194, 70195, 70196, 70197, 70198, 70199, 70200, 70201,
70202, 70203, 70204, 70205, 70206, 70207, 70208, 70209, 70210,
70211, 70212, 70213, 70214, 70215, 70216, 70217, 70218, 70219,
70220, 70221, 70222, 70223, 70224, 70225, 70226, 70227, 70228,
70229, 70230, 70231, 70232, 70233, 70234, 70235, 70236, 70237,
70238, 70239, 70240, 70241, 70242, 70243, 70244, 70245, 70246,
70247, 70248, 70249, 70250, 70251, 70252, 70253, 70254, 70255,
70256, 70257, 70258, 70259, 70260, 70261, 70262, 70263, 70264,
70265, 70266, 70267, 70268, 70269, 70270, 70271, 70272, 70273,
70274, 70275, 70276, 70277, 70278, 70279, 70280, 70281, 70282,
70283, 70284, 70285, 70286, 70287, 70288, 70289, 70290, 70291,
70292, 70293, 70294, 70295, 70296, 70297, 70298, 70299, 70300,
70301, 70302, 70303, 70304, 70305, 70306, 70307, 70308, 70309,
70310, 70311, 70312, 70313, 70314, 70315, 70316, 70317, 70318,
70319, 70320, 70321, 70322, 70323, 70324, 70325, 70326, 70327,
70328, 70329, 70330, 70331, 70332, 70333, 70334, 70335, 70336,
70337, 70338, 70339, 70340, 70341, 70342, 70343, 70344, 70345,
70346, 70347, 70348, 70349, 70350, 70351, 70352, 70353, 70354,
70355, 70356, 70357, 70358, 70359, 70360, 70361, 70362, 70363,
70364, 70365, 70366, 70367, 70368, 70369, 70370, 70371, 70372,
70373, 70374, 70375, 70376, 70377, 70378, 70379, 70380, 70381,
70382, 70383, 70384, 70385, 70386, 70387, 70388, 70389, 70390,
70391, 70392, 70393, 70394, 70395, 70396, 70397, 70398, 70399,
70400, 70401, 70402, 70403, 70404, 70405, 70406, 70407, 70408,
70409, 70410, 70411, 70412, 70413, 70414, 70415, 70416, 70417,
70418, 70419, 70420, 70421, 70422, 70423, 70424, 70425, 70426,
70427, 70428, 70429, 70430, 70431, 70432, 70433, 70434, 70435,
70436, 70437, 70438, 70439, 70440, 70441, 70442, 70443, 70444,
70445, 70446, 70447, 70448, 70449, 70450, 70451, 70452, 70453,
70454, 70455, 70456, 70457, 70458, 70459, 70460, 70461, 70462,
70463, 70464, 70465, 70466, 70467, 70468, 70469, 70470, 70471,
70472, 70473, 70474, 70475, 70476, 70477, 70478, 70479, 70480,
70481, 70482, 70483, 70484, 70485, 70486, 70487, 70488, 70489,
70490, 70491, 70492, 70493, 70494, 70495, 70496, 70497, 70498,
70499, 70500, 70501, 70502, 70503, 70504, 70505, 70506, 70507,
70508, 70509, 70510, 70511, 70512, 70513, 70514, 70515, 70516,
70517, 70518, 70519, 70520, 70521, 70522, 70523, 70524, 70525,
70526, 70527, 70528, 70529, 70530, 70531, 70532, 70533, 70534,
70535, 70536, 70537, 70538, 70539, 70540, 70541, 70542, 70543,
70544, 70545, 70546, 70547, 70548, 70549, 70550, 70551, 70552,
70553, 70554, 70555, 70556, 70557, 70558, 70559, 70560, 70561,
70562, 70563, 70564, 70565, 70566, 70567, 70568, 70569, 70570,
70571, 70572, 70573, 70574, 70575, 70576, 70577, 70578, 70579,
70580, 70581, 70582, 70583, 70584, 70585, 70586, 70587, 70588,
70589, 70590, 70591, 70592, 70593, 70594, 70595, 70596, 70597,
70598, 70599, 70600, 70601, 70602, 70603, 70604, 70605, 70606,
70607, 70608, 70609, 70610, 70611, 70612, 70613, 70614, 70615,
70616, 70617, 70618, 70619, 70620, 70621, 70622, 70623, 70624,
70625, 70626, 70627, 70628, 70629, 70630, 70631, 70632, 70633,
70634, 70635, 70636, 70637, 70638, 70639, 70640, 70641, 70642,
70643, 70644, 70645, 70646, 70647, 70648, 70649, 70650, 70651,
70652, 70653, 70654, 70655, 70656, 70657, 70658, 70659, 70660,
70661, 70662, 70663, 70664, 70665, 70666, 70667, 70668, 70669,
70670, 70671, 70672, 70673, 70674, 70675, 70676, 70677,
70678, 70679, 70680, 70681, 70682, 70683, 70684, 70685, 70686,
70687, 70688, 70689, 70690, 70691, 70692, 70693, 70694, 70695,
70696, 70697, 70698, 70699, 70700, 70701, 70702, 70703, 70704,
70705, 70706, 70707, 70708, 70709, 70710, 70711, 70712, 70713,
70714, 70715, 70716, 70717, 70718, 70719, 70720, 70721, 70722,
70723, 70724, 70725, 70726, 70727, 70728, 70729, 70730, 70731,
70732, 70733, 70734, 70735, 70736, 70737, 70738, 70739, 70740,
70741, 70742, 70743, 70744, 70745, 70746, 70747, 70748, 70749,
70750, 70751, 70752, 70753, 70754, 70755, 70756, 70757, 70758,
70759, 70760, 70761, 70762, 70763, 70764, 70765, 70766, 70767,
70768, 70769, 70770, 70771, 70772, 70773, 70774, 70775, 70776,
70777, 70778, 70779, 70780, 70781, 70782, 70783, 70784, 70785,
70786, 70787, 70788, 70789, 70790, 70791, 70792, 70793, 70794,
70795, 70796, 70797, 70798, 70799, 70800, 70801, 70802, 70803,
70804, 70805, 70806, 70807, 70808, 70809, 70810, 70811, 70812,
70813, 70814, 70815, 70816, 70817, 70818, 70819, 70820, 70821,
70822, 70823, 70824, 70825, 70826, 70827, 70828, 70829, 70830,
70831, 70832, 70833, 70834, 70835, 70836, 70837, 70838, 70839,
70840, 70841, 70842, 70843, 70844, 70845, 70846, 70847, 70848,
70849, 70850, 70851, 70852, 70853, 70854, 70855, 70856, 70857,
70858, 70859, 70860, 70861, 70862, 70863, 70864, 70865, 70866,
70867, 70868, 70869, 70870, 70871, 70872, 70873, 70874, 70875,
70876, 70877, 70878, 70879, 70880, 70881, 70882, 70883, 70884,
70885, 70886, 70887, 70888, 70889, 70890, 70891, 70892, 70893,
70894, 70895, 70896, 70897, 70898, 70899, 70900, 70901, 70902,
70903, 70904, 70905, 70906, 70907, 70908, 70909, 70910, 70911,
70912, 70913, 70914, 70915, 70916, 70917, 70918, 70919, 70920,
70921, 70922, 70923, 70924, 70925, 70926, 70927, 70928, 70929,
70930, 70931, 70932, 70933, 70934, 70935, 70936, 70937, 70938,
70939, 70940, 70941, 70942, 70943, 70944, 70945, 70946, 70947,
70948, 70949, 70950, 70951, 70952, 70953, 70954, 70955, 70956,
70957, 70958, 70959, 70960, 70961, 70962, 70963, 70964, 70965,
70966, 70967, 70968, 70969, 70970, 70971, 70972, 70973, 70974,
70975, 70976, 70977, 70978, 70979, 70980, 70981, 70982, 70983,
70984, 70985, 70986, 70987, 70988, 70989, 70990, 70991, 70992,
70993, 70994, 70995, 70996, 70997, 70998, 70999, 71000, 71001,
71002, 71003, 71004, 71005. The term "identity" as known in the
art, refers to a relationship between the sequences of two or more
peptides, as determined by comparing the sequences. In the art,
identity also means the degree of sequence relatedness between
peptides, as determined by the number of matches between strings of
two or more amino acid residues. Identity measures the percent of
identical matches between the smaller of two or more sequences with
gap alignments (if any) addressed by a particular mathematical
model or computer program (i.e., "algorithms"). Identity of related
peptides can be readily calculated by known methods. Such methods
include, but are not limited to, those described in Computational
Molecular Biology, Lesk, A. M., ed., Oxford University Press, New
York, 1988; Biocomputing: Informatics and Genome Projects, Smith,
D. W., ed., Academic Press, New York, 1993; Computer Analysis of
Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds.,
Humana Press, New Jersey, 1994; Sequence Analysis in Molecular
Biology, von Heinje, G., Academic Press, 1987; Sequence Analysis
Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New
York, 1991; and Carillo et al., SIAM J. Applied Math. 48, 1073
(1988).
[0096] In some embodiments, the polypeptide variant may have the
same or a similar activity as the reference polypeptide.
Alternatively, the variant may have an altered activity (e.g.,
increased or decreased) relative to a reference polypeptide.
Generally, variants of a particular polynucleotide or polypeptide
of the invention will have at least about 40%, 45%, 50%, 55%, 60%,
65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%,
98%, 99% but less than 100% sequence identity to that particular
reference polynucleotide or polypeptide as determined by sequence
alignment programs and parameters described herein and known to
those skilled in the art. Such tools for alignment include those of
the BLAST suite (Stephen F. Altschul, Thomas L. Madden, Alejandro
A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res.
25:3389-3402.) Other tools are described herein, specifically in
the definition of "Identity."
[0097] Default parameters in the BLAST algorithm include, for
example, an expect threshold of 10, Word size of 28, Match/Mismatch
Scores 1, -2, Gap costs Linear. Any filter can be applied as well
as a selection for species specific repeats, e.g., Homo
sapiens.
Biologics
[0098] The polynucleotides, primary constructs or mmRNA disclosed
herein, may encode one or more biologics. As used herein, a
"biologic" is a polypeptide-based molecule produced by the methods
provided herein and which may be used to treat, cure, mitigate,
prevent, or diagnose a serious or life-threatening disease or
medical condition. Biologics, according to the present invention
include, but are not limited to, allergenic extracts (e.g. for
allergy shots and tests), blood components, gene therapy products,
human tissue or cellular products used in transplantation,
vaccines, monoclonal antibodies, cytokines, growth factors,
enzymes, thrombolytics, and immunomodulators, among others.
[0099] According to the present invention, one or more biologics
currently being marketed or in development may be encoded by the
polynucleotides, primary constructs or mmRNA of the present
invention. While not wishing to be bound by theory, it is believed
that incorporation of the encoding polynucleotides of a known
biologic into the primary constructs or mmRNA of the invention will
result in improved therapeutic efficacy due at least in part to the
specificity, purity and/or selectivity of the construct
designs.
Antibodies
[0100] The primary constructs or mmRNA disclosed herein, may encode
one or more antibodies or fragments thereof. The term "antibody"
includes monoclonal antibodies (including full length antibodies
which have an immunoglobulin Fc region), antibody compositions with
polyepitopic specificity, multispecific antibodies (e.g.,
bispecific antibodies, diabodies, and single-chain molecules), as
well as antibody fragments. The term "immunoglobulin" (Ig) is used
interchangeably with "antibody" herein. As used herein, the term
"monoclonal antibody" refers to an antibody obtained from a
population of substantially homogeneous antibodies, i.e., the
individual antibodies comprising the population are identical
except for possible naturally occurring mutations and/or
post-translation modifications (e.g., isomerizations, amidations)
that may be present in minor amounts. Monoclonal antibodies are
highly specific, being directed against a single antigenic
site.
[0101] The monoclonal antibodies herein specifically include
"chimeric" antibodies (immunoglobulins) in which a portion of the
heavy and/or light chain is identical with or homologous to
corresponding sequences in antibodies derived from a particular
species or belonging to a particular antibody class or subclass,
while the remainder of the chain(s) is(are) identical with or
homologous to corresponding sequences in antibodies derived from
another species or belonging to another antibody class or subclass,
as well as fragments of such antibodies, so long as they exhibit
the desired biological activity. Chimeric antibodies of interest
herein include, but are not limited to, "primatized" antibodies
comprising variable domain antigen-binding sequences derived from a
non-human primate (e.g., Old World Monkey, Ape etc.) and human
constant region sequences.
[0102] An "antibody fragment" comprises a portion of an intact
antibody, preferably the antigen binding and/or the variable region
of the intact antibody. Examples of antibody fragments include Fab,
Fab', F(ab').sub.2 and Fv fragments; diabodies; linear antibodies;
nanobodies; single-chain antibody molecules and multispecific
antibodies formed from antibody fragments.
[0103] Any of the five classes of immunoglobulins, IgA, IgD, IgE,
IgG and IgM, may be encoded by the mmRNA of the invention,
including the heavy chains designated alpha, delta, epsilon, gamma
and mu, respectively. Also included are polynucleotide sequences
encoding the subclasses, gamma and mu. Hence any of the subclasses
of antibodies may be encoded in part or in whole and include the
following subclasses: IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2.
[0104] According to the present invention, one or more antibodies
or fragments currently being marketed or in development may be
encoded by the polynucleotides, primary constructs or mmRNA of the
present invention. While not wishing to be bound by theory, it is
believed that incorporation into the primary constructs of the
invention will result in improved therapeutic efficacy due at least
in part to the specificity, purity and selectivity of the mmRNA
designs.
[0105] Antibodies encoded in the polynucleotides, primary
constructs or mmRNA of the invention may be utilized to treat
conditions or diseases in many therapeutic areas such as, but not
limited to, blood, cardiovascular, CNS, poisoning (including
antivenoms), dermatology, endocrinology, gastrointestinal, medical
imaging, musculoskeletal, oncology, immunology, respiratory,
sensory and anti-infective.
[0106] In one embodiment, primary constructs or mmRNA disclosed
herein may encode monoclonal antibodies and/or variants thereof.
Variants of antibodies may also include, but are not limited to,
substitutional variants, conservative amino acid substitution,
insertional variants, deletional variants and/or covalent
derivatives. In one embodiment, the primary construct and/or mmRNA
disclosed herein may encode an immunoglobulin Fc region. In another
embodiment, the primary constructs and/or mmRNA may encode a
variant immunoglobulin Fc region. As a non-limiting example, the
primary constructs and/or mmRNA may encode an antibody having a
variant immunoglobulin Fc region as described in U.S. Pat. No.
8,217,147 herein incorporated by reference in its entirety.
Vaccines
[0107] The primary constructs or mmRNA disclosed herein, may encode
one or more vaccines. As used herein, a "vaccine" is a biological
preparation that improves immunity to a particular disease or
infectious agent. According to the present invention, one or more
vaccines currently being marketed or in development may be encoded
by the polynucleotides, primary constructs or mmRNA of the present
invention. While not wishing to be bound by theory, it is believed
that incorporation into the primary constructs or mmRNA of the
invention will result in improved therapeutic efficacy due at least
in part to the specificity, purity and selectivity of the construct
designs.
[0108] Vaccines encoded in the polynucleotides, primary constructs
or mmRNA of the invention may be utilized to treat conditions or
diseases in many therapeutic areas such as, but not limited to,
cardiovascular, CNS, dermatology, endocrinology, oncology,
immunology, respiratory, and anti-infective.
Therapeutic Proteins or Peptides
[0109] The primary constructs or mmRNA disclosed herein, may encode
one or more validated or "in testing" therapeutic proteins or
peptides.
[0110] According to the present invention, one or more therapeutic
proteins or peptides currently being marketed or in development may
be encoded by the polynucleotides, primary constructs or mmRNA of
the present invention. While not wishing to be bound by theory, it
is believed that incorporation into the primary constructs or mmRNA
of the invention will result in improved therapeutic efficacy due
at least in part to the specificity, purity and selectivity of the
construct designs.
[0111] Therapeutic proteins and peptides encoded in the
polynucleotides, primary constructs or mmRNA of the invention may
be utilized to treat conditions or diseases in many therapeutic
areas such as, but not limited to, blood, cardiovascular, CNS,
poisoning (including antivenoms), dermatology, endocrinology,
genetic, genitourinary, gastrointestinal, musculoskeletal,
oncology, and immunology, respiratory, sensory and
anti-infective.
Cell-Penetrating Polypeptides
[0112] The primary constructs or mmRNA disclosed herein, may encode
one or more cell-penetrating polypeptides. As used herein,
"cell-penetrating polypeptide" or CPP refers to a polypeptide which
may facilitate the cellular uptake of molecules. A cell-penetrating
polypeptide of the present invention may contain one or more
detectable labels. The polypeptides may be partially labeled or
completely labeled throughout. The polynucleotide, primary
construct or mmRNA may encode the detectable label completely,
partially or not at all. The cell-penetrating peptide may also
include a signal sequence. As used herein, a "signal sequence"
refers to a sequence of amino acid residues bound at the amino
terminus of a nascent protein during protein translation. The
signal sequence may be used to signal the secretion of the
cell-penetrating polypeptide.
[0113] In one embodiment, the polynucleotides, primary constructs
or mmRNA may also encode a fusion protein. The fusion protein may
be created by operably linking a charged protein to a therapeutic
protein. As used herein, "operably linked" refers to the
therapeutic protein and the charged protein being connected in such
a way to permit the expression of the complex when introduced into
the cell. As used herein, "charged protein" refers to a protein
that carries a positive, negative or overall neutral electrical
charge. Preferably, the therapeutic protein may be covalently
linked to the charged protein in the formation of the fusion
protein. The ratio of surface charge to total or surface amino
acids may be approximately 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8
or 0.9.
[0114] The cell-penetrating polypeptide encoded by the
polynucleotides, primary constructs or mmRNA may form a complex
after being translated. The complex may comprise a charged protein
linked, e.g. covalently linked, to the cell-penetrating
polypeptide. "Therapeutic protein" refers to a protein that, when
administered to a cell has a therapeutic, diagnostic, and/or
prophylactic effect and/or elicits a desired biological and/or
pharmacological effect.
[0115] In one embodiment, the cell-penetrating polypeptide may
comprise a first domain and a second domain. The first domain may
comprise a supercharged polypeptide. The second domain may comprise
a protein-binding partner. As used herein, "protein-binding
partner" includes, but is not limited to, antibodies and functional
fragments thereof, scaffold proteins, or peptides. The
cell-penetrating polypeptide may further comprise an intracellular
binding partner for the protein-binding partner. The
cell-penetrating polypeptide may be capable of being secreted from
a cell where the polynucleotide, primary construct or mmRNA may be
introduced. The cell-penetrating polypeptide may also be capable of
penetrating the first cell.
[0116] In a further embodiment, the cell-penetrating polypeptide is
capable of penetrating a second cell. The second cell may be from
the same area as the first cell, or it may be from a different
area. The area may include, but is not limited to, tissues and
organs. The second cell may also be proximal or distal to the first
cell.
[0117] In one embodiment, the polynucleotides, primary constructs
or mmRNA may encode a cell-penetrating polypeptide which may
comprise a protein-binding partner. The protein binding partner may
include, but is not limited to, an antibody, a supercharged
antibody or a functional fragment. The polynucleotides, primary
constructs or mmRNA may be introduced into the cell where a
cell-penetrating polypeptide comprising the protein-binding partner
is introduced.
Secreted Proteins
[0118] Human and other eukaryotic cells are subdivided by membranes
into many functionally distinct compartments. Each membrane-bounded
compartment, or organelle, contains different proteins essential
for the function of the organelle. The cell uses "sorting signals,"
which are amino acid motifs located within the protein, to target
proteins to particular cellular organelles.
[0119] One type of sorting signal, called a signal sequence, a
signal peptide, or a leader sequence, directs a class of proteins
to an organelle called the endoplasmic reticulum (ER).
[0120] Proteins targeted to the ER by a signal sequence can be
released into the extracellular space as a secreted protein.
Similarly, proteins residing on the cell membrane can also be
secreted into the extracellular space by proteolytic cleavage of a
"linker" holding the protein to the membrane. While not wishing to
be bound by theory, the molecules of the present invention may be
used to exploit the cellular trafficking described above. As such,
in some embodiments of the invention, polynucleotides, primary
constructs or mmRNA are provided to express a secreted protein. The
secreted proteins may be selected from those described herein or
those in US Patent Publication, 20100255574, the contents of which
are incorporated herein by reference in their entirety.
[0121] In one embodiment, these may be used in the manufacture of
large quantities of valuable human gene products.
Plasma Membrane Proteins
[0122] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a protein of
the plasma membrane.
Cytoplasmic or Cytoskeletal Proteins
[0123] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a cytoplasmic
or cytoskeletal protein.
Intracellular Membrane Bound Proteins
[0124] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express an
intracellular membrane bound protein.
Nuclear Proteins
[0125] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a nuclear
protein.
Proteins Associated with Human Disease
[0126] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a protein
associated with human disease.
Miscellaneous Proteins
[0127] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a protein with
a presently unknown therapeutic function.
Targeting Moieties
[0128] In some embodiments of the invention, polynucleotides,
primary constructs or mmRNA are provided to express a targeting
moiety. These include a protein-binding partner or a receptor on
the surface of the cell, which functions to target the cell to a
specific tissue space or to interact with a specific moiety, either
in vivo or in vitro. Suitable protein-binding partners include, but
are not limited to, antibodies and functional fragments thereof,
scaffold proteins, or peptides. Additionally, polynucleotide,
primary construct or mmRNA can be employed to direct the synthesis
and extracellular localization of lipids, carbohydrates, or other
biological moieties or biomolecules.
Polypeptide Libraries
[0129] In one embodiment, the polynucleotides, primary constructs
or mmRNA may be used to produce polypeptide libraries. These
libraries may arise from the production of a population of
polynucleotides, primary constructs or mmRNA, each containing
various structural or chemical modification designs. In this
embodiment, a population of polynucleotides, primary constructs or
mmRNA may comprise a plurality of encoded polypeptides, including
but not limited to, an antibody or antibody fragment, protein
binding partner, scaffold protein, and other polypeptides taught
herein or known in the art. In a preferred embodiment, the
polynucleotides are primary constructs of the present invention,
including mmRNA which may be suitable for direct introduction into
a target cell or culture which in turn may synthesize the encoded
polypeptides.
[0130] In certain embodiments, multiple variants of a protein, each
with different amino acid modification(s), may be produced and
tested to determine the best variant in terms of pharmacokinetics,
stability, biocompatibility, and/or biological activity, or a
biophysical property such as expression level. Such a library may
contain 10, 10.sup.2, 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6,
10.sup.7, 10.sup.8, 10.sup.9, or over 10.sup.9 possible variants
(including, but not limited to, substitutions, deletions of one or
more residues, and insertion of one or more residues).
Anti-Microbial and Anti-Viral Polypeptides
[0131] The polynucleotides, primary constructs and mmRNA of the
present invention may be designed to encode on or more
antimicrobial peptides (AMP) or antiviral peptides (AVP). AMPs and
AVPs have been isolated and described from a wide range of animals
such as, but not limited to, microorganisms, invertebrates, plants,
amphibians, birds, fish, and mammals (Wang et al., Nucleic Acids
Res. 2009; 37 (Database issue):D933-7). For example, anti-microbial
polypeptides are described in Antimicrobial Peptide Database
(http://aps.unmc.edu/AP/main.php; Wang et al., Nucleic Acids Res.
2009; 37 (Database issue):D933-7), CAMP: Collection of
Anti-Microbial Peptides
(http://www.bicnirrh.res.in/antimicrobial/); Thomas et al., Nucleic
Acids Res. 2010; 38 (Database issue):D774-80), U.S. Pat. No.
5,221,732, U.S. Pat. No. 5,447,914, U.S. Pat. No. 5,519,115, U.S.
Pat. No. 5,607,914, U.S. Pat. No. 5,714,577, U.S. Pat. No.
5,734,015, U.S. Pat. No. 5,798,336, U.S. Pat. No. 5,821,224, U.S.
Pat. No. 5,849,490, U.S. Pat. No. 5,856,127, U.S. Pat. No.
5,905,187, U.S. Pat. No. 5,994,308, U.S. Pat. No. 5,998,374, U.S.
Pat. No. 6,107,460, U.S. Pat. No. 6,191,254, U.S. Pat. No.
6,211,148, U.S. Pat. No. 6,300,489, U.S. Pat. No. 6,329,504, U.S.
Pat. No. 6,399,370, U.S. Pat. No. 6,476,189, U.S. Pat. No.
6,478,825, U.S. Pat. No. 6,492,328, U.S. Pat. No. 6,514,701, U.S.
Pat. No. 6,573,361, U.S. Pat. No. 6,573,361, U.S. Pat. No.
6,576,755, U.S. Pat. No. 6,605,698, U.S. Pat. No. 6,624,140, U.S.
Pat. No. 6,638,531, U.S. Pat. No. 6,642,203, U.S. Pat. No.
6,653,280, U.S. Pat. No. 6,696,238, U.S. Pat. No. 6,727,066, U.S.
Pat. No. 6,730,659, U.S. Pat. No. 6,743,598, U.S. Pat. No.
6,743,769, U.S. Pat. No. 6,747,007, U.S. Pat. No. 6,790,833, U.S.
Pat. No. 6,794,490, U.S. Pat. No. 6,818,407, U.S. Pat. No.
6,835,536, U.S. Pat. No. 6,835,713, U.S. Pat. No. 6,838,435, U.S.
Pat. No. 6,872,705, U.S. Pat. No. 6,875,907, U.S. Pat. No.
6,884,776, U.S. Pat. No. 6,887,847, U.S. Pat. No. 6,906,035, U.S.
Pat. No. 6,911,524, U.S. Pat. No. 6,936,432, U.S. Pat. No.
7,001,924, U.S. Pat. No. 7,071,293, U.S. Pat. No. 7,078,380, U.S.
Pat. No. 7,091,185, U.S. Pat. No. 7,094,759, U.S. Pat. No.
7,166,769, U.S. Pat. No. 7,244,710, U.S. Pat. No. 7,314,858, and
U.S. Pat. No. 7,582,301, the contents of which are incorporated by
reference in their entirety.
[0132] The anti-microbial polypeptides described herein may block
cell fusion and/or viral entry by one or more enveloped viruses
(e.g., HIV, HCV). For example, the anti-microbial polypeptide can
comprise or consist of a synthetic peptide corresponding to a
region, e.g., a consecutive sequence of at least about 5, 10, 15,
20, 25, 30, 35, 40, 45, 50, 55, or 60 amino acids of the
transmembrane subunit of a viral envelope protein, e.g., HIV-1
gp120 or gp41. The amino acid and nucleotide sequences of HIV-1
gp120 or gp41 are described in, e.g., Kuiken et al., (2008). "HIV
Sequence Compendium," Los Alamos National Laboratory.
[0133] In some embodiments, the anti-microbial polypeptide may have
at least about 75%, 80%, 85%, 90%, 95%, 100% sequence homology to
the corresponding viral protein sequence. In some embodiments, the
anti-microbial polypeptide may have at least about 75%, 80%, 85%,
90%, 95%, or 100% sequence homology to the corresponding viral
protein sequence.
[0134] In other embodiments, the anti-microbial polypeptide may
comprise or consist of a synthetic peptide corresponding to a
region, e.g., a consecutive sequence of at least about 5, 10, 15,
20, 25, 30, 35, 40, 45, 50, 55, or 60 amino acids of the binding
domain of a capsid binding protein. In some embodiments, the
anti-microbial polypeptide may have at least about 75%, 80%, 85%,
90%, 95%, or 100% sequence homology to the corresponding sequence
of the capsid binding protein.
[0135] The anti-microbial polypeptides described herein may block
protease dimerization and inhibit cleavage of viral proproteins
(e.g., HIV Gag-pol processing) into functional proteins thereby
preventing release of one or more enveloped viruses (e.g., HIV,
HCV). In some embodiments, the anti-microbial polypeptide may have
at least about 75%, 80%, 85%, 90%, 95%, 100% sequence homology to
the corresponding viral protein sequence.
[0136] In other embodiments, the anti-microbial polypeptide can
comprise or consist of a synthetic peptide corresponding to a
region, e.g., a consecutive sequence of at least about 5, 10, 15,
20, 25, 30, 35, 40, 45, 50, 55, or 60 amino acids of the binding
domain of a protease binding protein. In some embodiments, the
anti-microbial polypeptide may have at least about 75%, 80%, 85%,
90%, 95%, 100% sequence homology to the corresponding sequence of
the protease binding protein.
[0137] The anti-microbial polypeptides described herein can include
an in vitro-evolved polypeptide directed against a viral
pathogen.
Anti-Microbial Polypeptides
[0138] Anti-microbial polypeptides (AMPs) are small peptides of
variable length, sequence and structure with broad spectrum
activity against a wide range of microorganisms including, but not
limited to, bacteria, viruses, fungi, protozoa, parasites, prions,
and tumor/cancer cells. (See, e.g., Zaiou, J Mol Med, 2007; 85:317;
herein incorporated by reference in its entirety). It has been
shown that AMPs have broad-spectrum of rapid onset of killing
activities, with potentially low levels of induced resistance and
concomitant broad anti-inflammatory effects.
[0139] In some embodiments, the anti-microbial polypeptide (e.g.,
an anti-bacterial polypeptide) may be under 10 kDa, e.g., under 8
kDa, 6 kDa, 4 kDa, 2 kDa, or 1 kDa. In some embodiments, the
anti-microbial polypeptide (e.g., an anti-bacterial polypeptide)
consists of from about 6 to about 100 amino acids, e.g., from about
6 to about 75 amino acids, about 6 to about 50 amino acids, about 6
to about 25 amino acids, about 25 to about 100 amino acids, about
50 to about 100 amino acids, or about 75 to about 100 amino acids.
In certain embodiments, the anti-microbial polypeptide (e.g., an
anti-bacterial polypeptide) may consist of from about 15 to about
45 amino acids. In some embodiments, the anti-microbial polypeptide
(e.g., an anti-bacterial polypeptide) is substantially
cationic.
[0140] In some embodiments, the anti-microbial polypeptide (e.g.,
an anti-bacterial polypeptide) may be substantially amphipathic. In
certain embodiments, the anti-microbial polypeptide (e.g., an
anti-bacterial polypeptide) may be substantially cationic and
amphipathic. In some embodiments, the anti-microbial polypeptide
(e.g., an anti-bacterial polypeptide) may be cytostatic to a
Gram-positive bacterium. In some embodiments, the anti-microbial
polypeptide (e.g., an anti-bacterial polypeptide) may be cytotoxic
to a Gram-positive bacterium. In some embodiments, the
anti-microbial polypeptide (e.g., an anti-bacterial polypeptide)
may be cytostatic and cytotoxic to a Gram-positive bacterium. In
some embodiments, the anti-microbial polypeptide (e.g., an
anti-bacterial polypeptide) may be cytostatic to a Gram-negative
bacterium. In some embodiments, the anti-microbial polypeptide
(e.g., an anti-bacterial polypeptide) may be cytotoxic to a
Gram-negative bacterium. In some embodiments, the anti-microbial
polypeptide (e.g., an anti-bacterial polypeptide) may be cytostatic
and cytotoxic to a Gram-positive bacterium. In some embodiments,
the anti-microbial polypeptide may be cytostatic to a virus,
fungus, protozoan, parasite, prion, or a combination thereof. In
some embodiments, the anti-microbial polypeptide may be cytotoxic
to a virus, fungus, protozoan, parasite, prion, or a combination
thereof. In certain embodiments, the anti-microbial polypeptide may
be cytostatic and cytotoxic to a virus, fungus, protozoan,
parasite, prion, or a combination thereof. In some embodiments, the
anti-microbial polypeptide may be cytotoxic to a tumor or cancer
cell (e.g., a human tumor and/or cancer cell). In some embodiments,
the anti-microbial polypeptide may be cytostatic to a tumor or
cancer cell (e.g., a human tumor and/or cancer cell). In certain
embodiments, the anti-microbial polypeptide may be cytotoxic and
cytostatic to a tumor or cancer cell (e.g., a human tumor or cancer
cell). In some embodiments, the anti-microbial polypeptide (e.g.,
an anti-bacterial polypeptide) may be a secreted polypeptide.
[0141] In some embodiments, the anti-microbial polypeptide
comprises or consists of a defensin. Exemplary defensins include,
but are not limited to, .alpha.-defensins (e.g., neutrophil
defensin 1, defensin alpha 1, neutrophil defensin 3, neutrophil
defensin 4, defensin 5, defensin 6), .beta.-defensins (e.g.,
beta-defensin 1, beta-defensin 2, beta-defensin 103, beta-defensin
107, beta-defensin 110, beta-defensin 136), and .theta.-defensins.
In other embodiments, the anti-microbial polypeptide comprises or
consists of a cathelicidin (e.g., hCAP18).
Anti-Viral Polypeptides
[0142] Anti-viral polypeptides (AVPs) are small peptides of
variable length, sequence and structure with broad spectrum
activity against a wide range of viruses. See, e.g., Zaiou, J Mol
Med, 2007; 85:317. It has been shown that AVPs have a
broad-spectrum of rapid onset of killing activities, with
potentially low levels of induced resistance and concomitant broad
anti-inflammatory effects. In some embodiments, the anti-viral
polypeptide is under 10 kDa, e.g., under 8 kDa, 6 kDa, 4 kDa, 2
kDa, or 1 kDa. In some embodiments, the anti-viral polypeptide
comprises or consists of from about 6 to about 100 amino acids,
e.g., from about 6 to about 75 amino acids, about 6 to about 50
amino acids, about 6 to about 25 amino acids, about 25 to about 100
amino acids, about 50 to about 100 amino acids, or about 75 to
about 100 amino acids. In certain embodiments, the anti-viral
polypeptide comprises or consists of from about 15 to about 45
amino acids. In some embodiments, the anti-viral polypeptide is
substantially cationic. In some embodiments, the anti-viral
polypeptide is substantially amphipathic. In certain embodiments,
the anti-viral polypeptide is substantially cationic and
amphipathic. In some embodiments, the anti-viral polypeptide is
cytostatic to a virus. In some embodiments, the anti-viral
polypeptide is cytotoxic to a virus. In some embodiments, the
anti-viral polypeptide is cytostatic and cytotoxic to a virus. In
some embodiments, the anti-viral polypeptide is cytostatic to a
bacterium, fungus, protozoan, parasite, prion, or a combination
thereof. In some embodiments, the anti-viral polypeptide is
cytotoxic to a bacterium, fungus, protozoan, parasite, prion or a
combination thereof. In certain embodiments, the anti-viral
polypeptide is cytostatic and cytotoxic to a bacterium, fungus,
protozoan, parasite, prion, or a combination thereof. In some
embodiments, the anti-viral polypeptide is cytotoxic to a tumor or
cancer cell (e.g., a human cancer cell). In some embodiments, the
anti-viral polypeptide is cytostatic to a tumor or cancer cell
(e.g., a human cancer cell). In certain embodiments, the anti-viral
polypeptide is cytotoxic and cytostatic to a tumor or cancer cell
(e.g., a human cancer cell). In some embodiments, the anti-viral
polypeptide is a secreted polypeptide.
Cytotoxic Nucleosides
[0143] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the present invention may incorporate one or more
cytotoxic nucleosides. For example, cytotoxic nucleosides may be
incorporated into polynucleotides, primary constructs or mmRNA such
as bifunctional modified RNAs or mRNAs. Cytotoxic nucleoside
anti-cancer agents include, but are not limited to, adenosine
arabinoside, cytarabine, cytosine arabinoside, 5-fluorouracil,
fludarabine, floxuridine, FTORAFUR.RTM. (a combination of tegafur
and uracil), tegafur
((RS)-5-fluoro-1-(tetrahydrofuran-2-yl)pyrimidine-2,4(1H,3H)-dione),
and 6-mercaptopurine.
[0144] A number of cytotoxic nucleoside analogues are in clinical
use, or have been the subject of clinical trials, as anticancer
agents. Examples of such analogues include, but are not limited to,
cytarabine, gemcitabine, troxacitabine, decitabine, tezacitabine,
2'-deoxy-2'-methylidenecytidine (DMDC), cladribine, clofarabine,
5-azacytidine, 4'-thio-aracytidine, cyclopentenylcytosine and
1-(2-C-cyano-2-deoxy-beta-D-arabino-pentofuranosyl)-cytosine.
Another example of such a compound is fludarabine phosphate. These
compounds may be administered systemically and may have side
effects which are typical of cytotoxic agents such as, but not
limited to, little or no specificity for tumor cells over
proliferating normal cells.
[0145] A number of prodrugs of cytotoxic nucleoside analogues are
also reported in the art. Examples include, but are not limited to,
N4-behenoyl-1-beta-D-arabinofuranosylcytosine,
N4-octadecyl-1-beta-D-arabinofuranosylcytosine,
N4-palmitoyl-1-(2-C-cyano-2-deoxy-beta-D-arabino-pentofuranosyl)
cytosine, and P-4055 (cytarabine 5'-elaidic acid ester). In
general, these prodrugs may be converted into the active drugs
mainly in the liver and systemic circulation and display little or
no selective release of active drug in the tumor tissue. For
example, capecitabine, a prodrug of 5'-deoxy-5-fluorocytidine (and
eventually of 5-fluorouracil), is metabolized both in the liver and
in the tumor tissue. A series of capecitabine analogues containing
"an easily hydrolysable radical under physiological conditions" has
been claimed by Fujiu et al. (U.S. Pat. No. 4,966,891) and is
herein incorporated by reference. The series described by Fujiu
includes N4 alkyl and aralkyl carbamates of
5'-deoxy-5-fluorocytidine and the implication that these compounds
will be activated by hydrolysis under normal physiological
conditions to provide 5'-deoxy-5-fluorocytidine.
[0146] A series of cytarabine N4-carbamates has been by reported by
Fadl et al (Pharmazie. 1995, 50, 382-7, herein incorporated by
reference) in which compounds were designed to convert into
cytarabine in the liver and plasma. WO 2004/041203, herein
incorporated by reference, discloses prodrugs of gemcitabine, where
some of the prodrugs are N4-carbamates. These compounds were
designed to overcome the gastrointestinal toxicity of gemcitabine
and were intended to provide gemcitabine by hydrolytic release in
the liver and plasma after absorption of the intact prodrug from
the gastrointestinal tract. Nomura et al (Bioorg Med. Chem. 2003,
11, 2453-61, herein incorporated by reference) have described
acetal derivatives of 1-(3-C-ethynyl-.beta.-D-ribo-pentofaranosyl)
cytosine which, on bioreduction, produced an intermediate that
required further hydrolysis under acidic conditions to produce a
cytotoxic nucleoside compound.
[0147] Cytotoxic nucleotides which may be chemotherapeutic also
include, but are not limited to, pyrazolo[3,4-D]-pyrimidines,
allopurinol, azathioprine, capecitabine, cytosine arabinoside,
fluorouracil, mercaptopurine, 6-thioguanine, acyclovir,
ara-adenosine, ribavirin, 7-deaza-adenosine, 7-deaza-guanosine,
6-aza-uracil, 6-aza-cytidine, thymidine ribonucleotide,
5-bromodeoxyuridine, 2-chloro-purine, and inosine, or combinations
thereof.
Flanking Regions: Untranslated Regions (UTRs)
[0148] Untranslated regions (UTRs) of a gene are transcribed but
not translated. The 5'UTR starts at the transcription start site
and continues to the start codon but does not include the start
codon; whereas, the 3'UTR starts immediately following the stop
codon and continues until the transcriptional termination signal.
There is growing body of evidence about the regulatory roles played
by the UTRs in terms of stability of the nucleic acid molecule and
translation. The regulatory features of a UTR can be incorporated
into the polynucleotides, primary constructs and/or mmRNA of the
present invention to enhance the stability of the molecule. The
specific features can also be incorporated to ensure controlled
down-regulation of the transcript in case they are misdirected to
undesired organs sites.
5' UTR and Translation Initiation
[0149] Natural 5'UTRs bear features which play roles in for
translation initiation. They harbor signatures like Kozak sequences
which are commonly known to be involved in the process by which the
ribosome initiates translation of many genes. Kozak sequences have
the consensus CCR(A/G)CCAUGG, where R is a purine (adenine or
guanine) three bases upstream of the start codon (AUG), which is
followed by another `G`. 5'UTR also have been known to form
secondary structures which are involved in elongation factor
binding.
[0150] By engineering the features typically found in abundantly
expressed genes of specific target organs, one can enhance the
stability and protein production of the polynucleotides, primary
constructs or mmRNA of the invention. For example, introduction of
5' UTR of liver-expressed mRNA, such as albumin, serum amyloid A,
Apolipoprotein A/B/E, transferrin, alpha fetoprotein,
erythropoietin, or Factor VIII, could be used to enhance expression
of a nucleic acid molecule, such as a mmRNA, in hepatic cell lines
or liver. Likewise, use of 5' UTR from other tissue-specific mRNA
to improve expression in that tissue is possible for muscle (MyoD,
Myosin, Myoglobin, Myogenin, Herculin), for endothelial cells
(Tie-1, CD36), for myeloid cells (C/EBP, AML1, G-CSF, GM-CSF,
CD11b, MSR, Fr-1, i-NOS), for leukocytes (CD45, CD18), for adipose
tissue (CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial
cells (SP-A/B/C/D).
[0151] Other non-UTR sequences may be incorporated into the 5' (or
3' UTR) UTRs. For example, introns or portions of introns sequences
may be incorporated into the flanking regions of the
polynucleotides, primary constructs or mmRNA of the invention.
Incorporation of intronic sequences may increase protein production
as well as mRNA levels.
3' UTR and the AU Rich Elements
[0152] UTRs are known to have stretches of Adenosines and Uridines
embedded in them. These AU rich signatures are particularly
prevalent in genes with high rates of turnover. Based on their
sequence features and functional properties, the AU rich elements
(AREs) can be separated into three classes (Chen et al, 1995):
Class I AREs contain several dispersed copies of an AUUUA motif
within U-rich regions. C-Myc and MyoD contain class I AREs. Class
II AREs possess two or more overlapping UUAUUUA(U/A)(U/A) nonamers.
Molecules containing this type of AREs include GM-CSF and TNF-a.
Class III ARES are less well defined. These U rich regions do not
contain an AUUUA motif. c-Jun and Myogenin are two well-studied
examples of this class. Most proteins binding to the AREs are known
to destabilize the messenger, whereas members of the ELAV family,
most notably HuR, have been documented to increase the stability of
mRNA. HuR binds to AREs of all the three classes. Engineering the
HuR specific binding sites into the 3' UTR of nucleic acid
molecules will lead to HuR binding and thus, stabilization of the
message in vivo.
[0153] Introduction, removal or modification of 3' UTR AU rich
elements (AREs) can be used to modulate the stability of
polynucleotides, primary constructs or mmRNA of the invention. When
engineering specific polynucleotides, primary constructs or mmRNA,
one or more copies of an ARE can be introduced to make
polynucleotides, primary constructs or mmRNA of the invention less
stable and thereby curtail translation and decrease production of
the resultant protein. Likewise, AREs can be identified and removed
or mutated to increase the intracellular stability and thus
increase translation and production of the resultant protein.
Transfection experiments can be conducted in relevant cell lines,
using polynucleotides, primary constructs or mmRNA of the invention
and protein production can be assayed at various time points
post-transfection. For example, cells can be transfected with
different ARE-engineering molecules and by using an ELISA kit to
the relevant protein and assaying protein produced at 6 hour, 12
hour, 24 hour, 48 hour, and 7 days post-transfection.
Incorporating microRNA Binding Sites
[0154] microRNAs (or miRNA) are 19-25 nucleotide long noncoding
RNAs that bind to the 3'UTR of nucleic acid molecules and
down-regulate gene expression either by reducing nucleic acid
molecule stability or by inhibiting translation. The
polynucleotides, primary constructs or mmRNA of the invention may
comprise one or more microRNA target sequences, microRNA sequences,
or microRNA seeds. Such sequences may correspond to any known
microRNA such as those taught in US Publication US2005/0261218 and
US Publication US2005/0059005, the contents of which are
incorporated herein by reference in their entirety.
[0155] A microRNA sequence comprises a "seed" region, i.e., a
sequence in the region of positions 2-8 of the mature microRNA,
which sequence has perfect Watson-Crick complementarity to the
miRNA target sequence. A microRNA seed may comprise positions 2-8
or 2-7 of the mature microRNA. In some embodiments, a microRNA seed
may comprise 7 nucleotides (e.g., nucleotides 2-8 of the mature
microRNA), wherein the seed-complementary site in the corresponding
miRNA target is flanked by an adenine (A) opposed to microRNA
position 1. In some embodiments, a microRNA seed may comprise 6
nucleotides (e.g., nucleotides 2-7 of the mature microRNA), wherein
the seed-complementary site in the corresponding miRNA target is
flanked by an adenine (A) opposed to microRNA position 1. See for
example, Grimson A, Farh K K, Johnston W K, Garrett-Engele P, Lim L
P, Bartel D P; Mol Cell. 2007 Jul. 6; 27(1):91-105; each of which
is herein incorporated by reference in their entirety. The bases of
the microRNA seed have complete complementarity with the target
sequence. By engineering microRNA target sequences into the 3'UTR
of polynucleotides, primary constructs or mmRNA of the invention
one can target the molecule for degradation or reduced translation,
provided the microRNA in question is available. This process will
reduce the hazard of off target effects upon nucleic acid molecule
delivery. Identification of microRNA, microRNA target regions, and
their expression patterns and role in biology have been reported
(Bonauer et al., Curr Drug Targets 2010 11:943-949; Anand and
Cheresh Curr Opin Hematol 2011 18:171-176; Contreras and Rao
Leukemia 2012 26:404-413 (2011 Dec. 20. doi: 10.1038/leu.2011.356);
Bartel Cell 2009 136:215-233; Landgraf et al, Cell, 2007
129:1401-1414; each of which is herein incorporated by reference in
its entirety).
[0156] For example, if the nucleic acid molecule is an mRNA and is
not intended to be delivered to the liver but ends up there, then
miR-122, a microRNA abundant in liver, can inhibit the expression
of the gene of interest if one or multiple target sites of miR-122
are engineered into the 3' UTR of the polynucleotides, primary
constructs or mmRNA. Introduction of one or multiple binding sites
for different microRNA can be engineered to further decrease the
longevity, stability, and protein translation of a polynucleotides,
primary constructs or mmRNA.
[0157] As used herein, the term "microRNA site" refers to a
microRNA target site or a microRNA recognition site, or any
nucleotide sequence to which a microRNA binds or associates. It
should be understood that "binding" may follow traditional
Watson-Crick hybridization rules or may reflect any stable
association of the microRNA with the target sequence at or adjacent
to the microRNA site.
[0158] Conversely, for the purposes of the polynucleotides, primary
constructs or mmRNA of the present invention, microRNA binding
sites can be engineered out of (i.e. removed from) sequences in
which they naturally occur in order to increase protein expression
in specific tissues. For example, miR-122 binding sites may be
removed to improve protein expression in the liver. Regulation of
expression in multiple tissues can be accomplished through
introduction or removal or one or several microRNA binding
sites.
[0159] Examples of tissues where microRNA are known to regulate
mRNA, and thereby protein expression, include, but are not limited
to, liver (miR-122), muscle (miR-133, miR-206, miR-208),
endothelial cells (miR-17-92, miR-126), myeloid cells (miR-142-3p,
miR-142-5p, miR-16, miR-21, miR-223, miR-24, miR-27), adipose
tissue (let-7, miR-30c), heart (miR-1d, miR-149), kidney (miR-192,
miR-194, miR-204), and lung epithelial cells (let-7, miR-133,
miR-126). MicroRNA can also regulate complex biological processes
such as angiogenesis (miR-132) (Anand and Cheresh Curr Opin Hematol
2011 18:171-176; herein incorporated by reference in its entirety).
In the polynucleotides, primary constructs or mmRNA of the present
invention, binding sites for microRNAs that are involved in such
processes may be removed or introduced, in order to tailor the
expression of the polynucleotides, primary constructs or mmRNA
expression to biologically relevant cell types or to the context of
relevant biological processes. A listing of MicroRNA, miR sequences
and miR binding sites is listed in Table 9 of U.S. Provisional
Application No. 61/753,661 filed Jan. 17, 2013, in Table 9 of U.S.
Provisional Application No. 61/754,159 filed Jan. 18, 2013, and in
Table 7 of U.S. Provisional Application No. 61/758,921 filed Jan.
31, 2013, each of which are herein incorporated by reference in
their entireties.
[0160] Examples of use of microRNA to drive tissue or
disease-specific gene expression are listed (Getner and Naldini,
Tissue Antigens. 2012, 80:393-403; herein incorporated by reference
in its entirety). In addition, microRNA seed sites can be
incorporated into mRNA to decrease expression in certain cells
which results in a biological improvement. An example of this is
incorporation of miR-142 sites into a UGT1A1-expressing lentiviral
vector. The presence of miR-142 seed sites reduced expression in
hematopoietic cells, and as a consequence reduced expression in
antigen-presenting cells, leading to the absence of an immune
response against the virally expressed UGT1A1 (Schmitt et al.,
Gastroenterology 2010; 139:999-1007; Gonzalez-Asequinolaza et al.
Gastroenterology 2010, 139:726-729; both herein incorporated by
reference in its entirety). Incorporation of miR-142 sites into
modified mRNA could not only reduce expression of the encoded
protein in hematopoietic cells, but could also reduce or abolish
immune responses to the mRNA-encoded protein. Incorporation of
miR-142 seed sites (one or multiple) into mRNA would be important
in the case of treatment of patients with complete protein
deficiencies (UGT1A1 type I, LDLR-deficient patients, CRIM-negative
Pompe patients, etc.).
[0161] Lastly, through an understanding of the expression patterns
of microRNA in different cell types, polynucleotides, primary
constructs or mmRNA can be engineered for more targeted expression
in specific cell types or only under specific biological
conditions. Through introduction of tissue-specific microRNA
binding sites, polynucleotides, primary constructs or mmRNA could
be designed that would be optimal for protein expression in a
tissue or in the context of a biological condition.
[0162] Transfection experiments can be conducted in relevant cell
lines, using engineered polynucleotides, primary constructs or
mmRNA and protein production can be assayed at various time points
post-transfection. For example, cells can be transfected with
different microRNA binding site-engineering polynucleotides,
primary constructs or mmRNA and by using an ELISA kit to the
relevant protein and assaying protein produced at 6 hour, 12 hour,
24 hour, 48 hour, 72 hour and 7 days post-transfection. In vivo
experiments can also be conducted using microRNA-binding
site-engineered molecules to examine changes in tissue-specific
expression of formulated polynucleotides, primary constructs or
mmRNA.
5' Capping
[0163] The 5' cap structure of an mRNA is involved in nuclear
export, increasing mRNA stability and binds the mRNA Cap Binding
Protein (CBP), which is responsibile for mRNA stability in the cell
and translation competency through the association of CBP with
poly(A) binding protein to form the mature cyclic mRNA species. The
cap further assists the removal of 5' proximal introns removal
during mRNA splicing.
[0164] Endogenous mRNA molecules may be 5'-end capped generating a
5'-ppp-5'-triphosphate linkage between a terminal guanosine cap
residue and the 5'-terminal transcribed sense nucleotide of the
mRNA molecule. This 5'-guanylate cap may then be methylated to
generate an N7-methyl-guanylate residue. The ribose sugars of the
terminal and/or anteterminal transcribed nucleotides of the 5' end
of the mRNA may optionally also be 2'-O-methylated. 5'-decapping
through hydrolysis and cleavage of the guanylate cap structure may
target a nucleic acid molecule, such as an mRNA molecule, for
degradation.
[0165] Modifications to the polynucleotides, primary constructs,
and mmRNA of the present invention may generate a non-hydrolyzable
cap structure preventing decapping and thus increasing mRNA
half-life. Because cap structure hydrolysis requires cleavage of
5'-ppp-5' phosphorodiester linkages, modified nucleotides may be
used during the capping reaction. For example, a Vaccinia Capping
Enzyme from New England Biolabs (Ipswich, Mass.) may be used with
.alpha.-thio-guanosine nucleotides according to the manufacturer's
instructions to create a phosphorothioate linkage in the 5'-ppp-5'
cap. Additional modified guanosine nucleotides may be used such as
.alpha.-methyl-phosphonate and seleno-phosphate nucleotides.
[0166] Additional modifications include, but are not limited to,
2'-O-methylation of the ribose sugars of 5'-terminal and/or
5'-anteterminal nucleotides of the mRNA (as mentioned above) on the
2'-hydroxyl group of the sugar ring. Multiple distinct 5'-cap
structures can be used to generate the 5'-cap of a nucleic acid
molecule, such as an mRNA molecule.
[0167] Cap analogs, which herein are also referred to as synthetic
cap analogs, chemical caps, chemical cap analogs, or structural or
functional cap analogs, differ from natural (i.e. endogenous,
wild-type or physiological) 5'-caps in their chemical structure,
while retaining cap function. Cap analogs may be chemically (i.e.
non-enzymatically) or enzymatically synthesized and/or linked to a
nucleic acid molecule.
[0168] For example, the Anti-Reverse Cap Analog (ARCA) cap contains
two guanines linked by a 5'-5'-triphosphate group, wherein one
guanine contains an N7 methyl group as well as a 3'-O-methyl group
(i.e., N7,3'-O-dimethyl-guanosine-5'-triphosphate-5'-guanosine
(m.sup.7G-3' mppp-G; which may equivalently be designated 3'
O-Me-m7G(5')ppp(5')G). The 3'-O atom of the other, unmodified,
guanine becomes linked to the 5'-terminal nucleotide of the capped
nucleic acid molecule (e.g. an mRNA or mmRNA). The N7- and
3'-O-methlyated guanine provides the terminal moiety of the capped
nucleic acid molecule (e.g. mRNA or mmRNA).
[0169] Another exemplary cap is mCAP, which is similar to ARCA but
has a 2'-O-methyl group on guanosine (i.e.,
N7,2'-O-dimethyl-guanosine-5'-triphosphate-5'-guanosine,
m.sup.7Gm-ppp-G).
[0170] While cap analogs allow for the concomitant capping of a
nucleic acid molecule in an in vitro transcription reaction, up to
20% of transcripts can remain uncapped. This, as well as the
structural differences of a cap analog from an endogenous 5'-cap
structures of nucleic acids produced by the endogenous, cellular
transcription machinery, may lead to reduced translational
competency and reduced cellular stability.
[0171] Polynucleotides, primary constructs and mmRNA of the
invention may also be capped post-transcriptionally, using enzymes,
in order to generate more authentic 5'-cap structures. As used
herein, the phrase "more authentic" refers to a feature that
closely mirrors or mimics, either structurally or functionally, an
endogenous or wild type feature. That is, a "more authentic"
feature is better representative of an endogenous, wild-type,
natural or physiological cellular function and/or structure as
compared to synthetic features or analogs, etc., of the prior art,
or which outperforms the corresponding endogenous, wild-type,
natural or physiological feature in one or more respects.
Non-limiting examples of more authentic 5' cap structures of the
present invention are those which, among other things, have
enhanced binding of cap binding proteins, increased half life,
reduced susceptibility to 5' endonucleases and/or reduced 5'
decapping, as compared to synthetic 5' cap structures known in the
art (or to a wild-type, natural or physiological 5' cap structure).
For example, recombinant Vaccinia Virus Capping Enzyme and
recombinant 2'-O-methyltransferase enzyme can create a canonical
5'-5'-triphosphate linkage between the 5'-terminal nucleotide of an
mRNA and a guanine cap nucleotide wherein the cap guanine contains
an N7 methylation and the 5'-terminal nucleotide of the mRNA
contains a 2'-O-methyl. Such a structure is termed the Cap1
structure. This cap results in a higher translational-competency
and cellular stability and a reduced activation of cellular
pro-inflammatory cytokines, as compared, e.g., to other 5' cap
analog structures known in the art. Cap structures include, but are
not limited to, 7mG(5')ppp(5')N,pN2p (cap 0), 7mG(5')ppp(5')N1mpNp
(cap 1), and 7mG(5')-ppp(5')N1mpN2mp (cap 2).
[0172] Because the polynucleotides, primary constructs or mmRNA may
be capped post-transcriptionally, and because this process is more
efficient, nearly 100% of the polynucleotides, primary constructs
or mmRNA may be capped. This is in contrast to .about.80% when a
cap analog is linked to an mRNA in the course of an in vitro
transcription reaction.
[0173] According to the present invention, 5' terminal caps may
include endogenous caps or cap analogs. According to the present
invention, a 5' terminal cap may comprise a guanine analog. Useful
guanine analogs include, but are not limited to, inosine,
N1-methyl-guanosine, 2' fluoro-guanosine, 7-deaza-guanosine,
8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, and
2-azido-guanosine.
Viral Sequences
[0174] Additional viral sequences such as, but not limited to, the
translation enhancer sequence of the barley yellow dwarf virus
(BYDV-PAV), the Jaagsiekte sheep retrovirus (JSRV) and/or the
Enzootic nasal tumor virus (See e.g., International Pub. No.
WO2012129648; herein incorporated by reference in its entirety) can
be engineered and inserted in the 3' UTR of the polynucleotides,
primary constructs or mmRNA of the invention and can stimulate the
translation of the construct in vitro and in vivo. Transfection
experiments can be conducted in relevant cell lines at and protein
production can be assayed by ELISA at 12 hr, 24 hr, 48 hr, 72 hr
and day 7 post-transfection.
IRES Sequences
[0175] Further, provided are polynucleotides, primary constructs or
mmRNA which may contain an internal ribosome entry site (IRES).
First identified as a feature Picorna virus RNA, IRES plays an
important role in initiating protein synthesis in absence of the 5'
cap structure. An IRES may act as the sole ribosome binding site,
or may serve as one of multiple ribosome binding sites of an mRNA.
Polynucleotides, primary constructs or mmRNA containing more than
one functional ribosome binding site may encode several peptides or
polypeptides that are translated independently by the ribosomes
("multicistronic nucleic acid molecules"). When polynucleotides,
primary constructs or mmRNA are provided with an IRES, further
optionally provided is a second translatable region. Examples of
IRES sequences that can be used according to the invention include
without limitation, those from picornaviruses (e.g. FMDV), pest
viruses (CFFV), polio viruses (PV), encephalomyocarditis viruses
(ECMV), foot-and-mouth disease viruses (FMDV), hepatitis C viruses
(HCV), classical swine fever viruses (CSFV), murine leukemia virus
(MLV), simian immune deficiency viruses (SIV) or cricket paralysis
viruses (CrPV).
Poly-A Tails
[0176] During RNA processing, a long chain of adenine nucleotides
(poly-A tail) may be added to a polynucleotide such as an mRNA
molecules in order to increase stability. Immediately after
transcription, the 3' end of the transcript may be cleaved to free
a 3' hydroxyl. Then poly-A polymerase adds a chain of adenine
nucleotides to the RNA. The process, called polyadenylation, adds a
poly-A tail that can be between, for example, approximately 100 and
250 residues long.
[0177] It has been discovered that unique poly-A tail lengths
provide certain advantages to the polynucleotides, primary
constructs or mmRNA of the present invention.
[0178] Generally, the length of a poly-A tail of the present
invention is greater than 30 nucleotides in length. In another
embodiment, the poly-A tail is greater than 35 nucleotides in
length (e.g., at least or greater than about 35, 40, 45, 50, 55,
60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400,
450, 500, 600, 700, 800, 900, 1,000, 1,100, 1,200, 1,300, 1,400,
1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000
nucleotides). In some embodiments, the polynucleotide, primary
construct, or mmRNA includes from about 30 to about 3,000
nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250,
from 30 to 500, from 30 to 750, from 30 to 1,000, from 30 to 1,500,
from 30 to 2,000, from 30 to 2,500, from 50 to 100, from 50 to 250,
from 50 to 500, from 50 to 750, from 50 to 1,000, from 50 to 1,500,
from 50 to 2,000, from 50 to 2,500, from 50 to 3,000, from 100 to
500, from 100 to 750, from 100 to 1,000, from 100 to 1,500, from
100 to 2,000, from 100 to 2,500, from 100 to 3,000, from 500 to
750, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from
500 to 2,500, from 500 to 3,000, from 1,000 to 1,500, from 1,000 to
2,000, from 1,000 to 2,500, from 1,000 to 3,000, from 1,500 to
2,000, from 1,500 to 2,500, from 1,500 to 3,000, from 2,000 to
3,000, from 2,000 to 2,500, and from 2,500 to 3,000).
[0179] In one embodiment, the poly-A tail is designed relative to
the length of the overall polynucleotides, primary constructs or
mmRNA. This design may be based on the length of the coding region,
the length of a particular feature or region (such as the first or
flanking regions), or based on the length of the ultimate product
expressed from the polynucleotides, primary constructs or
mmRNA.
[0180] In this context the poly-A tail may be 10, 20, 30, 40, 50,
60, 70, 80, 90, or 100% greater in length than the polynucleotides,
primary constructs or mmRNA or feature thereof. The poly-A tail may
also be designed as a fraction of polynucleotides, primary
constructs or mmRNA to which it belongs. In this context, the
poly-A tail may be 10, 20, 30, 40, 50, 60, 70, 80, or 90% or more
of the total length of the construct or the total length of the
construct minus the poly-A tail. Further, engineered binding sites
and conjugation of polynucleotides, primary constructs or mmRNA for
Poly-A binding protein may enhance expression.
[0181] Additionally, multiple distinct polynucleotides, primary
constructs or mmRNA may be linked together to the PABP (Poly-A
binding protein) through the 3'-end using modified nucleotides at
the 3'-terminus of the poly-A tail. Transfection experiments can be
conducted in relevant cell lines at and protein production can be
assayed by ELISA at 12 hr, 24 hr, 48 hr, 72 hr and day 7
post-transfection.
[0182] In one embodiment, the polynucleotide primary constructs of
the present invention are designed to include a polyA-G Quartet.
The G-quartet is a cyclic hydrogen bonded array of four guanine
nucleotides that can be formed by G-rich sequences in both DNA and
RNA. In this embodiment, the G-quartet is incorporated at the end
of the poly-A tail. The resultant mmRNA construct is assayed for
stability, protein production and other parameters including
half-life at various time points. It has been discovered that the
polyA-G quartet results in protein production equivalent to at
least 75% of that seen using a poly-A tail of 120 nucleotides
alone.
Quantification
[0183] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the present invention may be quantified in exosomes
derived from one or more bodily fluid. As used herein "bodily
fluids" include peripheral blood, serum, plasma, ascites, urine,
cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial
fluid, aqueous humor, amniotic fluid, cerumen, breast milk,
broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's
fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears,
cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph,
chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit,
vaginal secretions, mucosal secretion, stool water, pancreatic
juice, lavage fluids from sinus cavities, bronchopulmonary
aspirates, blastocyl cavity fluid, and umbilical cord blood.
Alternatively, exosomes may be retrieved from an organ selected
from the group consisting of lung, heart, pancreas, stomach,
intestine, bladder, kidney, ovary, testis, skin, colon, breast,
prostate, brain, esophagus, liver, and placenta.
[0184] In the quantification method, a sample of not more than 2 mL
is obtained from the subject and the exosomes isolated by size
exclusion chromatography, density gradient centrifugation,
differential centrifugation, nanomembrane ultrafiltration,
immunoabsorbent capture, affinity purification, microfluidic
separation, or combinations thereof. In the analysis, the level or
concentration of a polynucleotide, primary construct or mmRNA may
be an expression level, presence, absence, truncation or alteration
of the administered construct. It is advantageous to correlate the
level with one or more clinical phenotypes or with an assay for a
human disease biomarker. The assay may be performed using construct
specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow
cytometry, electrophoresis, mass spectrometry, or combinations
thereof while the exosomes may be isolated using
immunohistochemical methods such as enzyme linked immunosorbent
assay (ELISA) methods. Exosomes may also be isolated by size
exclusion chromatography, density gradient centrifugation,
differential centrifugation, nanomembrane ultrafiltration,
immunoabsorbent capture, affinity purification, microfluidic
separation, or combinations thereof
[0185] These methods afford the investigator the ability to
monitor, in real time, the level of polynucleotides, primary
constructs or mmRNA remaining or delivered. This is possible
because the polynucleotides, primary constructs or mmRNA of the
present invention differ from the endogenous forms due to the
structural or chemical modifications.
II. DESIGN AND SYNTHESIS OF mmRNA
[0186] Polynucleotides, primary constructs or mmRNA for use in
accordance with the invention may be prepared according to any
available technique including, but not limited to chemical
synthesis, enzymatic synthesis, which is generally termed in vitro
transcription (IVT) or enzymatic or chemical cleavage of a longer
precursor, etc. Methods of synthesizing RNAs are known in the art
(see, e.g., Gait, M. J. (ed.) Oligonucleotide synthesis: a
practical approach, Oxford [Oxfordshire], Washington, D.C.: IRL
Press, 1984; and Herdewijn, P. (ed.) Oligonucleotide synthesis:
methods and applications, Methods in Molecular Biology, v. 288
(Clifton, N.J.) Totowa, N.J.: Humana Press, 2005; both of which are
incorporated herein by reference).
[0187] The process of design and synthesis of the primary
constructs of the invention generally includes the steps of gene
construction, mRNA production (either with or without
modifications) and purification. In the enzymatic synthesis method,
a target polynucleotide sequence encoding the polypeptide of
interest is first selected for incorporation into a vector which
will be amplified to produce a cDNA template. Optionally, the
target polynucleotide sequence and/or any flanking sequences may be
codon optimized. The cDNA template is then used to produce mRNA
through in vitro transcription (IVT). After production, the mRNA
may undergo purification and clean-up processes. The steps of which
are provided in more detail below.
Gene Construction
[0188] The step of gene construction may include, but is not
limited to gene synthesis, vector amplification, plasmid
purification, plasmid linearization and clean-up, and cDNA template
synthesis and clean-up.
Gene Synthesis
[0189] Once a polypeptide of interest, or target, is selected for
production, a primary construct is designed. Within the primary
construct, a first region of linked nucleosides encoding the
polypeptide of interest may be constructed using an open reading
frame (ORF) of a selected nucleic acid (DNA or RNA) transcript. The
ORF may comprise the wild type ORF, an isoform, variant or a
fragment thereof. As used herein, an "open reading frame" or "ORF"
is meant to refer to a nucleic acid sequence (DNA or RNA) which is
capable of encoding a polypeptide of interest. ORFs often begin
with the start codon, ATG and end with a nonsense or termination
codon or signal.
[0190] Further, the nucleotide sequence of the first region may be
codon optimized. Codon optimization methods are known in the art
and may be useful in efforts to achieve one or more of several
goals. These goals include to match codon frequencies in target and
host organisms to ensure proper folding, bias GC content to
increase mRNA stability or reduce secondary structures, minimize
tandem repeat codons or base runs that may impair gene construction
or expression, customize transcriptional and translational control
regions, insert or remove protein trafficking sequences, remove/add
post translation modification sites in encoded protein (e.g.
glycosylation sites), add, remove or shuffle protein domains,
insert or delete restriction sites, modify ribosome binding sites
and mRNA degradation sites, to adjust translational rates to allow
the various domains of the protein to fold properly, or to reduce
or eliminate problem secondary structures within the mRNA. Codon
optimization tools, algorithms and services are known in the art,
non-limiting examples include services from GeneArt (Life
Technologies), DNA2.0 (Menlo Park Calif.) and/or proprietary
methods. In one embodiment, the ORF sequence is optimized using
optimization algorithms. Codon options for each amino acid are
given in Table 1.
TABLE-US-00001 TABLE 1 Codon Options Single Letter Amino Acid Code
Codon Options Isoleucine I ATT, ATC, ATA Leucine L CTT, CTC, CTA,
CTG, TTA, TTG Valine V GTT, GTC, GTA, GTG Phenylalanine F TTT, TTC
Methionine M ATG Cysteine C TGT, TGC Alanine A GCT, GCC, GCA, GCG
Glycine G GGT, GGC, GGA, GGG Proline P CCT, CCC, CCA, CCG Threonine
T ACT, ACC, ACA, ACG Serine S TCT, TCC, TCA, TCG, AGT, AGC Tyrosine
Y TAT, TAC Tryptophan W TGG Glutamine Q CAA, CAG Asparagine N AAT,
AAC Histidine H CAT, CAC Glutamic acid E GAA, GAG Aspartic acid D
GAT, GAC Lysine K AAA, AAG Arginine R CGT, CGC, CGA, CGG, AGA, AGG
Selenocysteine Sec UGA in mRNA in presence of Selenocystein
insertion element (SECIS) Stop codons Stop TAA, TAG, TGA
[0191] Features, which may be considered beneficial in some
embodiments of the present invention, may be encoded by the primary
construct and may flank the ORF as a first or second flanking
region. The flanking regions may be incorporated into the primary
construct before and/or after optimization of the ORF. It is not
required that a primary construct contain both a 5' and 3' flanking
region. Examples of such features include, but are not limited to,
untranslated regions (UTRs), Kozak sequences, an oligo(dT)
sequence, and detectable tags and may include multiple cloning
sites which may have XbaI recognition.
[0192] In some embodiments, a 5' UTR and/or a 3' UTR may be
provided as flanking regions. Multiple 5' or 3' UTRs may be
included in the flanking regions and may be the same or of
different sequences. Any portion of the flanking regions, including
none, may be codon optimized and any may independently contain one
or more different structural or chemical modifications, before
and/or after codon optimization. Combinations of features may be
included in the first and second flanking regions and may be
contained within other features. For example, the ORF may be
flanked by a 5' UTR which may contain a strong Kozak translational
initiation signal and/or a 3' UTR which may include an oligo(dT)
sequence for templated addition of a poly-A tail. 5'UTR may
comprise a first polynucleotide fragment and a second
polynucleotide fragment from the same and/or different genes such
as the 5'UTRs described in US Patent Application Publication No.
20100293625, herein incorporated by reference in its entirety.
[0193] Tables 2 and 3 provide a listing of exemplary UTRs which may
be utilized in the primary construct of the present invention as
flanking regions. Shown in Table 2 is a listing of a
5'-untranslated region of the invention. Variants of 5' UTRs may be
utilized wherein one or more nucleotides are added or removed to
the termini, including A, T, C or G.
TABLE-US-00002 TABLE 2 5'-Untranslated Regions SEQ 5' UTR Name/ ID
Identifier Description Sequence NO. 5UTR-001 Upstream
GGGAAATAAGAGAGAAAAG 1 UTR AAGAGTAAGAAGAAATATA AGAGCCACC 5UTR-002
Upstream GGGAGATCAGAGAGAAAAG 2 UTR AAGAGTAAGAAGAAATATA AGAGCCACC
5UTR-003 Upstream GGAATAAAAGTCTCAACAC 3 UTR AACATATACAAAACAAACG
AATCTCAAGCAATCAAGCA TTCTACTTCTATTGCAGCA ATTTAAATCATTTCTTTTA
AAGCAAAAGCAATTTTCTG AAAATTTTCACCATTTACG AACGATAGCAAC 5UTR-004
Upstream GGGAGACAAGCUUGGCAUU 4 UTR CCGGUACUGUUGGUAAAGC CACC
[0194] Shown in Table 3 is a representative listing of
3'-untranslated regions of the invention. Variants of 3' UTRs may
be utilized wherein one or more nucleotides are added or removed to
the termini, including A, T, C or G.
TABLE-US-00003 TABLE 3 3'-Untranslated Regions 3' UTR Name/ SEQ ID
Identifier Description Sequence NO. 3UTR-001 Creatine
GCGCCTGCCCACCTGCCACCGACTGCTGG 5 Kinase AACCCAGCCAGTGGGAGGGCCTGGCCCA
CCAGAGTCCTGCTCCCTCACTCCTCGCCC CGCCCCCTGTCCCAGAGTCCCACCTGGGG
GCTCTCTCCACCCTTCTCAGAGTTCCAGT TTCAACCAGAGTTCCAACCAATGGGCTCC
ATCCTCTGGATTCTGGCCAATGAAATATC TCCCTGGCAGGGTCCTCTTCTTTTCCCAG
AGCTCCACCCCAACCAGGAGCTCTAGTTA ATGGAGAGCTCCCAGCACACTCGGAGCT
TGTGCTTTGTCTCCACGCAAAGCGATAAA TAAAAGCATTGGTGGCCTTTGGTCTTTGA
ATAAAGCCTGAGTAGGAAGTCTAGA 3UTR-002 Myoglobin
GCCCCTGCCGCTCCCACCCCCACCCATCT 6 GGGCCCCGGGTTCAAGAGAGAGCGGGGT
CTGATCTCGTGTAGCCATATAGAGTTTGC TTCTGAGTGTCTGCTTTGTTTAGTAGAGG
TGGGCAGGAGGAGCTGAGGGGCTGGGGC TGGGGTGTTGAAGTTGGCTTTGCATGCCC
AGCGATGCGCCTCCCTGTGGGATGTCATC ACCCTGGGAACCGGGAGTGGCCCTTGGC
TCACTGTGTTCTGCATGGTTTGGATCTGA ATTAATTGTCCTTTCTTCTAAATCCCAACC
GAACTTCTTCCAACCTCCAAACTGGCTGT AACCCCAAATCCAAGCCATTAACTACACC
TGACAGTAGCAATTGTCTGATTAATCACT GGCCCCTTGAAGACAGCAGAATGTCCCTT
TGCAATGAGGAGGAGATCTGGGCTGGGC GGGCCAGCTGGGGAAGCATTTGACTATCT
GGAACTTGTGTGTGCCTCCTCAGGTATGG CAGTGACTCACCTGGTTTTAATAAAACAA
CCTGCAACATCTCATGGTCTTTGAATAAA GCCTGAGTAGGAAGTCTAGA 3UTR-003
.alpha.-actin ACACACTCCACCTCCAGCACGCGACTTCT 7
CAGGACGACGAATCTTCTCAATGGGGGG GCGGCTGAGCTCCAGCCACCCCGCAGTC
ACTTTCTTTGTAACAACTTCCGTTGCTGCC ATCGTAAACTGACACAGTGTTTATAACGT
GTACATACATTAACTTATTACCTCATTTT GTTATTTTTCGAAACAAAGCCCTGTGGAA
GAAAATGGAAAACTTGAAGAAGCATTAA AGTCATTCTGTTAAGCTGCGTAAATGGTC
TTTGAATAAAGCCTGAGTAGGAAGTCTA GA 3UTR-004 Albumin
CATCACATTTAAAAGCATCTCAGCCTACC 8 ATGAGAATAAGAGAAAGAAAATGAAGAT
CAAAAGCTTATTCATCTGTTTTTCTTTTTC GTTGGTGTAAAGCCAACACCCTGTCTAAA
AAACATAAATTTCTTTAATCATTTTGCCT CTTTTCTCTGTGCTTCAATTAATAAAAAA
TGGAAAGAATCTAATAGAGTGGTACAGC ACTGTTATTTTTCAAAGATGTGTTGCTAT
CCTGAAAATTCTGTAGGTTCTGTGGAAGT TCCAGTGTTCTCTCTTATTCCACTTCGGTA
GAGGATTTCTAGTTTCTTGTGGGCTAATT AAATAAATCATTAATACTCTTCTAATGGT
CTTTGAATAAAGCCTGAGTAGGAAGTCTA GA 3UTR-005 .alpha.-globin
GCTGCCTTCTGCGGGGCTTGCCTTCTGGC 9 CATGCCCTTCTTCTCTCCCTTGCACCTGTA
CCTCTTGGTCTTTGAATAAAGCCTGAGTA GGAAGGCGGCCGCTCGAGCATGCATCTA GA
3UTR-006 G-CSF GCCAAGCCCTCCCCATCCCATGTATTTAT 10
CTCTATTTAATATTTATGTCTATTTAAGCC TCATATTTAAAGACAGGGAAGAGCAGAA
CGGAGCCCCAGGCCTCTGTGTCCTTCCCT GCATTTCTGAGTTTCATTCTCCTGCCTGTA
GCAGTGAGAAAAAGCTCCTGTCCTCCCAT CCCCTGGACTGGGAGGTAGATAGGTAAA
TACCAAGTATTTATTACTATGACTGCTCC CCAGCCCTGGCTCTGCAATGGGCACTGGG
ATGAGCCGCTGTGAGCCCCTGGTCCTGAG GGTCCCCACCTGGGACCCTTGAGAGTATC
AGGTCTCCCACGTGGGAGACAAGAAATC CCTGTTTAATATTTAAACAGCAGTGTTCC
CCATCTGGGTCCTTGCACCCCTCACTCTG GCCTCAGCCGACTGCACAGCGGCCCCTGC
ATCCCCTTGGCTGTGAGGCCCCTGGACAA GCAGAGGTGGCCAGAGCTGGGAGGCATG
GCCCTGGGGTCCCACGAATTTGCTGGGGA ATCTCGTTTTTCTTCTTAAGACTTTTGGGA
CATGGTTTGACTCCCGAACATCACCGACG CGTCTCCTGTTTTTCTGGGTGGCCTCGGG
ACACCTGCCCTGCCCCCACGAGGGTCAG GACTGTGACTCTTTTTAGGGCCAGGCAGG
TGCCTGGACATTTGCCTTGCTGGACGGGG ACTGGGGATGTGGGAGGGAGCAGACAGG
AGGAATCATGTCAGGCCTGTGTGTGAAA GGAAGCTCCACTGTCACCCTCCACCTCTT
CACCCCCCACTCACCAGTGTCCCCTCCAC TGTCACATTGTAACTGAACTTCAGGATAA
TAAAGTGTTTGCCTCCATGGTCTTTGAAT AAAGCCTGAGTAGGAAGGCGGCCGCTCG
AGCATGCATCTAGA 3UTR-007 Col1a2; ACTCAATCTAAATTAAAAAAGAAAGAAA 11
collagen, type TTTGAAAAAACTTTCTCTTTGCCATTTCTT I, alpha 2
CTTCTTCTTTTTTAACTGAAAGCTGAATCC TTCCATTTCTTCTGCACATCTACTTGCTTA
AATTGTGGGCAAAAGAGAAAAAGAAGGA TTGATCAGAGCATTGTGCAATACAGTTTC
ATTAACTCCTTCCCCCGCTCCCCCAAAAA TTTGAATTTTTTTTTCAACACTCTTACACC
TGTTATGGAAAATGTCAACCTTTGTAAGA AAACCAAAATAAAAATTGAAAAATAAAA
ACCATAAACATTTGCACCACTTGTGGCTT TTGAATATCTTCCACAGAGGGAAGTTTAA
AACCCAAACTTCCAAAGGTTTAAACTACC TCAAAACACTTTCCCATGAGTGTGATCCA
CATTGTTAGGTGCTGACCTAGACAGAGAT GAACTGAGGTCCTTGTTTTGTTTTGTTCAT
AATACAAAGGTGCTAATTAATAGTATTTC AGATACTTGAAGAATGTTGATGGTGCTAG
AAGAATTTGAGAAGAAATACTCCTGTATT GAGTTGTATCGTGTGGTGTATTTTTTAAA
AAATTTGATTTAGCATTCATATTTTCCATC TTATTCCCAATTAAAAGTATGCAGATTAT
TTGCCCAAATCTTCTTCAGATTCAGCATT TGTTCTTTGCCAGTCTCATTTTCATCTTCT
TCCATGGTTCCACAGAAGCTTTGTTTCTT GGGCAAGCAGAAAAATTAAATTGTACCT
ATTTTGTATATGTGAGATGTTTAAATAAA TTGTGAAAAAAATGAAATAAAGCATGTT
TGGTTTTCCAAAAGAACATAT 3UTR-008 Col6a2; CGCCGCCGCCCGGGCCCCGCAGTCGAGG
12 collagen, type GTCGTGAGCCCACCCCGTCCATGGTGCTA VI, alpha 2
AGCGGGCCCGGGTCCCACACGGCCAGCA CCGCTGCTCACTCGGACGACGCCCTGGGC
CTGCACCTCTCCAGCTCCTCCCACGGGGT CCCCGTAGCCCCGGCCCCCGCCCAGCCCC
AGGTCTCCCCAGGCCCTCCGCAGGCTGCC CGGCCTCCCTCCCCCTGCAGCCATCCCAA
GGCTCCTGACCTACCTGGCCCCTGAGCTC TGGAGCAAGCCCTGACCCAATAAAGGCT
TTGAACCCAT 3UTR-009 RPN1; GGGGCTAGAGCCCTCTCCGCACAGCGTG 13
ribophorin I GAGACGGGGCAAGGAGGGGGGTTATTAG
GATTGGTGGTTTTGTTTTGCTTTGTTTAAA GCCGTGGGAAAATGGCACAACTTTACCTC
TGTGGGAGATGCAACACTGAGAGCCAAG GGGTGGGAGTTGGGATAATTTTTATATAA
AAGAAGTTTTTCCACTTTGAATTGCTAAA AGTGGCATTTTTCCTATGTGCAGTCACTC
CTCTCATTTCTAAAATAGGGACGTGGCCA GGCACGGTGGCTCATGCCTGTAATCCCAG
CACTTTGGGAGGCCGAGGCAGGCGGCTC ACGAGGTCAGGAGATCGAGACTATCCTG
GCTAACACGGTAAAACCCTGTCTCTACTA AAAGTACAAAAAATTAGCTGGGCGTGGT
GGTGGGCACCTGTAGTCCCAGCTACTCGG GAGGCTGAGGCAGGAGAAAGGCATGAAT
CCAAGAGGCAGAGCTTGCAGTGAGCTGA GATCACGCCATTGCACTCCAGCCTGGGCA
ACAGTGTTAAGACTCTGTCTCAAATATAA ATAAATAAATAAATAAATAAATAAATAA
ATAAAAATAAAGCGAGATGTTGCCCTCA AA 3UTR-010 LRP1; low
GGCCCTGCCCCGTCGGACTGCCCCCAGAA 14 density
AGCCTCCTGCCCCCTGCCAGTGAAGTCCT lipoprotein
TCAGTGAGCCCCTCCCCAGCCAGCCCTTC receptor-
CCTGGCCCCGCCGGATGTATAAATGTAAA related AATGAAGGAATTACATTTTATATGTGAGC
protein 1 GAGCAAGCCGGCAAGCGAGCACAGTATT
ATTTCTCCATCCCCTCCCTGCCTGCTCCTT GGCACCCCCATGCTGCCTTCAGGGAGAC
AGGCAGGGAGGGCTTGGGGCTGCACCTC CTACCCTCCCACCAGAACGCACCCCACTG
GGAGAGCTGGTGGTGCAGCCTTCCCCTCC CTGTATAAGACACTTTGCCAAGGCTCTCC
CCTCTCGCCCCATCCCTGCTTGCCCGCTC CCACAGCTTCCTGAGGGCTAATTCTGGGA
AGGGAGAGTTCTTTGCTGCCCCTGTCTGG AAGACGTGGCTCTGGGTGAGGTAGGCGG
GAAAGGATGGAGTGTTTTAGTTCTTGGGG GAGGCCACCCCAAACCCCAGCCCCAACT
CCAGGGGCACCTATGAGATGGCCATGCT CAACCCCCCTCCCAGACAGGCCCTCCCTG
TCTCCAGGGCCCCCACCGAGGTTCCCAGG GCTGGAGACTTCCTCTGGTAAACATTCCT
CCAGCCTCCCCTCCCCTGGGGACGCCAAG GAGGTGGGCCACACCCAGGAAGGGAAAG
CGGGCAGCCCCGTTTTGGGGACGTGAAC GTTTTAATAATTTTTGCTGAATTCCTTTAC
AACTAAATAACACAGATATTGTTATAAAT AAAATTGT 3UTR-011 Nnt1;
ATATTAAGGATCAAGCTGTTAGCTAATAA 15 cardiotrophin-
TGCCACCTCTGCAGTTTTGGGAACAGGCA like cytokine
AATAAAGTATCAGTATACATGGTGATGTA factor 1 CATCTGTAGCAAAGCTCTTGGAGAAAAT
GAAGACTGAAGAAAGCAAAGCAAAAACT GTATAGAGAGATTTTTCAAAAGCAGTAAT
CCCTCAATTTTAAAAAAGGATTGAAAATT CTAAATGTCTTTCTGTGCATATTTTTTGTG
TTAGGAATCAAAAGTATTTTATAAAAGG AGAAAGAACAGCCTCATTTTAGATGTAGT
CCTGTTGGATTTTTTATGCCTCCTCAGTAA CCAGAAATGTTTTAAAAAACTAAGTGTTT
AGGATTTCAAGACAACATTATACATGGCT CTGAAATATCTGACACAATGTAAACATTG
CAGGCACCTGCATTTTATGTTTTTTTTTTC AACAAATGTGACTAATTTGAAACTTTTAT
GAACTTCTGAGCTGTCCCCTTGCAATTCA ACCGCAGTTTGAATTAATCATATCAAATC
AGTTTTAATTTTTTAAATTGTACTTCAGA GTCTATATTTCAAGGGCACATTTTCTCAC
TACTATTTTAATACATTAAAGGACTAAAT AATCTTTCAGAGATGCTGGAAACAAATC
ATTTGCTTTATATGTTTCATTAGAATACC AATGAAACATACAACTTGAAAATTAGTA
ATAGTATTTTTGAAGATCCCATTTCTAAT TGGAGATCTCTTTAATTTCGATCAACTTA
TAATGTGTAGTACTATATTAAGTGCACTT GAGTGGAATTCAACATTTGACTAATAAA
ATGAGTTCATCATGTTGGCAAGTGATGTG GCAATTATCTCTGGTGACAAAAGAGTAA
AATCAAATATTTCTGCCTGTTACAAATAT CAAGGAAGACCTGCTACTATGAAATAGA
TGACATTAATCTGTCTTCACTGTTTATAAT ACGGATGGATTTTTTTTCAAATCAGTGTG
TGTTTTGAGGTCTTATGTAATTGATGACA TTTGAGAGAAATGGTGGCTTTTTTTAGCT
ACCTCTTTGTTCATTTAAGCACCAGTAAA GATCATGTCTTTTTATAGAAGTGTAGATT
TTCTTTGTGACTTTGCTATCGTGCCTAAA GCTCTAAATATAGGTGAATGTGTGATGAA
TACTCAGATTATTTGTCTCTCTATATAATT AGTTTGGTACTAAGTTTCTCAAAAAATTA
TTAACACATGAAAGACAATCTCTAAACC AGAAAAAGAAGTAGTACAAATTTTGTTA
CTGTAATGCTCGCGTTTAGTGAGTTTAAA ACACACAGTATCTTTTGGTTTTATAATCA
GTTTCTATTTTGCTGTGCCTGAGATTAAG ATCTGTGTATGTGTGTGTGTGTGTGTGTG
CGTTTGTGTGTTAAAGCAGAAAAGACTTT
TTTAAAAGTTTTAAGTGATAAATGCAATT TGTTAATTGATCTTAGATCACTAGTAAAC
TCAGGGCTGAATTATACCATGTATATTCT ATTAGAAGAAAGTAAACACCATCTTTATT
CCTGCCCTTTTTCTTCTCTCAAAGTAGTTG TAGTTATATCTAGAAAGAAGCAATTTTGA
TTTCTTGAAAAGGTAGTTCCTGCACTCAG TTTAAACTAAAAATAATCATACTTGGATT
TTATTTATTTTTGTCATAGTAAAAATTTTA ATTTATATATATTTTTATTTAGTATTATCT
TATTCTTTGCTATTTGCCAATCCTTTGTCA TCAATTGTGTTAAATGAATTGAAAATTCA
TGCCCTGTTCATTTTATTTTACTTTATTGG TTAGGATATTTAAAGGATTTTTGTATATA
TAATTTCTTAAATTAATATTCCAAAAGGT TAGTGGACTTAGATTATAAATTATGGCAA
AAATCTAAAAACAACAAAAATGATTTTT ATACATTCTATTTCATTATTCCTCTTTTTC
CAATAAGTCATACAATTGGTAGATATGAC TTATTTTATTTTTGTATTATTCACTATATC
TTTATGATATTTAAGTATAAATAATTAAA AAAATTTATTGTACCTTATAGTCTGTCAC
CAAAAAAAAAAAATTATCTGTAGGTAGT GAAATGCTAATGTTGATTTGTCTTTAAGG
GCTTGTTAACTATCCTTTATTTTCTCATTT GTCTTAAATTAGGAGTTTGTGTTTAAATT
ACTCATCTAAGCAAAAAATGTATATAAAT CCCATTACTGGGTATATACCCAAAGGATT
ATAAATCATGCTGCTATAAAGACACATGC ACACGTATGTTTATTGCAGCACTATTCAC
AATAGCAAAGACTTGGAACCAACCCAAA TGTCCATCAATGATAGACTTGATTAAGAA
AATGTGCACATATACACCATGGAATACTA TGCAGCCATAAAAAAGGATGAGTTCATG
TCCTTTGTAGGGACATGGATAAAGCTGGA AACCATCATTCTGAGCAAACTATTGCAAG
GACAGAAAACCAAACACTGCATGTTCTC ACTCATAGGTGGGAATTGAACAATGAGA
ACACTTGGACACAAGGTGGGGAACACCA CACACCAGGGCCTGTCATGGGGTGGGGG
GAGTGGGGAGGGATAGCATTAGGAGATA TACCTAATGTAAATGATGAGTTAATGGGT
GCAGCACACCAACATGGCACATGTATAC ATATGTAGCAAACCTGCACGTTGTGCACA
TGTACCCTAGAACTTAAAGTATAATTAAA AAAAAAAAGAAAACAGAAGCTATTTATA
AAGAAGTTATTTGCTGAAATAAATGTGAT CTTTCCCATTAAAAAAATAAAGAAATTTT
GGGGTAAAAAAACACAATATATTGTATT CTTGAAAAATTCTAAGAGAGTGGATGTG
AAGTGTTCTCACCACAAAAGTGATAACTA ATTGAGGTAATGCACATATTAATTAGAAA
GATTTTGTCATTCCACAATGTATATATAC TTAAAAATATGTTATACACAATAAATACA
TACATTAAAAAATAAGTAAATGTA 3UTR-012 Col6a1
CCCACCCTGCACGCCGGCACCAAACCCTG 16 collagen type,
TCCTCCCACCCCTCCCCACTCATCACTAA VI alpha 1
ACAGAGTAAAATGTGATGCGAATTTTCCC GACCAACCTGATTCGCTAGATTTTTTTTA
AGGAAAAGCTTGGAAAGCCAGGACACAA CGCTGCTGCCTGCTTTGTGCAGGGTCCTC
CGGGGCTCAGCCCTGAGTTGGCATCACCT GCGCAGGGCCCTCTGGGGCTCAGCCCTG
AGCTAGTGTCACCTGCACAGGGCCCTCTG AGGCTCAGCCCTGAGCTGGCGTCACCTGT
GCAGGGCCCTCTGGGGCTCAGCCCTGAG CTGGCCTCACCTGGGTTCCCCACCCCGGG
CTCTCCTGCCCTGCCCTCCTGCCCGCCCTC CCTCCTGCCTGCGCAGCTCCTTCCCTAGG
CACCTCTGTGCTGCATCCCACCAGCCTGA GCAAGACGCCCTCTCGGGGCCTGTGCCGC
ACTAGCCTCCCTCTCCTCTGTCCCCATAG CTGGTTTTTCCCACCAATCCTCACCTAAC
AGTTACTTTACAATTAAACTCAAAGCAAG CTCTTCTCCTCAGCTTGGGGCAGCCATTG
GCCTCTGTCTCGTTTTGGGAAACCAAGGT CAGGAGGCCGTTGCAGACATAAATCTCG
GCGACTCGGCCCCGTCTCCTGAGGGTCCT GCTGGTGACCGGCCTGGACCTTGGCCCTA
CAGCCCTGGAGGCCGCTGCTGACCAGCA CTGACCCCGACCTCAGAGAGTACTCGCA
GGGGCGCTGGCTGCACTCAAGACCCTCG AGATTAACGGTGCTAACCCCGTCTGCTCC
TCCCTCCCGCAGAGACTGGGGCCTGGACT GGACATGAGAGCCCCTTGGTGCCACAGA
GGGCTGTGTCTTACTAGAAACAACGCAA ACCTCTCCTTCCTCAGAATAGTGATGTGT
TCGACGTTTTATCAAAGGCCCCCTTTCTA TGTTCATGTTAGTTTTGCTCCTTCTGTGTT
TTTTTCTGAACCATATCCATGTTGCTGACT TTTCCAAATAAAGGTTTTCACTCCTCTC
3UTR-013 Calr; AGAGGCCTGCCTCCAGGGCTGGACTGAG 17 calreticulin
GCCTGAGCGCTCCTGCCGCAGAGCTGGCC GCGCCAAATAATGTCTCTGTGAGACTCGA
GAACTTTCATTTTTTTCCAGGCTGGTTCG GATTTGGGGTGGATTTTGGTTTTGTTCCC
CTCCTCCACTCTCCCCCACCCCCTCCCCG CCCTTTTTTTTTTTTTTTTTTAAACTGGTAT
TTTATCTTTGATTCTCCTTCAGCCCTCACC CCTGGTTCTCATCTTTCTTGATCAACATCT
TTTCTTGCCTCTGTCCCCTTCTCTCATCTC TTAGCTCCCCTCCAACCTGGGGGGCAGTG
GTGTGGAGAAGCCACAGGCCTGAGATTT CATCTGCTCTCCTTCCTGGAGCCCAGAGG
AGGGCAGCAGAAGGGGGTGGTGTCTCCA ACCCCCCAGCACTGAGGAAGAACGGGGC
TCTTCTCATTTCACCCCTCCCTTTCTCCCC TGCCCCCAGGACTGGGCCACTTCTGGGTG
GGGCAGTGGGTCCCAGATTGGCTCACACT GAGAATGTAAGAACTACAAACAAAATTT
CTATTAAATTAAATTTTGTGTCTCC 3UTR-014 Col1a1;
CTCCCTCCATCCCAACCTGGCTCCCTCCC 18 collagen, type
ACCCAACCAACTTTCCCCCCAACCCGGAA I, alpha 1
ACAGACAAGCAACCCAAACTGAACCCCC TCAAAAGCCAAAAAATGGGAGACAATTT
CACATGGACTTTGGAAAATATTTTTTTCC TTTGCATTCATCTCTCAAACTTAGTTTTTA
TCTTTGACCAACCGAACATGACCAAAAA CCAAAAGTGCATTCAACCTTACCAAAAA
AAAAAAAAAAAAAAGAATAAATAAATA ACTTTTTAAAAAAGGAAGCTTGGTCCACT
TGCTTGAAGACCCATGCGGGGGTAAGTC CCTTTCTGCCCGTTGGGCTTATGAAACCC
CAATGCTGCCCTTTCTGCTCCTTTCTCCAC ACCCCCCTTGGGGCCTCCCCTCCACTCCT
TCCCAAATCTGTCTCCCCAGAAGACACAG GAAACAATGTATTGTCTGCCCAGCAATCA
AAGGCAATGCTCAAACACCCAAGTGGCC CCCACCCTCAGCCCGCTCCTGCCCGCCCA
GCACCCCCAGGCCCTGGGGGACCTGGGG TTCTCAGACTGCCAAAGAAGCCTTGCCAT
CTGGCGCTCCCATGGCTCTTGCAACATCT CCCCTTCGTTTTTGAGGGGGTCATGCCGG
GGGAGCCACCAGCCCCTCACTGGGTTCG GAGGAGAGTCAGGAAGGGCCACGACAAA
GCAGAAACATCGGATTTGGGGAACGCGT GTCAATCCCTTGTGCCGCAGGGCTGGGCG
GGAGAGACTGTTCTGTTCCTTGTGTAACT GTGTTGCTGAAAGACTACCTCGTTCTTGT
CTTGATGTGTCACCGGGGCAACTGCCTGG GGGCGGGGATGGGGGCAGGGTGGAAGCG
GCTCCCCATTTTATACCAAAGGTGCTACA TCTATGTGATGGGTGGGGTGGGGAGGGA
ATCACTGGTGCTATAGAAATTGAGATGCC CCCCCAGGCCAGCAAATGTTCCTTTTTGT
TCAAAGTCTATTTTTATTCCTTGATATTTT TCTTTTTTTTTTTTTTTTTTTGTGGATGGG
GACTTGTGAATTTTTCTAAAGGTGCTATT TAACATGGGAGGAGAGCGTGTGCGGCTC
CAGCCCAGCCCGCTGCTCACTTTCCACCC TCTCTCCACCTGCCTCTGGCTTCTCAGGC
CTCTGCTCTCCGACCTCTCTCCTCTGAAA CCCTCCTCCACAGCTGCAGCCCATCCTCC
CGGCTCCCTCCTAGTCTGTCCTGCGTCCT CTGTCCCCGGGTTTCAGAGACAACTTCCC
AAAGCACAAAGCAGTTTTTCCCCCTAGGG GTGGGAGGAAGCAAAAGACTCTGTACCT
ATTTTGTATGTGTATAATAATTTGAGATG TTTTTAATTATTTTGATTGCTGGAATAAA
GCATGTGGAAATGACCCAAACATAATCC GCAGTGGCCTCCTAATTTCCTTCTTTGGA
GTTGGGGGAGGGGTAGACATGGGGAAGG GGCTTTGGGGTGATGGGCTTGCCTTCCAT
TCCTGCCCTTTCCCTCCCCACTATTCTCTT CTAGATCCCTCCATAACCCCACTCCCCTT
TCTCTCACCCTTCTTATACCGCAAACCTTT CTACTTCCTCTTTCATTTTCTATTCTTGCA
ATTTCCTTGCACCTTTTCCAAATCCTCTTC TCCCCTGCAATACCATACAGGCAATCCAC
GTGCACAACACACACACACACTCTTCACA TCTGGGGTTGTCCAAACCTCATACCCACT
CCCCTTCAAGCCCATCCACTCTCCACCCC CTGGATGCCCTGCACTTGGTGGCGGTGGG
ATGCTCATGGATACTGGGAGGGTGAGGG GAGTGGAACCCGTGAGGAGGACCTGGGG
GCCTCTCCTTGAACTGACATGAAGGGTCA TCTGGCCTCTGCTCCCTTCTCACCCACGCT
GACCTCCTGCCGAAGGAGCAACGCAACA GGAGAGGGGTCTGCTGAGCCTGGCGAGG
GTCTGGGAGGGACCAGGAGGAAGGCGTG CTCCCTGCTCGCTGTCCTGGCCCTGGGGG
AGTGAGGGAGACAGACACCTGGGAGAGC TGTGGGGAAGGCACTCGCACCGTGCTCTT
GGGAAGGAAGGAGACCTGGCCCTGCTCA CCACGGACTGGGTGCCTCGACCTCCTGAA
TCCCCAGAACACAACCCCCCTGGGCTGG GGTGGTCTGGGGAACCATCGTGCCCCCGC
CTCCCGCCTACTCCTTTTTAAGCTT 3UTR-015 Plod1
TTGGCCAGGCCTGACCCTCTTGGACCTTT 19 procollagen-
CTTCTTTGCCGACAACCACTGCCCAGCAG lysine, 2-
CCTCTGGGACCTCGGGGTCCCAGGGAAC oxoglutarate
CCAGTCCAGCCTCCTGGCTGTTGACTTCC 5-dioxygenase
CATTGCTCTTGGAGCCACCAATCAAAGAG 1 ATTCAAAGAGATTCCTGCAGGCCAGAGG
CGGAACACACCTTTATGGCTGGGGCTCTC CGTGGTGTTCTGGACCCAGCCCCTGGAGA
CACCATTCACTTTTACTGCTTTGTAGTGA CTCGTGCTCTCCAACCTGTCTTCCTGAAA
AACCAAGGCCCCCTTCCCCCACCTCTTCC ATGGGGTGAGACTTGAGCAGAACAGGGG
CTTCCCCAAGTTGCCCAGAAAGACTGTCT GGGTGAGAAGCCATGGCCAGAGCTTCTC
CCAGGCACAGGTGTTGCACCAGGGACTT CTGCTTCAAGTTTTGGGGTAAAGACACCT
GGATCAGACTCCAAGGGCTGCCCTGAGT CTGGGACTTCTGCCTCCATGGCTGGTCAT
GAGAGCAAACCGTAGTCCCCTGGAGACA GCGACTCCAGAGAACCTCTTGGGAGACA
GAAGAGGCATCTGTGCACAGCTCGATCTT CTACTTGCCTGTGGGGAGGGGAGTGACA
GGTCCACACACCACACTGGGTCACCCTGT CCTGGATGCCTCTGAAGAGAGGGACAGA
CCGTCAGAAACTGGAGAGTTTCTATTAAA GGTCATTTAAACCA 3UTR-016 Nucb1;
TCCTCCGGGACCCCAGCCCTCAGGATTCC 20 nucleobindin 1
TGATGCTCCAAGGCGACTGATGGGCGCT GGATGAAGTGGCACAGTCAGCTTCCCTG
GGGGCTGGTGTCATGTTGGGCTCCTGGGG CGGGGGCACGGCCTGGCATTTCACGCATT
GCTGCCACCCCAGGTCCACCTGTCTCCAC TTTCACAGCCTCCAAGTCTGTGGCTCTTC
CCTTCTGTCCTCCGAGGGGCTTGCCTTCT CTCGTGTCCAGTGAGGTGCTCAGTGATCG
GCTTAACTTAGAGAAGCCCGCCCCCTCCC CTTCTCCGTCTGTCCCAAGAGGGTCTGCT
CTGAGCCTGCGTTCCTAGGTGGCTCGGCC TCAGCTGCCTGGGTTGTGGCCGCCCTAGC
ATCCTGTATGCCCACAGCTACTGGAATCC CCGCTGCTGCTCCGGGCCAAGCTTCTGGT
TGATTAATGAGGGCATGGGGTGGTCCCTC AAGACCTTCCCCTACCTTTTGTGGAACCA
GTGATGCCTCAAAGACAGTGTCCCCTCCA CAGCTGGGTGCCAGGGGCAGGGGATCCT
CAGTATAGCCGGTGAACCCTGATACCAG GAGCCTGGGCCTCCCTGAACCCCTGGCTT
CCAGCCATCTCATCGCCAGCCTCCTCCTG GACCTCTTGGCCCCCAGCCCCTTCCCCAC
ACAGCCCCAGAAGGGTCCCAGAGCTGAC CCCACTCCAGGACCTAGGCCCAGCCCCTC
AGCCTCATCTGGAGCCCCTGAAGACCAGT CCCACCCACCTTTCTGGCCTCATCTGACA
CTGCTCCGCATCCTGCTGTGTGTCCTGTTC CATGTTCCGGTTCCATCCAAATACACTTT
CTGGAACAAA 3UTR-017 .alpha.-globin GCTGGAGCCTCGGTGGCCATGCTTCTTGC
21
CCCTTGGGCCTCCCCCCAGCCCCTCCTCC CCTTCCTGCACCCGTACCCCCGTGGTCTT
TGAATAAAGTCTGAGTGGGCGGC
[0195] It should be understood that those listed in the previous
tables are examples and that any UTR from any gene may be
incorporated into the respective first or second flanking region of
the primary construct. Furthermore, multiple wild-type UTRs of any
known gene may be utilized. It is also within the scope of the
present invention to provide artificial UTRs which are not variants
of wild type genes. These UTRs or portions thereof may be placed in
the same orientation as in the transcript from which they were
selected or may be altered in orientation or location. Hence a 5'
or 3' UTR may be inverted, shortened, lengthened, made chimeric
with one or more other 5' UTRs or 3' UTRs. As used herein, the term
"altered" as it relates to a UTR sequence, means that the UTR has
been changed in some way in relation to a reference sequence. For
example, a 3' or 5' UTR may be altered relative to a wild type or
native UTR by the change in orientation or location as taught above
or may be altered by the inclusion of additional nucleotides,
deletion of nucleotides, swapping or transposition of nucleotides.
Any of these changes producing an "altered" UTR (whether 3' or 5')
comprise a variant UTR.
[0196] In one embodiment, a double, triple or quadruple UTR such as
a 5' or 3' UTR may be used. As used herein, a "double" UTR is one
in which two copies of the same UTR are encoded either in series or
substantially in series. For example, a double beta-globin 3' UTR
may be used as described in US Patent publication 20100129877, the
contents of which are incorporated herein by reference in its
entirety.
[0197] It is also within the scope of the present invention to have
patterned UTRs. As used herein "patterned UTRs" are those UTRs
which reflect a repeating or alternating pattern, such as ABABAB or
AABBAABBAABB or ABCABCABC or variants thereof repeated once, twice,
or more than 3 times. In these patterns, each letter, A, B, or C
represent a different UTR at the nucleotide level.
[0198] In one embodiment, flanking regions are selected from a
family of transcripts whose proteins share a common function,
structure, feature of property. For example, polypeptides of
interest may belong to a family of proteins which are expressed in
a particular cell, tissue or at some time during development. The
UTRs from any of these genes may be swapped for any other UTR of
the same or different family of proteins to create a new chimeric
primary transcript. As used herein, a "family of proteins" is used
in the broadest sense to refer to a group of two or more
polypeptides of interest which share at least one function,
structure, feature, localization, origin, or expression
pattern.
[0199] After optimization (if desired), the primary construct
components are reconstituted and transformed into a vector such as,
but not limited to, plasmids, viruses, cosmids, and artificial
chromosomes. For example, the optimized construct may be
reconstituted and transformed into chemically competent E. coli,
yeast, neurospora, maize, drosophila, etc. where high copy
plasmid-like or chromosome structures occur by methods described
herein.
[0200] The untranslated region may also include translation
enhancer elements (TEE). As a non-limiting example, the TEE may
include those described in US Application No. 20090226470, herein
incorporated by reference in its entirety, and those known in the
art.
Stop Codons
[0201] In one embodiment, the primary constructs of the present
invention may include at least two stop codons before the 3'
untranslated region (UTR). The stop codon may be selected from TGA,
TAA and TAG. In one embodiment, the primary constructs of the
present invention include the stop codon TGA and one additional
stop codon. In a further embodiment the addition stop codon may be
TAA. In another embodiment, the primary constructs of the present
invention include three stop codons.
Vector Amplification
[0202] The vector containing the primary construct is then
amplified and the plasmid isolated and purified using methods known
in the art such as, but not limited to, a maxi prep using the
Invitrogen PURELINK.TM. HiPure Maxiprep Kit (Carlsbad, Calif.).
Plasmid Linearization
[0203] The plasmid may then be linearized using methods known in
the art such as, but not limited to, the use of restriction enzymes
and buffers. The linearization reaction may be purified using
methods including, for example Invitrogen's PURELINK.TM. PCR Micro
Kit (Carlsbad, Calif.), and HPLC based purification methods such
as, but not limited to, strong anion exchange HPLC, weak anion
exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic
interaction HPLC (HIC-HPLC) and Invitrogen's standard PURELINK.TM.
PCR Kit (Carlsbad, Calif.). The purification method may be modified
depending on the size of the linearization reaction which was
conducted. The linearized plasmid is then used to generate cDNA for
in vitro transcription (IVT) reactions.
cDNA Template Synthesis
[0204] A cDNA template may be synthesized by having a linearized
plasmid undergo polymerase chain reaction (PCR). Table 4 is a
listing of primers and probes that may be usefully in the PCR
reactions of the present invention. It should be understood that
the listing is not exhaustive and that primer-probe design for any
amplification is within the skill of those in the art. Probes may
also contain chemically modified bases to increase base-pairing
fidelity to the target molecule and base-pairing strength. Such
modifications may include 5-methyl-Cytidine, 2,6-di-amino-purine,
2'-fluoro, phosphoro-thioate, or locked nucleic acids.
TABLE-US-00004 TABLE 4 Primers and Probes Prime/ SEQ Probe
Hybridization ID Identifier Sequence (5'-3') target NO. UFP
TTGGACCCTCGTACAGAAGCTAA cDNA Template 22 TACG URP
T.sub.x160CTTCCTACTCAGGCTTTATTC cDNA Template 23 AAAGACCA GBA1
CCTTGACCTTCTGGAACTTC Acid 24 glucocerebrosidase GBA2
CCAAGCACTGAAACGGATAT Acid 25 glucocerebrosidase LUC1
GATGAAAAGTGCTCCAAGGA Luciferase 26 LUC2 AACCGTGATGAAAAGGTACC
Luciferase 27 LUC3 TCATGCAGATTGGAAAGGTC Luciferase 28 GCSF1
CTTCTTGGACTGTCCAGAGG G-CSF 29 GCSF2 GCAGTCCCTGATACAAGAAC G-CSF 30
GCSF3 GATTGAAGGTGGCTCGCTAC G-CSF 31 *UFPis universal forward
primer; URP is universal reverse primer.
[0205] In one embodiment, the cDNA may be submitted for sequencing
analysis before undergoing transcription.
mRNA Production
[0206] The process of mRNA or mmRNA production may include, but is
not limited to, in vitro transcription, cDNA template removal and
RNA clean-up, and mRNA capping and/or tailing reactions.
In Vitro Transcription
[0207] The cDNA produced in the previous step may be transcribed
using an in vitro transcription (IVT) system. The system typically
comprises a transcription buffer, nucleotide triphosphates (NTPs),
an RNase inhibitor and a polymerase. The NTPs may be manufactured
in house, may be selected from a supplier, or may be synthesized as
described herein. The NTPs may be selected from, but are not
limited to, those described herein including natural and unnatural
(modified) NTPs. The polymerase may be selected from, but is not
limited to, T7 RNA polymerase, T3 RNA polymerase and mutant
polymerases such as, but not limited to, polymerases able to
incorporate modified nucleic acids.
RNA Polymerases
[0208] Any number of RNA polymerases or variants may be used in the
design of the primary constructs of the present invention.
[0209] RNA polymerases may be modified by inserting or deleting
amino acids of the RNA polymerase sequence. As a non-limiting
example, the RNA polymerase may be modified to exhibit an increased
ability to incorporate a 2'-modified nucleotide triphosphate
compared to an unmodified RNA polymerase (see International
Publication WO2008078180 and U.S. Pat. No. 8,101,385; herein
incorporated by reference in their entireties).
[0210] Variants may be obtained by evolving an RNA polymerase,
optimizing the RNA polymerase amino acid and/or nucleic acid
sequence and/or by using other methods known in the art. As a
non-limiting example, T7 RNA polymerase variants may be evolved
using the continuous directed evolution system set out by Esvelt et
al. (Nature (2011) 472(7344):499-503; herein incorporated by
reference in its entirety) where clones of T7 RNA polymerase may
encode at least one mutation such as, but not limited to, lysine at
position 93 substituted for threonine (K93T), 14M, A7T, E63V, V64D,
A65E, D66Y, T76N, C125R, S128R, A136T, N165S, G175R, H176L, Y178H,
F182L, L196F, G198V, D208Y, E222K, S228A, Q239R, T243N, G259D,
M267I, G280C, H300R, D351A, A354S, E356D, L360P, A383V, Y385C,
D388Y, S397R, M401T, N410S, K450R, P451T, G452V, E484A, H523L,
H524N, G542V, E565K, K577E, K577M, N601S, S684Y, L6991, K713E,
N748D, Q754R, E775K, A827V, D851N or L864F. As another non-limiting
example, T7 RNA polymerase variants may encode at least mutation as
described in U.S. Pub. Nos. 20100120024 and 20070117112; herein
incorporated by reference in their entireties. Variants of RNA
polymerase may also include, but are not limited to, substitutional
variants, conservative amino acid substitution, insertional
variants, deletional variants and/or covalent derivatives.
[0211] In one embodiment, the primary construct may be designed to
be recognized by the wild type or variant RNA polymerases. In doing
so, the primary construct may be modified to contain sites or
regions of sequence changes from the wild type or parent primary
construct.
[0212] In one embodiment, the primary construct may be designed to
include at least one substitution and/or insertion upstream of an
RNA polymerase binding or recognition site, downstream of the RNA
polymerase binding or recognition site, upstream of the TATA box
sequence, downstream of the TATA box sequence of the primary
construct but upstream of the coding region of the primary
construct, within the 5'UTR, before the 5'UTR and/or after the
5'UTR.
[0213] In one embodiment, the 5'UTR of the primary construct may be
replaced by the insertion of at least one region and/or string of
nucleotides of the same base. The region and/or string of
nucleotides may include, but is not limited to, at least 3, at
least 4, at least 5, at least 6, at least 7 or at least 8
nucleotides and the nucleotides may be natural and/or unnatural. As
a non-limiting example, the group of nucleotides may include 5-8
adenine, cytosine, thymine, a string of any of the other
nucleotides disclosed herein and/or combinations thereof.
[0214] In one embodiment, the 5'UTR of the primary construct may be
replaced by the insertion of at least two regions and/or strings of
nucleotides of two different bases such as, but not limited to,
adenine, cytosine, thymine, any of the other nucleotides disclosed
herein and/or combinations thereof. For example, the 5'UTR may be
replaced by inserting 5-8 adenine bases followed by the insertion
of 5-8 cytosine bases. In another example, the 5'UTR may be
replaced by inserting 5-8 cytosine bases followed by the insertion
of 5-8 adenine bases.
[0215] In one embodiment, the primary construct may include at
least one substitution and/or insertion downstream of the
transcription start site which may be recognized by an RNA
polymerase. As a non-limiting example, at least one substitution
and/or insertion may occur downstream the transcription start site
by substituting at least one nucleic acid in the region just
downstream of the transcription start site (such as, but not
limited to, +1 to +6). Changes to region of nucleotides just
downstream of the transcription start site may affect initiation
rates, increase apparent nucleotide triphosphate (NTP) reaction
constant values, and increase the dissociation of short transcripts
from the transcription complex curing initial transcription (Brieba
et al, Biochemistry (2002) 41: 5144-5149; herein incorporated by
reference in its entirety). The modification, substitution and/or
insertion of at least one nucleic acid may cause a silent mutation
of the nucleic acid sequence or may cause a mutation in the amino
acid sequence.
[0216] In one embodiment, the primary construct may include the
substitution of at least 1, at least 2, at least 3, at least 4, at
least 5, at least 6, at least 7, at least 8, at least 9, at least
10, at least 11, at least 12 or at least 13 guanine bases
downstream of the transcription start site.
[0217] In one embodiment, the primary construct may include the
substitution of at least 1, at least 2, at least 3, at least 4, at
least 5 or at least 6 guanine bases in the region just downstream
of the transcription start site. As a non-limiting example, if the
nucleotides in the region are GGGAGA the guanine bases may be
substituted by at least 1, at least 2, at least 3 or at least 4
adenine nucleotides. In another non-limiting example, if the
nucleotides in the region are GGGAGA the guanine bases may be
substituted by at least 1, at least 2, at least 3 or at least 4
cytosine bases. In another non-limiting example, if the nucleotides
in the region are GGGAGA the guanine bases may be substituted by at
least 1, at least 2, at least 3 or at least 4 thymine, and/or any
of the nucleotides described herein.
[0218] In one embodiment, the primary construct may include at
least one substitution and/or insertion upstream of the start
codon. For the purpose of clarity, one of skill in the art would
appreciate that the start codon is the first codon of the protein
coding region whereas the transcription start site is the site
where transcription begins. The primary construct may include, but
is not limited to, at least 1, at least 2, at least 3, at least 4,
at least 5, at least 6, at least 7 or at least 8 substitutions
and/or insertions of nucleotide bases. The nucleotide bases may be
inserted or substituted at 1, at least 1, at least 2, at least 3,
at least 4 or at least 5 locations upstream of the start codon. The
nucleotides inserted and/or substituted may be the same base (e.g.,
all A or all C or all T or all G), two different bases (e.g., A and
C, A and T, or C and T), three different bases (e.g., A, C and T or
A, C and T) or at least four different bases. As a non-limiting
example, the guanine base upstream of the coding region in the
primary construct may be substituted with adenine, cytosine,
thymine, or any of the nucleotides described herein. In another
non-limiting example the substitution of guanine bases in the
primary construct may be designed so as to leave one guanine base
in the region downstream of the transcription start site and before
the start codon (see Esvelt et al. Nature (2011) 472(7344):499-503;
herein incorporated by reference in its entirety). As a
non-limiting example, at least 5 nucleotides may be inserted at 1
location downstream of the transcription start site but upstream of
the start codon and the at least 5 nucleotides may be the same base
type.
cDNA Template Removal and Clean-Up
[0219] The cDNA template may be removed using methods known in the
art such as, but not limited to, treatment with Deoxyribonuclease I
(DNase I). RNA clean-up may also include a purification method such
as, but not limited to, AGENCOURT.RTM. CLEANSEQ.RTM. system from
Beckman Coulter (Danvers, Mass.), HPLC based purification methods
such as, but not limited to, strong anion exchange HPLC, weak anion
exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic
interaction HPLC (HIC-HPLC).
Capping and/or Tailing Reactions
[0220] The primary construct or mmRNA may also undergo capping
and/or tailing reactions. A capping reaction may be performed by
methods known in the art to add a 5' cap to the 5' end of the
primary construct. Methods for capping include, but are not limited
to, using a Vaccinia Capping enzyme (New England Biolabs, Ipswich,
Mass.).
[0221] A poly-A tailing reaction may be performed by methods known
in the art, such as, but not limited to, 2' O-methyltransferase and
by methods as described herein. If the primary construct generated
from cDNA does not include a poly-T, it may be beneficial to
perform the poly-A-tailing reaction before the primary construct is
cleaned.
mRNA Purification
[0222] Primary construct or mmRNA purification may include, but is
not limited to, mRNA or mmRNA clean-up, quality assurance and
quality control. mRNA or mmRNA clean-up may be performed by methods
known in the arts such as, but not limited to, AGENCOURT.RTM. beads
(Beckman Coulter Genomics, Danvers, Mass.), poly-T beads, LNA.TM.
oligo-T capture probes (EXIQON.RTM. Inc, Vedbaek, Denmark) or HPLC
based purification methods such as, but not limited to, strong
anion exchange HPLC, weak anion exchange HPLC, reverse phase
HPLC(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The
term "purified" when used in relation to a polynucleotide such as a
"purified mRNA or mmRNA" refers to one that is separated from at
least one contaminant. As used herein, a "contaminant" is any
substance which makes another unfit, impure or inferior. Thus, a
purified polynucleotide (e.g., DNA and RNA) is present in a form or
setting different from that in which it is found in nature, or a
form or setting different from that which existed prior to
subjecting it to a treatment or purification method.
[0223] A quality assurance and/or quality control check may be
conducted using methods such as, but not limited to, gel
electrophoresis, UV absorbance, or analytical HPLC.
[0224] In another embodiment, the mRNA or mmRNA may be sequenced by
methods including, but not limited to
reverse-transcriptase-PCR.
[0225] In one embodiment, the mRNA or mmRNA may be quantified using
methods such as, but not limited to, ultraviolet visible
spectroscopy (UV/Vis). A non-limiting example of a UV/Vis
spectrometer is a NANODROP.RTM. spectrometer (ThermoFisher,
Waltham, Mass.). The quantified mRNA or mmRNA may be analyzed in
order to determine if the mRNA or mmRNA may be of proper size,
check that no degradation of the mRNA or mmRNA has occurred.
Degradation of the mRNA and/or mmRNA may be checked by methods such
as, but not limited to, agarose gel electrophoresis, HPLC based
purification methods such as, but not limited to, strong anion
exchange HPLC, weak anion exchange HPLC, reverse phase
HPLC(RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid
chromatography-mass spectrometry (LCMS), capillary electrophoresis
(CE) and capillary gel electrophoresis (CGE).
Signal Sequences
[0226] The primary constructs or mmRNA may also encode additional
features which facilitate trafficking of the polypeptides to
therapeutically relevant sites. One such feature which aids in
protein trafficking is the signal sequence. As used herein, a
"signal sequence" or "signal peptide" is a polynucleotide or
polypeptide, respectively, which is from about 9 to 200 nucleotides
(3-60 amino acids) in length which is incorporated at the 5' (or
N-terminus) of the coding region or polypeptide encoded,
respectively. Addition of these sequences result in trafficking of
the encoded polypeptide to the endoplasmic reticulum through one or
more secretory pathways. Some signal peptides are cleaved from the
protein by signal peptidase after the proteins are transported.
[0227] Table 5 is a representative listing of protein signal
sequences which may be incorporated for encoding by the
polynucleotides, primary constructs or mmRNA of the invention.
TABLE-US-00005 TABLE 5 Signal Sequences NUCLEOTIDE SEQ SEQ SEQUENCE
ID ENCODED ID ID Description (5'-3') NO. PEPTIDE NO. SS-001
.alpha.-1- ATGATGCCATCCTC 32 MMPSSVSWGILL 94 antitrypsin
AGTCTCATGGGGTA AGLCCLVPVSLA TTTTGCTCTTGGCGG GTCTGTGCTGTCTCG
TGCCGGTGTCGCTC GCA SS-002 G-CSF ATGGCCGGACCGGC 33 MAGPATQSPMK 95
GACTCAGTCGCCCA LMALQLLLWHS TGAAACTCATGGCC ALWTVQEA CTGCAGTTGTTGCTT
TGGCACTCAGCCCT CTGGACCGTCCAAG AGGCG SS-003 Factor IX ATGCAGAGAGTGAA
34 MQRVNMIMAES 96 CATGATTATGGCCG PSLITICLLGYLL AGTCCCCATCGCTC
SAECTVFLDHEN ATCACAATCTGCCT ANKILNRPKR GCTTGGTACCTGCTT
TCCGCCGAATGCAC TGTCTTTCTGGATCA CGAGAATGCGAATA AGATCTTGAACCGA
CCCAAACGG SS-004 Prolactin ATGAAAGGATCATT 35 MKGSLLLLLVSN 97
GCTGTTGCTCCTCGT LLLCQSVAP GTCGAACCTTCTGC TTTGCCAGTCCGTA GCCCCC
SS-005 Albumin ATGAAATGGGTGAC 36 MKWVTFISLLFL 98 GTTCATCTCACTGTT
FSSAYSRG VFRR GTTTTTGTTCTCGTC CGCCTACTCCAGGG GAGTATTCCGCCGA SS-006
HMMSP38 ATGTGGTGGCGGCT 37 MWWRLWWLLL 99 CTGGTGGCTGCTCC LLLLLPMWA
TGTTGCTCCTCTTGC TGTGGCCCATGGTG TGGGCA MLS-001 ornithine
TGCTCTTTAACCTCC 38 MLFNLRILLNNA 100 carbamoyl- GCATCCTGTTGAAT
AFRNGHNFMVR transferase AACGCTGCGTTCCG NFRCGQPLQ AAATGGGCATAACT
TCATGGTACGCAAC TTCAGATGCGGCCA GCCACTCCAG MLS-002 Cytochrome
ATGTCCGTCTTGAC 39 MSVLTPLLLRGL 101 C Oxidase ACCCCTGCTCTTGA
TGSARRLPVPRA subunit 8A GAGGGCTGACGGGG KIHSL TCCGCTAGACGCCT
GCCGGTACCGCGAG CGAAGATCCACTCC CTG MLS-003 Cytochrome ATGAGCGTGCTCAC
40 MSVLTPLLLRGL 102 C Oxidase TCCGTTGCTTCTTCG TGSARRLPVPRA subunit
8A AGGGCTTACGGGAT KIHSL CGGCTCGGAGGTTG CCCGTCCCGAGAGC
GAAGATCCATTCGT TG SS-007 Type III, TGACAAAAATAACT 41 MVTKITLSPQNF
103 bacterial TTATCTCCCCAGAA RIQKQETTLLKE TTTTAGAATCCAAA
KSTEKNSLAKSI AACAGGAAACCACA LAVKNHFIELRS CTACTAAAAGAAAA
KLSERFISHKNT ATCAACCGAGAAAA ATTCTTTAGCAAAA AGTATTCTCGCAGT
AAAAATCACTTCAT CGAATTAAGGTCAA AATTATCGGAACGT TTTATTTCGCATAAG AACACT
SS-008 Viral ATGCTGAGCTTTGT 42 MLSFVDTRTLLL 104 GGATACCCGCACCC
LAVTSCLATCQ TGCTGCTGCTGGCG GTGACCAGCTGCCT GGCGACCTGCCAG SS-009
viral ATGGGCAGCAGCCA 43 MGSSQAPRMGS 105 GGCGCCGCGCATGG VGGHGLMALLM
GCAGCGTGGGCGGC AGLILPGILA CATGGCCTGATGGC GCTGCTGATGGCGG
GCCTGATTCTGCCG GGCATTCTGGCG SS-010 Viral ATGGCGGGCATTTT 44
MAGIFYFLFSFLF 106 TTATTTTCTGTTTAG GICD CTTTCTGTTTGGCAT TTGCGAT
SS-011 Viral ATGGAAAACCGCCT 45 MENRLLRVFLV 107 GCTGCGCGTGTTTCT
WAALTMDGASA GGTGTGGGCGGCGC TGACCATGGATGGC GCGAGCGCG SS-012 Viral
ATGGCGCGCCAGGG 46 MARQGCFGSYQ 108 CTGCTTTGGCAGCT VISLFTFAIGVNL
ATCAGGTGATTAGC CLG CTGTTTACCTTTGCG ATTGGCGTGAACCT GTGCCTGGGC SS-013
Bacillus ATGAGCCGCCTGCC 47 MSRLPVLLLLQL 109 GGTGCTGCTGCTGC LVRPGLQ
TGCAGCTGCTGGTG CGCCCGGGCCTGCA G SS-014 Bacillus ATGAAACAGCAGAA 48
MKQQKRLYARL 110 ACGCCTGTATGCGC LTLLFALIFLLPH GCCTGCTGACCCTG SSASA
CTGTTTGCGCTGATT TTTCTGCTGCCGCAT AGCAGCGCGAGCGC G SS-015 Secretion
ATGGCGACGCCGCT 49 MATPLPPPSPRH 111 signal GCCTCCGCCCTCCC LRLLRLLLSG
CGCGGCACCTGCGG CTGCTGCGGCTGCT GCTCTCCGCCCTCGT CCTCGGC SS-016
Secretion ATGAAGGCTCCGGG 50 MKAPGRLVLIIL 112 signal TCGGCTCGTGCTCA
CSVVFS TCATCCTGTGCTCCG TGGTCTTCTCT SS-017 Secretion ATGCTTCAGCTTTG
51 MLQLWKLLCGV 113 signal GAAACTTGTTCTCCT LT GTGCGGCGTGCTCA CT
SS-018 Secretion ATGCTTTATCTCCAG 52 MLYLQGWSMPA 114 signal
GGTTGGAGCATGCC VA TGCTGTGGCA SS-019 Secretion ATGGATAACGTGCA 53
MDNVQPKIKHR 115 signal GCCGAAAATAAAAC PFCFSVKGHVK ATCGCCCCTTCTGCT
MLRLDIINSLVTT TCAGTGTGAAAGGC VFMLIVSVLALIP CACGTGAAGATGCT
GCGGCTGGATATTA TCAACTCACTGGTA ACAACAGTATTCAT GCTCATCGTATCTGT
GTTGGCACTGATAC CA SS-020 Secretion ATGCCCTGCCTAGA 54 MPCLDQQLTVH
116 signal CCAACAGCTCACTG ALPCPAQPSSLA TTCATGCCCTACCCT FCQVGFLTA
GCCCTGCCCAGCCC TCCTCTCTGGCCTTC TGCCAAGTGGGGTT CTTAACAGCA SS-021
Secretion ATGAAAACCTTGTT 55 MKTLFNPAPAIA 117 signal CAATCCAGCCCCTG
DLDPQFYTLSDV CCATTGCTGACCTG FCCNESEAEILTG GATCCCCAGTTCTA LTVGSAADA
CACCCTCTCAGATG TGTTCTGCTGCAAT GAAAGTGAGGCTGA GATTTTAACTGGCC
TCACGGTGGGCAGC GCTGCAGATGCT SS-022 Secretion ATGAAGCCTCTCCT 56
MKPLLVVFVFLF 118 signal TGTTGTGTTTGTCTT LWDPVLA TCTTTTCCTTTGGGA
TCCAGTGCTGGCA SS-023 Secretion ATGTCCTGTTCCCTA 57 MS CSLKFTLIVIF
119 signal AAGTTTACTTTGATT FTCTLSSS GTAATTTTTTTTTAC TGTTGGCTTTCATCC
AGC SS-024 Secretion ATGGTTCTTACTAA 58 MVLTKPLQRNG 120 signal
ACCTCTTCAAAGAA SMMSFENVKEK ATGGCAGCATGATG SREGGPHAHTPE
AGCTTTGAAAATGT EELCFVVTHTPQ GAAAGAAAAGAGC VQTTLNLFFHIF
AGAGAAGGAGGGC KVLTQPLSLLWG CCCATGCACACACA CCCGAAGAAGAATT
GTGTTTCGTGGTAA CACACTACCCTCAG GTTCAGACCACACT CAACCTGTTTTTCCA
TATATTCAAGGTTCT TACTCAACCACTTTC CCTTCTGTGGGGT SS-025 Secretion
ATGGCCACCCCGCC 59 MATPPFRLIRKM 121 signal ATTCCGGCTGATAA
FSFKVSRWMGL GGAAGATGTTTTCC ACFRSLAAS TTCAAGGTGAGCAG ATGGATGGGGCTTG
CCTGCTTCCGGTCCC TGGCGGCATCC SS-026 Secretion ATGAGCTTTTTCCA 60
MSFFQLLMKRK 122 signal ACTCCTGATGAAAA ELIPLVVFMTVA GGAAGGAACTCATT
AGGASS CCCTTGGTGGTGTTC ATGACTGTGGCGGC GGGTGGAGCCTCAT CT SS-027
Secretion ATGGTCTCAGCTCT 61 MVSALRGAPLIR 123 signal GCGGGGAGCACCCC
VHSSPVSSPSVS TGATCAGGGTGCAC GPAALVSCLSSQ TCAAGCCCTGTTTCT SSALS
TCTCCTTCTGTGAGT GGACCACGGAGGCT GGTGAGCTGCCTGT CATCCCAAAGCTCA
GCTCTGAGC SS-028 Secretion ATGATGGGGTCCCC 62 MMGSPVSHLLA 124 signal
AGTGAGTCATCTGC GFCVWVVLG TGGCCGGCTTCTGT GTGTGGGTCGTCTT GGGC SS-029
Secretion ATGGCAAGCATGGC 63 MASMAAVLTW 125 signal TGCCGTGCTCACCT
ALALLSAFSATQ GGGCTCTGGCTCTT A CTTTCAGCGTTTTCG
GCCACCCAGGCA SS-030 Secretion ATGGTGCTCATGTG 64 MVLMWTSGDAF 126
signal GACCAGTGGTGACG KTAYFLLKGAPL CCTTCAAGACGGCC QFSVCGLLQVLV
TACTTCCTGCTGAA DLAILGQATA GGGTGCCCCTCTGC AGTTCTCCGTGTGC
GGCCTGCTGCAGGT GCTGGTGGACCTGG CCATCCTGGGGCAG GCCTACGCC SS-031
Secretion ATGGATTTTGTCGCT 65 MDFVAGAIGGV 127 signal GGAGCCATCGGAGG
CGVAVGYPLDT CGTCTGCGGTGTTG VKVRIQTEPLYT CTGTGGGCTACCCC GIWHCVRDTYH
CTGGACACGGTGAA RERVWGFYRGL GGTCAGGATCCAGA SLPVCTVSLVSS
CGGAGCCAAAGTAC ACAGGCATCTGGCA CTGCGTCCGGGATA CGTATCACCGAGAG
CGCGTGTGGG GCTTCTACCGGGGC CTCTCGCTGCCCGT GTGCACGGTGTCCC TGGTATCTTCC
SS-032 Secretion ATGGAGAAGCCCCT 66 MEKPLFPLVPLH 128 signal
CTTCCCATTAGTGCC WFGFGYTALVV TTTGCATTGGTTTGG SGGIVGYVKTGS
CTTTGGCTACACAG VPSLAAGLLFGS CACTGGTTGTTTCTG LA GTGGGATCGTTGGC
TATGTAAAAACAGG CAGCGTGCCGTCCC TGGCTGCAGGGCTG CTCTTCGGCAGTCT AGCC
SS-033 Secretion ATGGGTCTGCTCCTT 67 MGLLLPLALCIL 129 signal
CCCCTGGCACTCTG VLC CATCCTAGTCCTGT GC SS-034 Secretion
ATGGGGATCCAGAC 68 MGIQTSPVLLAS 130 signal GAGCCCCGTCCTGC
LGVGLVTLLGLA TGGCCTCCCTGGGG VG GTGGGGCTGGTCAC TCTGCTCGGCCTGG
CTGTGGGC SS-035 Secretion ATGTCGGACCTGCT 69 MSDLLLLGLIGG 131 signal
ACTACTGGGCCTGA LTLLLLLTLLAF TTGGGGGCCTGACT A CTCTTACTGCTGCTG
ACGCTGCTAGCCTT TGCC SS-036 Secretion ATGGAGACTGTGGT 70 METVVIVAIGVL
132 signal GATTGTTGCCATAG ATIFLASFAALV GTGTGCTGGCCACC LVCRQ
ATGTTTCTGGCTTCG TTTGCAGCCTTGGT GCTGGTTTGCAGGC AG SS-037 Secretion
ATGCGCGGCTCTGT 71 MAGSVECTWG 133 signal GGAGTGCACCTGGG WGHCAPSPLLL
GTTGGGGGCACTGT WTLLLFAAPFGL GCCCCCAGCCCCCT LG GCTCCTTTGGACTCT
ACTTCTGTTTGCAGC CCCATTTGGCCTGCT GGGG SS-038 Secretion
ATGATGCCGTCCCG 72 MMPSRTNLATGI 134 signal TACCAACCTGGCTA
PSSKVKYSRLSS CTGGAATCCCCAGT TDDGYIDLQFKK AGTAAAGTGAAATA
TPPKIPYKAIALA TTCAAGGCTCTCCA TVLFLIGA GCACAGACGATGGC TACATTGACCTTCA
GTTTAAGAAAACCC CTCCTAAGATCCCTT ATAAGGCCATCGCA CTTGCCACTGTGCT
GTTTTTGATTGGCGC C SS-039 Secretion ATGGCCCTGCCCCA 73 MALPQMCDGSH
135 signal GATGTGTGACGGGA LASTLRYCMTVS GCCACTTGGCCTCC GTVVLVAGTLCF
ACCCTCCGCTATTG A CATGACAGTCAGCG GCACAGTGGTTCTG GTGGCCGGGACGCT
CTGCTTCGCT SS-041 Vrg-6 TGAAAAAGTGGTTC 74 MKKWFVAAGIG 136
GTTGCTGCCGGCAT AGLLMLSSAA CGGCGCTGCCGGAC TCATGCTCTCCAGC GCCGCCA
SS-042 PhoA ATGAAACAGAGCAC 75 MKQSTIALALLP 137 CATTGCGCTGGCGC
LLFTPVTKA TGCTGCCGCTGCTG TTTACCCCGGTGAC CAAAGCG SS-043 OmpA
ATGAAAAAAACCGC 76 MKKTAIAIAVAL 138 GATTGCGATTGCGG AGFATVAQA
TGGCGCTGGCGGGC TTTGCGACCGTGGC GCAGGCG SS-044 STI ATGAAAAAACTGAT 77
MKKLMLAIFFSV 139 GCTGGCGATTTTTTT LSFPSFSQS TAGCGTGCTGAGCT
TTCCGAGCTTTAGC CAGAGC SS-045 STII ATGAAAAAAAACAT 78 MKKNIAFLLAS 140
TGCGTTTCTGCTGGC MFVFSIATNAYA GAGCATGTTTGTGT TTAGCATTGCGACC
AACGCGTATGCG SS-046 Amylase ATGTTTGCGAAACG 79 MFAKRFKTSLLP 141
CTTTAAAACCAGCC LFAGFLLLFHLV TGCTGCCGCTGTTTG LAGPAAAS CGGGCTTTCTGCTG
CTGTTTCATCTGGTG CTGGCGGGCCCGGC GGCGGCGAGC SS-047 Alpha
ATGCGCTTTCCGAG 80 MRFPSIFTAVLF 142 Factor CATTTTTACCGCGGT AASSALA
GCTGTTTGCGGCGA GCAGCGCGCTGGCG SS-048 Alpha ATGCGCTTTCCGAG 81
MRFPSIFTTVLFA 143 Factor CATTTTTACCACCGT ASSALA GCTGTTTGCGGCGA
GCAGCGCGCTGGCG SS-049 Alpha ATGCGCTTTCCGAG 82 MRFPSIFTSVLFA 144
Factor CATTTTTACCAGCGT ASSALA GCTGTTTGCGGCGA GCAGCGCGCTGGCG SS-050
Alpha ATGCGCTTTCCGAG 83 MRFPSIFTHVLF 145 Factor CATTTTTACCCATGT
AASSALA GCTGTTTGCGGCGA GCAGCGCGCTGGCG SS-051 Alpha ATGCGCTTTCCGAG
84 MRFPSIFTIVLFA 146 Factor CATTTTTACCATTGT ASSALA GCTGTTTGCGGCGA
GCAGCGCGCTGGCG SS-052 Alpha ATGCGCTTTCCGAG 85 MRFPSIFTFVLFA 147
Factor CATTTTTACCTTTGT ASSALA GCTGTTTGCGGCGA GCAGCGCGCTGGCG SS-053
Alpha ATGCGCTTTCCGAG 86 MRFPSIFTEVLFA 148 Factor CATTTTTACCGAAG
ASSALA TGCTGTTTGCGGCG AGCAGCGCGCTGGC G SS-054 Alpha ATGCGCTTTCCGAG
87 MRFPSIFTGVLF 149 Factor CATTTTTACCGGCGT AASSALA GCTGTTTGCGGCGA
GCAGCGCGCTGGCG SS-055 Endoglucanase ATGCGTTCCTCCCCC 88 MRSSPLLRSAVV
150 V CTCCTCCGCTCCGCC AALPVLALA GTTGTGGCCGCCCT GCCGGTGTTGGCCC TTGCC
SS-056 Secretion ATGGGCGCGGCGGC 89 MGAAAVRWHL 151 signal
CGTGCGCTGGCACT CVLLALGTRGRL TGTGCGTGCTGCTG GCCCTGGGCACACG
CGGGCGGCTG SS-057 Fungal ATGAGGAGCTCCCT 90 MRSSLVLFFVSA 152
TGTGCTGTTCTTTGT WTALA CTCTGCGTGGACGG CCTTGGCCAG SS-058 Fibronectin
ATGCTCAGGGGTCC 91 MLRGPGPGRLLL 153 GGGACCCGGGCGGC LAVLCLGTSVRC
TGCTGCTGCTAGCA TETGKSKR GTCCTGTGCCTGGG GACATCGGTGCGCT
GCACCGAAACCGGG AAGAGCAAGAGG SS-059 Fibronectin ATGCTTAGGGGTCC 92
MLRGPGPGLLLL 154 GGGGCCCGGGCTGC AVQCLGTAVPST TGCTGCTGGCCGTC GA
CAGCTGGGGACAGC GGTGCCCTCCACG SS-060 Fibronectin ATGCGCCGGGGGGC 93
MRRGALTGLLL 155 CCTGACCGGGCTGC VLCLSVVLRAAP TCCTGGTCCTGTGCC
SATSKKRR TGAGTGTTGTGCTA CGTGCAGCCCCCTC TGCAACAAGCAAGA AGCGCAGG
[0228] In the table, SS is secretion signal and MLS is
mitochondrial leader signal. The primary constructs or mmRNA of the
present invention may be designed to encode any of the signal
sequences of SEQ ID NOs 94-155, or fragments or variants thereof.
These sequences may be included at the beginning of the polypeptide
coding region, in the middle or at the terminus or alternatively
into a flanking region. Further, any of the polynucleotide primary
constructs of the present invention may also comprise one or more
of the sequences defined by SEQ ID NOs 32-93. These may be in the
first region or either flanking region.
[0229] Additional signal sequences which may be utilized in the
present invention include those taught in, for example, databases
such as those found at http://www.signalpeptide.de/ or
http://proline.bic.nus.edu.sg/spdb/. Those described in U.S. Pat.
Nos. 8,124,379; 7,413,875 and 7,385,034 are also within the scope
of the invention and the contents of each are incorporated herein
by reference in their entirety.
Target Selection
[0230] According to the present invention, the primary constructs
comprise at least a first region of linked nucleosides encoding at
least one polypeptide of interest. The polypeptides of interest or
"Targets" of the present invention are listed in LengthyTable 6.
Shown in Lengthy Table 6, in addition to the name and description
of the gene encoding the polypeptide of interest (Target
Description) are the ENSEMBL Transcript ID (ENST), the ENSEMBL
Protein ID (ENSP) and when available the optimized transcript
sequence ID (Optimized Trans SEQ ID) or optimized open reading
frame sequence ID (Optimized ORF SEQ ID). For any particular gene
there may exist one or more variants or isoforms. Where these
exist, they are shown in the table as well. It will be appreciated
by those of skill in the art that disclosed in the Table are
potential flanking regions. These are encoded in each ENST
transcript either to the 5' (upstream) or 3' (downstream) of the
ORF or coding region. The coding region is definitively and
specifically disclosed by teaching the ENSP sequence. Consequently,
the sequences taught flanking that encoding the protein are
considered flanking regions. It is also possible to further
characterize the 5' and 3' flanking regions by utilizing one or
more available databases or algorithms. Databases have annotated
the features contained in the flanking regions of the ENST
transcripts and these are available in the art.
Protein Cleavage Signals and Sites
[0231] In one embodiment, the polypeptides of the present invention
may include at least one protein cleavage signal containing at
least one protein cleavage site. The protein cleavage site may be
located at the N-terminus, the C-terminus, at any space between the
N-- and the C-termini such as, but not limited to, half-way between
the N- and C-termini, between the N-terminus and the half way
point, between the half way point and the C-terminus, and
combinations thereof.
[0232] The polypeptides of the present invention may include, but
is not limited to, a proprotein convertase (or prohormone
convertase), thrombin or Factor Xa protein cleavage signal.
Proprotein convertases are a family of nine proteinases, comprising
seven basic amino acid-specific subtilisin-like serine proteinases
related to yeast kexin, known as prohormone convertase 1/3 (PC1/3),
PC2, furin, PC4, PC5/6, paired basic amino-acid cleaving enzyme 4
(PACE4) and PC7, and two other subtilases that cleave at non-basic
residues, called subtilisin kexin isozyme 1 (SKI-1) and proprotein
convertase subtilisin kexin 9 (PCSK9). Non-limiting examples of
protein cleavage signal amino acid sequences are listing in Table
7. In Table 7, "X" refers to any amino acid, "n" may be 0, 2, 4 or
6 amino acids and "*" refers to the protein cleavage site. In Table
7, SEQ ID NO: 251421 refers to when n=4 and SEQ ID NO: 251422
refers to when n=6.
TABLE-US-00006 TABLE 7 Protein Cleavage Site Sequences Protein
Amino Acid Cleavage SEQ Cleavage Signal Sequence ID NO Proprotein
R-X-X-R* 251419 convertase R-X-K/R-R* 251420 K/R-Xn-K/R* 251421 or
251422 Thrombin L-V-P-R*-G-S 251423 L-V-P-R* 251424
A/F/G/I/L/T/V/M-A/F/ 251425 G/I/L/T/V/W-P-R* Factor Xa I-E-G-R*
251426 I-D-G-R* 251427 A-E-G-R* 251428 A/F/G/I/L/T/V/M-D/E-G-R*
251429
[0233] In one embodiment, the primary constructs and the mmRNA of
the present invention may be engineered such that the primary
construct or mmRNA contains at least one encoded protein cleavage
signal. The encoded protein cleavage signal may be located before
the start codon, after the start codon, before the coding region,
within the coding region such as, but not limited to, half way in
the coding region, between the start codon and the half way point,
between the half way point and the stop codon, after the coding
region, before the stop codon, between two stop codons, after the
stop codon and combinations thereof
[0234] In one embodiment, the primary constructs or mmRNA of the
present invention may include at least one encoded protein cleavage
signal containing at least one protein cleavage site. The encoded
protein cleavage signal may include, but is not limited to, a
proprotein convertase (or prohormone convertase), thrombin and/or
Factor Xa protein cleavage signal. One of skill in the art may use
Table 1 above or other known methods to determine the appropriate
encoded protein cleavage signal to include in the primary
constructs or mmRNA of the present invention. For example, starting
with the signal of Table 7 and considering the codons of Table 1
one can design a signal for the primary construct which can produce
a protein signal in the resulting polypeptide.
[0235] In one embodiment, the polypeptides of the present invention
include at least one protein cleavage signal and/or site.
[0236] As a non-limiting example, U.S. Pat. No. 7,374,930 and U.S.
Pub. No. 20090227660, herein incorporated by reference in their
entireties, use a furin cleavage site to cleave the N-terminal
methionine of GLP-1 in the expression product from the Golgi
apparatus of the cells. In one embodiment, the polypeptides of the
present invention include at least one protein cleavage signal
and/or site with the proviso that the polypeptide is not GLP-1.
[0237] In one embodiment, the primary constructs or mmRNA of the
present invention includes at least one encoded protein cleavage
signal and/or site.
[0238] In one embodiment, the primary constructs or mmRNA of the
present invention includes at least one encoded protein cleavage
signal and/or site with the proviso that the primary construct or
mmRNA does not encode GLP-1.
[0239] In one embodiment, the primary constructs or mmRNA of the
present invention may include more than one coding region. Where
multiple coding regions are present in the primary construct or
mmRNA of the present invention, the multiple coding regions may be
separated by encoded protein cleavage sites. As a non-limiting
example, the primary construct or mmRNA may be signed in an ordered
pattern. On such pattern follows AXBY form where A and B are coding
regions which may be the same or different coding regions and/or
may encode the same or different polypeptides, and X and Y are
encoded protein cleavage signals which may encode the same or
different protein cleavage signals. A second such pattern follows
the form AXYBZ where A and B are coding regions which may be the
same or different coding regions and/or may encode the same or
different polypeptides, and X, Y and Z are encoded protein cleavage
signals which may encode the same or different protein cleavage
signals. A third pattern follows the form ABXCY where A, B and C
are coding regions which may be the same or different coding
regions and/or may encode the same or different polypeptides, and X
and Y are encoded protein cleavage signals which may encode the
same or different protein cleavage signals.
[0240] In one embodiment, the polypeptides, primary constructs and
mmRNA can also contain sequences that encode protein cleavage sites
so that the polypeptides, primary constructs and mmRNA can be
released from a carrier region or a fusion partner by treatment
with a specific protease for said protein cleavage site.
[0241] In one embodiment, the polypeptides, primary constructs and
mmRNA of the present invention may include a sequence encoding the
2A peptide. In one embodiment, this sequence may be used to
separate the coding region of two or more polypeptides of interest.
As a non-limiting example, the sequence encoding the 2A peptide may
be between coding region A and coding region B (A-2Apep-B). The
presence of the 2A peptide would result in the cleavage of one long
protein into protein A, protein B and the 2A peptide. Protein A and
protein B may be the same or different polypeptides of interest. In
another embodiment, the 2A peptide may be used in the
polynucleotides, primary constructs and/or mmRNA of the present
invention to produce two, three, four, five, six, seven, eight,
nine, ten or more proteins.
Incorporating Post Transcriptional Control Modulators
[0242] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA of the present invention may include at least one post
transcriptional control modulator. These post transcriptional
control modulators may be, but are not limited to, small molecules,
compounds and regulatory sequences. As a non-limiting example, post
transcriptional control may be achieved using small molecules
identified by PTC Therapeutics Inc. (South Plainfield, N.J.) using
their GEMS.TM. (Gene Expression Modulation by Small-Molecules)
screening technology.
[0243] The post transcriptional control modulator may be a gene
expression modulator which is screened by the method detailed in or
a gene expression modulator described in International Publication
No. WO2006022712, herein incorporated by reference in its entirety.
Methods identifying RNA regulatory sequences involved in
translational control are described in International Publication
No. WO2004067728, herein incorporated by reference in its entirety;
methods identifying compounds that modulate untranslated region
dependent expression of a gene are described in International
Publication No. WO2004065561, herein incorporated by reference in
its entirety.
[0244] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA of the present invention may include at least one post
transcriptional control modulator is located in the 5' and/or the
3' untranslated region of the polynucleotides, primary constructs
and/or mmRNA of the present invention
[0245] In another embodiment, the polynucleotides, primary
constructs and/or mmRNA of the present invention may include at
least one post transcription control modulator to modulate
premature translation termination. The post transcription control
modulators may be compounds described in or a compound found by
methods outlined in International Publication Nso. WO2004010106,
WO2006044456, WO2006044682, WO2006044503 and WO2006044505, each of
which is herein incorporated by reference in its entirety. As a
non-limiting example, the compound may bind to a region of the 28S
ribosomal RNA in order to modulate premature translation
termination (See e.g., WO2004010106, herein incorporated by
reference in its entirety).
[0246] In one embodiment, polynucleotides, primary constructs
and/or mmRNA of the present invention may include at least one post
transcription control modulator to alter protein expression. As a
non-limiting example, the expression of VEGF may be regulated using
the compounds described in or a compound found by the methods
described in International Publication Nos. WO2005118857,
WO2006065480, WO2006065479 and WO2006058088, each of which is
herein incorporated by reference in its entirety.
[0247] The polynucleotides, primary constructs and/or mmRNA of the
present invention may include at least one post transcription
control modulator to control translation. In one embodiment, the
post transcription control modulator may be a RNA regulatory
sequence. As a non-limiting example, the RNA regulatory sequence
may be identified by the methods described in International
Publication No. WO2006071903, herein incorporated by reference in
its entirety.
III. MODIFICATIONS
[0248] Herein, in a polynucleotide (such as a primary construct or
an mRNA molecule), the terms "modification" or, as appropriate,
"modified" refer to modification with respect to A, G, U or C
ribonucleotides. Generally, herein, these terms are not intended to
refer to the ribonucleotide modifications in naturally occurring
5'-terminal mRNA cap moieties. In a polypeptide, the term
"modification" refers to a modification as compared to the
canonical set of 20 amino acids, moiety)
[0249] The modifications may be various distinct modifications. In
some embodiments, the coding region, the flanking regions and/or
the terminal regions may contain one, two, or more (optionally
different) nucleoside or nucleotide modifications. In some
embodiments, a modified polynucleotide, primary construct, or mmRNA
introduced to a cell may exhibit reduced degradation in the cell,
as compared to an unmodified polynucleotide, primary construct, or
mmRNA.
[0250] The polynucleotides, primary constructs, and mmRNA can
include any useful modification, such as to the sugar, the
nucleobase, or the internucleoside linkage (e.g. to a linking
phosphate/to a phosphodiester linkage/to the phosphodiester
backbone). One or more atoms of a pyrimidine nucleobase may be
replaced or substituted with optionally substituted amino,
optionally substituted thiol, optionally substituted alkyl (e.g.,
methyl or ethyl), or halo (e.g., chloro or fluoro). In certain
embodiments, modifications (e.g., one or more modifications) are
present in each of the sugar and the internucleoside linkage.
Modifications according to the present invention may be
modifications of ribonucleic acids (RNAs) to deoxyribonucleic acids
(DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs),
peptide nucleic acids (PNAs), locked nucleic acids (LNAs) or
hybrids thereof). Additional modifications are described
herein.
[0251] As described herein, the polynucleotides, primary
constructs, and mmRNA of the invention do not substantially induce
an innate immune response of a cell into which the mRNA is
introduced. Features of an induced innate immune response include
1) increased expression of pro-inflammatory cytokines, 2)
activation of intracellular PRRs (RIG-I, MDA5, etc, and/or 3)
termination or reduction in protein translation.
[0252] In certain embodiments, it may desirable to intracellularly
degrade a modified nucleic acid molecule introduced into the cell.
For example, degradation of a modified nucleic acid molecule may be
preferable if precise timing of protein production is desired.
Thus, in some embodiments, the invention provides a modified
nucleic acid molecule containing a degradation domain, which is
capable of being acted on in a directed manner within a cell. In
another aspect, the present disclosure provides polynucleotides
comprising a nucleoside or nucleotide that can disrupt the binding
of a major groove interacting, e.g. binding, partner with the
polynucleotide (e.g., where the modified nucleotide has decreased
binding affinity to major groove interacting partner, as compared
to an unmodified nucleotide).
[0253] The polynucleotides, primary constructs, and mmRNA can
optionally include other agents (e.g., RNAi-inducing agents, RNAi
agents, siRNAs, shRNAs, miRNAs, antisense RNAs, ribozymes,
catalytic DNA, tRNA, RNAs that induce triple helix formation,
aptamers, vectors, etc.). In some embodiments, the polynucleotides,
primary constructs, or mmRNA may include one or more messenger RNAs
(mRNAs) and one or more modified nucleoside or nucleotides (e.g.,
mmRNA molecules). Details for these polynucleotides, primary
constructs, and mmRNA follow.
Polynucleotides and Primary Constructs
[0254] The polynucleotides, primary constructs, and mmRNA of the
invention includes a first region of linked nucleosides encoding a
polypeptide of interest, a first flanking region located at the 5'
terminus of the first region, and a second flanking region located
at the 3' terminus of the first region.
[0255] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, first flanking region, or second
flanking region) includes n number of linked nucleosides having
Formula (Ia) or Formula (Ia-1):
##STR00001##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0256] wherein
[0257] U is O, S, N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein
nu is an integer from 0 to 2 and each R.sup.U is, independently, H,
halo, or optionally substituted alkyl;
[0258] - - - is a single bond or absent;
[0259] each of R.sup.1', R.sup.2', R.sup.1'', R.sup.2'', R.sup.1,
R.sup.2, R.sup.3, R.sup.4, and R.sup.5 is independently, if
present, H, halo, hydroxy, thiol, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyloxy,
optionally substituted alkynyloxy, optionally substituted
aminoalkoxy, optionally substituted alkoxyalkoxy, optionally
substituted hydroxyalkoxy, optionally substituted amino, azido,
optionally substituted aryl, optionally substituted aminoalkyl,
optionally substituted aminoalkenyl, optionally substituted
aminoalkynyl, or absent; wherein the combination of R3 with one or
more of R1', R1'', R2', R2'', or R5 (e.g., the combination of R1'
and R3, the combination of R1'' and R3, the combination of R2' and
R3, the combination of R2'' and R3, or the combination of R5 and
R3) can join together to form optionally substituted alkylene or
optionally substituted heteroalkylene and, taken together with the
carbons to which they are attached, provide an optionally
substituted heterocyclyl (e.g., a bicyclic, tricyclic, or
tetracyclic heterocyclyl); wherein the combination of R5 with one
or more of R1', R1'', R2', or R2'' (e.g., the combination of R1'
and R5, the combination of R1'' and R5, the combination of R2' and
R5, or the combination of R2'' and R5) can join together to form
optionally substituted alkylene or optionally substituted
heteroalkylene and, taken together with the carbons to which they
are attached, provide an optionally substituted heterocyclyl (e.g.,
a bicyclic, tricyclic, or tetracyclic heterocyclyl); and wherein
the combination of R.sup.4 and one or more of R.sup.1', R.sup.1'',
R.sup.2', R.sup.2'', R.sup.3, or R.sup.5 can join together to form
optionally substituted alkylene or optionally substituted
heteroalkylene and, taken together with the carbons to which they
are attached, provide an optionally substituted heterocyclyl (e.g.,
a bicyclic, tricyclic, or tetracyclic heterocyclyl); each of m' and
m'' is, independently, an integer from 0 to 3 (e.g., from 0 to 2,
from 0 to 1, from 1 to 3, or from 1 to 2);
[0260] each of Y.sup.1, Y.sup.2, and Y.sup.3, is, independently, O,
S, Se, --NR.sup.N1--, optionally substituted alkylene, or
optionally substituted heteroalkylene, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted aryl, or
absent;
[0261] each Y.sup.4 is, independently, H, hydroxy, thiol, boranyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted thioalkoxy, optionally
substituted alkoxyalkoxy, or optionally substituted amino;
[0262] each Y.sup.5 is, independently, O, S, Se, optionally
substituted alkylene (e.g., methylene), or optionally substituted
heteroalkylene;
[0263] n is an integer from 1 to 100,000; and
[0264] B is a nucleobase (e.g., a purine, a pyrimidine, or
derivatives thereof), wherein the combination of B and R.sup.1',
the combination of B and R.sup.2', the combination of B and
R.sup.1'', or the combination of B and R.sup.2'' can, taken
together with the carbons to which they are attached, optionally
form a bicyclic group (e.g., a bicyclic heterocyclyl) or wherein
the combination of B, R.sup.1'', and R.sup.3 or the combination of
B, R.sup.2'', and R.sup.3 can optionally form a tricyclic or
tetracyclic group (e.g., a tricyclic or tetracyclic heterocyclyl,
such as in Formula (IIo)-(IIp) herein). In some embodiments, the
polynucleotide, primary construct, or mmRNA includes a modified
ribose. In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, the first flanking region, or the
second flanking region) includes n number of linked nucleosides
having Formula (Ia-2)-(Ia-5) or a pharmaceutically acceptable salt
or stereoisomer thereof.
##STR00002##
[0265] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, the first flanking region, or the
second flanking region) includes n number of linked nucleosides
having Formula (Ib) or Formula (Ib-1):
##STR00003##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0266] wherein
[0267] U is O, S, N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein
nu is an integer from 0 to 2 and each R.sup.U is, independently, H,
halo, or optionally substituted alkyl;
[0268] - - - is a single bond or absent;
[0269] each of R.sup.1, R.sup.3', R.sup.3'', and R.sup.4 is,
independently, H, halo, hydroxy, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted alkenyloxy,
optionally substituted alkynyloxy, optionally substituted
aminoalkoxy, optionally substituted alkoxyalkoxy, optionally
substituted hydroxyalkoxy, optionally substituted amino, azido,
optionally substituted aryl, optionally substituted aminoalkyl,
optionally substituted aminoalkenyl, optionally substituted
aminoalkynyl, or absent; and wherein the combination of R.sup.1 and
R.sup.3' or the combination of R.sup.1 and R.sup.3'' can be taken
together to form optionally substituted alkylene or optionally
substituted heteroalkylene (e.g., to produce a locked nucleic
acid);
[0270] each R.sup.5 is, independently, H, halo, hydroxy, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyloxy, optionally substituted alkynyloxy,
optionally substituted aminoalkoxy, optionally substituted
alkoxyalkoxy, or absent;
[0271] each of Y.sup.1, Y.sup.2, and Y.sup.3 is, independently, O,
S, Se, --NR.sup.N1--, optionally substituted alkylene, or
optionally substituted heteroalkylene, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl;
[0272] each Y.sup.4 is, independently, H, hydroxy, thiol, boranyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted alkoxyalkoxy, or optionally
substituted amino;
[0273] n is an integer from 1 to 100,000; and
[0274] B is a nucleobase.
[0275] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, first flanking region, or second
flanking region) includes n number of linked nucleosides having
Formula (Ic):
##STR00004##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0276] wherein
[0277] U is O, S, N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein
nu is an integer from 0 to 2 and each R.sup.U is, independently, H,
halo, or optionally substituted alkyl;
[0278] - - - is a single bond or absent;
[0279] each of B.sup.1, B.sup.2, and B.sup.3 is, independently, a
nucleobase (e.g., a purine, a pyrimidine, or derivatives thereof,
as described herein), H, halo, hydroxy, thiol, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyloxy, optionally substituted alkynyloxy,
optionally substituted aminoalkoxy, optionally substituted
alkoxyalkoxy, optionally substituted hydroxyalkoxy, optionally
substituted amino, azido, optionally substituted aryl, optionally
substituted aminoalkyl, optionally substituted aminoalkenyl, or
optionally substituted aminoalkynyl, wherein one and only one of
B.sup.1, B.sup.2, and B.sup.3 is a nucleobase;
[0280] each of R.sup.b1, R.sup.b2, R.sup.b3, R.sup.3, and R.sup.5
is, independently, H, halo, hydroxy, thiol, optionally substituted
alkyl, optionally substituted alkoxy, optionally substituted
alkenyloxy, optionally substituted alkynyloxy, optionally
substituted aminoalkoxy, optionally substituted alkoxyalkoxy,
optionally substituted hydroxyalkoxy, optionally substituted amino,
azido, optionally substituted aryl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl or optionally
substituted aminoalkynyl;
[0281] each of Y.sup.1, Y.sup.2, and Y.sup.3, is, independently, O,
S, Se, --NR.sup.N1--, optionally substituted alkylene, or
optionally substituted heteroalkylene, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl;
[0282] each Y.sup.4 is, independently, H, hydroxy, thiol, boranyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted thioalkoxy, optionally
substituted alkoxyalkoxy, or optionally substituted amino;
[0283] each Y.sup.5 is, independently, O, S, Se, optionally
substituted alkylene (e.g., methylene), or optionally substituted
heteroalkylene;
[0284] n is an integer from 1 to 100,000; and
[0285] wherein the ring including U can include one or more double
bonds.
[0286] In particular embodiments, the ring including U does not
have a double bond between U-CB.sup.3R.sup.b3 or between
CB.sup.3R.sup.b3-C.sup.B2R.sup.b2.
[0287] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, first flanking region, or second
flanking region) includes n number of linked nucleosides having
Formula (Id):
##STR00005##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0288] wherein
[0289] U is O, S, N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein
nu is an integer from 0 to 2 and each R.sup.U is, independently, H,
halo, or optionally substituted alkyl;
[0290] each R.sup.3 is, independently, H, halo, hydroxy, thiol,
optionally substituted alkyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted aminoalkoxy, optionally
substituted alkoxyalkoxy, optionally substituted hydroxyalkoxy,
optionally substituted amino, azido, optionally substituted aryl,
optionally substituted aminoalkyl, optionally substituted
aminoalkenyl, or optionally substituted aminoalkynyl;
[0291] each of Y.sup.1, Y.sup.2, and Y.sup.3, is, independently, O,
S, Se, --NR.sup.N1--, optionally substituted alkylene, or
optionally substituted heteroalkylene, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl;
[0292] each Y.sup.4 is, independently, H, hydroxy, thiol, boranyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted thioalkoxy, optionally
substituted alkoxyalkoxy, or optionally substituted amino;
[0293] each Y.sup.5 is, independently, O, S, optionally substituted
alkylene (e.g., methylene), or optionally substituted
heteroalkylene;
[0294] n is an integer from 1 to 100,000; and
[0295] B is a nucleobase (e.g., a purine, a pyrimidine, or
derivatives thereof).
[0296] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, first flanking region, or second
flanking region) includes n number of linked nucleosides having
Formula (Ie):
##STR00006##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0297] wherein
[0298] each of U' and U'' is, independently, O, S,
N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein nu is an integer
from 0 to 2 and each R.sup.U is, independently, H, halo, or
optionally substituted alkyl;
[0299] each R.sup.6 is, independently, H, halo, hydroxy, thiol,
optionally substituted alkyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted aminoalkoxy, optionally
substituted alkoxyalkoxy, optionally substituted hydroxyalkoxy,
optionally substituted amino, azido, optionally substituted aryl,
optionally substituted aminoalkyl, optionally substituted
aminoalkenyl, or optionally substituted aminoalkynyl;
[0300] each Y.sup.5' is, independently, O, S, optionally
substituted alkylene (e.g., methylene or ethylene), or optionally
substituted heteroalkylene;
[0301] n is an integer from 1 to 100,000; and
[0302] B is a nucleobase (e.g., a purine, a pyrimidine, or
derivatives thereof).
[0303] In some embodiments, the polynucleotide, primary construct,
or mmRNA (e.g., the first region, first flanking region, or second
flanking region) includes n number of linked nucleosides having
Formula (If) or (If-1):
##STR00007##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0304] wherein
[0305] each of U' and U'' is, independently, O, S, N,
N(R.sup.U).sub.nu, or C(R.sup.U).sub.nu, wherein nu is an integer
from 0 to 2 and each R.sup.U is, independently, H, halo, or
optionally substituted alkyl (e.g., U' is O and U'' is N);
[0306] - - - is a single bond or absent;
[0307] each of R.sup.1', R.sup.2', R.sup.1'', R.sup.2'', R.sup.3,
and R.sup.4 is, independently, H, halo, hydroxy, thiol, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyloxy, optionally substituted alkynyloxy,
optionally substituted aminoalkoxy, optionally substituted
alkoxyalkoxy, optionally substituted hydroxyalkoxy, optionally
substituted amino, azido, optionally substituted aryl, optionally
substituted aminoalkyl, optionally substituted aminoalkenyl,
optionally substituted aminoalkynyl, or absent; and wherein the
combination of R.sup.1' and R.sup.3, the combination of R.sup.1''
and R.sup.3, the combination of R.sup.2' and R.sup.3, or the
combination of R.sup.2'' and R.sup.3 can be taken together to form
optionally substituted alkylene or optionally substituted
heteroalkylene (e.g., to produce a locked nucleic acid); each of m'
and m'' is, independently, an integer from 0 to 3 (e.g., from 0 to
2, from 0 to 1, from 1 to 3, or from 1 to 2);
[0308] each of Y.sup.1, Y.sup.2, and Y.sup.3, is, independently, O,
S, Se, --NR.sup.N1--, optionally substituted alkylene, or
optionally substituted heteroalkylene, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted aryl, or
absent;
[0309] each Y.sup.4 is, independently, H, hydroxy, thiol, boranyl,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted thioalkoxy, optionally
substituted alkoxyalkoxy, or optionally substituted amino;
[0310] each Y.sup.5 is, independently, O, S, Se, optionally
substituted alkylene (e.g., methylene), or optionally substituted
heteroalkylene;
[0311] n is an integer from 1 to 100,000; and
[0312] B is a nucleobase (e.g., a purine, a pyrimidine, or
derivatives thereof).
[0313] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia), (Ia-1)-(Ia-3),
(Ib)-(If), and (IIa)-(IIp)), the ring including U has one or two
double bonds.
[0314] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each of R.sup.1, R.sup.1', and
R.sup.1'', if present, is H. In further embodiments, each of
R.sup.2, R.sup.2', and R.sup.2'', if present, is, independently, H,
halo (e.g., fluoro), hydroxy, optionally substituted alkoxy (e.g.,
methoxy or ethoxy), or optionally substituted alkoxyalkoxy. In
particular embodiments, alkoxyalkoxy is
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl). In some embodiments, s2
is 0, s1 is 1 or 2, s3 is 0 or 1, and R' is C.sub.1-6 alkyl.
[0315] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each of R.sup.2, R.sup.2', and
R.sup.2'', if present, is H. In further embodiments, each of
R.sup.1, R.sup.1', and R.sup.1'', if present, is, independently, H,
halo (e.g., fluoro), hydroxy, optionally substituted alkoxy (e.g.,
methoxy or ethoxy), or optionally substituted alkoxyalkoxy. In
particular embodiments, alkoxyalkoxy is
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl). In some embodiments, s2
is 0, s1 is 1 or 2, s3 is 0 or 1, and R' is C.sub.1-6 alkyl.
[0316] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each of R.sup.3, R.sup.4, and
R.sup.5 is, independently, H, halo (e.g., fluoro), hydroxy,
optionally substituted alkyl, optionally substituted alkoxy (e.g.,
methoxy or ethoxy), or optionally substituted alkoxyalkoxy. In
particular embodiments, R.sup.3 is H, R.sup.4 is H, R.sup.5 is H,
or R.sup.3, R.sup.4, and R.sup.5 are all H. In particular
embodiments, R.sup.3 is C.sub.1-6 alkyl, R.sup.4 is C.sub.1-6
alkyl, R.sup.5 is C.sub.1-6 alkyl, or R.sup.3, R.sup.4, and R.sup.5
are all C.sub.1-6 alkyl. In particular embodiments, R.sup.3 and
R.sup.4 are both H, and R.sup.5 is C.sub.1-6 alkyl.
[0317] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), R.sup.3 and R.sup.5 join together to
form optionally substituted alkylene or optionally substituted
heteroalkylene and, taken together with the carbons to which they
are attached, provide an optionally substituted heterocyclyl (e.g.,
a bicyclic, tricyclic, or tetracyclic heterocyclyl, such as
trans-3',4' analogs, wherein R.sup.3 and R.sup.5 join together to
form heteroalkylene (e.g.,
--(CH.sub.2).sub.b1O(CH.sub.2).sub.b2O(CH.sub.2).sub.b3--, wherein
each of b1, b2, and b3 are, independently, an integer from 0 to
3).
[0318] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), R.sup.3 and one or more of R.sup.1',
R.sup.1'', R.sup.2', R.sup.2'', or R.sup.5 join together to form
optionally substituted alkylene or optionally substituted
heteroalkylene and, taken together with the carbons to which they
are attached, provide an optionally substituted heterocyclyl (e.g.,
a bicyclic, tricyclic, or tetracyclic heterocyclyl, R.sup.3 and one
or more of R.sup.1', R.sup.1'', R.sup.2', R.sup.2'', or R.sup.5
join together to form heteroalkylene (e.g.,
--(CH.sub.2).sub.b1O(CH.sub.2).sub.b2O(CH.sub.2).sub.b3--, wherein
each of b1, b2, and b3 are, independently, an integer from 0 to
3).
[0319] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), R.sup.5 and one or more of R.sup.1',
R.sup.1'', R.sup.2', or R.sup.2'' join together to form optionally
substituted alkylene or optionally substituted heteroalkylene and,
taken together with the carbons to which they are attached, provide
an optionally substituted heterocyclyl (e.g., a bicyclic,
tricyclic, or tetracyclic heterocyclyl, R.sup.5 and one or more of
R.sup.1', R.sup.1'', R.sup.2', or R.sup.2'' join together to form
heteroalkylene (e.g.,
--(CH.sub.2).sub.b1O(CH.sub.2).sub.b2O(CH.sub.2).sub.b3--, wherein
each of b1, b2, and b3 are, independently, an integer from 0 to
3).
[0320] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each Y.sup.2 is, independently, O,
S, or --NR.sup.N1--, wherein R.sup.N1 is H, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, or optionally substituted aryl. In particular embodiments,
Y.sup.2 is NR.sup.N1--, wherein R.sup.N1 is H or optionally
substituted alkyl (e.g., C.sub.1-6 alkyl, such as methyl, ethyl,
isopropyl, or n-propyl).
[0321] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each Y.sup.3 is, independently, O or
S.
[0322] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), R.sup.1 is H; each R.sup.2 is,
independently, H, halo (e.g., fluoro), hydroxy, optionally
substituted alkoxy (e.g., methoxy or ethoxy), or optionally
substituted alkoxyalkoxy (e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, such as wherein s2 is 0,
s1 is 1 or 2, s3 is 0 or 1, and R' is C.sub.1-6 alkyl); each
Y.sup.2 is, independently, O or --NR.sup.N1--, wherein R.sup.N1 is
H, optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl
(e.g., wherein R.sup.N1 is H or optionally substituted alkyl (e.g.,
C.sub.1-6 alkyl, such as methyl, ethyl, isopropyl, or n-propyl));
and each Y.sup.3 is, independently, O or S (e.g., S). In further
embodiments, R.sup.3 is H, halo (e.g., fluoro), hydroxy, optionally
substituted alkyl, optionally substituted alkoxy (e.g., methoxy or
ethoxy), or optionally substituted alkoxyalkoxy. In yet further
embodiments, each Y.sup.1 is, independently, O or --NR.sup.N1--,
wherein R.sup.N1 is H, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, or optionally
substituted aryl (e.g., wherein R.sup.N1 is H or optionally
substituted alkyl (e.g., C.sub.1-6 alkyl, such as methyl, ethyl,
isopropyl, or n-propyl)); and each Y.sup.4 is, independently, H,
hydroxy, thiol, optionally substituted alkyl, optionally
substituted alkoxy, optionally substituted thioalkoxy, optionally
substituted alkoxyalkoxy, or optionally substituted amino.
[0323] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), each R.sup.1 is, independently, H,
halo (e.g., fluoro), hydroxy, optionally substituted alkoxy (e.g.,
methoxy or ethoxy), or optionally substituted alkoxyalkoxy (e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, such as wherein s2 is 0,
s1 is 1 or 2, s3 is 0 or 1, and R' is C.sub.1-6 alkyl); R.sup.2 is
H; each Y.sup.2 is, independently, 0 or --NR.sup.N1--, wherein
R.sup.N1 is H, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, or optionally substituted
aryl (e.g., wherein R.sup.N1 is H or optionally substituted alkyl
(e.g., C.sub.1-6 alkyl, such as methyl, ethyl, isopropyl, or
n-propyl)); and each Y.sup.3 is, independently, O or S (e.g., S).
In further embodiments, R.sup.3 is H, halo (e.g., fluoro), hydroxy,
optionally substituted alkyl, optionally substituted alkoxy (e.g.,
methoxy or ethoxy), or optionally substituted alkoxyalkoxy. In yet
further embodiments, each Y.sup.1 is, independently, O or
--NR.sup.N1--, wherein R.sup.N1 is H, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl, or
optionally substituted aryl (e.g., wherein R.sup.N1 is H or
optionally substituted alkyl (e.g., C.sub.1-6 alkyl, such as
methyl, ethyl, isopropyl, or n-propyl)); and each Y.sup.4 is,
independently, H, hydroxy, thiol, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted thioalkoxy,
optionally substituted alkoxyalkoxy, or optionally substituted
amino.
[0324] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), the ring including U is in the
.beta.-D (e.g., .beta.-D-ribo) configuration.
[0325] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), the ring including U is in the
.alpha.-L (e.g., .alpha.-L-ribo) configuration.
[0326] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), one or more B is not pseudouridine
(.psi.) or 5-methyl-cytidine (m.sup.5C). In some embodiments, about
10% to about 100% of n number of B nucleobases is not .psi. or
m.sup.5C (e.g., from 10% to 20%, from 10% to 35%, from 10% to 50%,
from 10% to 60%, from 10% to 75%, from 10% to 90%, from 10% to 95%,
from 10% to 98%, from 10% to 99%, from 20% to 35%, from 20% to 50%,
from 20% to 60%, from 20% to 75%, from 20% to 90%, from 20% to 95%,
from 20% to 98%, from 20% to 99%, from 20% to 100%, from 50% to
60%, from 50% to 75%, from 50% to 90%, from 50% to 95%, from 50% to
98%, from 50% to 99%, from 50% to 100%, from 75% to 90%, from 75%
to 95%, from 75% to 98%, from 75% to 99%, and from 75% to 100% of n
number of B is not .psi. or m.sup.5C). In some embodiments, B is
not .psi. or m.sup.5C.
[0327] In some embodiments of the polynucleotides, primary
constructs, or mmRNA (e.g., Formulas (Ia)-(Ia-5), (Ib)-(If-1),
(IIa)-(IIp), (IIb-1), (IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2),
(IVa)-(IVl), and (IXa)-(IXr)), when B is an unmodified nucleobase
selected from cytosine, guanine, uracil and adenine, then at least
one of Y.sup.1, Y.sup.2, or Y.sup.3 is not O.
[0328] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes a modified ribose. In some embodiments, the
polynucleotide, primary construct, or mmRNA (e.g., the first
region, the first flanking region, or the second flanking region)
includes n number of linked nucleosides having Formula
(IIa)-(IIc):
##STR00008##
or a pharmaceutically acceptable salt or stereoisomer thereof. In
particular embodiments, U is O or C(R.sup.U).sub.nu, wherein nu is
an integer from 0 to 2 and each R.sup.U is, independently, H, halo,
or optionally substituted alkyl (e.g., U is --CH.sub.2--or --CH--).
In other embodiments, each of R.sup.1, R.sup.2, R.sup.3, R.sup.4,
and R.sup.5 is, independently, H, halo, hydroxy, thiol, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyloxy, optionally substituted alkynyloxy,
optionally substituted aminoalkoxy, optionally substituted
alkoxyalkoxy, optionally substituted hydroxyalkoxy, optionally
substituted amino, azido, optionally substituted aryl, optionally
substituted aminoalkyl, optionally substituted aminoalkenyl,
optionally substituted aminoalkynyl, or absent (e.g., each R.sup.1
and R.sup.2 is, independently, H, halo, hydroxy, optionally
substituted alkyl, or optionally substituted alkoxy; each R.sup.3
and R.sup.4 is, independently, H or optionally substituted alkyl;
and R.sup.5 is H or hydroxy), and is a single bond or double
bond.
[0329] In particular embodiments, the polynucleotides or mmRNA
includes n number of linked nucleosides having Formula
(IIb-1)-(IIb-2):
##STR00009##
or a pharmaceutically acceptable salt or stereoisomer thereof. In
some embodiments, U is O or C(R.sup.U).sub.nu, wherein nu is an
integer from 0 to 2 and each R.sup.U is, independently, H, halo, or
optionally substituted alkyl (e.g., U is --CH.sub.2-- or --CH--).
In other embodiments, each of R.sup.1 and R.sup.2 is,
independently, H, halo, hydroxy, thiol, optionally substituted
alkyl, optionally substituted alkoxy, optionally substituted
alkenyloxy, optionally substituted alkynyloxy, optionally
substituted aminoalkoxy, optionally substituted alkoxyalkoxy,
optionally substituted hydroxyalkoxy, optionally substituted amino,
azido, optionally substituted aryl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl, or absent (e.g., each R.sup.1 and R.sup.2
is, independently, H, halo, hydroxy, optionally substituted alkyl,
or optionally substituted alkoxy, e.g., H, halo, hydroxy, alkyl, or
alkoxy). In particular embodiments, R.sup.2 is hydroxy or
optionally substituted alkoxy (e.g., methoxy, ethoxy, or any
described herein).
[0330] In particular embodiments, the polynucleotide, primary
construct, or mmRNA includes n number of linked nucleosides having
Formula (IIc-1)-(IIc-4):
##STR00010##
or a pharmaceutically acceptable salt or stereoisomer thereof. In
some embodiments, U is O or C(R.sup.U).sub.nu, wherein nu is an
integer from 0 to 2 and each R.sup.U is, independently, H, halo, or
optionally substituted alkyl (e.g., U is --CH.sub.2-- or --CH--).
In some embodiments, each of R.sup.1, R.sup.2, and R.sup.3 is,
independently, H, halo, hydroxy, thiol, optionally substituted
alkyl, optionally substituted alkoxy, optionally substituted
alkenyloxy, optionally substituted alkynyloxy, optionally
substituted aminoalkoxy, optionally substituted alkoxyalkoxy,
optionally substituted hydroxyalkoxy, optionally substituted amino,
azido, optionally substituted aryl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl, or absent (e.g., each R.sup.1 and R.sup.2
is, independently, H, halo, hydroxy, optionally substituted alkyl,
or optionally substituted alkoxy, e.g., H, halo, hydroxy, alkyl, or
alkoxy; and each R.sup.3 is, independently, H or optionally
substituted alkyl)). In particular embodiments, R.sup.2 is
optionally substituted alkoxy (e.g., methoxy or ethoxy, or any
described herein). In particular embodiments, R.sup.1 is optionally
substituted alkyl, and R.sup.2 is hydroxy. In other embodiments,
R.sup.1 is hydroxy, and R.sup.2 is optionally substituted alkyl. In
further embodiments, R.sup.3 is optionally substituted alkyl.
[0331] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes an acyclic modified ribose. In some embodiments,
the polynucleotide, primary construct, or mmRNA (e.g., the first
region, the first flanking region, or the second flanking region)
includes n number of linked nucleosides having Formula
(IId)-(IIf):
##STR00011##
or a pharmaceutically acceptable salt or stereoisomer thereof
[0332] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes an acyclic modified hexitol. In some embodiments,
the polynucleotide, primary construct, or mmRNA (e.g., the first
region, the first flanking region, or the second flanking region)
includes n number of linked nucleosides Formula (IIg)-(IIj):
##STR00012##
or a pharmaceutically acceptable salt or stereoisomer thereof
[0333] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes a sugar moiety having a contracted or an expanded
ribose ring. In some embodiments, the polynucleotide, primary
construct, or mmRNA (e.g., the first region, the first flanking
region, or the second flanking region) includes n number of linked
nucleosides having Formula
(IIk)-(IIm):
##STR00013##
[0334] or a pharmaceutically acceptable salt or stereoisomer
thereof, wherein each of R.sup.1', R.sup.1'', R.sup.2', and
R.sup.2'' is, independently, H, halo, hydroxy, optionally
substituted alkyl, optionally substituted alkoxy, optionally
substituted alkenyloxy, optionally substituted alkynyloxy,
optionally substituted aminoalkoxy, optionally substituted
alkoxyalkoxy, or absent; and wherein the combination of R.sup.2'
and R.sup.3 or the combination of R.sup.2'' and R.sup.3 can be
taken together to form optionally substituted alkylene or
optionally substituted heteroalkylene.
[0335] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes a locked modified ribose. In some embodiments,
the polynucleotide, primary construct, or mmRNA (e.g., the first
region, the first flanking region, or the second flanking region)
includes n number of linked nucleosides having Formula (IIn):
##STR00014##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein R.sup.3' is O, S, or --NR.sup.N1--, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl and
R.sup.3'' is optionally substituted alkylene (e.g., --CH.sub.2--,
--CH.sub.2CH.sub.2--, or --CH.sub.2CH.sub.2CH.sub.2--) or
optionally substituted heteroalkylene (e.g., --CH.sub.2NH--,
--CH.sub.2CH.sub.2NH--, --CH.sub.2OCH.sub.2--, or
--CH.sub.2CH.sub.2OCH.sub.2--) (e.g., R.sup.3' is O and R.sup.3''
is optionally substituted alkylene (e.g., --CH.sub.2--,
--CH.sub.2CH.sub.2--, or --CH.sub.2CH.sub.2CH.sub.2--)).
[0336] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes n number of linked nucleosides having Formula
(IIn-1)-(II-n2):
##STR00015##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein R.sup.3' is O, S, or --NR.sup.N1--, wherein R.sup.N1 is H,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, or optionally substituted aryl and
R.sup.3'' is optionally substituted alkylene (e.g., --CH.sub.2--,
--CH.sub.2CH.sub.2--, or --CH.sub.2CH.sub.2CH.sub.2--) or
optionally substituted heteroalkylene (e.g., --CH.sub.2NH--,
--CH.sub.2CH.sub.2NH--, --CH.sub.2OCH.sub.2--, or
--CH.sub.2CH.sub.2OCH.sub.2--) (e.g., R.sup.3' is O and R.sup.3''
is optionally substituted alkylene (e.g., --CH.sub.2--,
--CH.sub.2CH.sub.2--, or --CH.sub.2CH.sub.2CH.sub.2--)).
[0337] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes a locked modified ribose that forms a tetracyclic
heterocyclyl. In some embodiments, the polynucleotide, primary
construct, or mmRNA (e.g., the first region, the first flanking
region, or the second flanking region) includes n number of linked
nucleosides having Formula (IIo):
##STR00016##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein R.sup.12a, R.sup.12c, T.sup.1', T.sup.1'', T.sup.2',
T.sup.2'', V.sup.1, and V.sup.3 are as described herein.
[0338] Any of the formulas for the polynucleotides, primary
constructs, or mmRNA can include one or more nucleobases described
herein (e.g., Formulas (b1)-(b43)).
[0339] In one embodiment, the present invention provides methods of
preparing a polynucleotide, primary construct, or mmRNA, wherein
the polynucleotide comprises n number of nucleosides having Formula
(Ia), as defined herein:
##STR00017##
the method comprising reacting a compound of Formula (Ma), as
defined herein:
##STR00018##
with an RNA polymerase, and a cDNA template.
[0340] In a further embodiment, the present invention provides
methods of amplifying a polynucleotide, primary construct, or mmRNA
comprising at least one nucleotide (e.g., mmRNA molecule), the
method comprising: reacting a compound of Formula (Ma), as defined
herein, with a primer, a cDNA template, and an RNA polymerase.
[0341] In one embodiment, the present invention provides methods of
preparing a polynucleotide, primary construct, or mmRNA comprising
at least one nucleotide (e.g., mmRNA molecule), wherein the
polynucleotide comprises n number of nucleosides having Formula
(Ia), as defined herein:
##STR00019##
the method comprising reacting a compound of Formula (IIIa-1), as
defined herein:
##STR00020##
with an RNA polymerase, and a cDNA template.
[0342] In a further embodiment, the present invention provides
methods of amplifying a polynucleotide, primary construct, or mmRNA
comprising at least one nucleotide (e.g., mmRNA molecule), the
method comprising:
[0343] reacting a compound of Formula (IIIa-1), as defined herein,
with a primer, a cDNA template, and an RNA polymerase.
[0344] In one embodiment, the present invention provides methods of
preparing a modified mRNA comprising at least one nucleotide (e.g.,
mmRNA molecule), wherein the polynucleotide comprises n number of
nucleosides having Formula (Ia-2), as defined herein:
##STR00021##
the method comprising reacting a compound of Formula (IIIa-2), as
defined herein:
##STR00022##
with an RNA polymerase, and a cDNA template.
[0345] In a further embodiment, the present invention provides
methods of amplifying a modified mRNA comprising at least one
nucleotide (e.g., mmRNA molecule), the method comprising:
[0346] reacting a compound of Formula (IIIa-2), as defined herein,
with a primer, a cDNA template, and an RNA polymerase.
[0347] In some embodiments, the reaction may be repeated from 1 to
about 7,000 times. In any of the embodiments herein, B may be a
nucleobase of Formula (b1)-(b43).
[0348] The polynucleotides, primary constructs, and mmRNA can
optionally include 5' and/or 3' flanking regions, which are
described herein.
Modified RNA (mmRNA) Molecules
[0349] The present invention also includes building blocks, e.g.,
modified ribonucleosides, modified ribonucleotides, of modified RNA
(mmRNA) molecules. For example, these building blocks can be useful
for preparing the polynucleotides, primary constructs, or mmRNA of
the invention.
In some embodiments, the building block molecule has Formula (IIIa)
or (IIIa-1):
##STR00023##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein the substituents are as described herein (e.g., for Formula
(Ia) and (Ia-1)), and wherein when B is an unmodified nucleobase
selected from cytosine, guanine, uracil and adenine, then at least
one of Y.sup.1, Y.sup.2, or Y.sup.3 is not O.
[0350] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IVa)-(IVb):
##STR00024##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)). In
particular embodiments, Formula (IVa) or (IVb) is combined with a
modified uracil (e.g., any one of formulas (b1)-(b9), (b21)-(b23),
and (b28)-(b31), such as formula (b1), (b8), (b28), (b29), or
(b30)). In particular embodiments, Formula (IVa) or (IVb) is
combined with a modified cytosine (e.g., any one of formulas
(b10)-(b14), (b24), (b25), and (b32)-(b36), such as formula (b10)
or (b32)). In particular embodiments, Formula (IVa) or (IVb) is
combined with a modified guanine (e.g., any one of formulas
(b15)-(b17) and (b37)-(b40)). In particular embodiments, Formula
(IVa) or (IVb) is combined with a modified adenine (e.g., any one
of formulas (b18)-(b20) and (b41)-(b43)).
[0351] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IVc)-(IVk):
##STR00025## ##STR00026##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)). In
particular embodiments, one of Formulas (IVc)-(IVk) is combined
with a modified uracil (e.g., any one of formulas (b1)-(b9),
(b21)-(b23), and (b28)-(b31), such as formula (b1), (b8), (b28),
(b29), or (b30)). In particular embodiments, one of Formulas
(IVc)-(IVk) is combined with a modified cytosine (e.g., any one of
formulas (b10)-(b14), (b24), (b25), and (b32)-(b36), such as
formula (b10) or (b32)). In particular embodiments, one of Formulas
(IVc)-(IVk) is combined with a modified guanine (e.g., any one of
formulas (b15)-(b17) and (b37)-(b40)). In particular embodiments,
one of Formulas (IVc)-(IVk) is combined with a modified adenine
(e.g., any one of formulas (b18)-(b20) and (b41)-(b43)).
[0352] In other embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (Va) or (Vb):
##STR00027##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)).
[0353] In other embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IXa)-(IXd):
##STR00028##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)). In
particular embodiments, one of Formulas (IXa)-(IXd) is combined
with a modified uracil (e.g., any one of formulas (b1)-(b9),
(b21)-(b23), and (b28)-(b31), such as formula (b1), (b8), (b28),
(b29), or (b30)). In particular embodiments, one of Formulas
(IXa)-(IXd) is combined with a modified cytosine (e.g., any one of
formulas (b10)-(b14), (b24), (b25), and (b32)-(b36), such as
formula (b10) or (b32)). In particular embodiments, one of Formulas
(IXa)-(IXd) is combined with a modified guanine (e.g., any one of
formulas (b15)-(b17) and (b37)-(b40)). In particular embodiments,
one of Formulas (IXa)-(IXd) is combined with a modified adenine
(e.g., any one of formulas (b18)-(b20) and (b41)-(b43)).
[0354] In other embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IXe)-(IXg):
##STR00029##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)). In
particular embodiments, one of Formulas (IXe)-(IXg) is combined
with a modified uracil (e.g., any one of formulas (b1)-(b9),
(b21)-(b23), and (b28)-(b31), such as formula (b1), (b8), (b28),
(b29), or (b30)). In particular embodiments, one of Formulas
(IXe)-(IXg) is combined with a modified cytosine (e.g., any one of
formulas (b10)-(b14), (b24), (b25), and (b32)-(b36), such as
formula (b10) or (b32)). In particular embodiments, one of Formulas
(IXe)-(IXg) is combined with a modified guanine (e.g., any one of
formulas (b15)-(b17) and (b37)-(b40)). In particular embodiments,
one of Formulas (IXe)-(IXg) is combined with a modified adenine
(e.g., any one of formulas (b18)-(b20) and (b41)-(b43)).
[0355] In other embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IXh)-(IXk):
##STR00030##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein B is as described herein (e.g., any one of (b1)-(b43)). In
particular embodiments, one of Formulas (IXh)-(IXk) is combined
with a modified uracil (e.g., any one of formulas (b1)-(b9),
(b21)-(b23), and (b28)-(b31), such as formula (b1), (b8), (b28),
(b29), or (b30)). In particular embodiments, one of Formulas
(IXh)-(IXk) is combined with a modified cytosine (e.g., any one of
formulas (b10)-(b14), (b24), (b25), and (b32)-(b36), such as
formula (b10) or (b32)). In particular embodiments, one of Formulas
(IXh)-(IXk) is combined with a modified guanine (e.g., any one of
formulas (b15)-(b17) and (b37)-(b40)). In particular embodiments,
one of Formulas (IXh)-(IXk) is combined with a modified adenine
(e.g., any one of formulas (b18)-(b20) and (b41)-(b43)).
[0356] In other embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
has Formula (IXl)-(IXr):
##STR00031##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r1 and r2 is, independently, an integer from 0 to 5
(e.g., from 0 to 3, from 1 to 3, or from 1 to 5) and B is as
described herein (e.g., any one of (b1)-(b43)). In particular
embodiments, one of Formulas (IXl)-(IXr) is combined with a
modified uracil (e.g., any one of formulas (b1)-(b9), (b21)-(b23),
and (b28)-(b31), such as formula (b1), (b8), (b28), (b29), or
(b30)). In particular embodiments, one of Formulas (IXl)-(IXr) is
combined with a modified cytosine (e.g., any one of formulas
(b10)-(b14), (b24), (b25), and (b32)-(b36), such as formula (b10)
or (b32)). In particular embodiments, one of Formulas (IXl)-(IXr)
is combined with a modified guanine (e.g., any one of formulas
(b15)-(b17) and (b37)-(b40)). In particular embodiments, one of
Formulas (IXl)-(IXr) is combined with a modified adenine (e.g., any
one of formulas (b18)-(b20) and (b41)-(b43)).
[0357] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
can be selected from the group consisting of:
##STR00032## ##STR00033##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5).
[0358] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
can be selected from the group consisting of:
##STR00034## ##STR00035##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5) and s1 is as described
herein.
[0359] In some embodiments, the building block molecule, which may
be incorporated into a nucleic acid (e.g., RNA, mRNA,
polynucleotide, primary construct, or mmRNA), is a modified uridine
(e.g., selected from the group consisting of:
##STR00036## ##STR00037## ##STR00038## ##STR00039## ##STR00040##
##STR00041## ##STR00042## ##STR00043## ##STR00044## ##STR00045##
##STR00046## ##STR00047## ##STR00048## ##STR00049## ##STR00050##
##STR00051## ##STR00052## ##STR00053## ##STR00054## ##STR00055##
##STR00056##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein Y.sup.1, Y.sup.3, Y.sup.4, Y.sup.6, and r are as described
herein (e.g., each r is, independently, an integer from 0 to 5,
such as from 0 to 3, from 1 to 3, or from 1 to 5)).
[0360] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
is a modified cytidine (e.g., selected from the group consisting
of:
##STR00057## ##STR00058## ##STR00059## ##STR00060## ##STR00061##
##STR00062## ##STR00063##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein Y', Y.sup.3, Y.sup.4, Y.sup.6, and r are as described
herein (e.g., each r is, independently, an integer from 0 to 5,
such as from 0 to 3, from 1 to 3, or from 1 to 5)). For example,
the building block molecule, which may be incorporated into a
polynucleotide, primary construct, or mmRNA, can be:
##STR00064##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5).
[0361] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
is a modified adenosine (e.g., selected from the group consisting
of:
##STR00065## ##STR00066## ##STR00067## ##STR00068## ##STR00069##
##STR00070## ##STR00071## ##STR00072## ##STR00073##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein Y.sup.1, Y.sup.3, Y.sup.4, Y.sup.6, and r are as described
herein (e.g., each r is, independently, an integer from 0 to 5,
such as from 0 to 3, from 1 to 3, or from 1 to 5)).
[0362] In some embodiments, the building block molecule, which may
be incorporated into a polynucleotide, primary construct, or mmRNA,
is a modified guanosine (e.g., selected from the group consisting
of:
##STR00074## ##STR00075## ##STR00076## ##STR00077## ##STR00078##
##STR00079## ##STR00080## ##STR00081##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein Y.sup.1, Y.sup.3, Y.sup.4, Y.sup.6, and r are as described
herein (e.g., each r is, independently, an integer from 0 to 5,
such as from 0 to 3, from 1 to 3, or from 1 to 5)).
[0363] In some embodiments, the chemical modification can include
replacement of C group at C-5 of the ring (e.g., for a pyrimidine
nucleoside, such as cytosine or uracil) with N (e.g., replacement
of the >CH group at C-5 with >NR.sup.N1 group, wherein
R.sup.N1 is H or optionally substituted alkyl). For example, the
building block molecule, which may be incorporated into a
polynucleotide, primary construct, or mmRNA, can be:
##STR00082##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5).
[0364] In another embodiment, the chemical modification can include
replacement of the hydrogen at C-5 of cytosine with halo (e.g., Br,
Cl, F, or I) or optionally substituted alkyl (e.g., methyl). For
example, the building block molecule, which may be incorporated
into a polynucleotide, primary construct, or mmRNA, can be:
##STR00083##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5).
[0365] In yet a further embodiment, the chemical modification can
include a fused ring that is formed by the NH.sub.2 at the C-4
position and the carbon atom at the C-5 position. For example, the
building block molecule, which may be incorporated into a
polynucleotide, primary construct, or mmRNA, can be:
##STR00084##
or a pharmaceutically acceptable salt or stereoisomer thereof,
wherein each r is, independently, an integer from 0 to 5 (e.g.,
from 0 to 3, from 1 to 3, or from 1 to 5).
Modifications on the Sugar
[0366] The modified nucleosides and nucleotides (e.g., building
block molecules), which may be incorporated into a polynucleotide,
primary construct, or mmRNA (e.g., RNA or mRNA, as described
herein), can be modified on the sugar of the ribonucleic acid. For
example, the 2' hydroxyl group (OH) can be modified or replaced
with a number of different substituents. Exemplary substitutions at
the 2'-position include, but are not limited to, H, halo,
optionally substituted C.sub.1-6 alkyl; optionally substituted
C.sub.1-6 alkoxy; optionally substituted C.sub.6-10 aryloxy;
optionally substituted C.sub.3-8 cycloalkyl; optionally substituted
C.sub.3-8 cycloalkoxy; optionally substituted C.sub.6-10 aryloxy;
optionally substituted C.sub.6-10 aryl-C.sub.1-6 alkoxy, optionally
substituted C.sub.1-12 (heterocyclyl)oxy; a sugar (e.g., ribose,
pentose, or any described herein); a polyethyleneglycol (PEG),
--O(CH.sub.2CH.sub.2O).sub.nCH.sub.2CH.sub.2OR, where R is H or
optionally substituted alkyl, and n is an integer from 0 to 20
(e.g., from 0 to 4, from 0 to 8, from 0 to 10, from 0 to 16, from 1
to 4, from 1 to 8, from 1 to 10, from 1 to 16, from 1 to 20, from 2
to 4, from 2 to 8, from 2 to 10, from 2 to 16, from 2 to 20, from 4
to 8, from 4 to 10, from 4 to 16, and from 4 to 20); "locked"
nucleic acids (LNA) in which the 2'-hydroxyl is connected by a
C.sub.1-6 alkylene or C.sub.1-6 heteroalkylene bridge to the
4'-carbon of the same ribose sugar, where exemplary bridges
included methylene, propylene, ether, or amino bridges; aminoalkyl,
as defined herein; aminoalkoxy, as defined herein; amino as defined
herein; and amino acid, as defined herein
Generally, RNA includes the sugar group ribose, which is a
5-membered ring having an oxygen. Exemplary, non-limiting modified
nucleotides include replacement of the oxygen in ribose (e.g., with
S, Se, or alkylene, such as methylene or ethylene); addition of a
double bond (e.g., to replace ribose with cyclopentenyl or
cyclohexenyl); ring contraction of ribose (e.g., to form a
4-membered ring of cyclobutane or oxetane); ring expansion of
ribose (e.g., to form a 6- or 7-membered ring having an additional
carbon or heteroatom, such as for anhydrohexitol, altritol,
mannitol, cyclohexanyl, cyclohexenyl, and morpholino that also has
a phosphoramidate backbone); multicyclic forms (e.g., tricyclo; and
"unlocked" forms, such as glycol nucleic acid (GNA) (e.g., R-GNA or
S-GNA, where ribose is replaced by glycol units attached to
phosphodiester bonds), threose nucleic acid (TNA, where ribose is
replace with .alpha.-L-threofuranosyl-(3'.fwdarw.2')), and peptide
nucleic acid (PNA, where 2-amino-ethyl-glycine linkages replace the
ribose and phosphodiester backbone). The sugar group can also
contain one or more carbons that possess the opposite
stereochemical configuration than that of the corresponding carbon
in ribose. Thus, a polynucleotide, primary construct, or mmRNA
molecule can include nucleotides containing, e.g., arabinose, as
the sugar.
Modifications on the Nucleobase
[0367] The present disclosure provides for modified nucleosides and
nucleotides. As described herein "nucleoside" is defined as a
compound containing a sugar molecule (e.g., a pentose or ribose) or
a derivative thereof in combination with an organic base (e.g., a
purine or pyrimidine) or a derivative thereof (also referred to
herein as "nucleobase"). As described herein, "nucleotide" is
defined as a nucleoside including a phosphate group. The modified
nucleotides may by synthesized by any useful method, as described
herein (e.g., chemically, enzymatically, or recombinantly to
include one or more modified or non-natural nucleosides).
[0368] The modified nucleotide base pairing encompasses not only
the standard adenosine-thymine, adenosine-uracil, or
guanosine-cytosine base pairs, but also base pairs formed between
nucleotides and/or modified nucleotides comprising non-standard or
modified bases, wherein the arrangement of hydrogen bond donors and
hydrogen bond acceptors permits hydrogen bonding between a
non-standard base and a standard base or between two complementary
non-standard base structures. One example of such non-standard base
pairing is the base pairing between the modified nucleotide inosine
and adenine, cytosine or uracil.
[0369] The modified nucleosides and nucleotides can include a
modified nucleobase. Examples of nucleobases found in RNA include,
but are not limited to, adenine, guanine, cytosine, and uracil.
Examples of nucleobase found in DNA include, but are not limited
to, adenine, guanine, cytosine, and thymine. These nucleobases can
be modified or wholly replaced to provide polynucleotides, primary
constructs, or mmRNA molecules having enhanced properties, e.g.,
resistance to nucleases through disruption of the binding of a
major groove binding partner. Table 8 below identifies the chemical
faces of each canonical nucleotide. Circles identify the atoms
comprising the respective chemical regions.
TABLE-US-00007 TABLE 8 Major Groove Face Minor Groove Face
Watson-Crick Base-pairing Face Pyrimidines Cytidine: ##STR00085##
##STR00086## ##STR00087## Uridine: ##STR00088## ##STR00089##
##STR00090## Purines Adenosine: ##STR00091## ##STR00092##
##STR00093## Guanosine: ##STR00094## ##STR00095## ##STR00096##
[0370] In some embodiments, B is a modified uracil. Exemplary
modified uracils include those having Formula (b1)-(b5):
##STR00097##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0371] wherein
[0372] is a single or double bond;
[0373] each of T.sup.1', T.sup.1'', T.sup.2', and T.sup.2'' is,
independently, H, optionally substituted alkyl, optionally
substituted alkoxy, or optionally substituted thioalkoxy, or the
combination of T.sup.1' and T.sup.1'' or the combination of
T.sup.2' and T.sup.2'' join together (e.g., as in T.sup.2) to form
O (oxo), S (thio), or Se (seleno);
[0374] each of V.sup.1 and V.sup.2 is, independently, O, S,
N(R.sup.Vb).sub.nv, or C(R.sup.Vb).sub.nv, wherein nv is an integer
from 0 to 2 and each R.sup.Vb is, independently, H, halo,
optionally substituted amino acid, optionally substituted alkyl,
optionally substituted haloalkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted hydroxyalkyl, optionally
substituted hydroxyalkenyl, optionally substituted hydroxyalkynyl,
optionally substituted aminoalkyl (e.g., substituted with an
N-protecting group, such as any described herein, e.g.,
trifluoroacetyl), optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl, optionally substituted acylaminoalkyl
(e.g., substituted with an N-protecting group, such as any
described herein, e.g., trifluoroacetyl), optionally substituted
alkoxycarbonylalkyl, optionally substituted alkoxycarbonylalkenyl,
optionally substituted alkoxycarbonylalkynyl, or optionally
substituted alkynyloxy (e.g., optionally substituted with any
substituent described herein, such as those selected from (1)-(21)
for alkyl);
[0375] R.sup.10 is H, halo, optionally substituted amino acid,
hydroxy, optionally substituted alkyl, optionally substituted
alkenyl, optionally substituted alkynyl, optionally substituted
aminoalkyl, optionally substituted hydroxyalkyl, optionally
substituted hydroxyalkenyl, optionally substituted hydroxyalkynyl,
optionally substituted aminoalkenyl, optionally substituted
aminoalkynyl, optionally substituted alkoxy, optionally substituted
alkoxycarbonylalkyl, optionally substituted alkoxycarbonylalkenyl,
optionally substituted alkoxycarbonylalkynyl, optionally
substituted alkoxycarbonylalkoxy, optionally substituted
carboxyalkoxy, optionally substituted carboxyalkyl, or optionally
substituted carbamoylalkyl;
[0376] R.sup.11 is H or optionally substituted alkyl;
[0377] R.sup.12a is H, optionally substituted alkyl, optionally
substituted hydroxyalkyl, optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, or optionally
substituted aminoalkynyl, optionally substituted carboxyalkyl
(e.g., optionally substituted with hydroxy), optionally substituted
carboxyalkoxy, optionally substituted carboxyaminoalkyl, or
optionally substituted carbamoylalkyl; and
[0378] R.sup.12c is H, halo, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted thioalkoxy,
optionally substituted amino, optionally substituted hydroxyalkyl,
optionally substituted hydroxyalkenyl, optionally substituted
hydroxyalkynyl, optionally substituted aminoalkyl, optionally
substituted aminoalkenyl, or optionally substituted
aminoalkynyl.
[0379] Other exemplary modified uracils include those having
Formula (b6)-(b9):
##STR00098##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0380] wherein
[0381] is a single or double bond;
[0382] each of T.sup.1', T.sup.1'', T.sup.2', and T.sup.2'' is,
independently, H, optionally substituted alkyl, optionally
substituted alkoxy, or optionally substituted thioalkoxy, or the
combination of T.sup.1' and T.sup.1'' join together (e.g., as in
T.sup.1) or the combination of T.sup.2' and T.sup.2'' join together
(e.g., as in T.sup.2) to form O (oxo), S (thio), or Se (seleno), or
each T.sup.1 and T.sup.2 is, independently, O (oxo), S (thio), or
Se (seleno);
[0383] each of W.sup.1 and W.sup.2 is, independently,
N(R.sup.Wa).sub.nw or C(R.sup.Wa).sub.nw, wherein nw is an integer
from 0 to 2 and each R.sup.Wa is, independently, H, optionally
substituted alkyl, or optionally substituted alkoxy;
[0384] each V.sup.3 is, independently, O, S, N(R.sup.Va).sub.nv, or
C(R.sup.Va).sub.nv, wherein nv is an integer from 0 to 2 and each
R.sup.Va is, independently, H, halo, optionally substituted amino
acid, optionally substituted alkyl, optionally substituted
hydroxyalkyl, optionally substituted hydroxyalkenyl, optionally
substituted hydroxyalkynyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted
heterocyclyl, optionally substituted alkheterocyclyl, optionally
substituted alkoxy, optionally substituted alkenyloxy, or
optionally substituted alkynyloxy, optionally substituted
aminoalkyl (e.g., substituted with an N-protecting group, such as
any described herein, e.g., trifluoroacetyl, or sulfoalkyl),
optionally substituted aminoalkenyl, optionally substituted
aminoalkynyl, optionally substituted acylaminoalkyl (e.g.,
substituted with an N-protecting group, such as any described
herein, e.g., trifluoroacetyl), optionally substituted
alkoxycarbonylalkyl, optionally substituted alkoxycarbonylalkenyl,
optionally substituted alkoxycarbonylalkynyl, optionally
substituted alkoxycarbonylacyl, optionally substituted
alkoxycarbonylalkoxy, optionally substituted carboxyalkyl (e.g.,
optionally substituted with hydroxy and/or an O-protecting group),
optionally substituted carboxyalkoxy, optionally substituted
carboxyaminoalkyl, or optionally substituted carbamoylalkyl (e.g.,
optionally substituted with any substituent described herein, such
as those selected from (1)-(21) for alkyl), and wherein R.sup.Va
and R.sup.12c taken together with the carbon atoms to which they
are attached can form optionally substituted cycloalkyl, optionally
substituted aryl, or optionally substituted heterocyclyl (e.g., a
5- or 6-membered ring);
[0385] R.sup.12a is H, optionally substituted alkyl, optionally
substituted hydroxyalkyl, optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl, optionally substituted carboxyalkyl
(e.g., optionally substituted with hydroxy and/or an O-protecting
group), optionally substituted carboxyalkoxy, optionally
substituted carboxyaminoalkyl, optionally substituted
carbamoylalkyl, or absent;
[0386] R.sup.12b is H, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted hydroxyalkyl, optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl, optionally substituted alkaryl,
optionally substituted heterocyclyl, optionally substituted
alkheterocyclyl, optionally substituted amino acid, optionally
substituted alkoxycarbonylacyl, optionally substituted
alkoxycarbonylalkoxy, optionally substituted alkoxycarbonylalkyl,
optionally substituted alkoxycarbonylalkenyl, optionally
substituted alkoxycarbonylalkynyl, optionally substituted
alkoxycarbonylalkoxy, optionally substituted carboxyalkyl (e.g.,
optionally substituted with hydroxy and/or an O-protecting group),
optionally substituted carboxyalkoxy, optionally substituted
carboxyaminoalkyl, or optionally substituted carbamoylalkyl,
[0387] wherein the combination of R.sup.12b and T.sup.1' or the
combination of R.sup.12b and R.sup.12c can join together to form
optionally substituted heterocyclyl; and
[0388] R.sup.12c is H, halo, optionally substituted alkyl,
optionally substituted alkoxy, optionally substituted thioalkoxy,
optionally substituted amino, optionally substituted aminoalkyl,
optionally substituted aminoalkenyl, or optionally substituted
aminoalkynyl.
[0389] Further exemplary modified uracils include those having
Formula (b28)-(b31):
##STR00099##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0390] wherein
[0391] each of T.sup.1 and T.sup.2 is, independently, O (oxo), S
(thio), or Se (seleno);
[0392] each R.sup.Vb' and R.sup.Vb'' is, independently, H, halo,
optionally substituted amino acid, optionally substituted alkyl,
optionally substituted haloalkyl, optionally substituted
hydroxyalkyl, optionally substituted hydroxyalkenyl, optionally
substituted hydroxyalkynyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted aminoalkyl (e.g., substituted
with an N-protecting group, such as any described herein, e.g.,
trifluoroacetyl, or sulfoalkyl), optionally substituted
aminoalkenyl, optionally substituted aminoalkynyl, optionally
substituted acylaminoalkyl (e.g., substituted with an N-protecting
group, such as any described herein, e.g., trifluoroacetyl),
optionally substituted alkoxycarbonylalkyl, optionally substituted
alkoxycarbonylalkenyl, optionally substituted
alkoxycarbonylalkynyl, optionally substituted alkoxycarbonylacyl,
optionally substituted alkoxycarbonylalkoxy, optionally substituted
carboxyalkyl (e.g., optionally substituted with hydroxy and/or an
O-protecting group), optionally substituted carboxyalkoxy,
optionally substituted carboxyaminoalkyl, or optionally substituted
carbamoylalkyl (e.g., optionally substituted with any substituent
described herein, such as those selected from (1)-(21) for alkyl)
(e.g., R.sup.Vb' is optionally substituted alkyl, optionally
substituted alkenyl, or optionally substituted aminoalkyl, e.g.,
substituted with an N-protecting group, such as any described
herein, e.g., trifluoroacetyl, or sulfoalkyl);
[0393] R.sup.12a is H, optionally substituted alkyl, optionally
substituted carboxyaminoalkyl, optionally substituted aminoalkyl
(e.g., e.g., substituted with an N-protecting group, such as any
described herein, e.g., trifluoroacetyl, or sulfoalkyl), optionally
substituted aminoalkenyl, or optionally substituted aminoalkynyl;
and
[0394] R.sup.12b is H, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted hydroxyalkyl, optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
aminoalkyl, optionally substituted aminoalkenyl, optionally
substituted aminoalkynyl (e.g., e.g., substituted with an
N-protecting group, such as any described herein, e.g.,
trifluoroacetyl, or sulfoalkyl),
[0395] optionally substituted alkoxycarbonylacyl, optionally
substituted alkoxycarbonylalkoxy, optionally substituted
alkoxycarbonylalkyl, optionally substituted alkoxycarbonylalkenyl,
optionally substituted alkoxycarbonylalkynyl, optionally
substituted alkoxycarbonylalkoxy, optionally substituted
carboxyalkoxy, optionally substituted carboxyalkyl, or optionally
substituted carbamoylalkyl.
[0396] In particular embodiments, T.sup.1 is O (oxo), and T.sup.2
is S (thio) or Se (seleno). In other embodiments, T.sup.1 is S
(thio), and T.sup.2 is O (oxo) or Se (seleno). In some embodiments,
R.sup.Vb' is H, optionally substituted alkyl, or optionally
substituted alkoxy.
[0397] In other embodiments, each R.sup.12a and R.sup.12b is,
independently, H, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, or optionally
substituted hydroxyalkyl. In particular embodiments, R.sup.12a is
H. In other embodiments, both R.sup.12a and R.sup.12b are H.
[0398] In some embodiments, each R.sup.Vb' of R.sup.12b is,
independently, optionally substituted aminoalkyl (e.g., substituted
with an N-protecting group, such as any described herein, e.g.,
trifluoroacetyl, or sulfoalkyl), optionally substituted
aminoalkenyl, optionally substituted aminoalkynyl, or optionally
substituted acylaminoalkyl (e.g., substituted with an N-protecting
group, such as any described herein, e.g., trifluoroacetyl). In
some embodiments, the amino and/or alkyl of the optionally
substituted aminoalkyl is substituted with one or more of
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted sulfoalkyl, optionally substituted carboxy
(e.g., substituted with an O-protecting group), optionally
substituted hydroxy (e.g., substituted with an O-protecting group),
optionally substituted carboxyalkyl (e.g., substituted with an
O-protecting group), optionally substituted alkoxycarbonylalkyl
(e.g., substituted with an O-protecting group), or N-protecting
group. In some embodiments, optionally substituted aminoalkyl is
substituted with an optionally substituted sulfoalkyl or optionally
substituted alkenyl. In particular embodiments, R.sup.12a and
R.sup.Vb'' are both H. In particular embodiments, T.sup.1 is O
(oxo), and T.sup.2 is S (thio) or Se (seleno).
[0399] In some embodiments, R.sup.Vb' is optionally substituted
alkoxycarbonylalkyl or optionally substituted carbamoylalkyl.
[0400] In particular embodiments, the optional substituent for
R.sup.12a, R.sup.12b, R.sup.12c, or R.sup.Va is a polyethylene
glycol group (e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl); or an
amino-polyethylene glycol group (e.g.,
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl).
[0401] In some embodiments, B is a modified cytosine. Exemplary
modified cytosines include compounds of Formula (b10)-(b14):
##STR00100##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0402] wherein
[0403] each of T.sup.3' and T.sup.3'' is, independently, H,
optionally substituted alkyl, optionally substituted alkoxy, or
optionally substituted thioalkoxy, or the combination of T.sup.3'
and T.sup.3'' join together (e.g., as in T.sup.3) to form O (oxo),
S (thio), or Se (seleno);
[0404] each V.sup.4 is, independently, O, S, N(R.sup.Vc).sub.nv, or
C(R.sup.Vc).sub.nv, wherein nv is an integer from 0 to 2 and each
R.sup.Vc is, independently, H, halo, optionally substituted amino
acid, optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
heterocyclyl, optionally substituted alkheterocyclyl, or optionally
substituted alkynyloxy (e.g., optionally substituted with any
substituent described herein, such as those selected from (1)-(21)
for alkyl), wherein the combination of R.sup.13b and R.sup.Vc can
be taken together to form optionally substituted heterocyclyl;
[0405] each V.sup.5 is, independently, N(R.sup.Vd).sub.nv, or
C(R.sup.Vd).sub.nv, wherein nv is an integer from 0 to 2 and each
R.sup.Vd is, independently, H, halo, optionally substituted amino
acid, optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, optionally substituted
heterocyclyl, optionally substituted alkheterocyclyl, or optionally
substituted alkynyloxy (e.g., optionally substituted with any
substituent described herein, such as those selected from (1)-(21)
for alkyl) (e.g., V.sup.5 is --CH or N);
[0406] each of R.sup.13a and R.sup.13b is, independently, H,
optionally substituted acyl, optionally substituted acyloxyalkyl,
optionally substituted alkyl, or optionally substituted alkoxy,
wherein the combination of R.sup.13b and R.sup.14 can be taken
together to form optionally substituted heterocyclyl;
[0407] each R.sup.14 is, independently, H, halo, hydroxy, thiol,
optionally substituted acyl, optionally substituted amino acid,
optionally substituted alkyl, optionally substituted haloalkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted hydroxyalkyl (e.g., substituted with an
O-protecting group), optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
alkoxy, optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted aminoalkoxy, optionally
substituted alkoxyalkoxy, optionally substituted acyloxyalkyl,
optionally substituted amino (e.g., --NHR, wherein R is H, alkyl,
aryl, or phosphoryl), azido, optionally substituted aryl,
optionally substituted heterocyclyl, optionally substituted
alkheterocyclyl, optionally substituted aminoalkyl, optionally
substituted aminoalkenyl, or optionally substituted aminoalkyl;
and
[0408] each of R.sup.15 and R.sup.16 is, independently, H,
optionally substituted alkyl, optionally substituted alkenyl, or
optionally substituted alkynyl.
[0409] Further exemplary modified cytosines include those having
Formula (b32)-(b35):
##STR00101##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0410] wherein
[0411] each of T.sup.1 and T.sup.3 is, independently, O (oxo), S
(thio), or Se (seleno);
[0412] each of R.sup.13a and R.sup.13b is, independently, H,
optionally substituted acyl, optionally substituted acyloxyalkyl,
optionally substituted alkyl, or optionally substituted alkoxy,
wherein the combination of R.sup.13b and R.sup.14 can be taken
together to form optionally substituted heterocyclyl;
[0413] each R.sup.14 is, independently, H, halo, hydroxy, thiol,
optionally substituted acyl, optionally substituted amino acid,
optionally substituted alkyl, optionally substituted haloalkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted hydroxyalkyl (e.g., substituted with an
O-protecting group), optionally substituted hydroxyalkenyl,
optionally substituted hydroxyalkynyl, optionally substituted
alkoxy, optionally substituted alkenyloxy, optionally substituted
alkynyloxy, optionally substituted aminoalkoxy, optionally
substituted alkoxyalkoxy, optionally substituted acyloxyalkyl,
optionally substituted amino (e.g., --NHR, wherein R is H, alkyl,
aryl, or phosphoryl), azido, optionally substituted aryl,
optionally substituted heterocyclyl, optionally substituted
alkheterocyclyl, optionally substituted aminoalkyl (e.g.,
hydroxyalkyl, alkyl, alkenyl, or alkynyl), optionally substituted
aminoalkenyl, or optionally substituted aminoalkynyl; and
[0414] each of R.sup.15 and R.sup.16 is, independently, H,
optionally substituted alkyl, optionally substituted alkenyl, or
optionally substituted alkynyl (e.g., R.sup.15 is H, and R.sup.16
is H or optionally substituted alkyl).
[0415] In some embodiments, R.sup.15 is H, and R.sup.16 is H or
optionally substituted alkyl. In particular embodiments, R.sup.14
is H, acyl, or hydroxyalkyl. In some embodiments, R.sup.14 is halo.
In some embodiments, both R.sup.14 and R.sup.15 are H. In some
embodiments, both R.sup.15 and R.sup.16 are H. In some embodiments,
each of R.sup.14 and R.sup.15 and R.sup.16 is H. In further
embodiments, each of R.sup.13a and R.sup.13b is independently, H or
optionally substituted alkyl.
[0416] Further non-limiting examples of modified cytosines include
compounds of Formula (b36):
##STR00102##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0417] wherein
[0418] each R.sup.13b is, independently, H, optionally substituted
acyl, optionally substituted acyloxyalkyl, optionally substituted
alkyl, or optionally substituted alkoxy, wherein the combination of
R.sup.13b and R.sup.14b can be taken together to form optionally
substituted heterocyclyl;
[0419] each R.sup.14a and R.sup.14b is, independently, H, halo,
hydroxy, thiol, optionally substituted acyl, optionally substituted
amino acid, optionally substituted alkyl, optionally substituted
haloalkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted hydroxyalkyl (e.g., substituted
with an O-protecting group), optionally substituted hydroxyalkenyl,
optionally substituted alkoxy, optionally substituted alkenyloxy,
optionally substituted alkynyloxy, optionally substituted
aminoalkoxy, optionally substituted alkoxyalkoxy, optionally
substituted acyloxyalkyl, optionally substituted amino (e.g.,
--NHR, wherein R is H, alkyl, aryl, phosphoryl, optionally
substituted aminoalkyl, or optionally substituted
carboxyaminoalkyl), azido, optionally substituted aryl, optionally
substituted heterocyclyl, optionally substituted alkheterocyclyl,
optionally substituted aminoalkyl, optionally substituted
aminoalkenyl, or optionally substituted aminoalkynyl; and
[0420] each of R.sup.15 is, independently, H, optionally
substituted alkyl, optionally substituted alkenyl, or optionally
substituted alkynyl.
[0421] In particular embodiments, R.sup.14b is an optionally
substituted amino acid (e.g., optionally substituted lysine). In
some embodiments, R.sup.14a is H.
[0422] In some embodiments, B is a modified guanine Exemplary
modified guanines include compounds of Formula (b15)-(b17):
##STR00103##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0423] wherein
[0424] each of T.sup.4', T.sup.4'', T.sup.5', T.sup.5'', T.sup.6',
and T.sup.6'' is independently, H, optionally substituted alkyl, or
optionally substituted alkoxy, and wherein the combination of
T.sup.4' and T.sup.4'' (e.g., as in T.sup.4) or the combination of
T.sup.5' and T.sup.5'' (e.g., as in T.sup.5) or the combination of
T.sup.6' and T.sup.6'' (e.g., as in T.sup.6) join together form O
(oxo), S (thio), or Se (seleno);
[0425] each of V.sup.5 and V.sup.6 is, independently, O, S,
N(R.sup.Vd).sub.nv, or C(R.sup.Vd).sub.nv, wherein nv is an integer
from 0 to 2 and each R.sup.Vd is, independently, H, halo, thiol,
optionally substituted amino acid, cyano, amidine, optionally
substituted aminoalkyl, optionally substituted aminoalkenyl,
optionally substituted aminoalkynyl, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted alkoxy, optionally substituted alkenyloxy,
or optionally substituted alkynyloxy (e.g., optionally substituted
with any substituent described herein, such as those selected from
(1)-(21) for alkyl), optionally substituted thioalkoxy, or
optionally substituted amino; and
[0426] each of R.sup.17, R.sup.18, R.sup.19a, R.sup.19b, R.sup.21,
R.sup.22, R.sup.23, and R.sup.24 is, independently, H, halo, thiol,
optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted thioalkoxy,
optionally substituted amino, or optionally substituted amino
acid.
[0427] Exemplary modified guanosines include compounds of Formula
(b37)-(b40):
##STR00104##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0428] wherein
[0429] each of T.sup.4' is, independently, H, optionally
substituted alkyl, or optionally substituted alkoxy, and each
T.sup.4 is, independently, O (oxo), S (thio), or Se (seleno);
[0430] each of R.sup.18, R.sup.19a, R.sup.19b, and R.sup.21 is,
independently, H, halo, thiol, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted thioalkoxy, optionally substituted amino, or
optionally substituted amino acid.
[0431] In some embodiments, R.sup.18 is H or optionally substituted
alkyl. In further embodiments, T.sup.4 is oxo. In some embodiments,
each of R.sup.19a and R.sup.19b is, independently, H or optionally
substituted alkyl.
[0432] In some embodiments, B is a modified adenine. Exemplary
modified adenines include compounds of Formula (b18)-(b20):
##STR00105##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0433] wherein
[0434] each V.sup.7 is, independently, O, S, N(R.sup.Ve).sub.nv, or
C(R.sup.Ve).sub.nv, wherein nv is an integer from 0 to 2 and each
R.sup.Ve is, independently, H, halo, optionally substituted amino
acid, optionally substituted alkyl, optionally substituted alkenyl,
optionally substituted alkynyl, optionally substituted alkoxy,
optionally substituted alkenyloxy, or optionally substituted
alkynyloxy (e.g., optionally substituted with any substituent
described herein, such as those selected from (1)-(21) for
alkyl);
[0435] each R.sup.25 is, independently, H, halo, thiol, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted thioalkoxy, or
optionally substituted amino;
[0436] each of R.sup.26a and R.sup.26b is, independently, H,
optionally substituted acyl, optionally substituted amino acid,
optionally substituted carbamoylalkyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted hydroxyalkyl, optionally
substituted hydroxyalkenyl, optionally substituted hydroxyalkynyl,
optionally substituted alkoxy, or polyethylene glycol group (e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl); or an
amino-polyethylene glycol group (e.g.,
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl);
[0437] each R.sup.27 is, independently, H, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted alkoxy, optionally substituted
thioalkoxy or optionally substituted amino;
[0438] each R.sup.28 is, independently, H, optionally substituted
alkyl, optionally substituted alkenyl, or optionally substituted
alkynyl; and
[0439] each R.sup.29 is, independently, H, optionally substituted
acyl, optionally substituted amino acid, optionally substituted
carbamoylalkyl, optionally substituted alkyl, optionally
substituted alkenyl, optionally substituted alkynyl, optionally
substituted hydroxyalkyl, optionally substituted hydroxyalkenyl,
optionally substituted alkoxy, or optionally substituted amino.
[0440] Exemplary modified adenines include compounds of Formula
(b41)-(b43):
##STR00106##
or a pharmaceutically acceptable salt or stereoisomer thereof,
[0441] wherein
[0442] each R.sup.25 is, independently, H, halo, thiol, optionally
substituted alkyl, optionally substituted alkenyl, optionally
substituted alkynyl, optionally substituted thioalkoxy, or
optionally substituted amino;
[0443] each of R.sup.26a and R.sup.26b is, independently, H,
optionally substituted acyl, optionally substituted amino acid,
optionally substituted carbamoylalkyl, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted hydroxyalkyl, optionally
substituted hydroxyalkenyl, optionally substituted hydroxyalkynyl,
optionally substituted alkoxy, or polyethylene glycol group (e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl); or an
amino-polyethylene glycol group (e.g.,
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl); and
[0444] each R.sup.27 is, independently, H, optionally substituted
alkyl, optionally substituted alkenyl, optionally substituted
alkynyl, optionally substituted alkoxy, optionally substituted
thioalkoxy, or optionally substituted amino.
[0445] In some embodiments, R.sup.26a is H, and R.sup.26b is
optionally substituted alkyl. In some embodiments, each of
R.sup.26a and R.sup.26b is, independently, optionally substituted
alkyl. In particular embodiments, R.sup.27 is optionally
substituted alkyl, optionally substituted alkoxy, or optionally
substituted thioalkoxy. In other embodiments, R.sup.25 is
optionally substituted alkyl, optionally substituted alkoxy, or
optionally substituted thioalkoxy.
[0446] In particular embodiments, the optional substituent for
R.sup.26a, R.sup.26b, or R.sup.29 is a polyethylene glycol group
(e.g.,
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl); or an
amino-polyethylene glycol group (e.g.,
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.si(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl).
[0447] In some embodiments, B may have Formula (b21):
##STR00107##
[0448] wherein X.sup.12 is, independently, O, S, optionally
substituted alkylene (e.g., methylene), or optionally substituted
heteroalkylene, xa is an integer from 0 to 3, and R.sup.12a and
T.sup.2 are as described herein.
[0449] In some embodiments, B may have Formula (b22):
##STR00108##
wherein R.sup.10' is, independently, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted aryl, optionally substituted heterocyclyl,
optionally substituted aminoalkyl, optionally substituted
aminoalkenyl, optionally substituted aminoalkynyl, optionally
substituted alkoxy, optionally substituted alkoxycarbonylalkyl,
optionally substituted alkoxycarbonylalkenyl, optionally
substituted alkoxycarbonylalkynyl, optionally substituted
alkoxycarbonylalkoxy, optionally substituted carboxyalkoxy,
optionally substituted carboxyalkyl, or optionally substituted
carbamoylalkyl, and R.sup.11, R.sup.12a, T.sup.1, and T.sup.2 are
as described herein.
[0450] In some embodiments, B may have Formula (b23):
##STR00109##
wherein R.sup.10 is optionally substituted heterocyclyl (e.g.,
optionally substituted furyl, optionally substituted thienyl, or
optionally substituted pyrrolyl), optionally substituted aryl
(e.g., optionally substituted phenyl or optionally substituted
naphthyl), or any substituent described herein (e.g., for
R.sup.10); and wherein R.sup.11 (e.g., H or any substituent
described herein), R.sup.12a (e.g., H or any substituent described
herein), T.sup.1 (e.g., oxo or any substituent described herein),
and T.sup.2 (e.g., oxo or any substituent described herein) are as
described herein. In some embodiments, B may have Formula
(b24):
##STR00110##
wherein R.sup.14' is, independently, optionally substituted alkyl,
optionally substituted alkenyl, optionally substituted alkynyl,
optionally substituted aryl, optionally substituted heterocyclyl,
optionally substituted alkaryl, optionally substituted
alkheterocyclyl, optionally substituted aminoalkyl, optionally
substituted aminoalkenyl, optionally substituted aminoalkynyl,
optionally substituted alkoxy, optionally substituted
alkoxycarbonylalkenyl, optionally substituted
alkoxycarbonylalkynyl, optionally substituted alkoxycarbonylalkyl,
optionally substituted alkoxycarbonylalkoxy, optionally substituted
carboxyalkoxy, optionally substituted carboxyalkyl, or optionally
substituted carbamoylalkyl, and R.sup.13a, R.sup.13b, R.sup.15, and
T.sup.3 are as described herein.
[0451] In some embodiments, B may have Formula (b25):
##STR00111##
wherein R.sup.14' is optionally substituted heterocyclyl (e.g.,
optionally substituted furyl, optionally substituted thienyl, or
optionally substituted pyrrolyl), optionally substituted aryl
(e.g., optionally substituted phenyl or optionally substituted
naphthyl), or any substituent described herein (e.g., for R.sup.14
or R.sup.14'); and wherein R.sup.13a (e.g., H or any substituent
described herein), R.sup.13b (e.g., H or any substituent described
herein), R.sup.15 (e.g., H or any substituent described herein),
and T.sup.3 (e.g., oxo or any substituent described herein) are as
described herein.
[0452] In some embodiments, B is a nucleobase selected from the
group consisting of cytosine, guanine, adenine, and uracil. In some
embodiments, B may be:
##STR00112##
[0453] In some embodiments, the modified nucleobase is a modified
uracil. Exemplary nucleobases and nucleosides having a modified
uracil include pseudouridine (.psi.), pyridin-4-one ribonucleoside,
5-aza-uridine, 6-aza-uridine, 2-thio-5-aza-uridine, 2-thio-uridine
(s.sup.2U), 4-thio-uridine (s.sup.4U), 4-thio-pseudouridine,
2-thio-pseudouridine, 5-hydroxy-uridine (ho.sup.5U),
5-aminoallyl-uridine, 5-halo-uridine (e.g., 5-iodo-uridine or
5-bromo-uridine), 3-methyl-uridine (m.sup.3U), 5-methoxy-uridine
(mo.sup.5U), uridine 5-oxyacetic acid (cmo.sup.5U), uridine
5-oxyacetic acid methyl ester (mcmo.sup.5U),
5-carboxymethyl-uridine (cm.sup.5U), 1-carboxymethyl-pseudouridine,
5-carboxyhydroxymethyl-uridine (chm.sup.5U),
5-carboxyhydroxymethyl-uridine methyl ester (mchm.sup.5U),
5-methoxycarbonylmethyl-uridine (mcm.sup.5U),
5-methoxycarbonylmethyl-2-thio-uridine (mcm.sup.5s.sup.2U),
5-aminomethyl-2-thio-uridine (nm.sup.5s.sup.2U),
5-methylaminomethyl-uridine (mnm.sup.5U),
5-methylaminomethyl-2-thio-uridine (mnm.sup.5s.sup.2U),
5-methylaminomethyl-2-seleno-uridine (mnm.sup.5se.sup.2U),
5-carbamoylmethyl-uridine (ncm.sup.5U),
5-carboxymethylaminomethyl-uridine (cmnm.sup.5U),
5-carboxymethylaminomethyl-2-thio-uridine (cmnm.sup.5s.sup.2U),
5-propynyl-uridine, 1-propynyl-pseudouridine,
5-taurinomethyl-uridine (.tau.m.sup.5U),
1-taurinomethyl-pseudouridine,
5-taurinomethyl-2-thio-uridine(.tau.m.sup.5s.sup.2U),
1-taurinomethyl-4-thio-pseudouridine, 5-methyl-uridine (m.sup.5U,
i.e., having the nucleobase deoxythymine), 1-methylpseudouridine
(m.sup.1.psi.), 5-methyl-2-thio-uridine (m.sup.5s.sup.2U),
1-methyl-4-thio-pseudouridine (m.sup.1s.sup.4.psi.),
4-thio-1-methyl-pseudouridine, 3-methyl-pseudouridine
(m.sup.3.psi.), 2-thio-1-methyl-pseudouridine,
1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-1-deaza-pseudouridine, dihydrouridine (D),
dihydropseudouridine, 5,6-dihydrouridine, 5-methyl-dihydrouridine
(m.sup.5D), 2-thio-dihydrouridine, 2-thio-dihydropseudouridine,
2-methoxy-uridine, 2-methoxy-4-thio-uridine,
4-methoxy-pseudouridine, 4-methoxy-2-thio-pseudouridine,
N1-methyl-pseudouridine (also known as 1-methylpseudouridine
(m.sup.1.psi.)), 3-(3-amino-3-carboxypropyl)uridine (acp.sup.3U),
1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp.sup.3.psi.),
5-(isopentenylaminomethyl)uridine (inm.sup.5U),
5-(isopentenylaminomethyl)-2-thio-uridine (inm.sup.5s.sup.2U),
.alpha.-thio-uridine, 2'-O-methyl-uridine (Um),
5,2'-O-dimethyl-uridine (m.sup.5Um), 2'-O-methyl-pseudouridine
(.psi.m), 2-thio-2'-O-methyl-uridine (s.sup.2Um),
5-methoxycarbonylmethyl-2'-O-methyl-uridine (mcm.sup.5Um),
5-carbamoylmethyl-2'-.beta.-methyl-uridine (ncm.sup.5Um),
5-carboxymethylaminomethyl-2'-O-methyl-uridine (cmnm.sup.5Um),
3,2'-O-dimethyl-uridine (m.sup.3Um),
5-(isopentenylaminomethyl)-2'-.beta.-methyl-uridine (inm.sup.5Um),
1-thio-uridine, deoxythymidine, 2'-F-ara-uridine, 2'-F-uridine,
2'-OH-ara-uridine, 5-(2-carbomethoxyvinyl) uridine, and
5-[3-(1-E-propenylamino)uridine.
[0454] In some embodiments, the modified nucleobase is a modified
cytosine. Exemplary nucleobases and nucleosides having a modified
cytosine include 5-aza-cytidine, 6-aza-cytidine, pseudoisocytidine,
3-methyl-cytidine (m.sup.3C), N4-acetyl-cytidine (ac.sup.4C),
5-formyl-cytidine (f.sup.5C), N4-methyl-cytidine (m.sup.4C),
5-methyl-cytidine (m.sup.5C), 5-halo-cytidine (e.g.,
5-iodo-cytidine), 5-hydroxymethyl-cytidine (hm.sup.5C),
1-methyl-pseudoisocytidine, pyrrolo-cytidine,
pyrrolo-pseudoisocytidine, 2-thio-cytidine (s.sup.2C),
2-thio-5-methyl-cytidine, 4-thio-pseudoisocytidine,
4-thio-1-methyl-pseudoisocytidine,
4-thio-1-methyl-1-deaza-pseudoisocytidine,
1-methyl-1-deaza-pseudoisocytidine, zebularine, 5-aza-zebularine,
5-methyl-zebularine, 5-aza-2-thio-zebularine, 2-thio-zebularine,
2-methoxy-cytidine, 2-methoxy-5-methyl-cytidine,
4-methoxy-pseudoisocytidine, 4-methoxy-1-methyl-pseudoisocytidine,
lysidine (k.sub.2C), .alpha.-thio-cytidine, 2'-O-methyl-cytidine
(Cm), 5,2'-O-dimethyl-cytidine (m.sup.5Cm),
N4-acetyl-2'-O-methyl-cytidine (ac.sup.4Cm),
N4,2'-O-dimethyl-cytidine (m.sup.4Cm),
5-formyl-2'-O-methyl-cytidine (f.sup.5Cm),
N4,N4,2'-O-trimethyl-cytidine (m.sup.4.sub.2Cm), 1-thio-cytidine,
2'-F-ara-cytidine, 2'-F-cytidine, and 2'-OH-ara-cytidine.
[0455] In some embodiments, the modified nucleobase is a modified
adenine. Exemplary nucleobases and nucleosides having a modified
adenine include 2-amino-purine, 2,6-diaminopurine,
2-amino-6-halo-purine (e.g., 2-amino-6-chloro-purine),
6-halo-purine (e.g., 6-chloro-purine), 2-amino-6-methyl-purine,
8-azido-adenosine, 7-deaza-adenine, 7-deaza-8-aza-adenine,
7-deaza-2-amino-purine, 7-deaza-8-aza-2-amino-purine,
7-deaza-2,6-diaminopurine, 7-deaza-8-aza-2,6-diaminopurine,
1-methyl-adenosine (m'A), 2-methyl-adenine (m.sup.2A),
N6-methyl-adenosine (m.sup.6A), 2-methylthio-N6-methyl-adenosine
(ms.sup.2m.sup.6A), N6-isopentenyl-adenosine (i.sup.6A),
2-methylthio-N6-isopentenyl-adenosine (ms.sup.2i.sup.6A),
N6-(cis-hydroxyisopentenyl)adenosine (io.sup.6A),
2-methylthio-N6-(cis-hydroxyisopentenyl)adenosine
(ms.sup.2io.sup.6A), N6-glycinylcarbamoyl-adenosine (g.sup.6A),
N6-threonylcarbamoyl-adenosine (t.sup.6A),
N6-methyl-N6-threonylcarbamoyl-adenosine (m.sup.6t.sup.6A),
2-methylthio-N6-threonylcarbamoyl-adenosine (ms.sup.2g.sup.6A),
N6,N6-dimethyl-adenosine (m.sup.6.sub.2A),
N6-hydroxynorvalylcarbamoyl-adenosine (hn.sup.6A),
2-methylthio-N6-hydroxynorvalylcarbamoyl-adenosine
(ms.sup.2hn.sup.6A), N6-acetyl-adenosine (ac.sup.6A),
7-methyl-adenine, 2-methylthio-adenine, 2-methoxy-adenine,
.alpha.-thio-adenosine, 2'-O-methyl-adenosine (Am),
N6,2'-O-dimethyl-adenosine (m.sup.6Am),
N6,N6,2'-O-trimethyl-adenosine (m.sup.6.sub.2Am),
1,2'-O-dimethyl-adenosine (m.sup.1Am), 2'-.beta.-ribosyladenosine
(phosphate) (Ar(p)), 2-amino-N6-methyl-purine, 1-thio-adenosine,
8-azido-adenosine, 2'-F-ara-adenosine, 2'-F-adenosine,
2'-OH-ara-adenosine, and
N6-(19-amino-pentaoxanonadecyl)-adenosine.
[0456] In some embodiments, the modified nucleobase is a modified
guanine Exemplary nucleobases and nucleosides having a modified
guanine include inosine (I), 1-methyl-inosine (m.sup.1I), wyosine
(imG), methylwyosine (mimG), 4-demethyl-wyosine (imG-14),
isowyosine (imG2), wybutosine (yW), peroxywybutosine (o.sub.2yW),
hydroxywybutosine (OHyW), undermodified hydroxywybutosine (OHyW*),
7-deaza-guanosine, queuosine (Q), epoxyqueuosine (oQ),
galactosyl-queuosine (galQ), mannosyl-queuosine (manQ),
7-cyano-7-deaza-guanosine (preQo), 7-aminomethyl-7-deaza-guanosine
(preQ.sub.1), archaeosine (G.sup.+), 7-deaza-8-aza-guanosine,
6-thio-guanosine, 6-thio-7-deaza-guanosine,
6-thio-7-deaza-8-aza-guanosine, 7-methyl-guanosine (m.sup.7G),
6-thio-7-methyl-guanosine, 7-methyl-inosine, 6-methoxy-guanosine,
1-methyl-guanosine (m.sup.1G), N2-methyl-guanosine (m.sup.2G),
N2,N2-dimethyl-guanosine (m.sup.2.sub.2G), N2,7-dimethyl-guanosine
(m.sup.2,7G), N2, N2,7-dimethyl-guanosine (m.sup.2,2,7G),
8-oxo-guanosine, 7-methyl-8-oxo-guanosine,
1-methyl-6-thio-guanosine, N2-methyl-6-thio-guanosine,
N2,N2-dimethyl-6-thio-guanosine, .alpha.-thio-guanosine,
2'-O-methyl-guanosine (Gm), N2-methyl-2'-O-methyl-guanosine
(m.sup.2Gm), N2,N2-dimethyl-2'-O-methyl-guanosine
(m.sup.2.sub.2Gm), 1-methyl-2'-O-methyl-guanosine (m.sup.1Gm),
N2,7-dimethyl-2'-O-methyl-guanosine (m.sup.2,7Gm),
2'-O-methyl-inosine (Im), 1,2'-O-dimethyl-inosine (m.sup.1Im), and
2'-O-ribosylguanosine (phosphate) (Gr(p)).
[0457] The nucleobase of the nucleotide can be independently
selected from a purine, a pyrimidine, a purine or pyrimidine
analog. For example, the nucleobase can each be independently
selected from adenine, cytosine, guanine, uracil, or hypoxanthine.
In another embodiment, the nucleobase can also include, for
example, naturally-occurring and synthetic derivatives of a base,
including pyrazolo[3,4-d]pyrimidines, 5-methylcytosine (5-me-C),
5-hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine,
6-methyl and other alkyl derivatives of adenine and guanine,
2-propyl and other alkyl derivatives of adenine and guanine,
2-thiouracil, 2-thiothymine and 2-thiocytosine, 5-propynyl uracil
and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil
(pseudouracil), 4-thiouracil, 8-halo (e.g., 8-bromo), 8-amino,
8-thiol, 8-thioalkyl, 8-hydroxyl and other 8-substituted adenines
and guanines, 5-halo particularly 5-bromo, 5-trifluoromethyl and
other 5-substituted uracils and cytosines, 7-methylguanine and
7-methyladenine, 8-azaguanine and 8-azaadenine, deazaguanine,
7-deazaguanine, 3-deazaguanine, deazaadenine, 7-deazaadenine,
3-deazaadenine, pyrazolo[3,4-d]pyrimidine, imidazo[1,5-a]1,3,5
triazinones, 9-deazapurines, imidazo[4,5-d]pyrazines,
thiazolo[4,5-d]pyrimidines, pyrazin-2-ones, 1,2,4-triazine,
pyridazine; and 1,3,5 triazine. When the nucleotides are depicted
using the shorthand A, G, C, T or U, each letter refers to the
representative base and/or derivatives thereof, e.g., A includes
adenine or adenine analogs, e.g., 7-deaza adenine).
Modifications on the Internucleoside Linkage
[0458] The modified nucleotides, which may be incorporated into a
polynucleotide, primary construct, or mmRNA molecule, can be
modified on the internucleoside linkage (e.g., phosphate backbone).
Herein, in the context of the polynucleotide backbone, the phrases
"phosphate" and "phosphodiester" are used interchangeably. Backbone
phosphate groups can be modified by replacing one or more of the
oxygen atoms with a different substituent. Further, the modified
nucleosides and nucleotides can include the wholesale replacement
of an unmodified phosphate moiety with another internucleoside
linkage as described herein. Examples of modified phosphate groups
include, but are not limited to, phosphorothioate,
phosphoroselenates, boranophosphates, boranophosphate esters,
hydrogen phosphonates, phosphoramidates, phosphorodiamidates, alkyl
or aryl phosphonates, and phosphotriesters. Phosphorodithioates
have both non-linking oxygens replaced by sulfur. The phosphate
linker can also be modified by the replacement of a linking oxygen
with nitrogen (bridged phosphoramidates), sulfur (bridged
phosphorothioates), and carbon (bridged
methylene-phosphonates).
[0459] The .alpha.-thio substituted phosphate moiety is provided to
confer stability to RNA and DNA polymers through the unnatural
phosphorothioate backbone linkages. Phosphorothioate DNA and RNA
have increased nuclease resistance and subsequently a longer
half-life in a cellular environment. Phosphorothioate linked
polynucleotides, primary constructs, or mmRNA molecules are
expected to also reduce the innate immune response through weaker
binding/activation of cellular innate immune molecules.
[0460] In specific embodiments, a modified nucleoside includes an
alpha-thio-nucleoside (e.g., 5'-O-(1-thiophosphate)-adenosine,
5'-O-(1-thiophosphate)-cytidine (.alpha.-thio-cytidine),
5'-O-(1-thiophosphate)-guanosine, 5'-O-(1-thiophosphate)-uridine,
or 5'-O-(1-thiophosphate)-pseudouridine).
[0461] Other internucleoside linkages that may be employed
according to the present invention, including internucleoside
linkages which do not contain a phosphorous atom, are described
herein below.
Combinations of Modified Sugars, Nucleobases, and Internucleoside
Linkages
[0462] The polynucleotides, primary constructs, and mmRNA of the
invention can include a combination of modifications to the sugar,
the nucleobase, and/or the internucleoside linkage. These
combinations can include any one or more modifications described
herein. For examples, any of the nucleotides described herein in
Formulas (Ia), (Ia-1)-(Ia-3), (Ib)-(If), (IIa)-(IIp), (IIb-1),
(IIb-2), (IIc-1)-(IIc-2), (IIn-1), (IIn-2), (IVa)-(IVl), and
(IXa)-(IXr) can be combined with any of the nucleobases described
herein (e.g., in Formulas (b1)-(b43) or any other described
herein).
Synthesis of Polypeptides, Primary Constructs, and mmRNA
Molecules
[0463] The polypeptides, primary constructs, and mmRNA molecules
for use in accordance with the invention may be prepared according
to any useful technique, as described herein. The modified
nucleosides and nucleotides used in the synthesis of
polynucleotides, primary constructs, and mmRNA molecules disclosed
herein can be prepared from readily available starting materials
using the following general methods and procedures. Where typical
or preferred process conditions (e.g., reaction temperatures,
times, mole ratios of reactants, solvents, pressures, etc.) are
provided, a skilled artisan would be able to optimize and develop
additional process conditions. Optimum reaction conditions may vary
with the particular reactants or solvent used, but such conditions
can be determined by one skilled in the art by routine optimization
procedures.
[0464] The processes described herein can be monitored according to
any suitable method known in the art. For example, product
formation can be monitored by spectroscopic means, such as nuclear
magnetic resonance spectroscopy (e.g., .sup.1H or .sup.13C)
infrared spectroscopy, spectrophotometry (e.g., UV-visible), or
mass spectrometry, or by chromatography such as high performance
liquid chromatography (HPLC) or thin layer chromatography.
[0465] Preparation of polypeptides, primary constructs, and mmRNA
molecules of the present invention can involve the protection and
deprotection of various chemical groups. The need for protection
and deprotection, and the selection of appropriate protecting
groups can be readily determined by one skilled in the art. The
chemistry of protecting groups can be found, for example, in
Greene, et al., Protective Groups in Organic Synthesis, 2d. Ed.,
Wiley & Sons, 1991, which is incorporated herein by reference
in its entirety.
[0466] The reactions of the processes described herein can be
carried out in suitable solvents, which can be readily selected by
one of skill in the art of organic synthesis. Suitable solvents can
be substantially nonreactive with the starting materials
(reactants), the intermediates, or products at the temperatures at
which the reactions are carried out, i.e., temperatures which can
range from the solvent's freezing temperature to the solvent's
boiling temperature. A given reaction can be carried out in one
solvent or a mixture of more than one solvent. Depending on the
particular reaction step, suitable solvents for a particular
reaction step can be selected.
[0467] Resolution of racemic mixtures of modified nucleosides and
nucleotides can be carried out by any of numerous methods known in
the art. An example method includes fractional recrystallization
using a "chiral resolving acid" which is an optically active,
salt-forming organic acid. Suitable resolving agents for fractional
recrystallization methods are, for example, optically active acids,
such as the D and L forms of tartaric acid, diacetyltartaric acid,
dibenzoyltartaric acid, mandelic acid, malic acid, lactic acid or
the various optically active camphorsulfonic acids. Resolution of
racemic mixtures can also be carried out by elution on a column
packed with an optically active resolving agent (e.g.,
dinitrobenzoylphenylglycine). Suitable elution solvent composition
can be determined by one skilled in the art.
Modified nucleosides and nucleotides (e.g., building block
molecules) can be prepared according to the synthetic methods
described in Ogata et al., J. Org. Chem. 74:2585-2588 (2009);
Purmal et al., Nucl. Acids Res. 22(1): 72-78, (1994); Fukuhara et
al., Biochemistry, 1(4): 563-568 (1962); and Xu et al.,
Tetrahedron, 48(9): 1729-1740 (1992), each of which are
incorporated by reference in their entirety.
[0468] The polypeptides, primary constructs, and mmRNA of the
invention may or may not be uniformly modified along the entire
length of the molecule. For example, one or more or all types of
nucleotide (e.g., purine or pyrimidine, or any one or more or all
of A, G, U, C) may or may not be uniformly modified in a
polynucleotide of the invention, or in a given predetermined
sequence region thereof (e.g. one or more of the sequence regions
represented in FIG. 1). In some embodiments, all nucleotides X in a
polynucleotide of the invention (or in a given sequence region
thereof) are modified, wherein X may any one of nucleotides A, G,
U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C,
A+G+U, A+G+C, G+U+C or A+G+C.
[0469] Different sugar modifications, nucleotide modifications,
and/or internucleoside linkages (e.g., backbone structures) may
exist at various positions in the polynucleotide, primary
construct, or mmRNA. One of ordinary skill in the art will
appreciate that the nucleotide analogs or other modification(s) may
be located at any position(s) of a polynucleotide, primary
construct, or mmRNA such that the function of the polynucleotide,
primary construct, or mmRNA is not substantially decreased. A
modification may also be a 5' or 3' terminal modification. The
polynucleotide, primary construct, or mmRNA may contain from about
1% to about 100% modified nucleotides (either in relation to
overall nucleotide content, or in relation to one or more types of
nucleotide, i.e. any one or more of A, G, U or C) or any
intervening percentage (e.g., from 1% to 20%, from 1% to 25%, from
1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1%
to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10%
to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10%
to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from
20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from
20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%,
from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%,
from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to
95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80%
to 100%, from 90% to 95%, from 90% to 100%, and from 95% to
100%).
[0470] In some embodiments, the polynucleotide, primary construct,
or mmRNA includes a modified pyrimidine (e.g., a modified
uracil/uridine/U or modified cytosine/cytidine/C). In some
embodiments, the uracil or uridine (generally: U) in the
polynucleotide, primary construct, or mmRNA molecule may be
replaced with from about 1% to about 100% of a modified uracil or
modified uridine (e.g., from 1% to 20%, from 1% to 25%, from 1% to
50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to
90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to
50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to
90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20%
to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20%
to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from
50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from
50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%,
from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to
100%, from 90% to 95%, from 90% to 100%, and from 95% to 100% of a
modified uracil or modified uridine). The modified uracil or
uridine can be replaced by a compound having a single unique
structure or by a plurality of compounds having different
structures (e.g., 2, 3, 4 or more unique structures, as described
herein). In some embodiments, the cytosine or cytidine (generally:
C) in the polynucleotide, primary construct, or mmRNA molecule may
be replaced with from about 1% to about 100% of a modified cytosine
or modified cytidine (e.g., from 1% to 20%, from 1% to 25%, from 1%
to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to
90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to
50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to
90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20%
to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20%
to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from
50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from
50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%,
from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to
100%, from 90% to 95%, from 90% to 100%, and from 95% to 100% of a
modified cytosine or modified cytidine). The modified cytosine or
cytidine can be replaced by a compound having a single unique
structure or by a plurality of compounds having different
structures (e.g., 2, 3, 4 or more unique structures, as described
herein).
In some embodiments, the present disclosure provides methods of
synthesizing a polynucleotide, primary construct, or mmRNA (e.g.,
the first region, first flanking region, or second flanking region)
including n number of linked nucleosides having Formula (Ia-1):
##STR00113##
comprising: a) reacting a nucleotide of Formula (IV-1):
##STR00114##
with a phosphoramidite compound of Formula (V-1):
##STR00115##
wherein Y.sup.9 is H, hydroxy, phosphoryl, pyrophosphate, sulfate,
amino, thiol, optionally substituted amino acid, or a peptide
(e.g., including from 2 to 12 amino acids); and each P.sup.1,
P.sup.2, and P.sup.3 is, independently, a suitable protecting
group; and
##STR00116##
denotes a solid support; to provide a polynucleotide, primary
construct, or mmRNA of Formula (VI-1):
##STR00117##
and b) oxidizing or sulfurizing the polynucleotide, primary
construct, or mmRNA of Formula (V) to yield a polynucleotide,
primary construct, or mmRNA of Formula (VII-1):
##STR00118##
and c) removing the protecting groups to yield the polynucleotide,
primary construct, or mmRNA of Formula (Ia).
[0471] In some embodiments, steps a) and b) are repeated from 1 to
about 10,000 times. In some embodiments, the methods further
comprise a nucleotide (e.g., mmRNA molecule) selected from the
group consisting of A, C, G and U adenosine, cytosine, guanosine,
and uracil. In some embodiments, the nucleobase may be a pyrimidine
or derivative thereof. In some embodiments, the polynucleotide,
primary construct, or mmRNA is translatable.
[0472] Other components of polynucleotides, primary constructs, and
mmRNA are optional, and are beneficial in some embodiments. For
example, a 5' untranslated region (UTR) and/or a 3'UTR are
provided, wherein either or both may independently contain one or
more different nucleotide modifications. In such embodiments,
nucleotide modifications may also be present in the translatable
region. Also provided are polynucleotides, primary constructs, and
mmRNA containing a Kozak sequence.
[0473] Exemplary syntheses of modified nucleotides, which are
incorporated into a modified nucleic acid or mmRNA, e.g., RNA or
mRNA, are provided below in Scheme 1 through Scheme 11. Scheme 1
provides a general method for phosphorylation of nucleosides,
including modified nucleosides.
##STR00119##
[0474] Various protecting groups may be used to control the
reaction. For example, Scheme 2 provides the use of multiple
protecting and deprotecting steps to promote phosphorylation at the
5' position of the sugar, rather than the 2' and 3' hydroxyl
groups.
##STR00120##
[0475] Modified nucleotides can be synthesized in any useful
manner. Schemes 3, 4, and 7 provide exemplary methods for
synthesizing modified nucleotides having a modified purine
nucleobase; and Schemes 5 and 6 provide exemplary methods for
synthesizing modified nucleotides having a modified pseudouridine
or pseudoisocytidine, respectively.
##STR00121##
##STR00122##
##STR00123##
##STR00124##
##STR00125##
[0476] Schemes 8 and 9 provide exemplary syntheses of modified
nucleotides. Scheme 10 provides a non-limiting biocatalytic method
for producing nucleotides.
##STR00126##
##STR00127##
##STR00128##
[0477] Scheme 11 provides an exemplary synthesis of a modified
uracil, where the N1 position is modified with R.sup.12b, as
provided elsewhere, and the 5'-position of ribose is
phosphorylated. T.sup.1, T.sup.2, R.sup.12a, R.sup.12b, and r are
as provided herein. This synthesis, as well as optimized versions
thereof, can be used to modify other pyrimidine nucleobases and
purine nucleobases (see e.g., Formulas (b1)-(b43)) and/or to
install one or more phosphate groups (e.g., at the 5' position of
the sugar). This alkylating reaction can also be used to include
one or more optionally substituted alkyl group at any reactive
group (e.g., amino group) in any nucleobase described herein (e.g.,
the amino groups in the Watson-Crick base-pairing face for
cytosine, uracil, adenine, and guanine)
##STR00129##
Combinations of Nucleotides in mmRNA
[0478] Further examples of modified nucleotides and modified
nucleotide combinations are provided below in Table 9. These
combinations of modified nucleotides can be used to form the
polypeptides, primary constructs, or mmRNA of the invention. Unless
otherwise noted, the modified nucleotides may be completely
substituted for the natural nucleotides of the modified nucleic
acids or mmRNA of the invention. As a non-limiting example, the
natural nucleotide uridine may be substituted with a modified
nucleoside described herein. In another non-limiting example, the
natural nucleotide uridine may be partially substituted (e.g.,
about 0.1%, 1%, 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%,
55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or 99.9%) with at least
one of the modified nucleoside disclosed herein.
TABLE-US-00008 TABLE 9 Modified Nucleotide Modified Nucleotide
Combination .alpha.-thio-cytidine
.alpha.-thio-cytidine/5-iodo-uridine
.alpha.-thio-cytidine/N1-methyl-pseudouridine
.alpha.-thio-cytidine/.alpha.-thio-uridine
.alpha.-thio-cytidine/5-methyl-uridine
.alpha.-thio-cytidine/pseudo-uridine about 50% of the cytosines are
.alpha.-thio-cytidine pseudoisocytidine
pseudoisocytidine/5-iodo-uridine
pseudoisocytidine/N1-methyl-pseudouridine
pseudoisocytidine/.alpha.-thio-uridine
pseudoisocytidine/5-methyl-uridine pseudoisocytidine/pseudouridine
about 25% of cytosines are pseudoisocytidine
pseudoisocytidine/about 50% of uridines are N1-
methyl-pseudouridine and about 50% of uridines are pseudouridine
pseudoisocytidine/about 25% of uridines are N1-
methyl-pseudouridine and about 25% of uridines are pseudouridine
pyrrolo-cytidine pyrrolo-cytidine/5-iodo-uridine
pyrrolo-cytidine/N1-methyl-pseudouridine
pyrrolo-cytidine/.alpha.-thio-uridine
pyrrolo-cytidine/5-methyl-uridine pyrrolo-cytidine/pseudouridine
about 50% of the cytosines are pyrrolo-cytidine 5-methyl-cytidine
5-methyl-cytidine/5-iodo-uridine
5-methyl-cytidine/N1-methyl-pseudouridine
5-methyl-cytidine/.alpha.-thio-uridine
5-methyl-cytidine/5-methyl-uridine 5-methyl-cytidine/pseudouridine
about 25% of cytosines are 5-methyl-cytidine about 50% of cytosines
are 5-methyl-cytidine 5-methyl-cytidine/5-methoxy-uridine
5-methyl-cytidine/5-bromo-uridine 5-methyl-cytidine/2-thio-uridine
5-methyl-cytidine/about 50% of uridines are 2-thio- uridine about
50% of uridines are 5-methyl-cytidine/about 50% of uridines are
2-thio-uridine N4-acetyl-cytidine N4-acetyl-cytidine/5-iodo-uridine
N4-acetyl-cytidine/N1-methyl-pseudouridine
N4-acetyl-cytidine/.alpha.-thio-uridine
N4-acetyl-cytidine/5-methyl-uridine
N4-acetyl-cytidine/pseudouridine about 50% of cytosines are
N4-acetyl-cytidine about 25% of cytosines are N4-acetyl-cytidine
N4-acetyl-cytidine/5-methoxy-uridine
N4-acetyl-cytidine/5-bromo-uridine
N4-acetyl-cytidine/2-thio-uridine about 50% of cytosines are
N4-acetyl-cytidine/about 50% of uridines are 2-thio-uridine
[0479] Further examples of modified nucleotide combinations are
provided below in Table 10. These combinations of modified
nucleotides can be used to form the polypeptides, primary
constructs, or mmRNA of the invention.
TABLE-US-00009 TABLE 10 Modified Nucleotide Modified Nucleotide
Combination modified cytidine having modified cytidine with
(b10)/pseudouridine one or more nucleobases modified cytidine with
(b10)/N1-methyl- of Formula (b10) pseudouridine modified cytidine
with (b10)/5-methoxy-uridine modified cytidine with
(b10)/5-methyl-uridine modified cytidine with (b10)/5-bromo-uridine
modified cytidine with (b10)/2-thio-uridine about 50% of cytidine
substituted with modified cytidine (b10)/about 50% of uridines are
2-thio-uridine modified cytidine having modified cytidine with
(b32)/pseudouridine one or more nucleobases modified cytidine with
(b32)/N1-methyl- of Formula (b32) pseudouridine modified cytidine
with (b32)/5-methoxy-uridine modified cytidine with
(b32)/5-methyl-uridine modified cytidine with (b32)/5-bromo-uridine
modified cytidine with (b32)/2-thio-uridine about 50% of cytidine
substituted with modified cytidine (b32)/about 50% of uridines are
2-thio-uridine modified uridine having modified uridine with
(b1)/N4-acetyl-cytidine one or more nucleobases modified uridine
with (b1)/5-methyl-cytidine of Formula (b1) modified uridine having
modified uridine with (b8)/N4-acetyl-cytidine one or more
nucleobases modified uridine with (b8)/5-methyl-cytidine of Formula
(b8) modified uridine having modified uridine with
(b28)/N4-acetyl-cytidine one or more nucleobases modified uridine
with (b28)/5-methyl-cytidine of Formula (b28) modified uridine
having modified uridine with (b29)/N4-acetyl-cytidine one or more
nucleobases modified uridine with (b29)/5-methyl-cytidine of
Formula (b29) modified uridine having modified uridine with
(b30)/N4-acetyl-cytidine one or more nucleobases modified uridine
with (b30)/5-methyl-cytidine of Formula (b30)
[0480] In some embodiments, at least 25% of the cytosines are
replaced by a compound of Formula (b10)-(b14) (e.g., at least about
30%, at least about 35%, at least about 40%, at least about 45%, at
least about 50%, at least about 55%, at least about 60%, at least
about 65%, at least about 70%, at least about 75%, at least about
80%, at least about 85%, at least about 90%, at least about 95%, or
about 100%).
[0481] In some embodiments, at least 25% of the uracils are
replaced by a compound of Formula (b1)-(b9) (e.g., at least about
30%, at least about 35%, at least about 40%, at least about 45%, at
least about 50%, at least about 55%, at least about 60%, at least
about 65%, at least about 70%, at least about 75%, at least about
80%, at least about 85%, at least about 90%, at least about 95%, or
about 100%).
[0482] In some embodiments, at least 25% of the cytosines are
replaced by a compound of Formula (b10)-(b14), and at least 25% of
the uracils are replaced by a compound of Formula (b1)-(b9) (e.g.,
at least about 30%, at least about 35%, at least about 40%, at
least about 45%, at least about 50%, at least about 55%, at least
about 60%, at least about 65%, at least about 70%, at least about
75%, at least about 80%, at least about 85%, at least about 90%, at
least about 95%, or about 100%).
IV. PHARMACEUTICAL COMPOSITIONS
Formulation, Administration, Delivery and Dosing
[0483] The present invention provides polynucleotides, primary
constructs and mmRNA compositions and complexes in combination with
one or more pharmaceutically acceptable excipients. Pharmaceutical
compositions may optionally comprise one or more additional active
substances, e.g. therapeutically and/or prophylactically active
substances. General considerations in the formulation and/or
manufacture of pharmaceutical agents may be found, for example, in
Remington: The Science and Practice of Pharmacy 21.sup.st ed.,
Lippincott Williams & Wilkins, 2005 (incorporated herein by
reference).
[0484] In some embodiments, compositions are administered to
humans, human patients or subjects. For the purposes of the present
disclosure, the phrase "active ingredient" generally refers to
polynucleotides, primary constructs and mmRNA to be delivered as
described herein.
[0485] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions which are suitable for administration to humans, it
will be understood by the skilled artisan that such compositions
are generally suitable for administration to any other animal,
e.g., to non-human animals, e.g. non-human mammals. Modification of
pharmaceutical compositions suitable for administration to humans
in order to render the compositions suitable for administration to
various animals is well understood, and the ordinarily skilled
veterinary pharmacologist can design and/or perform such
modification with merely ordinary, if any, experimentation.
Subjects to which administration of the pharmaceutical compositions
is contemplated include, but are not limited to, humans and/or
other primates; mammals, including commercially relevant mammals
such as cattle, pigs, horses, sheep, cats, dogs, mice, and/or rats;
and/or birds, including commercially relevant birds such as
poultry, chickens, ducks, geese, and/or turkeys.
[0486] Formulations of the pharmaceutical compositions described
herein may be prepared by any method known or hereafter developed
in the art of pharmacology. In general, such preparatory methods
include the step of bringing the active ingredient into association
with an excipient and/or one or more other accessory ingredients,
and then, if necessary and/or desirable, dividing, shaping and/or
packaging the product into a desired single- or multi-dose
unit.
[0487] A pharmaceutical composition in accordance with the
invention may be prepared, packaged, and/or sold in bulk, as a
single unit dose, and/or as a plurality of single unit doses. As
used herein, a "unit dose" is discrete amount of the pharmaceutical
composition comprising a predetermined amount of the active
ingredient. The amount of the active ingredient is generally equal
to the dosage of the active ingredient which would be administered
to a subject and/or a convenient fraction of such a dosage such as,
for example, one-half or one-third of such a dosage.
[0488] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
invention will vary, depending upon the identity, size, and/or
condition of the subject treated and further depending upon the
route by which the composition is to be administered. By way of
example, the composition may comprise between 0.1% and 100%, e.g.,
between 0.5 and 50%, between 1-30%, between 5-80%, at least 80%
(w/w) active ingredient.
Formulations
[0489] The polynucleotide, primary construct, and mmRNA of the
invention can be formulated using one or more excipients to: (1)
increase stability; (2) increase cell transfection; (3) permit the
sustained or delayed release (e.g., from a depot formulation of the
polynucleotide, primary construct, or mmRNA); (4) alter the
biodistribution (e.g., target the polynucleotide, primary
construct, or mmRNA to specific tissues or cell types); (5)
increase the translation of encoded protein in vivo; and/or (6)
alter the release profile of encoded protein in vivo. In addition
to traditional excipients such as any and all solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, excipients of the present
invention can include, without limitation, lipidoids, liposomes,
lipid nanoparticles, polymers, lipoplexes, core-shell
nanoparticles, peptides, proteins, cells transfected with
polynucleotide, primary construct, or mmRNA (e.g., for
transplantation into a subject), hyaluronidase, nanoparticle mimics
and combinations thereof. Accordingly, the formulations of the
invention can include one or more excipients, each in an amount
that together increases the stability of the polynucleotide,
primary construct, or mmRNA, increases cell transfection by the
polynucleotide, primary construct, or mmRNA, increases the
expression of polynucleotide, primary construct, or mmRNA encoded
protein, and/or alters the release profile of polynucleotide,
primary construct, or mmRNA encoded proteins. Further, the primary
construct and mmRNA of the present invention may be formulated
using self-assembled nucleic acid nanoparticles.
[0490] Formulations of the pharmaceutical compositions described
herein may be prepared by any method known or hereafter developed
in the art of pharmacology. In general, such preparatory methods
include the step of associating the active ingredient with an
excipient and/or one or more other accessory ingredients.
[0491] A pharmaceutical composition in accordance with the present
disclosure may be prepared, packaged, and/or sold in bulk, as a
single unit dose, and/or as a plurality of single unit doses. As
used herein, a "unit dose" refers to a discrete amount of the
pharmaceutical composition comprising a predetermined amount of the
active ingredient. The amount of the active ingredient may
generally be equal to the dosage of the active ingredient which
would be administered to a subject and/or a convenient fraction of
such a dosage including, but not limited to, one-half or one-third
of such a dosage.
[0492] Relative amounts of the active ingredient, the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition in accordance with the
present disclosure may vary, depending upon the identity, size,
and/or condition of the subject being treated and further depending
upon the route by which the composition is to be administered. For
example, the composition may comprise between 0.1% and 99% (w/w) of
the active ingredient.
[0493] In some embodiments, the formulations described herein may
contain at least one mmRNA. As a non-limiting example, the
formulations may contain 1, 2, 3, 4 or 5 mmRNA. In one embodiment
the formulation may contain modified mRNA encoding proteins
selected from categories such as, but not limited to, human
proteins, veterinary proteins, bacterial proteins, biological
proteins, antibodies, immunogenic proteins, therapeutic peptides
and proteins, secreted proteins, plasma membrane proteins,
cytoplasmic and cytoskeletal proteins, intrancellular membrane
bound proteins, nuclear proteins, proteins associated with human
disease and/or proteins associated with non-human diseases. In one
embodiment, the formulation contains at least three modified mRNA
encoding proteins. In one embodiment, the formulation contains at
least five modified mRNA encoding proteins.
[0494] Pharmaceutical formulations may additionally comprise a
pharmaceutically acceptable excipient, which, as used herein,
includes, but is not limited to, any and all solvents, dispersion
media, diluents, or other liquid vehicles, dispersion or suspension
aids, surface active agents, isotonic agents, thickening or
emulsifying agents, preservatives, and the like, as suited to the
particular dosage form desired. Various excipients for formulating
pharmaceutical compositions and techniques for preparing the
composition are known in the art (see Remington: The Science and
Practice of Pharmacy, 21.sup.st Edition, A. R. Gennaro, Lippincott,
Williams & Wilkins, Baltimore, Md., 2006; incorporated herein
by reference in its entirety). The use of a conventional excipient
medium may be contemplated within the scope of the present
disclosure, except insofar as any conventional excipient medium may
be incompatible with a substance or its derivatives, such as by
producing any undesirable biological effect or otherwise
interacting in a deleterious manner with any other component(s) of
the pharmaceutical composition.
[0495] In some embodiments, the particle size of the lipid
nanoparticle may be increased and/or decreased. The change in
particle size may be able to help counter biological reaction such
as, but not limited to, inflammation or may increase the biological
effect of the modified mRNA delivered to mammals.
[0496] Pharmaceutically acceptable excipients used in the
manufacture of pharmaceutical compositions include, but are not
limited to, inert diluents, surface active agents and/or
emulsifiers, preservatives, buffering agents, lubricating agents,
and/or oils. Such excipients may optionally be included in the
pharmaceutical formulations of the invention.
Lipidoids
[0497] The synthesis of lipidoids has been extensively described
and formulations containing these compounds are particularly suited
for delivery of polynucleotides, primary constructs or mmRNA (see
Mahon et al., Bioconjug Chem. 2010 21:1448-1454; Schroeder et al.,
J Intern Med. 2010 267:9-21; Akinc et al., Nat Biotechnol. 2008
26:561-569; Love et al., Proc Natl Acad Sci USA. 2010
107:1864-1869; Siegwart et al., Proc Natl Acad Sci USA. 2011
108:12996-3001; all of which are incorporated herein in their
entireties).
[0498] While these lipidoids have been used to effectively deliver
double stranded small interfering RNA molecules in rodents and
non-human primates (see Akinc et al., Nat Biotechnol. 2008
26:561-569; Frank-Kamenetsky et al., Proc Natl Acad Sci USA. 2008
105:11915-11920; Akinc et al., Mol. Ther. 2009 17:872-879; Love et
al., Proc Natl Acad Sci USA. 2010 107:1864-1869; Leuschner et al.,
Nat Biotechnol. 2011 29:1005-1010; all of which is incorporated
herein in their entirety), the present disclosure describes their
formulation and use in delivering single stranded polynucleotides,
primary constructs, or mmRNA. Complexes, micelles, liposomes or
particles can be prepared containing these lipidoids and therefore,
can result in an effective delivery of the polynucleotide, primary
construct, or mmRNA, as judged by the production of an encoded
protein, following the injection of a lipidoid formulation via
localized and/or systemic routes of administration. Lipidoid
complexes of polynucleotides, primary constructs, or mmRNA can be
administered by various means including, but not limited to,
intravenous, intramuscular, or subcutaneous routes.
[0499] In vivo delivery of nucleic acids may be affected by many
parameters, including, but not limited to, the formulation
composition, nature of particle PEGylation, degree of loading,
oligonucleotide to lipid ratio, and biophysical parameters such as,
but not limited to, particle size (Akinc et al., Mol Ther. 2009
17:872-879; herein incorporated by reference in its entirety). As
an example, small changes in the anchor chain length of
poly(ethylene glycol) (PEG) lipids may result in significant
effects on in vivo efficacy. Formulations with the different
lipidoids, including, but not limited to
penta[3-(1-laurylaminopropionyl)]-triethylenetetramine
hydrochloride (TETA-5LAP; aka 98N12-5, see Murugaiah et al.,
Analytical Biochemistry, 401:61 (2010); herein incorporated by
reference in its entirety), C12-200 (including derivatives and
variants), and MD1, can be tested for in vivo activity.
[0500] The lipidoid referred to herein as "98N12-5" is disclosed by
Akinc et al., Mol Ther. 2009 17:872-879 and is incorporated by
reference in its entirety. (See FIG. 2)
[0501] The lipidoid referred to herein as "C12-200" is disclosed by
Love et al., Proc Natl Acad Sci USA. 2010 107:1864-1869 (see FIG.
2) and Liu and Huang, Molecular Therapy. 2010 669-670 (see FIG. 2);
both of which are herein incorporated by reference in their
entirety. The lipidoid formulations can include particles
comprising either 3 or 4 or more components in addition to
polynucleotide, primary construct, or mmRNA. As an example,
formulations with certain lipidoids, include, but are not limited
to, 98N12-5 and may contain 42% lipidoid, 48% cholesterol and 10%
PEG (C.sub.1-4 alkyl chain length). As another example,
formulations with certain lipidoids, include, but are not limited
to, C12-200 and may contain 50% lipidoid, 10% disteroylphosphatidyl
choline, 38.5% cholesterol, and 1.5% PEG-DMG.
[0502] In one embodiment, a polynucleotide, primary construct, or
mmRNA formulated with a lipidoid for systemic intravenous
administration can target the liver. For example, a final optimized
intravenous formulation using polynucleotide, primary construct, or
mmRNA, and comprising a lipid molar composition of 42% 98N12-5, 48%
cholesterol, and 10% PEG-lipid with a final weight ratio of about
7.5 to 1 total lipid to polynucleotide, primary construct, or
mmRNA, and a C.sub.1-4 alkyl chain length on the PEG lipid, with a
mean particle size of roughly 50-60 nm, can result in the
distribution of the formulation to be greater than 90% to the
liver. (see, Akinc et al., Mol. Ther. 2009 17:872-879; herein
incorporated by reference in its entirety). In another example, an
intravenous formulation using a C12-200 (see U.S. provisional
application 61/175,770 and published international application
WO2010129709, each of which is herein incorporated by reference in
their entirety) lipidoid may have a molar ratio of 50/10/38.5/1.5
of C12-200/disteroylphosphatidyl choline/cholesterol/PEG-DMG, with
a weight ratio of 7 to 1 total lipid to polynucleotide, primary
construct, or mmRNA, and a mean particle size of 80 nm may be
effective to deliver polynucleotide, primary construct, or mmRNA to
hepatocytes (see, Love et al., Proc Natl Acad Sci USA. 2010
107:1864-1869 herein incorporated by reference in its entirety). In
another embodiment, an MD1 lipidoid-containing formulation may be
used to effectively deliver polynucleotide, primary construct, or
mmRNA to hepatocytes in vivo. The characteristics of optimized
lipidoid formulations for intramuscular or subcutaneous routes may
vary significantly depending on the target cell type and the
ability of formulations to diffuse through the extracellular matrix
into the blood stream. While a particle size of less than 150 nm
may be desired for effective hepatocyte delivery due to the size of
the endothelial fenestrae (see, Akinc et al., Mol Ther. 2009
17:872-879 herein incorporated by reference in its entirety), use
of a lipidoid-formulated polynucleotide, primary construct, or
mmRNA to deliver the formulation to other cells types including,
but not limited to, endothelial cells, myeloid cells, and muscle
cells may not be similarly size-limited. Use of lipidoid
formulations to deliver siRNA in vivo to other non-hepatocyte cells
such as myeloid cells and endothelium has been reported (see Akinc
et al., Nat Biotechnol. 2008 26:561-569; Leuschner et al., Nat
Biotechnol. 2011 29:1005-1010; Cho et al. Adv. Funct. Mater. 2009
19:3112-3118; 8.sup.th International Judah Folkman Conference,
Cambridge, Mass. Oct. 8-9, 2010; each of which is herein
incorporated by reference in its entirety). Effective delivery to
myeloid cells, such as monocytes, lipidoid formulations may have a
similar component molar ratio. Different ratios of lipidoids and
other components including, but not limited to,
disteroylphosphatidyl choline, cholesterol and PEG-DMG, may be used
to optimize the formulation of the polynucleotide, primary
construct, or mmRNA for delivery to different cell types including,
but not limited to, hepatocytes, myeloid cells, muscle cells, etc.
For example, the component molar ratio may include, but is not
limited to, 50% C12-200, 10% disteroylphosphatidyl choline, 38.5%
cholesterol, and %1.5 PEG-DMG (see Leuschner et al., Nat Biotechnol
2011 29:1005-1010; herein incorporated by reference in its
entirety). The use of lipidoid formulations for the localized
delivery of nucleic acids to cells (such as, but not limited to,
adipose cells and muscle cells) via either subcutaneous or
intramuscular delivery, may not require all of the formulation
components desired for systemic delivery, and as such may comprise
only the lipidoid and the polynucleotide, primary construct, or
mmRNA.
[0503] Combinations of different lipidoids may be used to improve
the efficacy of polynucleotide, primary construct, or mmRNA
directed protein production as the lipidoids may be able to
increase cell transfection by the polynucleotide, primary
construct, or mmRNA; and/or increase the translation of encoded
protein (see Whitehead et al., Mol. Ther. 2011, 19:1688-1694,
herein incorporated by reference in its entirety).
Liposomes, Lipoplexes, and Lipid Nanoparticles
[0504] The polynucleotide, primary construct, and mmRNA of the
invention can be formulated using one or more liposomes,
lipoplexes, or lipid nanoparticles. In one embodiment,
pharmaceutical compositions of polynucleotide, primary construct,
or mmRNA include liposomes. Liposomes are artificially-prepared
vesicles which may primarily be composed of a lipid bilayer and may
be used as a delivery vehicle for the administration of nutrients
and pharmaceutical formulations. Liposomes can be of different
sizes such as, but not limited to, a multilamellar vesicle (MLV)
which may be hundreds of nanometers in diameter and may contain a
series of concentric bilayers separated by narrow aqueous
compartments, a small unicellular vesicle (SUV) which may be
smaller than 50 nm in diameter, and a large unilamellar vesicle
(LUV) which may be between 50 and 500 nm in diameter. Liposome
design may include, but is not limited to, opsonins or ligands in
order to improve the attachment of liposomes to unhealthy tissue or
to activate events such as, but not limited to, endocytosis.
Liposomes may contain a low or a high pH in order to improve the
delivery of the pharmaceutical formulations.
[0505] The formation of liposomes may depend on the physicochemical
characteristics such as, but not limited to, the pharmaceutical
formulation entrapped and the liposomal ingredients, the nature of
the medium in which the lipid vesicles are dispersed, the effective
concentration of the entrapped substance and its potential
toxicity, any additional processes involved during the application
and/or delivery of the vesicles, the optimization size,
polydispersity and the shelf-life of the vesicles for the intended
application, and the batch-to-batch reproducibility and possibility
of large-scale production of safe and efficient liposomal
products.
[0506] In one embodiment, pharmaceutical compositions described
herein may include, without limitation, liposomes such as those
formed from 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA)
liposomes, DiLa2 liposomes from Marina Biotech (Bothell, Wash.),
1,2-dilinoleyloxy-3-dimethylaminopropane (DLin-DMA),
2,2-dilinoleyl-4-(2-dimethylaminoethyl)-[1,3]-dioxolane
(DLin-KC2-DMA), and MC3 (US20100324120; herein incorporated by
reference in its entirety) and liposomes which may deliver small
molecule drugs such as, but not limited to, DOXIL.RTM. from Janssen
Biotech, Inc. (Horsham, Pa.).
[0507] In one embodiment, pharmaceutical compositions described
herein may include, without limitation, liposomes such as those
formed from the synthesis of stabilized plasmid-lipid particles
(SPLP) or stabilized nucleic acid lipid particle (SNALP) that have
been previously described and shown to be suitable for
oligonucleotide delivery in vitro and in vivo (see Wheeler et al.
Gene Therapy. 1999 6:271-281; Zhang et al. Gene Therapy. 1999
6:1438-1447; Jeffs et al. Pharm Res. 2005 22:362-372; Morrissey et
al., Nat. Biotechnol. 2005 2:1002-1007; Zimmermann et al., Nature.
2006 441:111-114; Heyes et al. J Contr Rel. 2005 107:276-287;
Semple et al. Nature Biotech. 2010 28:172-176; Judge et al. J Clin
Invest. 2009 119:661-673; deFougerolles Hum Gene Ther. 2008
19:125-132; all of which are incorporated herein in their
entireties). The original manufacture method by Wheeler et al. was
a detergent dialysis method, which was later improved by Jeffs et
al. and is referred to as the spontaneous vesicle formation method.
The liposome formulations are composed of 3 to 4 lipid components
in addition to the polynucleotide, primary construct, or mmRNA. As
an example a liposome can contain, but is not limited to, 55%
cholesterol, 20% disteroylphosphatidyl choline (DSPC), 10%
PEG-S-DSG, and 15% 1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),
as described by Jeffs et al. As another example, certain liposome
formulations may contain, but are not limited to, 48% cholesterol,
20% DSPC, 2% PEG-c-DMA, and 30% cationic lipid, where the cationic
lipid can be 1,2-distearloxy-N,N-dimethylaminopropane (DSDMA),
DODMA, DLin-DMA, or 1,2-dilinolenyloxy-3-dimethylaminopropane
(DLenDMA), as described by Heyes et al.
[0508] In one embodiment, pharmaceutical compositions may include
liposomes which may be formed to deliver mmRNA which may encode at
least one immunogen. The mmRNA may be encapsulated by the liposome
and/or it may be contained in an aqueous core which may then be
encapsulated by the liposome (see International Pub. Nos.
WO2012031046, WO2012031043, WO2012030901 and WO2012006378; each of
which is herein incorporated by reference in their entirety). In
another embodiment, the mmRNA which may encode an immunogen may be
formulated in a cationic oil-in-water emulsion where the emulsion
particle comprises an oil core and a cationic lipid which can
interact with the mmRNA anchoring the molecule to the emulsion
particle (see International Pub. No. WO2012006380; herein
incorporated by reference in its entirety). In yet another
embodiment, the lipid formulation may include at least cationic
lipid, a lipid which may enhance transfection and a least one lipid
which contains a hydrophilic head group linked to a lipid moiety
(International Pub. No. WO2011076807 and U.S. Pub. No. 20110200582;
each of which is herein incorporated by reference in their
entirety). In another embodiment, the polynucleotides, primary
constructs and/or mmRNA encoding an immunogen may be formulated in
a lipid vesicle which may have crosslinks between functionalized
lipid bilayers (see U.S. Pub. No. 20120177724, herein incorporated
by reference in its entirety).
[0509] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA may be formulated in a lipid vesicle which may have
crosslinks between functionalized lipid bilayers.
[0510] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA may be formulated in a liposome comprising a cationic
lipid. The liposome may have a molar ratio of nitrogen atoms in the
cationic lipid to the phosphates in the RNA (N:P ratio) of between
1:1 and 20:1 as described in International Publication No.
WO2013006825, herein incorporated by reference in its entirety. In
another embodiment, the liposome may have a N:P ratio of greater
than 20:1 or less than 1:1.
[0511] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA may be formulated in a lipid-polycation complex. The
formation of the lipid-polycation complex may be accomplished by
methods known in the art and/or as described in U.S. Pub. No.
20120178702, herein incorporated by reference in its entirety. As a
non-limiting example, the polycation may include a cationic peptide
or a polypeptide such as, but not limited to, polylysine,
polyornithine and/or polyarginine and the cationic peptides
described in International Pub. No. WO2012013326; herein
incorporated by reference in its entirety. In another embodiment,
the polynucleotides, primary constructs and/or mmRNA may be
formulated in a lipid-polycation complex which may further include
a neutral lipid such as, but not limited to, cholesterol or
dioleoyl phosphatidylethanolamine (DOPE).
[0512] The liposome formulation may be influenced by, but not
limited to, the selection of the cationic lipid component, the
degree of cationic lipid saturation, the nature of the PEGylation,
ratio of all components and biophysical parameters such as size. In
one example by Semple et al. (Semple et al. Nature Biotech. 2010
28:172-176; herein incorporated by reference in its entirety), the
liposome formulation was composed of 57.1% cationic lipid, 7.1%
dipalmitoylphosphatidylcholine, 34.3% cholesterol, and 1.4%
PEG-c-DMA. As another example, changing the composition of the
cationic lipid could more effectively deliver siRNA to various
antigen presenting cells (Basha et al. Mol Ther. 2011 19:2186-2200;
herein incorporated by reference in its entirety).
[0513] In some embodiments, the ratio of PEG in the lipid
nanoparticle (LNP) formulations may be increased or decreased
and/or the carbon chain length of the PEG lipid may be modified
from C14 to C18 to alter the pharmacokinetics and/or
biodistribution of the LNP formulations. As a non-limiting example,
LNP formulations may contain 1-5% of the lipid molar ratio of
PEG-c-DOMG as compared to the cationic lipid, DSPC and cholesterol.
In another embodiment the PEG-c-DOMG may be replaced with a PEG
lipid such as, but not limited to, PEG-DSG
(1,2-Distearoyl-sn-glycerol, methoxypolyethylene glycol) or PEG-DPG
(1,2-Dipalmitoyl-sn-glycerol, methoxypolyethylene glycol). The
cationic lipid may be selected from any lipid known in the art such
as, but not limited to, DLin-MC3-DMA, DLin-DMA, C12-200 and
DLin-KC2-DMA.
[0514] In one embodiment, the polynucleotides, primary constructs
or mmRNA may be formulated in a lipid nanoparticle such as those
described in International Publication No. WO2012170930, herein
incorporated by reference in its entirety.
[0515] In one embodiment, the cationic lipid may be selected from,
but not limited to, a cationic lipid described in International
Publication Nos. WO2012040184, WO2011153120, WO2011149733,
WO2011090965, WO2011043913, WO2011022460, WO2012061259,
WO2012054365, WO2012044638, WO2010080724, WO201021865 and
WO2008103276, U.S. Pat. Nos. 7,893,302, 7,404,969 and 8,283,333 and
US Patent Publication No. US20100036115 and US20120202871; each of
which is herein incorporated by reference in their entirety. In
another embodiment, the cationic lipid may be selected from, but
not limited to, formula A described in International Publication
Nos. WO2012040184, WO2011153120, WO2011149733, WO2011090965,
WO2011043913, WO2011022460, WO2012061259, WO2012054365 and
WO2012044638; each of which is herein incorporated by reference in
their entirety. In yet another embodiment, the cationic lipid may
be selected from, but not limited to, formula CLI-CLXXIX of
International Publication No. WO2008103276, formula CLI-CLXXIX of
U.S. Pat. No. 7,893,302, formula CLI-CLXXXXII of U.S. Pat. No.
7,404,969 and formula I-V1 of US Patent Publication No.
US20100036115; each of which is herein incorporated by reference in
their entirety. As a non-limiting example, the cationic lipid may
be selected from
(20Z,23Z)--N,N-dimethylnonacosa-20,23-dien-10-amine,
(17Z,20Z)--N,N-dimemylhexacosa-17,20-dien-9-amine,
(1Z,19Z)--N5N-dimethylpentacosa-16,19-dien-8-amine,
(13Z,16Z)--N,N-dimethyldocosa-13,16-dien-5-amine,
(12Z,15Z)--N,N-dimethylhenicosa-12,15-dien-4-amine,
(14Z,17Z)--N,N-dimethyltricosa-14,17-dien-6-amine,
(15Z,18Z)--N,N-dimethyltetracosa-15,18-dien-7-amine,
(18Z,21Z)--N,N-dimethylheptacosa-18,21-dien-10-amine,
(15Z,18Z)--N,N-dimethyltetracosa-15,18-dien-5-amine,
(14Z,17Z)--N,N-dimethyltricosa-14,17-dien-4-amine,
(19Z,22Z)--N,N-dimethyloctacosa-19,22-dien-9-amine,
(18Z,21Z)--N,N-dimethylheptacosa-18,21-dien-8-amine,
(17Z,20Z)--N,N-dimethylhexacosa-17,20-dien-7-amine,
(16Z,19Z)--N,N-dimethylpentacosa-16,19-dien-6-amine,
(22Z,25Z)--N,N-dimethylhentriaconta-22,25-dien-10-amine, (21
Z,24Z)--N,N-dimethyltriaconta-21,24-dien-9-amine,
(18Z)--N,N-dimethylheptacos-18-en-10-amine,
(17Z)--N,N-dimethylhexacos-17-en-9-amine,
(19Z,22Z)--N,N-dimethyloctacosa-19,22-dien-7-amine,
N,N-dimethylheptacosan-10-amine,
(20Z,23Z)--N-ethyl-N-methylnonacosa-20,23-dien-10-amine,
1-[(11Z,14Z)-1-nonylicosa-11,14-dien-1-yl]pyrrolidine,
(20Z)--N,N-dimethylheptacos-20-en-10-amine, (15Z)--N,N-dimethyl
eptacos-15-en-10-amine, (14Z)--N,N-dimethylnonacos-14-en-10-amine,
(17Z)--N,N-dimethylnonacos-17-en-10-amine,
(24Z)--N,N-dimethyltritriacont-24-en-10-amine,
(20Z)--N,N-dimethylnonacos-20-en-10-amine,
(22Z)--N,N-dimethylhentriacont-22-en-10-amine,
(16Z)--N,N-dimethylpentacos-16-en-8-amine,
(12Z,15Z)--N,N-dimethyl-2-nonylhenicosa-12,15-dien-1-amine,
(13Z,16Z)--N,N-dimethyl-3-nonyldocosa-13,16-dien-1-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]eptadecan-8-amine,
1-[(1S,2R)-2-hexylcyclopropyl]-N,N-dimethylnonadecan-10-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]nonadecan-10-amine,
N,N-dimethyl-21-[(1S,2R)-2-octylcyclopropyl]henicosan-10-amine,N,N-dimeth-
yl-1-[(1S,2S)-2-{[(1R,2R)-2-pentylcyclopropyl]methyl}cyclopropyl]nonadecan-
-10-amine,N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]hexadecan-8-amine,
N,N-dimethyl-[(1R,2S)-2-undecylcyclopropyl]tetradecan-5-amine,
N,N-dimethyl-3-{7-[(1S,2R)-2-octylcyclopropyl]heptyl}dodecan-1-amine,
1-[(1R,2S)-2-heptylcyclopropyl]-N,N-dimethyloctadecan-9-amine,
1-[(1S,2R)-2-decylcyclopropyl]-N,N-dimethylpentadecan-6-amine,
N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]pentadecan-8-amine,
R-N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octyloxy)propan-
-2-amine,
S-N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octylo-
xy)propan-2-amine,
1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}pyrr-
olidine,
(2S)--N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-[(5Z-
)-oct-5-en-1-yloxy]propan-2-amine,
1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}azet-
idine,
(2S)-1-(hexyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-ylo-
xy]propan-2-amine,
(2S)-1-(heptyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]pr-
opan-2-amine,
N,N-dimethyl-1-(nonyloxy)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-
-amine,
N,N-dimethyl-1-[(9Z)-octadec-9-en-1-yloxy]-3-(octyloxy)propan-2-am-
ine;
(2S)--N,N-dimethyl-1-[(6Z,9Z,12Z)-octadeca-6,9,12-trien-1-yloxy]-3-(o-
ctyloxy)propan-2-amine,
(2S)-1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(pentyloxy)pro-
pan-2-amine,
(2S)-1-(hexyloxy)-3-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethylprop-
an-2-amine,
1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2--
amine,
1-[(13Z,16Z)-docosa-13,16-dien-1-yloxy]-N,N-dimethyl-3-(octyloxy)pr-
opan-2-amine,
(2S)-1-[(13Z,16Z)-docosa-13,16-dien-1-yloxy]-3-(hexyloxy)-N,N-dimethylpro-
pan-2-amine,
(2S)-1-[(13Z)-docos-13-en-1-yloxy]-3-(hexyloxy)-N,N-dimethylpropan-2-amin-
e,
1-[(13Z)-docos-13-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine,
1-[(9Z)-hexadec-9-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine,
(2R)--N,N-dimethyl-H(1-metoyloctyl)oxy]-3-[(9Z,12Z)-octadeca-9,12-dien-1--
yloxy]propan-2-amine,
(2R)-1-[(3,7-dimethyloctyl)oxy]-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-di-
en-1-yloxy]propan-2-amine,
N,N-dimethyl-1-(octyloxy)-3-({8-[(1S,2S)-2-{[(1R,2R)-2-pentylcyclopropyl]-
methyl}cyclopropyl]octyl}oxy)propan-2-amine,
N,N-dimethyl-1-{[8-(2-oclylcyclopropyl)octyl]oxy}-3-(octyloxy)propan-2-am-
ine and (11E,20Z,23Z)--N,N-dimethylnonacosa-11,20,2-trien-10-amine
or a pharmaceutically acceptable salt or stereoisomer thereof.
[0516] In one embodiment, the lipid may be a cleavable lipid such
as those described in International Publication No. WO2012170889,
herein incorporated by reference in its entirety.
[0517] In one embodiment, the cationic lipid may be synthesized by
methods known in the art and/or as described in International
Publication Nos. WO2012040184, WO2011153120, WO2011149733,
WO2011090965, WO2011043913, WO2011022460, WO2012061259,
WO2012054365, WO2012044638, WO2010080724 and WO201021865; each of
which is herein incorporated by reference in their entirety.
[0518] In one embodiment, the LNP formulations of the
polynucleotides, primary constructs and/or mmRNA may contain
PEG-c-DOMG at 3% lipid molar ratio. In another embodiment, the LNP
formulations polynucleotides, primary constructs and/or mmRNA may
contain PEG-c-DOMG at 1.5% lipid molar ratio.
[0519] In one embodiment, the pharmaceutical compositions of the
polynucleotides, primary constructs and/or mmRNA may include at
least one of the PEGylated lipids described in International
Publication No. 2012099755, herein incorporated by reference.
[0520] In one embodiment, the LNP formulation may contain PEG-DMG
2000
(1,2-dimyristoyl-sn-glycero-3-phophoethanolamine-N--[methoxy(polyethylene
glycol)-2000). In one embodiment, the LNP formulation may contain
PEG-DMG 2000, a cationic lipid known in the art and at least one
other component. In another embodiment, the LNP formulation may
contain PEG-DMG 2000, a cationic lipid known in the art, DSPC and
cholesterol. As a non-limiting example, the LNP formulation may
contain PEG-DMG 2000, DLin-DMA, DSPC and cholesterol. As another
non-limiting example the LNP formulation may contain PEG-DMG 2000,
DLin-DMA, DSPC and cholesterol in a molar ratio of 2:40:10:48 (see
e.g., Geall et al., Nonviral delivery of self-amplifying RNA
vaccines, PNAS 2012; PMID: 22908294; herein incorporated by
reference in its entirety). As another non-limiting example,
modified RNA described herein may be formulated in a nanoparticle
to be delivered by a parenteral route as described in U.S. Pub. No.
20120207845; herein incorporated by reference in its entirety.
In one embodiment, the LNP formulation may be formulated by the
methods described in International Publication Nos. WO2011127255 or
WO2008103276, each of which is herein incorporated by reference in
their entirety. As a non-limiting example, modified RNA described
herein may be encapsulated in LNP formulations as described in
WO2011127255 and/or WO2008103276; each of which is herein
incorporated by reference in their entirety. In one embodiment, LNP
formulations described herein may comprise a polycationic
composition. As a non-limiting example, the polycationic
composition may be selected from formula I-60 of US Patent
Publication No. US20050222064; herein incorporated by reference in
its entirety. In another embodiment, the LNP formulations
comprising a polycationic composition may be used for the delivery
of the modified RNA described herein in vivo and/or in vitro.
[0521] In one embodiment, the LNP formulations described herein may
additionally comprise a permeability enhancer molecule.
Non-limiting permeability enhancer molecules are described in US
Patent Publication No. US20050222064; herein incorporated by
reference in its entirety.
[0522] In one embodiment, the pharmaceutical compositions may be
formulated in liposomes such as, but not limited to, DiLa2
liposomes (Marina Biotech, Bothell, Wash.), SMARTICLES.RTM. (Marina
Biotech, Bothell, Wash.), neutral DOPC
(1,2-dioleoyl-sn-glycero-3-phosphocholine) based liposomes (e.g.,
siRNA delivery for ovarian cancer (Landen et al. Cancer Biology
& Therapy 2006 5(12)1708-1713); herein incorporated by
reference in its entirety) and hyaluronan-coated liposomes (Quiet
Therapeutics, Israel).
[0523] The nanoparticle formulations may be a carbohydrate
nanoparticle comprising a carbohydrate carrier and a modified
nucleic acid molecule (e.g., mmRNA). As a non-limiting example, the
carbohydrate carrier may include, but is not limited to, an
anhydride-modified phytoglycogen or glycogen-type material,
phtoglycogen octenyl succinate, phytoglycogen beta-dextrin,
anhydride-modified phytoglycogen beta-dextrin. (See e.g.,
International Publication No. WO2012109121; herein incorporated by
reference in its entirety).
[0524] Lipid nanoparticle formulations may be improved by replacing
the cationic lipid with a biodegradable cationic lipid which is
known as a rapidly eliminated lipid nanoparticle (reLNP). Ionizable
cationic lipids, such as, but not limited to, DLinDMA,
DLin-KC2-DMA, and DLin-MC3-DMA, have been shown to accumulate in
plasma and tissues over time and may be a potential source of
toxicity. The rapid metabolism of the rapidly eliminated lipids can
improve the tolerability and therapeutic index of the lipid
nanoparticles by an order of magnitude from a 1 mg/kg dose to a 10
mg/kg dose in rat. Inclusion of an enzymatically degraded ester
linkage can improve the degradation and metabolism profile of the
cationic component, while still maintaining the activity of the
reLNP formulation. The ester linkage can be internally located
within the lipid chain or it may be terminally located at the
terminal end of the lipid chain. The internal ester linkage may
replace any carbon in the lipid chain.
[0525] In one embodiment, the internal ester linkage may be located
on either side of the saturated carbon. Non-limiting examples of
reLNPs include,
##STR00130##
[0526] In one embodiment, an immune response may be elicited by
delivering a lipid nanoparticle which may include a nanospecies, a
polymer and an immunogen. (U.S. Publication No. 20120189700 and
International Publication No. WO2012099805; each of which is herein
incorporated by reference in their entirety). The polymer may
encapsulate the nanospecies or partially encapsulate the
nanospecies. The immunogen may be a recombinant protein, a modified
RNA and/or a primary construct described herein. In one embodiment,
the lipid nanoparticle may be formulated for use in a vaccine such
as, but not limited to, against a pathogen.
[0527] Lipid nanoparticles may be engineered to alter the surface
properties of particles so the lipid nanoparticles may penetrate
the mucosal barrier. Mucus is located on mucosal tissue such as,
but not limited to, oral (e.g., the buccal and esophageal membranes
and tonsil tissue), ophthalmic, gastrointestinal (e.g., stomach,
small intestine, large intestine, colon, rectum), nasal,
respiratory (e.g., nasal, pharyngeal, tracheal and bronchial
membranes), genital (e.g., vaginal, cervical and urethral
membranes). Nanoparticles larger than 10-200 nm which are preferred
for higher drug encapsulation efficiency and the ability to provide
the sustained delivery of a wide array of drugs have been thought
to be too large to rapidly diffuse through mucosal barriers. Mucus
is continuously secreted, shed, discarded or digested and recycled
so most of the trapped particles may be removed from the mucosla
tissue within seconds or within a few hours. Large polymeric
nanoparticles (200 nm-500 nm in diameter) which have been coated
densely with a low molecular weight polyethylene glycol (PEG)
diffused through mucus only 4 to 6-fold lower than the same
particles diffusing in water (Lai et al. PNAS 2007 104(5):1482-487;
Lai et al. Adv Drug Deliv Rev. 2009 61(2): 158-171; each of which
is herein incorporated by reference in their entirety). The
transport of nanoparticles may be determined using rates of
permeation and/or fluorescent microscopy techniques including, but
not limited to, fluorescence recovery after photobleaching (FRAP)
and high resolution multiple particle tracking (MPT). As a
non-limiting example, compositions which can penetrate a mucosal
barrier may be made as described in U.S. Pat. No. 8,241,670, herein
incorporated by reference in its entirety.
[0528] The lipid nanoparticle engineered to penetrate mucus may
comprise a polymeric material (i.e. a polymeric core) and/or a
polymer-vitamin conjugate and/or a tri-block co-polymer. The
polymeric material may include, but is not limited to, polyamines,
polyethers, polyamides, polyesters, polycarbamates, polyureas,
polycarbonates, poly(styrenes), polyimides, polysulfones,
polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines,
polyisocyanates, polyacrylates, polymethacrylates,
polyacrylonitriles, and polyarylates. The polymeric material may be
biodegradable and/or biocompatible. The polymeric material may
additionally be irradiated. As a non-limiting example, the
polymeric material may be gamma irradiated (See e.g., International
App. No. WO201282165, herein incorporated by reference in its
entirety). Non-limiting examples of specific polymers include
poly(caprolactone) (PCL), ethylene vinyl acetate polymer (EVA),
poly(lactic acid) (PLA), poly(L-lactic acid) (PLLA), poly(glycolic
acid) (PGA), poly(lactic acid-co-glycolic acid) (PLGA),
poly(L-lactic acid-co-glycolic acid) (PLLGA), poly(D,L-lactide)
(PDLA), poly(L-lactide) (PLLA), poly(D,L-lactide-co-caprolactone),
poly(D,L-lactide-co-caprolactone-co-glycolide),
poly(D,L-lactide-co-PEO-co-D,L-lactide),
poly(D,L-lactide-co-PPO-co-D,L-lactide), polyalkyl cyanoacralate,
polyurethane, poly-L-lysine (PLL), hydroxypropyl methacrylate
(HPMA), polyethyleneglycol, poly-L-glutamic acid, poly(hydroxy
acids), polyanhydrides, polyorthoesters, poly(ester amides),
polyamides, poly(ester ethers), polycarbonates, polyalkylenes such
as polyethylene and polypropylene, polyalkylene glycols such as
poly(ethylene glycol) (PEG), polyalkylene oxides (PEO),
polyalkylene terephthalates such as poly(ethylene terephthalate),
polyvinyl alcohols (PVA), polyvinyl ethers, polyvinyl esters such
as poly(vinyl acetate), polyvinyl halides such as poly(vinyl
chloride) (PVC), polyvinylpyrrolidone, polysiloxanes, polystyrene
(PS), polyurethanes, derivatized celluloses such as alkyl
celluloses, hydroxyalkyl celluloses, cellulose ethers, cellulose
esters, nitro celluloses, hydroxypropylcellulose,
carboxymethylcellulose, polymers of acrylic acids, such as
poly(methyl(meth)acrylate) (PMMA), poly(ethyl(meth)acrylate),
poly(butyl(meth)acrylate), poly(isobutyl(meth)acrylate),
poly(hexyl(meth)acrylate), poly(isodecyl(meth)acrylate),
poly(lauryl(meth)acrylate), poly(phenyl(meth)acrylate), poly(methyl
acrylate), poly(isopropyl acrylate), poly(isobutyl acrylate),
poly(octadecyl acrylate) and copolymers and mixtures thereof,
polydioxanone and its copolymers, polyhydroxyalkanoates,
polypropylene fumarate, polyoxymethylene, poloxamers,
poly(ortho)esters, poly(butyric acid), poly(valeric acid),
poly(lactide-co-caprolactone), and trimethylene carbonate,
polyvinylpyrrolidone. The lipid nanoparticle may be coated or
associated with a co-polymer such as, but not limited to, a block
co-polymer (such as a branched polyether-polyamide block copolymer
described in International Publication No. WO2013012476, herein
incorporated by reference in its entirety), and (poly(ethylene
glycol))-(poly(propylene oxide))-(poly(ethylene glycol)) triblock
copolymer (see e.g., US Publication 20120121718 and US Publication
20100003337 and U.S. Pat. No. 8,263,665; each of which is herein
incorporated by reference in their entirety). The co-polymer may be
a polymer that is generally regarded as safe (GRAS) and the
formation of the lipid nanoparticle may be in such a way that no
new chemical entities are created. For example, the lipid
nanoparticle may comprise poloxamers coating PLGA nanoparticles
without forming new chemical entities which are still able to
rapidly penetrate human mucus (Yang et al. Angew. Chem. Int. Ed.
2011 50:2597-2600; herein incorporated by reference in its
entirety).
[0529] The vitamin of the polymer-vitamin conjugate may be vitamin
E. The vitamin portion of the conjugate may be substituted with
other suitable components such as, but not limited to, vitamin A,
vitamin E, other vitamins, cholesterol, a hydrophobic moiety, or a
hydrophobic component of other surfactants (e.g., sterol chains,
fatty acids, hydrocarbon chains and alkylene oxide chains).
[0530] The lipid nanoparticle engineered to penetrate mucus may
include surface altering agents such as, but not limited to, mmRNA,
anionic proteins (e.g., bovine serum albumin), surfactants (e.g.,
cationic surfactants such as for example
dimethyldioctadecyl-ammonium bromide), sugars or sugar derivatives
(e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin,
polyethylene glycol and poloxamer), mucolytic agents (e.g.,
N-acetylcysteine, mugwort, bromelain, papain, clerodendrum,
acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna,
ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin,
gelsolin, thymosin .beta.4 dornase alfa, neltenexine, erdosteine)
and various DNases including rhDNase. The surface altering agent
may be embedded or enmeshed in the particle's surface or disposed
(e.g., by coating, adsorption, covalent linkage, or other process)
on the surface of the lipid nanoparticle. (see e.g., US Publication
20100215580 and US Publication 20080166414; each of which is herein
incorporated by reference in their entirety).
[0531] The mucus penetrating lipid nanoparticles may comprise at
least one mmRNA described herein. The mmRNA may be encapsulated in
the lipid nanoparticle and/or disposed on the surface of the
particle. The mmRNA may be covalently coupled to the lipid
nanoparticle. Formulations of mucus penetrating lipid nanoparticles
may comprise a plurality of nanoparticles. Further, the
formulations may contain particles which may interact with the
mucus and alter the structural and/or adhesive properties of the
surrounding mucus to decrease mucoadhesion which may increase the
delivery of the mucus penetrating lipid nanoparticles to the
mucosal tissue.
[0532] In one embodiment, the polynucleotide, primary construct, or
mmRNA is formulated as a lipoplex, such as, without limitation, the
ATUPLEX.TM. system, the DACC system, the DBTC system and other
siRNA-lipoplex technology from Silence Therapeutics (London, United
Kingdom), STEMFECT.TM. from STEMGENT.RTM. (Cambridge, Mass.), and
polyethylenimine (PEI) or protamine-based targeted and non-targeted
delivery of nucleic acids acids (Aleku et al. Cancer Res. 2008
68:9788-9798; Strumberg et al. Int J Clin Pharmacol Ther 2012
50:76-78; Santel et al., Gene Ther 2006 13:1222-1234; Santel et
al., Gene Ther 2006 13:1360-1370; Gutbier et al., Pulm Pharmacol.
Ther. 2010 23:334-344; Kaufmann et al. Microvasc Res 2010
80:286-293 Weide et al. J Immunother. 2009 32:498-507; Weide et al.
J Immunother. 2008 31:180-188; Pascolo Expert Opin. Biol. Ther.
4:1285-1294; Fotin-Mleczek et al., 2011 J. Immunother. 34:1-15;
Song et al., Nature Biotechnol. 2005, 23:709-717; Peer et al., Proc
Natl Acad Sci USA. 2007 6; 104:4095-4100; deFougerolles Hum Gene
Ther. 2008 19:125-132; all of which are incorporated herein by
reference in its entirety).
[0533] In one embodiment such formulations may also be constructed
or compositions altered such that they passively or actively are
directed to different cell types in vivo, including but not limited
to hepatocytes, immune cells, tumor cells, endothelial cells,
antigen presenting cells, and leukocytes (Akinc et al. Mol Ther.
2010 18:1357-1364; Song et al., Nat Biotechnol. 2005 23:709-717;
Judge et al., J Clin Invest. 2009 119:661-673; Kaufmann et al.,
Microvasc Res 2010 80:286-293; Santel et al., Gene Ther 2006
13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370; Gutbier
et al., Pulm Pharmacol. Ther. 2010 23:334-344; Basha et al., Mol.
Ther. 2011 19:2186-2200; Fenske and Cullis, Expert Opin Drug Deliv.
2008 5:25-44; Peer et al., Science. 2008 319:627-630; Peer and
Lieberman, Gene Ther. 2011 18:1127-1133; all of which are
incorporated herein by reference in its entirety). One example of
passive targeting of formulations to liver cells includes the
DLin-DMA, DLin-KC2-DMA and DLin-MC3-DMA-based lipid nanoparticle
formulations which have been shown to bind to apolipoprotein E and
promote binding and uptake of these formulations into hepatocytes
in vivo (Akinc et al. Mol Ther. 2010 18:1357-1364; herein
incorporated by reference in its entirety). Formulations can also
be selectively targeted through expression of different ligands on
their surface as exemplified by, but not limited by, folate,
transferrin, N-acetylgalactosamine (GalNAc), and antibody targeted
approaches (Kolhatkar et al., Curr Drug Discov Technol. 2011
8:197-206; Musacchio and Torchilin, Front Biosci. 2011
16:1388-1412; Yu et al., Mol Membr Biol. 2010 27:286-298; Patil et
al., Crit Rev Ther Drug Carrier Syst. 2008 25:1-61; Benoit et al.,
Biomacromolecules. 2011 12:2708-2714; Zhao et al., Expert Opin Drug
Deliv. 2008 5:309-319; Akinc et al., Mol. Ther. 2010 18:1357-1364;
Srinivasan et al., Methods Mol. Biol. 2012 820:105-116; Ben-Arie et
al., Methods Mol. Biol. 2012 757:497-507; Peer 2010 J Control
Release. 20:63-68; Peer et al., Proc Natl Acad Sci USA. 2007
104:4095-4100; Kim et al., Methods Mol. Biol. 2011 721:339-353;
Subramanya et al., Mol. Ther. 2010 18:2028-2037; Song et al., Nat
Biotechnol. 2005 23:709-717; Peer et al., Science. 2008
319:627-630; Peer and Lieberman, Gene Ther. 2011 18:1127-1133; all
of which are incorporated herein by reference in its entirety).
[0534] In one embodiment, the polynucleotide, primary construct, or
mmRNA is formulated as a solid lipid nanoparticle. A solid lipid
nanoparticle (SLN) may be spherical with an average diameter
between 10 to 1000 nm. SLN possess a solid lipid core matrix that
can solubilize lipophilic molecules and may be stabilized with
surfactants and/or emulsifiers. In a further embodiment, the lipid
nanoparticle may be a self-assembly lipid-polymer nanoparticle (see
Zhang et al., ACS Nano, 2008, 2 (8), pp 1696-1702; herein
incorporated by reference in its entirety).
[0535] Liposomes, lipoplexes, or lipid nanoparticles may be used to
improve the efficacy of polynucleotide, primary construct, or mmRNA
directed protein production as these formulations may be able to
increase cell transfection by the polynucleotide, primary
construct, or mmRNA; and/or increase the translation of encoded
protein. One such example involves the use of lipid encapsulation
to enable the effective systemic delivery of polyplex plasmid DNA
(Heyes et al., Mol Ther. 2007 15:713-720; herein incorporated by
reference in its entirety). The liposomes, lipoplexes, or lipid
nanoparticles may also be used to increase the stability of the
polynucleotide, primary construct, or mmRNA.
[0536] In one embodiment, the polynucleotides, primary constructs,
and/or the mmRNA of the present invention can be formulated for
controlled release and/or targeted delivery. As used herein,
"controlled release" refers to a pharmaceutical composition or
compound release profile that conforms to a particular pattern of
release to effect a therapeutic outcome. In one embodiment, the
polynucleotides, primary constructs or the mmRNA may be
encapsulated into a delivery agent described herein and/or known in
the art for controlled release and/or targeted delivery. As used
herein, the term "encapsulate" means to enclose, surround or
encase. As it relates to the formulation of the compounds of the
invention, encapsulation may be substantial, complete or partial.
The term "substantially encapsulated" means that at least greater
than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or
greater than 99.999% of the pharmaceutical composition or compound
of the invention may be enclosed, surrounded or encased within the
delivery agent. "Partially encapsulation" means that less than 10,
10, 20, 30, 40 50 or less of the pharmaceutical composition or
compound of the invention may be enclosed, surrounded or encased
within the delivery agent. Advantageously, encapsulation may be
determined by measuring the escape or the activity of the
pharmaceutical composition or compound of the invention using
fluorescence and/or electron micrograph. For example, at least 1,
5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99,
99.9, 99.99 or greater than 99.99% of the pharmaceutical
composition or compound of the invention are encapsulated in the
delivery agent.
[0537] In one embodiment, the controlled release formulation may
include, but is not limited to, tri-block co-polymers. As a
non-limiting example, the formulation may include two different
types of tri-block co-polymers (International Pub. No. WO2012131104
and WO2012131106; each of which is herein incorporated by reference
in its entirety).
[0538] In another embodiment, the polynucleotides, primary
constructs, or the mmRNA may be encapsulated into a lipid
nanoparticle or a rapidly eliminated lipid nanoparticle and the
lipid nanoparticles or a rapidly eliminated lipid nanoparticle may
then be encapsulated into a polymer, hydrogel and/or surgical
sealant described herein and/or known in the art. As a non-limiting
example, the polymer, hydrogel or surgical sealant may be PLGA,
ethylene vinyl acetate (EVAc), poloxamer, GELSITE.RTM.
(Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX.RTM. (Halozyme
Therapeutics, San Diego Calif.), surgical sealants such as
fibrinogen polymers (Ethicon Inc. Cornelia, Ga.), TISSELL.RTM.
(Baxter International, Inc Deerfield, Ill.), PEG-based sealants,
and COSEAL.RTM. (Baxter International, Inc Deerfield, Ill.).
[0539] In another embodiment, the lipid nanoparticle may be
encapsulated into any polymer known in the art which may form a gel
when injected into a subject. As another non-limiting example, the
lipid nanoparticle may be encapsulated into a polymer matrix which
may be biodegradable.
[0540] In one embodiment, the polynucleotide, primary construct, or
mmRNA formulation for controlled release and/or targeted delivery
may also include at least one controlled release coating.
Controlled release coatings include, but are not limited to,
OPADRY.RTM., polyvinylpyrrolidone/vinyl acetate copolymer,
polyvinylpyrrolidone, hydroxypropyl methylcellulose, hydroxypropyl
cellulose, hydroxyethyl cellulose, EUDRAGIT RL.RTM., EUDRAGIT
RS.RTM. and cellulose derivatives such as ethylcellulose aqueous
dispersions (AQUACOAT.RTM. and SURELEASE.RTM.).
[0541] In one embodiment, the controlled release and/or targeted
delivery formulation may comprise at least one degradable polyester
which may contain polycationic side chains. Degradeable polyesters
include, but are not limited to, poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and
combinations thereof. In another embodiment, the degradable
polyesters may include a PEG conjugation to form a PEGylated
polymer.
[0542] In one embodiment, the polynucleotides, primary constructs,
and/or the mmRNA of the present invention may be encapsulated in a
therapeutic nanoparticle. Therapeutic nanoparticles may be
formulated by methods described herein and known in the art such
as, but not limited to, International Pub Nos. WO2010005740,
WO2010030763, WO2010005721, WO2010005723, WO2012054923, US Pub.
Nos. US20110262491, US20100104645, US20100087337, US20100068285,
US20110274759, US20100068286 and US20120288541 and U.S. Pat. Nos.
8,206,747, 8,293,276, 8,318,208 and 8,318,211 each of which is
herein incorporated by reference in their entirety. In another
embodiment, therapeutic polymer nanoparticles may be identified by
the methods described in US Pub No. US20120140790, herein
incorporated by reference in its entirety.
[0543] In one embodiment, the therapeutic nanoparticle may be
formulated for sustained release. As used herein, "sustained
release" refers to a pharmaceutical composition or compound that
conforms to a release rate over a specific period of time. The
period of time may include, but is not limited to, hours, days,
weeks, months and years. As a non-limiting example, the sustained
release nanoparticle may comprise a polymer and a therapeutic agent
such as, but not limited to, the polynucleotides, primary
constructs, and mmRNA of the present invention (see International
Pub No. 2010075072 and US Pub No. US20100216804, US20110217377 and
US20120201859, each of which is herein incorporated by reference in
their entirety).
[0544] In one embodiment, the therapeutic nanoparticles may be
formulated to be target specific. As a non-limiting example, the
therapeutic nanoparticles may include a corticosteroid (see
International Pub. No. WO2011084518; herein incorporated by
reference in its entirety). In one embodiment, the therapeutic
nanoparticles may be formulated to be cancer specific. As a
non-limiting example, the therapeutic nanoparticles may be
formulated in nanoparticles described in International Pub No.
WO2008121949, WO2010005726, WO2010005725, WO2011084521 and US Pub
No. US20100069426, US20120004293 and US20100104655, each of which
is herein incorporated by reference in their entirety.
[0545] In one embodiment, the nanoparticles of the present
invention may comprise a polymeric matrix. As a non-limiting
example, the nanoparticle may comprise two or more polymers such
as, but not limited to, polyethylenes, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates,
polycaprolactones, polyamides, polyacetals, polyethers, polyesters,
poly(orthoesters), polycyanoacrylates, polyvinyl alcohols,
polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof.
[0546] In one embodiment, the therapeutic nanoparticle comprises a
diblock copolymer. In one embodiment, the diblock copolymer may
include PEG in combination with a polymer such as, but not limited
to, polyethylenes, polycarbonates, polyanhydrides,
polyhydroxyacids, polypropylfumerates, polycaprolactones,
polyamides, polyacetals, polyethers, polyesters, poly(orthoesters),
polycyanoacrylates, polyvinyl alcohols, polyurethanes,
polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester) or
combinations thereof
[0547] As a non-limiting example the therapeutic nanoparticle
comprises a PLGA-PEG block copolymer (see US Pub. No. US20120004293
and U.S. Pat. No. 8,236,330, each of which is herein incorporated
by reference in their entirety). In another non-limiting example,
the therapeutic nanoparticle is a stealth nanoparticle comprising a
diblock copolymer of PEG and PLA or PEG and PLGA (see U.S. Pat. No.
8,246,968 and International Publication No. WO2012166923, each of
which is herein incorporated by reference in its entirety).
[0548] In one embodiment, the therapeutic nanoparticle may comprise
a multiblock copolymer (See e.g., U.S. Pat. Nos. 8,263,665 and
8,287,910; each of which is herein incorporated by reference in its
entirety).
[0549] In one embodiment, the block copolymers described herein may
be included in a polyion complex comprising a non-polymeric micelle
and the block copolymer. (See e.g., U.S. Pub. No. 20120076836;
herein incorporated by reference in its entirety).
[0550] In one embodiment, the therapeutic nanoparticle may comprise
at least one acrylic polymer. Acrylic polymers include but are not
limited to, acrylic acid, methacrylic acid, acrylic acid and
methacrylic acid copolymers, methyl methacrylate copolymers,
ethoxyethyl methacrylates, cyanoethyl methacrylate, amino alkyl
methacrylate copolymer, poly(acrylic acid), poly(methacrylic acid),
polycyanoacrylates and combinations thereof
[0551] In one embodiment, the therapeutic nanoparticles may
comprise at least one cationic polymer described herein and/or
known in the art.
[0552] In one embodiment, the therapeutic nanoparticles may
comprise at least one amine-containing polymer such as, but not
limited to polylysine, polyethylene imine, poly(amidoamine)
dendrimers, poly(beta-amino esters) (See e.g., U.S. Pat. No.
8,287,849; herein incorporated by reference in its entirety) and
combinations thereof.
[0553] In one embodiment, the therapeutic nanoparticles may
comprise at least one degradable polyester which may contain
polycationic side chains. Degradeable polyesters include, but are
not limited to, poly(serine ester), poly(L-lactide-co-L-lysine),
poly(4-hydroxy-L-proline ester), and combinations thereof. In
another embodiment, the degradable polyesters may include a PEG
conjugation to form a PEGylated polymer.
[0554] In another embodiment, the therapeutic nanoparticle may
include a conjugation of at least one targeting ligand. The
targeting ligand may be any ligand known in the art such as, but
not limited to, a monoclonal antibody. (Kirpotin et al, Cancer Res.
2006 66:6732-6740; herein incorporated by reference in its
entirety).
[0555] In one embodiment, the therapeutic nanoparticle may be
formulated in an aqueous solution which may be used to target
cancer (see International Pub No. WO2011084513 and US Pub No.
US20110294717, each of which is herein incorporated by reference in
their entirety).
[0556] In one embodiment, the polynucleotides, primary constructs,
or mmRNA may be encapsulated in, linked to and/or associated with
synthetic nanocarriers. Synthetic nanocarriers include, but are not
limited to, those described in International Pub. Nos.
WO2010005740, WO2010030763, WO201213501, WO2012149252,
WO2012149255, WO2012149259, WO2012149265, WO2012149268,
WO2012149282, WO2012149301, WO2012149393, WO2012149405,
WO2012149411, WO2012149454 and WO2013019669, and US Pub. Nos.
US20110262491, US20100104645, US20100087337 and US20120244222, each
of which is herein incorporated by reference in their entirety. The
synthetic nanocarriers may be formulated using methods known in the
art and/or described herein. As a non-limiting example, the
synthetic nanocarriers may be formulated by the methods described
in International Pub Nos. WO2010005740, WO2010030763 and
WO201213501 and US Pub. Nos. US20110262491, US20100104645,
US20100087337 and US2012024422, each of which is herein
incorporated by reference in their entirety. In another embodiment,
the synthetic nanocarrier formulations may be lyophilized by
methods described in International Pub. No. WO2011072218 and U.S.
Pat. No. 8,211,473; each of which is herein incorporated by
reference in their entirety.
[0557] In one embodiment, the synthetic nanocarriers may contain
reactive groups to release the polynucleotides, primary constructs
and/or mmRNA described herein (see International Pub. No.
WO20120952552 and US Pub No. US20120171229, each of which is herein
incorporated by reference in their entirety).
[0558] In one embodiment, the synthetic nanocarriers may contain an
immunostimulatory agent to enhance the immune response from
delivery of the synthetic nanocarrier. As a non-limiting example,
the synthetic nanocarrier may comprise a Th1 immunostimulatory
agent which may enhance a Th1-based response of the immune system
(see International Pub No. WO2010123569 and US Pub. No.
US20110223201, each of which is herein incorporated by reference in
its entirety).
[0559] In one embodiment, the synthetic nanocarriers may be
formulated for targeted release. In one embodiment, the synthetic
nanocarrier is formulated to release the polynucleotides, primary
constructs and/or mmRNA at a specified pH and/or after a desired
time interval. As a non-limiting example, the synthetic
nanoparticle may be formulated to release the polynucleotides,
primary constructs and/or mmRNA after 24 hours and/or at a pH of
4.5 (see International Pub. Nos. WO2010138193 and WO2010138194 and
US Pub Nos. US20110020388 and US20110027217, each of which is
herein incorporated by reference in their entireties).
[0560] In one embodiment, the synthetic nanocarriers may be
formulated for controlled and/or sustained release of the
polynucleotides, primary constructs and/or mmRNA described herein.
As a non-limiting example, the synthetic nanocarriers for sustained
release may be formulated by methods known in the art, described
herein and/or as described in International Pub No. WO2010138192
and US Pub No. 20100303850, each of which is herein incorporated by
reference in their entirety.
[0561] In one embodiment, the synthetic nanocarrier may be
formulated for use as a vaccine. In one embodiment, the synthetic
nanocarrier may encapsulate at least one polynucleotide, primary
construct and/or mmRNA which encode at least one antigen. As a
non-limiting example, the synthetic nanocarrier may include at
least one antigen and an excipient for a vaccine dosage form (see
International Pub No. WO2011150264 and US Pub No. US20110293723,
each of which is herein incorporated by reference in their
entirety). As another non-limiting example, a vaccine dosage form
may include at least two synthetic nanocarriers with the same or
different antigens and an excipient (see International Pub No.
WO2011150249 and US Pub No. US20110293701, each of which is herein
incorporated by reference in their entirety). The vaccine dosage
form may be selected by methods described herein, known in the art
and/or described in International Pub No. WO2011150258 and US Pub
No. US20120027806, each of which is herein incorporated by
reference in their entirety).
[0562] In one embodiment, the synthetic nanocarrier may comprise at
least one polynucleotide, primary construct and/or mmRNA which
encodes at least one adjuvant. As non-limiting example, the
adjuvant may comprise dimethyldioctadecylammonium-bromide,
dimethyldioctadecylammonium-chloride,
dimethyldioctadecylammonium-phosphate or
dimethyldioctadecylammonium-acetate (DDA) and an apolar fraction or
part of said apolar fraction of a total lipid extract of a
mycobacterium (See e.g, U.S. Pat. No. 8,241,610; herein
incorporated by reference in its entirety). In another embodiment,
the synthetic nanocarrier may comprise at least one polynucleotide,
primary construct and/or mmRNA and an adjuvant. As a non-limiting
example, the synthetic nanocarrier comprising and adjuvant may be
formulated by the methods described in International Pub No.
WO2011150240 and US Pub No. US20110293700, each of which is herein
incorporated by reference in its entirety.
[0563] In one embodiment, the synthetic nanocarrier may encapsulate
at least one polynucleotide, primary construct and/or mmRNA which
encodes a peptide, fragment or region from a virus. As a
non-limiting example, the synthetic nanocarrier may include, but is
not limited to, the nanocarriers described in International Pub No.
WO2012024621, WO201202629, WO2012024632 and US Pub No.
US20120064110, US20120058153 and US20120058154, each of which is
herein incorporated by reference in their entirety.
[0564] In one embodiment, the synthetic nanocarrier may be coupled
to a polynucleotide, primary construct or mmRNA which may be able
to trigger a humoral and/or cytotoxic T lymphocyte (CTL) response
(See e.g., International Publication No. WO2013019669, herein
incorporated by reference in its entirety).
[0565] In one embodiment, the nanoparticle may be optimized for
oral administration. The nanoparticle may comprise at least one
cationic biopolymer such as, but not limited to, chitosan or a
derivative thereof. As a non-limiting example, the nanoparticle may
be formulated by the methods described in U.S. Pub. No.
20120282343; herein incorporated by reference in its entirety.
Polymers, Biodegradable Nanoparticles, and Core-Shell
Nanoparticles
[0566] The polynucleotide, primary construct, and mmRNA of the
invention can be formulated using natural and/or synthetic
polymers. Non-limiting examples of polymers which may be used for
delivery include, but are not limited to, DYNAMIC
POLYCONJUGATE.RTM. (Arrowhead Reasearch Corp., Pasadena, Calif.)
formulations from MIRUS.RTM. Bio (Madison, Wis.) and Roche Madison
(Madison, Wis.), PHASERX.TM. polymer formulations such as, without
limitation, SMARTT POLYMER TECHNOLOGY.TM. (PHASERX.RTM., Seattle,
Wash.), DMRI/DOPE, poloxamer, VAXFECTIN.RTM. adjuvant from Vical
(San Diego, Calif.), chitosan, cyclodextrin from Calando
Pharmaceuticals (Pasadena, Calif.), dendrimers and
poly(lactic-co-glycolic acid) (PLGA) polymers. RONDEL.TM.
(RNAi/Oligonucleotide Nanoparticle Delivery) polymers (Arrowhead
Research Corporation, Pasadena, Calif.) and pH responsive co-block
polymers such as, but not limited to, PHASERX.RTM. (Seattle,
Wash.).
[0567] A non-limiting example of chitosan formulation includes a
core of positively charged chitosan and an outer portion of
negatively charged substrate (U.S. Pub. No. 20120258176; herein
incorporated by reference in its entirety). Chitosan includes, but
is not limited to N-trimethyl chitosan, mono-N-carboxymethyl
chitosan (MCC), N-palmitoyl chitosan (NPCS), EDTA-chitosan, low
molecular weight chitosan, chitosan derivatives, or combinations
thereof
[0568] In one embodiment, the polymers used in the present
invention have undergone processing to reduce and/or inhibit the
attachment of unwanted substances such as, but not limited to,
bacteria, to the surface of the polymer. The polymer may be
processed by methods known and/or described in the art and/or
described in International Pub. No. WO2012150467, herein
incorporated by reference in its entirety.
[0569] A non-limiting example of PLGA formulations include, but are
not limited to, PLGA injectable depots (e.g., ELIGARD.RTM. which is
formed by dissolving PLGA in 66% N-methyl-2-pyrrolidone (NMP) and
the remainder being aqueous solvent and leuprolide. Once injected,
the PLGA and leuprolide peptide precipitates into the subcutaneous
space).
[0570] Many of these polymer approaches have demonstrated efficacy
in delivering oligonucleotides in vivo into the cell cytoplasm
(reviewed in deFougerolles Hum Gene Ther. 2008 19:125-132; herein
incorporated by reference in its entirety). Two polymer approaches
that have yielded robust in vivo delivery of nucleic acids, in this
case with small interfering RNA (siRNA), are dynamic polyconjugates
and cyclodextrin-based nanoparticles. The first of these delivery
approaches uses dynamic polyconjugates and has been shown in vivo
in mice to effectively deliver siRNA and silence endogenous target
mRNA in hepatocytes (Rozema et al., Proc Natl Acad Sci USA. 2007
104:12982-12887; herein incorporated by reference in its entirety).
This particular approach is a multicomponent polymer system whose
key features include a membrane-active polymer to which nucleic
acid, in this case siRNA, is covalently coupled via a disulfide
bond and where both PEG (for charge masking) and
N-acetylgalactosamine (for hepatocyte targeting) groups are linked
via pH-sensitive bonds (Rozema et al., Proc Natl Acad Sci USA. 2007
104:12982-12887; herein incorporated by reference in its entirety).
On binding to the hepatocyte and entry into the endosome, the
polymer complex disassembles in the low-pH environment, with the
polymer exposing its positive charge, leading to endosomal escape
and cytoplasmic release of the siRNA from the polymer. Through
replacement of the N-acetylgalactosamine group with a mannose
group, it was shown one could alter targeting from
asialoglycoprotein receptor-expressing hepatocytes to sinusoidal
endothelium and Kupffer cells. Another polymer approach involves
using transferrin-targeted cyclodextrin-containing polycation
nanoparticles. These nanoparticles have demonstrated targeted
silencing of the EWS-FLI1 gene product in transferrin
receptor-expressing Ewing's sarcoma tumor cells (Hu-Lieskovan et
al., Cancer Res. 2005 65: 8984-8982; herein incorporated by
reference in its entirety) and siRNA formulated in these
nanoparticles was well tolerated in non-human primates (Heidel et
al., Proc Natl Acad Sci USA 2007 104:5715-21; herein incorporated
by reference in its entirety). Both of these delivery strategies
incorporate rational approaches using both targeted delivery and
endosomal escape mechanisms.
[0571] The polymer formulation can permit the sustained or delayed
release of polynucleotide, primary construct, or mmRNA (e.g.,
following intramuscular or subcutaneous injection). The altered
release profile for the polynucleotide, primary construct, or mmRNA
can result in, for example, translation of an encoded protein over
an extended period of time. The polymer formulation may also be
used to increase the stability of the polynucleotide, primary
construct, or mmRNA. Biodegradable polymers have been previously
used to protect nucleic acids other than mmRNA from degradation and
been shown to result in sustained release of payloads in vivo
(Rozema et al., Proc Natl Acad Sci USA. 2007 104:12982-12887;
Sullivan et al., Expert Opin Drug Deliv. 2010 7:1433-1446;
Convertine et al., Biomacromolecules. 2010 Oct. 1; Chu et al., Acc
Chem. Res. 2012 Jan. 13; Manganiello et al., Biomaterials. 2012
33:2301-2309; Benoit et al., Biomacromolecules. 2011 12:2708-2714;
Singha et al., Nucleic Acid Ther. 2011 2:133-147; deFougerolles Hum
Gene Ther. 2008 19:125-132; Schaffert and Wagner, Gene Ther. 2008
16:1131-1138; Chaturvedi et al., Expert Opin Drug Deliv. 2011
8:1455-1468; Davis, Mol Pharm. 2009 6:659-668; Davis, Nature 2010
464:1067-1070; each of which is herein incorporated by reference in
its entirety).
[0572] In one embodiment, the pharmaceutical compositions may be
sustained release formulations. In a further embodiment, the
sustained release formulations may be for subcutaneous delivery.
Sustained release formulations may include, but are not limited to,
PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer,
GELSITE.RTM. (Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX.RTM.
(Halozyme Therapeutics, San Diego Calif.), surgical sealants such
as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.), TISSELL.RTM.
(Baxter International, Inc Deerfield, Ill.), PEG-based sealants,
and COSEAL.RTM. (Baxter International, Inc Deerfield, Ill.).
[0573] As a non-limiting example modified mRNA may be formulated in
PLGA microspheres by preparing the PLGA microspheres with tunable
release rates (e.g., days and weeks) and encapsulating the modified
mRNA in the PLGA microspheres while maintaining the integrity of
the modified mRNA during the encapsulation process. EVAc are
non-biodegradeable, biocompatible polymers which are used
extensively in pre-clinical sustained release implant applications
(e.g., extended release products Ocusert a pilocarpine ophthalmic
insert for glaucoma or progestasert a sustained release
progesterone intrauterine device; transdermal delivery systems
Testoderm, Duragesic and Selegiline; catheters). Poloxamer F-407 NF
is a hydrophilic, non-ionic surfactant triblock copolymer of
polyoxyethylene-polyoxypropylene-polyoxyethylene having a low
viscosity at temperatures less than 5.degree. C. and forms a solid
gel at temperatures greater than 15.degree. C. PEG-based surgical
sealants comprise two synthetic PEG components mixed in a delivery
device which can be prepared in one minute, seals in 3 minutes and
is reabsorbed within 30 days. GELSITE.RTM. and natural polymers are
capable of in-situ gelation at the site of administration. They
have been shown to interact with protein and peptide therapeutic
candidates through ionic interaction to provide a stabilizing
effect.
[0574] Polymer formulations can also be selectively targeted
through expression of different ligands as exemplified by, but not
limited by, folate, transferrin, and N-acetylgalactosamine (GalNAc)
(Benoit et al., Biomacromolecules. 2011 12:2708-2714; Rozema et
al., Proc Natl Acad Sci USA. 2007 104:12982-12887; Davis, Mol
Pharm. 2009 6:659-668; Davis, Nature 2010 464:1067-1070; each of
which is herein incorporated by reference in its entirety).
[0575] The modified nucleic acid, and mmRNA of the invention may be
formulated with or in a polymeric compound. The polymer may include
at least one polymer such as, but not limited to, polyethenes,
polyethylene glycol (PEG), poly(l-lysine)(PLL), PEG grafted to PLL,
cationic lipopolymer, biodegradable cationic lipopolymer,
polyethyleneimine (PEI), cross-linked branched poly(alkylene
imines), a polyamine derivative, a modified poloxamer, a
biodegradable polymer, elastic biodegradable polymer, biodegradable
block copolymer, biodegradable random copolymer, biodegradable
polyester copolymer, biodegradable polyester block copolymer,
biodegradable polyester block random copolymer, multiblock
copolymers, linear biodegradable copolymer,
poly[.alpha.-(4-aminobutyl)-L-glycolic acid) (PAGA), biodegradable
cross-linked cationic multi-block copolymers, polycarbonates,
polyanhydrides, polyhydroxyacids, polypropylfumerates,
polycaprolactones, polyamides, polyacetals, polyethers, polyesters,
poly(orthoesters), polycyanoacrylates, polyvinyl alcohols,
polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates,
polycyanoacrylates, polyureas, polystyrenes, polyamines,
polylysine, poly(ethylene imine), poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester),
acrylic polymers, amine-containing polymers, dextran polymers,
dextran polymer derivatives or combinations thereof.
[0576] As a non-limiting example, the modified nucleic acid or
mmRNA of the invention may be formulated with the polymeric
compound of PEG grafted with PLL as described in U.S. Pat. No.
6,177,274; herein incorporated by reference in its entirety. The
formulation may be used for transfecting cells in vitro or for in
vivo delivery of the modified nucleic acid and mmRNA. In another
example, the modified nucleic acid and mmRNA may be suspended in a
solution or medium with a cationic polymer, in a dry pharmaceutical
composition or in a solution that is capable of being dried as
described in U.S. Pub. Nos. 20090042829 and 20090042825; each of
which are herein incorporated by reference in their entireties.
[0577] As another non-limiting example the polynucleotides, primary
constructs or mmRNA of the invention may be formulated with a
PLGA-PEG block copolymer (see US Pub. No. US20120004293 and U.S.
Pat. No. 8,236,330, herein incorporated by reference in their
entireties) or PLGA-PEG-PLGA block copolymers (See U.S. Pat. No.
6,004,573, herein incorporated by reference in its entirety). As a
non-limiting example, the polynucleotides, primary constructs or
mmRNA of the invention may be formulated with a diblock copolymer
of PEG and PLA or PEG and PLGA (see U.S. Pat. No. 8,246,968, herein
incorporated by reference in its entirety).
[0578] A polyamine derivative may be used to deliver nucleic acids
or to treat and/or prevent a disease or to be included in an
implantable or injectable device (U.S. Pub. No. 20100260817 herein
incorporated by reference in its entirety). As a non-limiting
example, a pharmaceutical composition may include the modified
nucleic acids and mmRNA and the polyamine derivative described in
U.S. Pub. No. 20100260817 (the contents of which are incorporated
herein by reference in its entirety. As a non-limiting example the
polynucleotides, primary constructs and mmRNA of the present
invention may be delivered using a polyamide polymer such as, but
not limited to, a polymer comprising a 1,3-dipolar addition polymer
prepared by combining a carbohydrate diazide monomer with a dilkyne
unite comprising oligoamines (U.S. Pat. No. 8,236,280; herein
incorporated by reference in its entirety).
[0579] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the present invention may be formulated with at least
one polymer and/or derivatives thereof described in International
Publication Nos. WO2011115862, WO2012082574 and WO2012068187 and
U.S. Pub. No. 20120283427, each of which are herein incorporated by
reference in their entireties. In another embodiment, the modified
nucleic acid or mmRNA of the present invention may be formulated
with a polymer of formula Z as described in WO2011115862, herein
incorporated by reference in its entirety. In yet another
embodiment, the modified nucleic acid or mmRNA may be formulated
with a polymer of formula Z, Z' or Z'' as described in
International Pub. Nos. WO2012082574 or WO2012068187 and U.S. Pub.
No. 2012028342, each of which are herein incorporated by reference
in their entireties. The polymers formulated with the modified RNA
of the present invention may be synthesized by the methods
described in International Pub. Nos. WO2012082574 or WO2012068187,
each of which are herein incorporated by reference in their
entireties.
[0580] The polynucleotides, primary constructs or mmRNA of the
invention may be formulated with at least one acrylic polymer.
Acrylic polymers include but are not limited to, acrylic acid,
methacrylic acid, acrylic acid and methacrylic acid copolymers,
methyl methacrylate copolymers, ethoxyethyl methacrylates,
cyanoethyl methacrylate, amino alkyl methacrylate copolymer,
poly(acrylic acid), poly(methacrylic acid), polycyanoacrylates and
combinations thereof.
[0581] Formulations of polynucleotides, primary constructs or mmRNA
of the invention may include at least one amine-containing polymer
such as, but not limited to polylysine, polyethylene imine,
poly(amidoamine) dendrimers or combinations thereof
[0582] For example, the modified nucleic acid or mmRNA of the
invention may be formulated in a pharmaceutical compound including
a poly(alkylene imine), a biodegradable cationic lipopolymer, a
biodegradable block copolymer, a biodegradable polymer, or a
biodegradable random copolymer, a biodegradable polyester block
copolymer, a biodegradable polyester polymer, a biodegradable
polyester random copolymer, a linear biodegradable copolymer, PAGA,
a biodegradable cross-linked cationic multi-block copolymer or
combinations thereof. The biodegradable cationic lipopolymer may be
made by methods known in the art and/or described in U.S. Pat. No.
6,696,038, U.S. App. Nos. 20030073619 and 20040142474 each of which
is herein incorporated by reference in their entireties. The
poly(alkylene imine) may be made using methods known in the art
and/or as described in U.S. Pub. No. 20100004315, herein
incorporated by reference in its entirety. The biodegradable
polymer, biodegradable block copolymer, the biodegradable random
copolymer, biodegradable polyester block copolymer, biodegradable
polyester polymer, or biodegradable polyester random copolymer may
be made using methods known in the art and/or as described in U.S.
Pat. Nos. 6,517,869 and 6,267,987, the contents of which are each
incorporated herein by reference in their entirety. The linear
biodegradable copolymer may be made using methods known in the art
and/or as described in U.S. Pat. No. 6,652,886. The PAGA polymer
may be made using methods known in the art and/or as described in
U.S. Pat. No. 6,217,912 herein incorporated by reference in its
entirety. The PAGA polymer may be copolymerized to form a copolymer
or block copolymer with polymers such as but not limited to,
poly-L-lysine, polyargine, polyornithine, histones, avidin,
protamines, polylactides and poly(lactide-co-glycolides). The
biodegradable cross-linked cationic multi-block copolymers may be
made my methods known in the art and/or as described in U.S. Pat.
No. 8,057,821 or U.S. Pub. No. 2012009145 each of which are herein
incorporated by reference in their entireties. For example, the
multi-block copolymers may be synthesized using linear
polyethyleneimine (LPEI) blocks which have distinct patterns as
compared to branched polyethyleneimines. Further, the composition
or pharmaceutical composition may be made by the methods known in
the art, described herein, or as described in U.S. Pub. No.
20100004315 or U.S. Pat. Nos. 6,267,987 and 6,217,912 each of which
are herein incorporated by reference in their entireties.
[0583] The polynucleotides, primary constructs, and mmRNA of the
invention may be formulated with at least one degradable polyester
which may contain polycationic side chains. Degradeable polyesters
include, but are not limited to, poly(serine ester),
poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), and
combinations thereof. In another embodiment, the degradable
polyesters may include a PEG conjugation to form a PEGylated
polymer.
[0584] The polynucleotides, primary construct, mmRNA of the
invention may be formulated with at least one crosslinkable
polyester. Crosslinkable polyesters include those known in the art
and described in US Pub. No. 20120269761, herein incorporated by
reference in its entirety.
[0585] In one embodiment, the polymers described herein may be
conjugated to a lipid-terminating PEG. As a non-limiting example,
PLGA may be conjugated to a lipid-terminating PEG forming
PLGA-DSPE-PEG. As another non-limiting example, PEG conjugates for
use with the present invention are described in International
Publication No. WO2008103276, herein incorporated by reference in
its entirety. The polymers may be conjugated using a ligand
conjugate such as, but not limited to, the conjugates described in
U.S. Pat. No. 8,273,363, herein incorporated by reference in its
entirety.
[0586] In one embodiment, the modified RNA described herein may be
conjugated with another compound. Non-limiting examples of
conjugates are described in U.S. Pat. Nos. 7,964,578 and 7,833,992,
each of which are herein incorporated by reference in their
entireties. In another embodiment, modified RNA of the present
invention may be conjugated with conjugates of formula I-122 as
described in U.S. Pat. Nos. 7,964,578 and 7,833,992, each of which
are herein incorporated by reference in their entireties. The
polynucleotides, primary constructs and/or mmRNA described herein
may be conjugated with a metal such as, but not limited to, gold.
(See e.g., Giljohann et al. Journ. Amer. Chem. Soc. 2009 131(6):
2072-2073; herein incorporated by reference in its entirety). In
another embodiment, the polynucleotides, primary constructs and/or
mmRNA described herein may be conjugated and/or encapsulated in
gold-nanoparticles. (Interantional Pub. No. WO201216269 and U.S.
Pub. No. 20120302940; each of which is herein incorporated by
reference in its entirety).
[0587] As described in U.S. Pub. No. 20100004313, herein
incorporated by reference in its entirety, a gene delivery
composition may include a nucleotide sequence and a poloxamer. For
example, the modified nucleic acid and mmRNA of the present
invention may be used in a gene delivery composition with the
poloxamer described in U.S. Pub. No. 20100004313.
[0588] In one embodiment, the polymer formulation of the present
invention may be stabilized by contacting the polymer formulation,
which may include a cationic carrier, with a cationic lipopolymer
which may be covalently linked to cholesterol and polyethylene
glycol groups. The polymer formulation may be contacted with a
cationic lipopolymer using the methods described in U.S. Pub. No.
20090042829 herein incorporated by reference in its entirety. The
cationic carrier may include, but is not limited to,
polyethylenimine, poly(trimethylenimine), poly(tetramethylenimine),
polypropylenimine, aminoglycoside-polyamine,
dideoxy-diamino-b-cyclodextrin, spermine, spermidine,
poly(2-dimethylamino)ethyl methacrylate, poly(lysine),
poly(histidine), poly(arginine), cationized gelatin, dendrimers,
chitosan, 1,2-Dioleoyl-3-Trimethylammonium-Propane(DOTAP),
N-[1-(2,3-dioleoyloxy)propyl]-N,N,N-trimethylammonium chloride
(DOTMA),
1-[2-(oleoyloxy)ethyl]-2-oleyl-3-(2-hydroxyethyl)imidazolinium
chloride (DOTIM),
2,3-dioleyloxy-N-[2(sperminecarboxamido)ethyl]-N,N-dimethyl-1-pr-
opanaminium trifluoroacetate (DOSPA),
3B--[N--(N',N'-Dimethylaminoethane)-carbamoyl]Cholesterol
Hydrochloride (DC-Cholesterol HCl) diheptadecylamidoglycyl
spermidine (DOGS), N,N-distearyl-N,N-dimethylammonium bromide
(DDAB), N-(1,2-dimyristyloxyprop-3-yl)-N,N-dimethyl-N-hydroxyethyl
ammonium bromide (DMRIE), N,N-dioleyl-N,N-dimethylammonium chloride
DODAC) and combinations thereof.
[0589] The polynucleotides, primary constructs and/or mmRNA of the
invention may be formulated in a polyplex of one or more polymers
(U.S. Pub. No. 20120237565 and 20120270927; each of which is herein
incorporated by reference in its entirety). In one embodiment, the
polyplex comprises two or more cationic polymers. The catioinic
polymer may comprise a poly(ethylene imine) (PEI) such as linear
PEI.
[0590] The polynucleotide, primary construct, and mmRNA of the
invention can also be formulated as a nanoparticle using a
combination of polymers, lipids, and/or other biodegradable agents,
such as, but not limited to, calcium phosphate. Components may be
combined in a core-shell, hybrid, and/or layer-by-layer
architecture, to allow for fine-tuning of the nanoparticle so to
delivery of the polynucleotide, primary construct and mmRNA may be
enhanced (Wang et al., Nat. Mater. 2006 5:791-796; Fuller et al.,
Biomaterials. 2008 29:1526-1532; DeKoker et al., Adv Drug Deliv
Rev. 2011 63:748-761; Endres et al., Biomaterials. 2011
32:7721-7731; Su et al., Mol. Pharm. 2011 Jun. 6; 8(3):774-87;
herein incorporated by reference in its entirety). As a
non-limiting example, the nanoparticle may comprise a plurality of
polymers such as, but not limited to hydrophilic-hydrophobic
polymers (e.g., PEG-PLGA), hydrophobic polymers (e.g., PEG) and/or
hydrophilic polymers (International Pub. No. WO20120225129; herein
incorporated by reference in its entirety).
[0591] Biodegradable calcium phosphate nanoparticles in combination
with lipids and/or polymers have been shown to deliver
polynucleotides, primary constructs and mmRNA in vivo. In one
embodiment, a lipid coated calcium phosphate nanoparticle, which
may also contain a targeting ligand such as anisamide, may be used
to deliver the polynucleotide, primary construct and mmRNA of the
present invention. For example, to effectively deliver siRNA in a
mouse metastatic lung model a lipid coated calcium phosphate
nanoparticle was used (Li et al., J Contr Rel. 2010 142: 416-421;
Li et al., J Contr Rel. 2012 158:108-114; Yang et al., Mol Ther.
2012 20:609-615; herein incorporated by reference in its entirety).
This delivery system combines both a targeted nanoparticle and a
component to enhance the endosomal escape, calcium phosphate, in
order to improve delivery of the siRNA.
[0592] In one embodiment, calcium phosphate with a PEG-polyanion
block copolymer may be used to delivery polynucleotides, primary
constructs and mmRNA (Kazikawa et al., J Contr Rel. 2004
97:345-356; Kazikawa et al., J Contr Rel. 2006 111:368-370; herein
incorporated by reference in its entirety).
[0593] In one embodiment, a PEG-charge-conversional polymer
(Pitella et al., Biomaterials. 2011 32:3106-3114) may be used to
form a nanoparticle to deliver the polynucleotides, primary
constructs and mmRNA of the present invention. The
PEG-charge-conversional polymer may improve upon the PEG-polyanion
block copolymers by being cleaved into a polycation at acidic pH,
thus enhancing endosomal escape.
[0594] The use of core-shell nanoparticles has additionally focused
on a high-throughput approach to synthesize cationic cross-linked
nanogel cores and various shells (Siegwart et al., Proc Natl Acad
Sci USA. 2011 108:12996-13001). The complexation, delivery, and
internalization of the polymeric nanoparticles can be precisely
controlled by altering the chemical composition in both the core
and shell components of the nanoparticle. For example, the
core-shell nanoparticles may efficiently deliver siRNA to mouse
hepatocytes after they covalently attach cholesterol to the
nanoparticle.
[0595] In one embodiment, a hollow lipid core comprising a middle
PLGA layer and an outer neutral lipid layer containing PEG may be
used to delivery of the polynucleotide, primary construct and mmRNA
of the present invention. As a non-limiting example, in mice
bearing a luciferease-expressing tumor, it was determined that the
lipid-polymer-lipid hybrid nanoparticle significantly suppressed
luciferase expression, as compared to a conventional lipoplex (Shi
et al, Angew Chem Int Ed. 2011 50:7027-7031; herein incorporated by
reference in its entirety).
[0596] In one embodiment, the lipid nanoparticles may comprise a
core of the modified nucleic acid molecules disclosed herein and a
polymer shell. The polymer shell may be any of the polymers
described herein and are known in the art. In an additional
embodiment, the polymer shell may be used to protect the modified
nucleic acids in the core.
[0597] Core-shell nanoparticles for use with the modified nucleic
acid molecules of the present invention are described and may be
formed by the methods described in U.S. Pat. No. 8,313,777 herein
incorporated by reference in its entirety.
[0598] In one embodiment, the core-shell nanoparticles may comprise
a core of the modified nucleic acid molecules disclosed herein and
a polymer shell. The polymer shell may be any of the polymers
described herein and are known in the art. In an additional
embodiment, the polymer shell may be used to protect the modified
nucleic acid molecules in the core. As a non-limiting example, the
core-shell nanoparticle may be used to treat an eye disease or
disorder (See e.g. US Publication No. 20120321719, herein
incorporated by reference in its entirety).
[0599] In one embodiment, the polymer used with the formulations
described herein may be a modified polymer (such as, but not
limited to, a modified polyacetal) as described in International
Publication No. WO2011120053, herein incorporated by reference in
its entirety.
Peptides and Proteins
[0600] The polynucleotide, primary construct, and mmRNA of the
invention can be formulated with peptides and/or proteins in order
to increase transfection of cells by the polynucleotide, primary
construct, or mmRNA. In one embodiment, peptides such as, but not
limited to, cell penetrating peptides and proteins and peptides
that enable intracellular delivery may be used to deliver
pharmaceutical formulations. A non-limiting example of a cell
penetrating peptide which may be used with the pharmaceutical
formulations of the present invention includes a cell-penetrating
peptide sequence attached to polycations that facilitates delivery
to the intracellular space, e.g., HIV-derived TAT peptide,
penetratins, transportans, or hCT derived cell-penetrating peptides
(see, e.g., Caron et al., Mol. Ther. 3(3):310-8 (2001); Langel,
Cell-Penetrating Peptides: Processes and Applications (CRC Press,
Boca Raton Fla., 2002); E1-Andaloussi et al., Curr. Pharm. Des.
11(28):3597-611 (2003); and Deshayes et al., Cell. Mol. Life Sci.
62(16):1839-49 (2005), all of which are incorporated herein by
reference in their entirety). The compositions can also be
formulated to include a cell penetrating agent, e.g., liposomes,
which enhance delivery of the compositions to the intracellular
space. Polynucleotides, primary constructs, and mmRNA of the
invention may be complexed to peptides and/or proteins such as, but
not limited to, peptides and/or proteins from Aileron Therapeutics
(Cambridge, Mass.) and Permeon Biologics (Cambridge, Mass.) in
order to enable intracellular delivery (Cronican et al., ACS Chem.
Biol. 2010 5:747-752; McNaughton et al., Proc. Natl. Acad. Sci. USA
2009 106:6111-6116; Sawyer, Chem Biol Drug Des. 2009 73:3-6;
Verdine and Hilinski, Methods Enzymol. 2012; 503:3-33; all of which
are herein incorporated by reference in its entirety).
[0601] In one embodiment, the cell-penetrating polypeptide may
comprise a first domain and a second domain. The first domain may
comprise a supercharged polypeptide. The second domain may comprise
a protein-binding partner. As used herein, "protein-binding
partner" includes, but are not limited to, antibodies and
functional fragments thereof, scaffold proteins, or peptides. The
cell-penetrating polypeptide may further comprise an intracellular
binding partner for the protein-binding partner. The
cell-penetrating polypeptide may be capable of being secreted from
a cell where the polynucleotide, primary construct, or mmRNA may be
introduced.
[0602] Formulations of the including peptides or proteins may be
used to increase cell transfection by the polynucleotide, primary
construct, or mmRNA, alter the biodistribution of the
polynucleotide, primary construct, or mmRNA (e.g., by targeting
specific tissues or cell types), and/or increase the translation of
encoded protein. (See e.g., International Pub. No. WO2012110636;
herein incorporated by reference in its entirety).
Cells
[0603] The polynucleotide, primary construct, and mmRNA of the
invention can be transfected ex vivo into cells, which are
subsequently transplanted into a subject. As non-limiting examples,
the pharmaceutical compositions may include red blood cells to
deliver modified RNA to liver and myeloid cells, virosomes to
deliver modified RNA in virus-like particles (VLPs), and
electroporated cells such as, but not limited to, from MAXCYTE.RTM.
(Gaithersburg, Md.) and from ERYTECH.RTM. (Lyon, France) to deliver
modified RNA. Examples of use of red blood cells, viral particles
and electroporated cells to deliver payloads other than mmRNA have
been documented (Godfrin et al., Expert Opin Biol Ther. 2012
12:127-133; Fang et al., Expert Opin Biol Ther. 2012 12:385-389; Hu
et al., Proc Natl Acad Sci USA. 2011 108:10980-10985; Lund et al.,
Pharm Res. 2010 27:400-420; Huckriede et al., J Liposome Res. 2007;
17:39-47; Cusi, Hum Vaccin. 2006 2:1-7; de Jonge et al., Gene Ther.
2006 13:400-411; all of which are herein incorporated by reference
in its entirety).
[0604] The polynucleotides, primary constructs and mmRNA may be
delivered in synthetic VLPs synthesized by the methods described in
International Pub No. WO2011085231 and US Pub No. 20110171248, each
of which are herein incorporated by reference in their
entireties.
[0605] Cell-based formulations of the polynucleotide, primary
construct, and mmRNA of the invention may be used to ensure cell
transfection (e.g., in the cellular carrier), alter the
biodistribution of the polynucleotide, primary construct, or mmRNA
(e.g., by targeting the cell carrier to specific tissues or cell
types), and/or increase the translation of encoded protein.
[0606] A variety of methods are known in the art and suitable for
introduction of nucleic acid into a cell, including viral and
non-viral mediated techniques. Examples of typical non-viral
mediated techniques include, but are not limited to,
electroporation, calcium phosphate mediated transfer,
nucleofection, sonoporation, heat shock, magnetofection, liposome
mediated transfer, microinjection, microprojectile mediated
transfer (nanoparticles), cationic polymer mediated transfer
(DEAE-dextran, polyethylenimine, polyethylene glycol (PEG) and the
like) or cell fusion.
[0607] The technique of sonoporation, or cellular sonication, is
the use of sound (e.g., ultrasonic frequencies) for modifying the
permeability of the cell plasma membrane. Sonoporation methods are
known to those in the art and are used to deliver nucleic acids in
vivo (Yoon and Park, Expert Opin Drug Deliv. 2010 7:321-330;
Postema and Gilja, Curr Pharm Biotechnol. 2007 8:355-361; Newman
and Bettinger, Gene Ther. 2007 14:465-475; all herein incorporated
by reference in their entirety). Sonoporation methods are known in
the art and are also taught for example as it relates to bacteria
in US Patent Publication 20100196983 and as it relates to other
cell types in, for example, US Patent Publication 20100009424, each
of which are incorporated herein by reference in their
entirety.
[0608] Electroporation techniques are also well known in the art
and are used to deliver nucleic acids in vivo and clinically (Andre
et al., Curr Gene Ther. 2010 10:267-280; Chiarella et al., Curr
Gene Ther. 2010 10:281-286; Hojman, Curr Gene Ther. 2010
10:128-138; all herein incorporated by reference in their
entirety). In one embodiment, polynucleotides, primary constructs
or mmRNA may be delivered by electroporation as described in
Example 8.
Hyaluronidase
[0609] The intramuscular or subcutaneous localized injection of
polynucleotide, primary construct, or mmRNA of the invention can
include hyaluronidase, which catalyzes the hydrolysis of
hyaluronan. By catalyzing the hydrolysis of hyaluronan, a
constituent of the interstitial barrier, hyaluronidase lowers the
viscosity of hyaluronan, thereby increasing tissue permeability
(Frost, Expert Opin. Drug Deliv. (2007) 4:427-440; herein
incorporated by reference in its entirety). It is useful to speed
their dispersion and systemic distribution of encoded proteins
produced by transfected cells. Alternatively, the hyaluronidase can
be used to increase the number of cells exposed to a
polynucleotide, primary construct, or mmRNA of the invention
administered intramuscularly or subcutaneously.
Nanoparticle Mimics
[0610] The polynucleotide, primary construct or mmRNA of the
invention may be encapsulated within and/or absorbed to a
nanoparticle mimic. A nanoparticle mimic can mimic the delivery
function organisms or particles such as, but not limited to,
pathogens, viruses, bacteria, fungus, parasites, prions and cells.
As a non-limiting example the polynucleotide, primary construct or
mmRNA of the invention may be encapsulated in a non-viron particle
which can mimic the delivery function of a virus (see International
Pub. No. WO2012006376 herein incorporated by reference in its
entirety).
Nanotubes
[0611] The polynucleotides, primary constructs or mmRNA of the
invention can be attached or otherwise bound to at least one
nanotube such as, but not limited to, rosette nanotubes, rosette
nanotubes having twin bases with a linker, carbon nanotubes and/or
single-walled carbon nanotubes, The polynucleotides, primary
constructs or mmRNA may be bound to the nanotubes through forces
such as, but not limited to, steric, ionic, covalent and/or other
forces.
[0612] In one embodiment, the nanotube can release one or more
polynucleotides, primary constructs or mmRNA into cells. The size
and/or the surface structure of at least one nanotube may be
altered so as to govern the interaction of the nanotubes within the
body and/or to attach or bind to the polynucleotides, primary
constructs or mmRNA disclosed herein. In one embodiment, the
building block and/or the functional groups attached to the
building block of the at least one nanotube may be altered to
adjust the dimensions and/or properties of the nanotube. As a
non-limiting example, the length of the nanotubes may be altered to
hinder the nanotubes from passing through the holes in the walls of
normal blood vessels but still small enough to pass through the
larger holes in the blood vessels of tumor tissue.
[0613] In one embodiment, at least one nanotube may also be coated
with delivery enhancing compounds including polymers, such as, but
not limited to, polyethylene glycol. In another embodiment, at
least one nanotube and/or the polynucleotides, primary constructs
or mmRNA may be mixed with pharmaceutically acceptable excipients
and/or delivery vehicles.
[0614] In one embodiment, the polynucleotides, primary constructs
or mmRNA are attached and/or otherwise bound to at least one
rosette nanotube. The rosette nanotubes may be formed by a process
known in the art and/or by the process described in International
Publication No. WO2012094304, herein incorporated by reference in
its entirety. At least one polynucleotide, primary construct and/or
mmRNA may be attached and/or otherwise bound to at least one
rosette nanotube by a process as described in International
Publication No. WO2012094304, herein incorporated by reference in
its entirety, where rosette nanotubes or modules forming rosette
nanotubes are mixed in aqueous media with at least one
polynucleotide, primary construct and/or mmRNA under conditions
which may cause at least one polynucleotide, primary construct or
mmRNA to attach or otherwise bind to the rosette nanotubes.
[0615] In one embodiment, the polynucleotides, primary constructs
or mmRNA may be attached to and/or otherwise bound to at least one
carbon nanotube. As a non-limiting example, the polynucleotides,
primary constructs or mmRNA may be bound to a linking agent and the
linked agent may be bound to the carbon nanotube (See e.g., U.S.
Pat. No. 8,246,995; herein incorporated by reference in its
entirety). The carbon nanotube may be a single-walled nanotube (See
e.g., U.S. Pat. No. 8,246,995; herein incorporated by reference in
its entirety).
Conjugates
[0616] The polynucleotides, primary constructs, and mmRNA of the
invention include conjugates, such as a polynucleotide, primary
construct, or mmRNA covalently linked to a carrier or targeting
group, or including two encoding regions that together produce a
fusion protein (e.g., bearing a targeting group and therapeutic
protein or peptide).
[0617] The conjugates of the invention include a naturally
occurring substance, such as a protein (e.g., human serum albumin
(HSA), low-density lipoprotein (LDL), high-density lipoprotein
(HDL), or globulin); an carbohydrate (e.g., a dextran, pullulan,
chitin, chitosan, inulin, cyclodextrin or hyaluronic acid); or a
lipid. The ligand may also be a recombinant or synthetic molecule,
such as a synthetic polymer, e.g., a synthetic polyamino acid, an
oligonucleotide (e.g. an aptamer). Examples of polyamino acids
include polyamino acid is a polylysine (PLL), poly L-aspartic acid,
poly L-glutamic acid, styrene-maleic acid anhydride copolymer,
poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic
anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer
(HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA),
polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide
polymers, or polyphosphazine. Example of polyamines include:
polyethylenimine, polylysine (PLL), spermine, spermidine,
polyamine, pseudopeptide-polyamine, peptidomimetic polyamine,
dendrimer polyamine, arginine, amidine, protamine, cationic lipid,
cationic porphyrin, quaternary salt of a polyamine, or an alpha
helical peptide.
[0618] Representative U.S. patents that teach the preparation of
polynucleotide conjugates, particularly to RNA, include, but are
not limited to, U.S. Pat. Nos. 4,828,979; 4,948,882; 5,218,105;
5,525,465; 5,541,313; 5,545,730; 5,552,538; 5,578,717, 5,580,731;
5,591,584; 5,109,124; 5,118,802; 5,138,045; 5,414,077; 5,486,603;
5,512,439; 5,578,718; 5,608,046; 4,587,044; 4,605,735; 4,667,025;
4,762,779; 4,789,737; 4,824,941; 4,835,263; 4,876,335; 4,904,582;
4,958,013; 5,082,830; 5,112,963; 5,214,136; 5,082,830; 5,112,963;
5,214,136; 5,245,022; 5,254,469; 5,258,506; 5,262,536; 5,272,250;
5,292,873; 5,317,098; 5,371,241, 5,391,723; 5,416,203, 5,451,463;
5,510,475; 5,512,667; 5,514,785; 5,565,552; 5,567,810; 5,574,142;
5,585,481; 5,587,371; 5,595,726; 5,597,696; 5,599,923; 5,599,928
and 5,688,941; 6,294,664; 6,320,017; 6,576,752; 6,783,931;
6,900,297; 7,037,646; each of which is herein incorporated by
reference in their entireties.
[0619] In one embodiment, the conjugate of the present invention
may function as a carrier for the modified nucleic acids and mmRNA
of the present invention. The conjugate may comprise a cationic
polymer such as, but not limited to, polyamine, polylysine,
polyalkylenimine, and polyethylenimine which may be grafted to with
poly(ethylene glycol). As a non-limiting example, the conjugate may
be similar to the polymeric conjugate and the method of
synthesizing the polymeric conjugate described in U.S. Pat. No.
6,586,524 herein incorporated by reference in its entirety.
[0620] The conjugates can also include targeting groups, e.g., a
cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid
or protein, e.g., an antibody, that binds to a specified cell type
such as a kidney cell. A targeting group can be a thyrotropin,
melanotropin, lectin, glycoprotein, surfactant protein A, Mucin
carbohydrate, multivalent lactose, multivalent galactose,
N-acetyl-galactosamine, N-acetyl-gulucosamine multivalent mannose,
multivalent fucose, glycosylated polyaminoacids, multivalent
galactose, transferrin, bisphosphonate, polyglutamate,
polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate,
vitamin B12, biotin, an RGD peptide, an RGD peptide mimetic or an
aptamer.
[0621] Targeting groups can be proteins, e.g., glycoproteins, or
peptides, e.g., molecules having a specific affinity for a
co-ligand, or antibodies e.g., an antibody, that binds to a
specified cell type such as a cancer cell, endothelial cell, or
bone cell. Targeting groups may also include hormones and hormone
receptors. They can also include non-peptidic species, such as
lipids, lectins, carbohydrates, vitamins, cofactors, multivalent
lactose, multivalent galactose, N-acetyl-galactosamine,
N-acetyl-gulucosamine multivalent mannose, multivalent fucose, or
aptamers. The ligand can be, for example, a lipopolysaccharide, or
an activator of p38 MAP kinase.
[0622] The targeting group can be any ligand that is capable of
targeting a specific receptor. Examples include, without
limitation, folate, GalNAc, galactose, mannose, mannose-6P,
apatamers, integrin receptor ligands, chemokine receptor ligands,
transferrin, biotin, serotonin receptor ligands, PSMA, endothelin,
GCPII, somatostatin, LDL, and HDL ligands. In particular
embodiments, the targeting group is an aptamer. The aptamer can be
unmodified or have any combination of modifications disclosed
herein.
[0623] In one embodiment, pharmaceutical compositions of the
present invention may include chemical modifications such as, but
not limited to, modifications similar to locked nucleic acids.
[0624] Representative U.S. patents that teach the preparation of
locked nucleic acid (LNA) such as those from Santaris, include, but
are not limited to, the following: U.S. Pat. Nos. 6,268,490;
6,670,461; 6,794,499; 6,998,484; 7,053,207; 7,084,125; and
7,399,845, each of which is herein incorporated by reference in its
entirety.
[0625] Representative U.S. patents that teach the preparation of
PNA compounds include, but are not limited to, U.S. Pat. Nos.
5,539,082; 5,714,331; and 5,719,262, each of which is herein
incorporated by reference. Further teaching of PNA compounds can be
found, for example, in Nielsen et al., Science, 1991, 254,
1497-1500.
[0626] Some embodiments featured in the invention include
polynucleotides, primary constructs or mmRNA with phosphorothioate
backbones and oligonucleosides with other modified backbones, and
in particular --CH.sub.2--NH--CH.sub.2--,
--CH.sub.2--N(CH.sub.3)--O--CH.sub.2--[known as a methylene
(methylimino) or MMI backbone],
--CH.sub.2--O--N(CH.sub.3)--CH.sub.2--,
--CH.sub.2--N(CH.sub.3)--N(CH.sub.3)--CH.sub.2-- and
--N(CH.sub.3)--CH.sub.2--CH.sub.2-- [wherein the native
phosphodiester backbone is represented as
--O--P(O).sub.2--O--CH.sub.2--] of the above-referenced U.S. Pat.
No. 5,489,677, and the amide backbones of the above-referenced U.S.
Pat. No. 5,602,240. In some embodiments, the polynucletotides
featured herein have morpholino backbone structures of the
above-referenced U.S. Pat. No. 5,034,506.
[0627] Modifications at the 2' position may also aid in delivery.
Preferably, modifications at the 2' position are not located in a
polypeptide-coding sequence, i.e., not in a translatable region.
Modifications at the 2' position may be located in a 5'UTR, a 3'UTR
and/or a tailing region. Modifications at the 2' position can
include one of the following at the 2' position: H (i.e.,
2'-deoxy); F; O--, S--, or N-alkyl; O--, S--, or N-alkenyl; O--, S-
or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and
alkynyl may be substituted or unsubstituted C.sub.1 to C.sub.10
alkyl or C.sub.2 to C.sub.10 alkenyl and alkynyl. Exemplary
suitable modifications include O[(CH.sub.2).sub.nO].sub.mCH.sub.3,
O(CH.sub.2)..sub.nOCH.sub.3, O(CH.sub.2).sub.nNH.sub.2,
O(CH.sub.2).sub.n--CH.sub.3, O(CH.sub.2).sub.nONH.sub.2, and
O(CH.sub.2).sub.nON[(CH.sub.2).sub.nCH.sub.3)].sub.2, where n and m
are from 1 to about 10. In other embodiments, the polynucleotides,
primary constructs or mmRNA include one of the following at the 2'
position: C.sub.1 to C.sub.10 lower alkyl, substituted lower alkyl,
alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH.sub.3, OCN, Cl,
Br, CN, CF.sub.3, OCF.sub.3, SOCH.sub.3, SO.sub.2CH.sub.3,
ONO.sub.2, NO.sub.2, N.sub.3, NH.sub.2, heterocycloalkyl,
heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted
silyl, an RNA cleaving group, a reporter group, an intercalator, a
group for improving the pharmacokinetic properties, or a group for
improving the pharmacodynamic properties, and other substituents
having similar properties. In some embodiments, the modification
includes a 2'-methoxyethoxy (2'-O--CH.sub.2CH.sub.2OCH.sub.3, also
known as 2'-O-(2-methoxyethyl) or 2'-MOE) (Martin et al., Helv.
Chim. Acta, 1995, 78:486-504) i.e., an alkoxy-alkoxy group. Another
exemplary modification is 2'-dimethylaminooxyethoxy, i.e., a
O(CH.sub.2).sub.2ON(CH.sub.3).sub.2 group, also known as 2'-DMAOE,
as described in examples herein below, and
2'-dimethylaminoethoxyethoxy (also known in the art as
2'-O-dimethylaminoethoxyethyl or 2'-DMAEOE), i.e.,
2'-O--CH.sub.2--O--CH.sub.2--N(CH.sub.2).sub.2, also described in
examples herein below. Other modifications include 2'-methoxy
(2'-OCH.sub.3), 2'-aminopropoxy
(2'-OCH.sub.2CH.sub.2CH.sub.2NH.sub.2) and 2'-fluoro (2'-F).
Similar modifications may also be made at other positions,
particularly the 3' position of the sugar on the 3' terminal
nucleotide or in 2'-5' linked dsRNAs and the 5' position of 5'
terminal nucleotide. Polynucleotides of the invention may also have
sugar mimetics such as cyclobutyl moieties in place of the
pentofuranosyl sugar. Representative U.S. patents that teach the
preparation of such modified sugar structures include, but are not
limited to, U.S. Pat. Nos. 4,981,957; 5,118,800; 5,319,080;
5,359,044; 5,393,878; 5,446,137; 5,466,786; 5,514,785; 5,519,134;
5,567,811; 5,576,427; 5,591,722; 5,597,909; 5,610,300; 5,627,053;
5,639,873; 5,646,265; 5,658,873; 5,670,633; and 5,700,920 and each
of which is herein incorporated by reference.
[0628] In still other embodiments, the polynucleotide, primary
construct, or mmRNA is covalently conjugated to a cell penetrating
polypeptide. The cell-penetrating peptide may also include a signal
sequence. The conjugates of the invention can be designed to have
increased stability; increased cell transfection; and/or altered
the biodistribution (e.g., targeted to specific tissues or cell
types).
[0629] In one embodiment, the polynucleotides, primary constructs
or mmRNA may be conjugated to an agent to enhance delivery. As a
non-limiting example, the agent may be a monomer or polymer such as
a targeting monomer or a polymer having targeting blocks as
described in International Publication No. WO2011062965, herein
incorporated by reference in its entirety. In another non-limiting
example, the agent may be a transport agent covalently coupled to
the polynucleotides, primary constructs or mmRNA of the present
invention (See e.g., U.S. Pat. Nos. 6,835,393 and 7,374,778, each
of which is herein incorporated by reference in its entirety). In
yet another non-limiting example, the agent may be a membrane
barrier transport enhancing agent such as those described in U.S.
Pat. Nos. 7,737,108 and 8,003,129, each of which is herein
incorporated by reference in its entirety.
[0630] In another embodiment, polynucleotides, primary constructs
or mmRNA may be conjugated to SMARTT POLYMER TECHNOLOGY.RTM.
(PHASERX.RTM., Inc. Seattle, Wash.).
Self-Assembled Nanoparticles
Nucleic Acid Self-Assembled Nanoparticles
[0631] Self-assembled nanoparticles have a well-defined size which
may be precisely controlled as the nucleic acid strands may be
easily reprogrammable. For example, the optimal particle size for a
cancer-targeting nanodelivery carrier is 20-100 nm as a diameter
greater than 20 nm avoids renal clearance and enhances delivery to
certain tumors through enhanced permeability and retention effect.
Using self-assembled nucleic acid nanoparticles a single uniform
population in size and shape having a precisely controlled spatial
orientation and density of cancer-targeting ligands for enhanced
delivery. As a non-limiting example, oligonucleotide nanoparticles
were prepared using programmable self-assembly of short DNA
fragments and therapeutic siRNAs. These nanoparticles are
molecularly identical with controllable particle size and target
ligand location and density. The DNA fragments and siRNAs
self-assembled into a one-step reaction to generate DNA/siRNA
tetrahedral nanoparticles for targeted in vivo delivery. (Lee et
al., Nature Nanotechnology 2012 7:389-393; herein incorporated by
reference in its entirety).
[0632] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA disclosed herein may be formulated as self-assembled
nanoparticles. As a non-limiting example, nucleic acids may be used
to make nanoparticles which may be used in a delivery system for
the polynucleotides, primary constructs and/or mmRNA of the present
invention (See e.g., International Pub. No. WO2012125987; herein
incorporated by reference in its entirety).
[0633] In one embodiment, the nucleic acid self-assembled
nanoparticles may comprise a core of the polynucleotides, primary
constructs or mmRNA disclosed herein and a polymer shell. The
polymer shell may be any of the polymers described herein and are
known in the art. In an additional embodiment, the polymer shell
may be used to protect the polynucleotides, primary constructs and
mmRNA in the core.
Polymer-Based Self-Assembled Nanoparticles
[0634] Polymers may be used to form sheets which self-assembled
into nanoparticles. These nanoparticles may be used to deliver the
polynucleotides, primary constructs and mmRNA of the present
invention. In one embodiment, these self-assembled nanoparticles
may be microsponges formed of long polymers of RNA hairpins which
form into crystalline `pleated` sheets before self-assembling into
microsponges. These microsponges are densely-packed sponge like
microparticles which may function as an efficient carrier and may
be able to deliver cargo to a cell. The microsponges may be from 1
um to 300 nm in diameter. The microsponges may be complexed with
other agents known in the art to form larger microsponges. As a
non-limiting example, the microsponge may be complexed with an
agent to form an outer layer to promote cellular uptake such as
polycation polyethyleneime (PEI). This complex can form a 250-nm
diameter particle that can remain stable at high temperatures
(150.degree. C.) (Grabow and Jaegar, Nature Materials 2012,
11:269-269; herein incorporated by reference in its entirety).
Additionally these microsponges may be able to exhibit an
extraordinary degree of protection from degradation by
ribonucleases.
[0635] In another embodiment, the polymer-based self-assembled
nanoparticles such as, but not limited to, microsponges, may be
fully programmable nanoparticles. The geometry, size and
stoichiometry of the nanoparticle may be precisely controlled to
create the optimal nanoparticle for delivery of cargo such as, but
not limited to, polynucleotides, primary constructs and/or
mmRNA.
[0636] In one embodiment, the polymer based nanoparticles may
comprise a core of the polynucleotides, primary constructs and/or
mmRNA disclosed herein and a polymer shell. The polymer shell may
be any of the polymers described herein and are known in the art.
In an additional embodiment, the polymer shell may be used to
protect the polynucleotides, primary construct and/or mmRNA in the
core.
[0637] In yet another embodiment, the polymer based nanoparticle
may comprise a non-nucleic acid polymer comprising a plurality of
heterogenous monomers such as those described in Interantional
Publication No. WO2013009736, herein incorporated by reference in
its entirety.
Inorganic Nanoparticles
[0638] The polynucleotides, primary constructs and/or mmRNAs of the
present invention may be formulated in inorganic nanoparticles
(U.S. Pat. No. 8,257,745, herein incorporated by reference in its
entirety). The inorganic nanoparticles may include, but are not
limited to, clay substances that are water swellable. As a
non-limiting example, the inorganic nanoparticle may include
synthetic smectite clays which are made from simple silicates (See
e.g., U.S. Pat. Nos. 5,585,108 and 8,257,745 each of which are
herein incorporated by reference in their entirety).
[0639] In one embodiment, the inorganic nanoparticles may comprise
a core of the modified nucleic acids disclosed herein and a polymer
shell. The polymer shell may be any of the polymers described
herein and are known in the art. In an additional embodiment, the
polymer shell may be used to protect the modified nucleic acids in
the core.
Semi-conductive and Metallic Nanoparticles
[0640] The polynucleotides, primary constructs and/or mmRNAs of the
present invention may be formulated in water-dispersible
nanoparticle comprising a semiconductive or metallic material (U.S.
Pub. No. 20120228565; herein incorporated by reference in its
entirety) or formed in a magnetic nanoparticle (U.S. Pub. No.
20120265001 and 20120283503; each of which is herein incorporated
by reference in its entirety). The water-dispersible nanoparticles
may be hydrophobic nanoparticles or hydrophilic nanoparticles.
[0641] In one embodiment, the semi-conductive and/or metallic
nanoparticles may comprise a core of the polynucleotides, primary
constructs and/or mmRNA disclosed herein and a polymer shell. The
polymer shell may be any of the polymers described herein and are
known in the art. In an additional embodiment, the polymer shell
may be used to protect the polynucleotides, primary constructs
and/or mmRNA in the core.
Gels and Hydrogels
[0642] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA disclosed herein may be encapsulated into any hydrogel
known in the art which may form a gel when injected into a subject.
Hydrogels are a network of polymer chains that are hydrophilic, and
are sometimes found as a colloidal gel in which water is the
dispersion medium. Hydrogels are highly absorbent (they can contain
over 99% water) natural or synthetic polymers. Hydrogels also
possess a degree of flexibility very similar to natural tissue, due
to their significant water content. The hydrogel described herein
may used to encapsulate lipid nanoparticles which are
biocompatible, biodegradable and/or porous.
[0643] As a non-limiting example, the hydrogel may be an
aptamer-functionalized hydrogel. The aptamer-functionalized
hydrogel may be programmed to release one or more polynucleotides,
primary constructs and/or mmRNA using nucleic acid hybridization.
(Battig et al., J. Am. Chem. Society. 2012 134:12410-12413; herein
incorporated by reference in its entirety).
[0644] As another non-limiting example, the hydrogel may be a
shaped as an inverted opal.
The opal hydrogels exhibit higher swelling ratios and the swelling
kinetics is an order of magnitude faster as well. Methods of
producing opal hydrogels and description of opal hydrogels are
described in International Pub. No. WO2012148684, herein
incorporated by reference in its entirety.
[0645] In yet another non-limiting example, the hydrogel may be an
antibacterial hydrogel. The antibacterial hydrogel may comprise a
pharmaceutical acceptable salt or organic material such as, but not
limited to pharmaceutical grade and/or medical grade silver salt
and aloe vera gel or extract. (International Pub. No. WO2012151438,
herein incorporated by reference in its entirety).
[0646] In one embodiment, the modified mRNA may be encapsulated in
a lipid nanoparticle and then the lipid nanoparticle may be
encapsulated into a hyrdogel.
[0647] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA disclosed herein may be encapsulated into any gel
known in the art. As a non-limiting example the gel may be a
fluorouracil injectable gel or a fluorouracil injectable gel
containing a chemical compound and/or drug known in the art. As
another example, the polynucleotides, primary constructs and/or
mmRNA may be encapsulated in a fluorouracil gel containing
epinephrine (See e.g., Smith et al. Cancer Chemotherapty and
Pharmacology, 1999 44(4):267-274; herein incorporated by reference
in its entirety).
[0648] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA disclosed herein may be encapsulated into a fibrin
gel, fibrin hydrogel or fibrin glue. In another embodiment, the
polynucleotides, primary constructs and/or mmRNA may be formulated
in a lipid nanoparticle or a rapidly eliminated lipid nanoparticle
prior to being encapsulated into a fibrin gel, fibrin hydrogel or a
fibrin glue. In yet another embodiment, the polynucleotides,
primary constructs and/or mmRNA may be formulated as a lipoplex
prior to being encapsulated into a fibrin gel, hydrogel or a fibrin
glue. Fibrin gels, hydrogels and glues comprise two components, a
fibrinogen solution and a thrombin solution which is rich in
calcium (See e.g., Spicer and Mikos, Journal of Controlled Release
2010. 148: 49-55; Kidd et al. Journal of Controlled Release 2012.
157:80-85; each of which is herein incorporated by reference in its
entirety). The concentration of the components of the fibrin gel,
hydrogel and/or glue can be altered to change the characteristics,
the network mesh size, and/or the degradation characteristics of
the gel, hydrogel and/or glue such as, but not limited to changing
the release characteristics of the fibrin gel, hydrogel and/or
glue. (See e.g., Spicer and Mikos, Journal of Controlled Release
2010. 148: 49-55; Kidd et al. Journal of Controlled Release 2012.
157:80-85; Catelas et al. Tissue Engineering 2008. 14:119-128; each
of which is herein incorporated by reference in its entirety). This
feature may be advantageous when used to deliver the modified mRNA
disclosed herein. (See e.g., Kidd et al. Journal of Controlled
Release 2012. 157:80-85; Catelas et al. Tissue Engineering 2008.
14:119-128; each of which is herein incorporated by reference in
its entirety).
Cations and Anions
[0649] Formulations of polynucleotides, primary constructs and/or
mmRNA disclosed herein may include cations or anions. In one
embodiment, the formulations include metal cations such as, but not
limited to, Zn2+, Ca2+, Cu2+, Mg+ and combinations thereof. As a
non-limiting example, formulations may include polymers and a
polynucleotides, primary constructs and/or mmRNA complexed with a
metal cation (See e.g., U.S. Pat. Nos. 6,265,389 and 6,555,525,
each of which is herein incorporated by reference in its
entirety).
Molded Nanoparticles and Microparticles
[0650] The polynucleotides, primary constructs and/or mmRNA
disclosed herein may be formulated in nanoparticles and/or
microparticles. These nanoparticles and/or microparticles may be
molded into any size shape and chemistry. As an example, the
nanoparticles and/or microparticles may be made using the
PRINT.RTM. technology by LIQUIDA TECHNOLOGIES.RTM. (Morrisville,
N.C.) (See e.g., International Pub. No. WO2007024323; herein
incorporated by reference in its entirety).
[0651] In one embodiment, the molded nanoparticles may comprise a
core of the polynucleotides, primary constructs and/or mmRNA
disclosed herein and a polymer shell. The polymer shell may be any
of the polymers described herein and are known in the art. In an
additional embodiment, the polymer shell may be used to protect the
polynucleotides, primary construct and/or mmRNA in the core.
NanoJackets and NanoLiposomes
[0652] The polynucleotides, primary constructs and/or mmRNA
disclosed herein may be formulated in NanoJackets and NanoLiposomes
by Keystone Nano (State College, Pa.). NanoJackets are made of
compounds that are naturally found in the body including calcium,
phosphate and may also include a small amount of silicates.
Nanojackets may range in size from 5 to 50 nm and may be used to
deliver hydrophilic and hydrophobic compounds such as, but not
limited to, polynucleotides, primary constructs and/or mmRNA.
[0653] NanoLiposomes are made of lipids such as, but not limited
to, lipids which naturally occur in the body. NanoLiposomes may
range in size from 60-80 nm and may be used to deliver hydrophilic
and hydrophobic compounds such as, but not limited to,
polynucleotides, primary constructs and/or mmRNA. In one aspect,
the polynucleotides, primary constructs and/or mmRNA disclosed
herein are formulated in a NanoLiposome such as, but not limited
to, Ceramide NanoLiposomes.
Excipients
[0654] Pharmaceutical formulations may additionally comprise a
pharmaceutically acceptable excipient, which, as used herein,
includes any and all solvents, dispersion media, diluents, or other
liquid vehicles, dispersion or suspension aids, surface active
agents, isotonic agents, thickening or emulsifying agents,
preservatives, solid binders, lubricants and the like, as suited to
the particular dosage form desired. Remington's The Science and
Practice of Pharmacy, 21.sup.st Edition, A. R. Gennaro (Lippincott,
Williams & Wilkins, Baltimore, Md., 2006; incorporated herein
by reference in its entirety) discloses various excipients used in
formulating pharmaceutical compositions and known techniques for
the preparation thereof. Except insofar as any conventional
excipient medium is incompatible with a substance or its
derivatives, such as by producing any undesirable biological effect
or otherwise interacting in a deleterious manner with any other
component(s) of the pharmaceutical composition, its use is
contemplated to be within the scope of this invention.
[0655] In some embodiments, a pharmaceutically acceptable excipient
is at least 95%, at least 96%, at least 97%, at least 98%, at least
99%, or 100% pure. In some embodiments, an excipient is approved
for use in humans and for veterinary use. In some embodiments, an
excipient is approved by United States Food and Drug
Administration. In some embodiments, an excipient is pharmaceutical
grade. In some embodiments, an excipient meets the standards of the
United States Pharmacopoeia (USP), the European Pharmacopoeia (EP),
the British Pharmacopoeia, and/or the International
Pharmacopoeia.
[0656] Pharmaceutically acceptable excipients used in the
manufacture of pharmaceutical compositions include, but are not
limited to, inert diluents, dispersing and/or granulating agents,
surface active agents and/or emulsifiers, disintegrating agents,
binding agents, preservatives, buffering agents, lubricating
agents, and/or oils. Such excipients may optionally be included in
pharmaceutical compositions.
[0657] Exemplary diluents include, but are not limited to, calcium
carbonate, sodium carbonate, calcium phosphate, dicalcium
phosphate, calcium sulfate, calcium hydrogen phosphate, sodium
phosphate lactose, sucrose, cellulose, microcrystalline cellulose,
kaolin, mannitol, sorbitol, inositol, sodium chloride, dry starch,
cornstarch, powdered sugar, etc., and/or combinations thereof.
[0658] Exemplary granulating and/or dispersing agents include, but
are not limited to, potato starch, corn starch, tapioca starch,
sodium starch glycolate, clays, alginic acid, guar gum, citrus
pulp, agar, bentonite, cellulose and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(VEEGUM.RTM.), sodium lauryl sulfate, quaternary ammonium
compounds, etc., and/or combinations thereof.
[0659] Exemplary surface active agents and/or emulsifiers include,
but are not limited to, natural emulsifiers (e.g. acacia, agar,
alginic acid, sodium alginate, tragacanth, chondrux, cholesterol,
xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol,
wax, and lecithin), colloidal clays (e.g. bentonite [aluminum
silicate] and VEEGUM.RTM. [magnesium aluminum silicate]), long
chain amino acid derivatives, high molecular weight alcohols (e.g.
stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin
monostearate, ethylene glycol distearate, glyceryl monostearate,
and propylene glycol monostearate, polyvinyl alcohol), carbomers
(e.g. carboxy polymethylene, polyacrylic acid, acrylic acid
polymer, and carboxyvinyl polymer), carrageenan, cellulosic
derivatives (e.g. carboxymethylcellulose sodium, powdered
cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty
acid esters (e.g. polyoxyethylene sorbitan monolaurate [TWEEN.RTM.
20], polyoxyethylene sorbitan [TWEENn.RTM.60], polyoxyethylene
sorbitan monooleate [TWEEN.RTM.80], sorbitan monopalmitate
[SPAN.RTM.40], sorbitan monostearate [SPAN.RTM.60], sorbitan
tristearate [SPAN.RTM.65], glyceryl monooleate, sorbitan monooleate
[SPAN.RTM.80]), polyoxyethylene esters (e.g. polyoxyethylene
monostearate [MYRJ.RTM.45], polyoxyethylene hydrogenated castor
oil, polyethoxylated castor oil, polyoxymethylene stearate, and
SOLUTOL.RTM.), sucrose fatty acid esters, polyethylene glycol fatty
acid esters (e.g. CREMOPHOR.RTM.), polyoxyethylene ethers, (e.g.
polyoxyethylene lauryl ether [BRIJ.RTM. 30]),
poly(vinyl-pyrrolidone), diethylene glycol monolaurate,
triethanolamine oleate, sodium oleate, potassium oleate, ethyl
oleate, oleic acid, ethyl laurate, sodium lauryl sulfate,
PLUORINC.RTM.F 68, POLOXAMER.RTM. 188, cetrimonium bromide,
cetylpyridinium chloride, benzalkonium chloride, docusate sodium,
etc. and/or combinations thereof.
[0660] Exemplary binding agents include, but are not limited to,
starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g.
sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol,
mannitol,); natural and synthetic gums (e.g. acacia, sodium
alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage
of isapol husks, carboxymethylcellulose, methylcellulose,
ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, microcrystalline cellulose,
cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum
silicate (Veegum.RTM.), and larch arabogalactan); alginates;
polyethylene oxide; polyethylene glycol; inorganic calcium salts;
silicic acid; polymethacrylates; waxes; water; alcohol; etc.; and
combinations thereof
[0661] Exemplary preservatives may include, but are not limited to,
antioxidants, chelating agents, antimicrobial preservatives,
antifungal preservatives, alcohol preservatives, acidic
preservatives, and/or other preservatives. Exemplary antioxidants
include, but are not limited to, alpha tocopherol, ascorbic acid,
acorbyl palmitate, butylated hydroxyanisole, butylated
hydroxytoluene, monothioglycerol, potassium metabisulfite,
propionic acid, propyl gallate, sodium ascorbate, sodium bisulfite,
sodium metabisulfite, and/or sodium sulfite. Exemplary chelating
agents include ethylenediaminetetraacetic acid (EDTA), citric acid
monohydrate, disodium edetate, dipotassium edetate, edetic acid,
fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric
acid, and/or trisodium edetate. Exemplary antimicrobial
preservatives include, but are not limited to, benzalkonium
chloride, benzethonium chloride, benzyl alcohol, bronopol,
cetrimide, cetylpyridinium chloride, chlorhexidine, chlorobutanol,
chlorocresol, chloroxylenol, cresol, ethyl alcohol, glycerin,
hexetidine, imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and/or thimerosal.
Exemplary antifungal preservatives include, but are not limited to,
butyl paraben, methyl paraben, ethyl paraben, propyl paraben,
benzoic acid, hydroxybenzoic acid, potassium benzoate, potassium
sorbate, sodium benzoate, sodium propionate, and/or sorbic acid.
Exemplary alcohol preservatives include, but are not limited to,
ethanol, polyethylene glycol, phenol, phenolic compounds,
bisphenol, chlorobutanol, hydroxybenzoate, and/or phenylethyl
alcohol. Exemplary acidic preservatives include, but are not
limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric
acid, acetic acid, dehydroacetic acid, ascorbic acid, sorbic acid,
and/or phytic acid. Other preservatives include, but are not
limited to, tocopherol, tocopherol acetate, deteroxime mesylate,
cetrimide, butylated hydroxyanisol (BHA), butylated hydroxytoluened
(BHT), ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl
ether sulfate (SLES), sodium bisulfite, sodium metabisulfite,
potassium sulfite, potassium metabisulfite, GLYDANT PLUS.RTM.,
PHENONIP, methylparaben, GERMALL.RTM. 115, GERMABEN.RTM.II,
NEOLONE.TM., KATHON.TM., and/or EUXYL.RTM..
[0662] Exemplary buffering agents include, but are not limited to,
citrate buffer solutions, acetate buffer solutions, phosphate
buffer solutions, ammonium chloride, calcium carbonate, calcium
chloride, calcium citrate, calcium glubionate, calcium gluceptate,
calcium gluconate, D-gluconic acid, calcium glycerophosphate,
calcium lactate, propanoic acid, calcium levulinate, pentanoic
acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium
phosphate, calcium hydroxide phosphate, potassium acetate,
potassium chloride, potassium gluconate, potassium mixtures,
dibasic potassium phosphate, monobasic potassium phosphate,
potassium phosphate mixtures, sodium acetate, sodium bicarbonate,
sodium chloride, sodium citrate, sodium lactate, dibasic sodium
phosphate, monobasic sodium phosphate, sodium phosphate mixtures,
tromethamine, magnesium hydroxide, aluminum hydroxide, alginic
acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl
alcohol, etc., and/or combinations thereof.
[0663] Exemplary lubricating agents include, but are not limited
to, magnesium stearate, calcium stearate, stearic acid, silica,
talc, malt, glyceryl behanate, hydrogenated vegetable oils,
polyethylene glycol, sodium benzoate, sodium acetate, sodium
chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate,
etc., and combinations thereof
[0664] Exemplary oils include, but are not limited to, almond,
apricot kernel, avocado, babassu, bergamot, black current seed,
borage, cade, camomile, canola, caraway, carnauba, castor,
cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton
seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol,
gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba,
kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary oils include, but are not limited
to, butyl stearate, caprylic triglyceride, capric triglyceride,
cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl
myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone
oil, and/or combinations thereof.
[0665] Excipients such as cocoa butter and suppository waxes,
coloring agents, coating agents, sweetening, flavoring, and/or
perfuming agents can be present in the composition, according to
the judgment of the formulator.
Delivery
[0666] The present disclosure encompasses the delivery of
polynucleotides, primary constructs or mmRNA for any of
therapeutic, pharmaceutical, diagnostic or imaging by any
appropriate route taking into consideration likely advances in the
sciences of drug delivery. Delivery may be naked or formulated.
Naked Delivery
[0667] The polynucleotides, primary constructs or mmRNA of the
present invention may be delivered to a cell naked. As used herein
in, "naked" refers to delivering polynucleotides, primary
constructs or mmRNA free from agents which promote transfection.
For example, the polynucleotides, primary constructs or mmRNA
delivered to the cell may contain no modifications. The naked
polynucleotides, primary constructs or mmRNA may be delivered to
the cell using routes of administration known in the art and
described herein.
Formulated Delivery
[0668] The polynucleotides, primary constructs or mmRNA of the
present invention may be formulated, using the methods described
herein. The formulations may contain polynucleotides, primary
constructs or mmRNA which may be modified and/or unmodified. The
formulations may further include, but are not limited to, cell
penetration agents, a pharmaceutically acceptable carrier, a
delivery agent, a bioerodible or biocompatible polymer, a solvent,
and a sustained-release delivery depot. The formulated
polynucleotides, primary constructs or mmRNA may be delivered to
the cell using routes of administration known in the art and
described herein.
[0669] The compositions may also be formulated for direct delivery
to an organ or tissue in any of several ways in the art including,
but not limited to, direct soaking or bathing, via a catheter, by
gels, powder, ointments, creams, gels, lotions, and/or drops, by
using substrates such as fabric or biodegradable materials coated
or impregnated with the compositions, and the like.
Administration
[0670] The polynucleotides, primary constructs or mmRNA of the
present invention may be administered by any route which results in
a therapeutically effective outcome. These include, but are not
limited to enteral, gastroenteral, epidural, oral, transdermal,
epidural (peridural), intracerebral (into the cerebrum),
intracerebroventricular (into the cerebral ventricles),
epicutaneous (application onto the skin), intradermal, (into the
skin itself), subcutaneous (under the skin), nasal administration
(through the nose), intravenous (into a vein), intraarterial (into
an artery), intramuscular (into a muscle), intracardiac (into the
heart), intraosseous infusion (into the bone marrow), intrathecal
(into the spinal canal), intraperitoneal, (infusion or injection
into the peritoneum), intravesical infusion, intravitreal, (through
the eye), intracavernous injection, (into the base of the penis),
intravaginal administration, intrauterine, extra-amniotic
administration, transdermal (diffusion through the intact skin for
systemic distribution), transmucosal (diffusion through a mucous
membrane), insufflation (snorting), sublingual, sublabial, enema,
eye drops (onto the conjunctiva), or in ear drops. In specific
embodiments, compositions may be administered in a way which allows
them cross the blood-brain barrier, vascular barrier, or other
epithelial barrier. Non-limiting routes of administration for the
polynucleotides, primary constructs or mmRNA of the present
invention are described below.
Parenteral and Injectible Administration
[0671] Liquid dosage forms for parenteral administration include,
but are not limited to, pharmaceutically acceptable emulsions,
microemulsions, solutions, suspensions, syrups, and/or elixirs. In
addition to active ingredients, liquid dosage forms may comprise
inert diluents commonly used in the art such as, for example, water
or other solvents, solubilizing agents and emulsifiers such as
ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate,
benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene
glycol, dimethylformamide, oils (in particular, cottonseed,
groundnut, corn, germ, olive, castor, and sesame oils), glycerol,
tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid
esters of sorbitan, and mixtures thereof. Besides inert diluents,
oral compositions can include adjuvants such as wetting agents,
emulsifying and suspending agents, sweetening, flavoring, and/or
perfuming agents. In certain embodiments for parenteral
administration, compositions are mixed with solubilizing agents
such as CREMOPHOR.RTM., alcohols, oils, modified oils, glycols,
polysorbates, cyclodextrins, polymers, and/or combinations
thereof.
[0672] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions may be formulated according to
the known art using suitable dispersing agents, wetting agents,
and/or suspending agents. Sterile injectable preparations may be
sterile injectable solutions, suspensions, and/or emulsions in
nontoxic parenterally acceptable diluents and/or solvents, for
example, as a solution in 1,3-butanediol. Among the acceptable
vehicles and solvents that may be employed are water, Ringer's
solution, U.S.P., and isotonic sodium chloride solution. Sterile,
fixed oils are conventionally employed as a solvent or suspending
medium. For this purpose any bland fixed oil can be employed
including synthetic mono- or diglycerides. Fatty acids such as
oleic acid can be used in the preparation of injectables.
[0673] Injectable formulations can be sterilized, for example, by
filtration through a bacterial-retaining filter, and/or by
incorporating sterilizing agents in the form of sterile solid
compositions which can be dissolved or dispersed in sterile water
or other sterile injectable medium prior to use.
[0674] In order to prolong the effect of an active ingredient, it
is often desirable to slow the absorption of the active ingredient
from subcutaneous or intramuscular injection. This may be
accomplished by the use of a liquid suspension of crystalline or
amorphous material with poor water solubility. The rate of
absorption of the drug then depends upon its rate of dissolution
which, in turn, may depend upon crystal size and crystalline form.
Alternatively, delayed absorption of a parenterally administered
drug form is accomplished by dissolving or suspending the drug in
an oil vehicle. Injectable depot forms are made by forming
microencapsule matrices of the drug in biodegradable polymers such
as polylactide-polyglycolide. Depending upon the ratio of drug to
polymer and the nature of the particular polymer employed, the rate
of drug release can be controlled. Examples of other biodegradable
polymers include poly(orthoesters) and poly(anhydrides). Depot
injectable formulations are prepared by entrapping the drug in
liposomes or microemulsions which are compatible with body
tissues.
Rectal and Vaginal Administration
[0675] Compositions for rectal or vaginal administration are
typically suppositories which can be prepared by mixing
compositions with suitable non-irritating excipients such as cocoa
butter, polyethylene glycol or a suppository wax which are solid at
ambient temperature but liquid at body temperature and therefore
melt in the rectum or vaginal cavity and release the active
ingredient.
Oral Administration
[0676] Liquid dosage forms for oral administration include, but are
not limited to, pharmaceutically acceptable emulsions,
microemulsions, solutions, suspensions, syrups, and/or elixirs. In
addition to active ingredients, liquid dosage forms may comprise
inert diluents commonly used in the art such as, for example, water
or other solvents, solubilizing agents and emulsifiers such as
ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl acetate,
benzyl alcohol, benzyl benzoate, propylene glycol, 1,3-butylene
glycol, dimethylformamide, oils (in particular, cottonseed,
groundnut, corn, germ, olive, castor, and sesame oils), glycerol,
tetrahydrofurfuryl alcohol, polyethylene glycols and fatty acid
esters of sorbitan, and mixtures thereof. Besides inert diluents,
oral compositions can include adjuvants such as wetting agents,
emulsifying and suspending agents, sweetening, flavoring, and/or
perfuming agents. In certain embodiments for parenteral
administration, compositions are mixed with solubilizing agents
such as CREMOPHOR.RTM., alcohols, oils, modified oils, glycols,
polysorbates, cyclodextrins, polymers, and/or combinations
thereof.
[0677] Solid dosage forms for oral administration include capsules,
tablets, pills, powders, and granules. In such solid dosage forms,
an active ingredient is mixed with at least one inert,
pharmaceutically acceptable excipient such as sodium citrate or
dicalcium phosphate and/or fillers or extenders (e.g. starches,
lactose, sucrose, glucose, mannitol, and silicic acid), binders
(e.g. carboxymethylcellulose, alginates, gelatin,
polyvinylpyrrolidinone, sucrose, and acacia), humectants (e.g.
glycerol), disintegrating agents (e.g. agar, calcium carbonate,
potato or tapioca starch, alginic acid, certain silicates, and
sodium carbonate), solution retarding agents (e.g. paraffin),
absorption accelerators (e.g. quaternary ammonium compounds),
wetting agents (e.g. cetyl alcohol and glycerol monostearate),
absorbents (e.g. kaolin and bentonite clay), and lubricants (e.g.
talc, calcium stearate, magnesium stearate, solid polyethylene
glycols, sodium lauryl sulfate), and mixtures thereof. In the case
of capsules, tablets and pills, the dosage form may comprise
buffering agents.
Topical or Transdermal Administration
[0678] As described herein, compositions containing the
polynucleotides, primary constructs or mmRNA of the invention may
be formulated for administration topically. The skin may be an
ideal target site for delivery as it is readily accessible. Gene
expression may be restricted not only to the skin, potentially
avoiding nonspecific toxicity, but also to specific layers and cell
types within the skin.
[0679] The site of cutaneous expression of the delivered
compositions will depend on the route of nucleic acid delivery.
Three routes are commonly considered to deliver polynucleotides,
primary constructs or mmRNA to the skin: (i) topical application
(e.g. for local/regional treatment and/or cosmetic applications);
(ii) intradermal injection (e.g. for local/regional treatment
and/or cosmetic applications); and (iii) systemic delivery (e.g.
for treatment of dermatologic diseases that affect both cutaneous
and extracutaneous regions). Polynucleotides, primary constructs or
mmRNA can be delivered to the skin by several different approaches
known in the art. Most topical delivery approaches have been shown
to work for delivery of DNA, such as but not limited to, topical
application of non-cationic liposome-DNA complex, cationic
liposome-DNA complex, particle-mediated (gene gun),
puncture-mediated gene transfections, and viral delivery
approaches. After delivery of the nucleic acid, gene products have
been detected in a number of different skin cell types, including,
but not limited to, basal keratinocytes, sebaceous gland cells,
dermal fibroblasts and dermal macrophages.
[0680] In one embodiment, the invention provides for a variety of
dressings (e.g., wound dressings) or bandages (e.g., adhesive
bandages) for conveniently and/or effectively carrying out methods
of the present invention. Typically dressing or bandages may
comprise sufficient amounts of pharmaceutical compositions and/or
polynucleotides, primary constructs or mmRNA described herein to
allow a user to perform multiple treatments of a subject(s).
[0681] In one embodiment, the invention provides for the
polynucleotides, primary constructs or mmRNA compositions to be
delivered in more than one injection.
[0682] In one embodiment, before topical and/or transdermal
administration at least one area of tissue, such as skin, may be
subjected to a device and/or solution which may increase
permeability. In one embodiment, the tissue may be subjected to an
abrasion device to increase the permeability of the skin (see U.S.
Patent Publication No. 20080275468, herein incorporated by
reference in its entirety). In another embodiment, the tissue may
be subjected to an ultrasound enhancement device. An ultrasound
enhancement device may include, but is not limited to, the devices
described in U.S. Publication No. 20040236268 and U.S. Pat. Nos.
6,491,657 and 6,234,990; each of which are herein incorporated by
reference in their entireties. Methods of enhancing the
permeability of tissue are described in U.S. Publication Nos.
20040171980 and 20040236268 and U.S. Pat. No. 6,190,315; each of
which are herein incorporated by reference in their entireties.
[0683] In one embodiment, a device may be used to increase
permeability of tissue before delivering formulations of modified
mRNA described herein. The permeability of skin may be measured by
methods known in the art and/or described in U.S. Pat. No.
6,190,315, herein incorporated by reference in its entirety. As a
non-limiting example, a modified mRNA formulation may be delivered
by the drug delivery methods described in U.S. Pat. No. 6,190,315,
herein incorporated by reference in its entirety.
[0684] In another non-limiting example tissue may be treated with a
eutectic mixture of local anesthetics (EMLA) cream before, during
and/or after the tissue may be subjected to a device which may
increase permeability. Katz et al. (Anesth Analg (2004); 98:371-76;
herein incorporated by reference in its entirety) showed that using
the EMLA cream in combination with a low energy, an onset of
superficial cutaneous analgesia was seen as fast as 5 minutes after
a pretreatment with a low energy ultrasound.
[0685] In one embodiment, enhancers may be applied to the tissue
before, during, and/or after the tissue has been treated to
increase permeability. Enhancers include, but are not limited to,
transport enhancers, physical enhancers, and cavitation enhancers.
Non-limiting examples of enhancers are described in U.S. Pat. No.
6,190,315, herein incorporated by reference in its entirety.
[0686] In one embodiment, a device may be used to increase
permeability of tissue before delivering formulations of modified
mRNA described herein, which may further contain a substance that
invokes an immune response. In another non-limiting example, a
formulation containing a substance to invoke an immune response may
be delivered by the methods described in U.S. Publication Nos.
20040171980 and 20040236268; each of which are herein incorporated
by reference in their entireties.
[0687] Dosage forms for topical and/or transdermal administration
of a composition may include ointments, pastes, creams, lotions,
gels, powders, solutions, sprays, inhalants and/or patches.
Generally, an active ingredient is admixed under sterile conditions
with a pharmaceutically acceptable excipient and/or any needed
preservatives and/or buffers as may be required.
[0688] Additionally, the present invention contemplates the use of
transdermal patches, which often have the added advantage of
providing controlled delivery of a compound to the body. Such
dosage forms may be prepared, for example, by dissolving and/or
dispensing the compound in the proper medium. Alternatively or
additionally, rate may be controlled by either providing a rate
controlling membrane and/or by dispersing the compound in a polymer
matrix and/or gel.
[0689] Formulations suitable for topical administration include,
but are not limited to, liquid and/or semi liquid preparations such
as liniments, lotions, oil in water and/or water in oil emulsions
such as creams, ointments and/or pastes, and/or solutions and/or
suspensions.
[0690] Topically-administrable formulations may, for example,
comprise from about 0.1% to about 10% (w/w) active ingredient,
although the concentration of active ingredient may be as high as
the solubility limit of the active ingredient in the solvent.
Formulations for topical administration may further comprise one or
more of the additional ingredients described herein.
Depot Administration
[0691] As described herein, in some embodiments, the composition is
formulated in depots for extended release. Generally, a specific
organ or tissue (a "target tissue") is targeted for
administration.
[0692] In some aspects of the invention, the polynucleotides,
primary constructs or mmRNA are spatially retained within or
proximal to a target tissue. Provided are method of providing a
composition to a target tissue of a mammalian subject by contacting
the target tissue (which contains one or more target cells) with
the composition under conditions such that the composition, in
particular the nucleic acid component(s) of the composition, is
substantially retained in the target tissue, meaning that at least
10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9,
99.99 or greater than 99.99% of the composition is retained in the
target tissue. Advantageously, retention is determined by measuring
the amount of the nucleic acid present in the composition that
enters one or more target cells. For example, at least 1, 5, 10,
20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99
or greater than 99.99% of the nucleic acids administered to the
subject are present intracellularly at a period of time following
administration. For example, intramuscular injection to a mammalian
subject is performed using an aqueous composition containing a
ribonucleic acid and a transfection reagent, and retention of the
composition is determined by measuring the amount of the
ribonucleic acid present in the muscle cells.
[0693] Aspects of the invention are directed to methods of
providing a composition to a target tissue of a mammalian subject,
by contacting the target tissue (containing one or more target
cells) with the composition under conditions such that the
composition is substantially retained in the target tissue. The
composition contains an effective amount of a polynucleotides,
primary constructs or mmRNA such that the polypeptide of interest
is produced in at least one target cell. The compositions generally
contain a cell penetration agent, although "naked" nucleic acid
(such as nucleic acids without a cell penetration agent or other
agent) is also contemplated, and a pharmaceutically acceptable
carrier.
[0694] In some circumstances, the amount of a protein produced by
cells in a tissue is desirably increased. Preferably, this increase
in protein production is spatially restricted to cells within the
target tissue. Thus, provided are methods of increasing production
of a protein of interest in a tissue of a mammalian subject. A
composition is provided that contains polynucleotides, primary
constructs or mmRNA characterized in that a unit quantity of
composition has been determined to produce the polypeptide of
interest in a substantial percentage of cells contained within a
predetermined volume of the target tissue.
[0695] In some embodiments, the composition includes a plurality of
different polynucleotides, primary constructs or mmRNA, where one
or more than one of the polynucleotides, primary constructs or
mmRNA encodes a polypeptide of interest. Optionally, the
composition also contains a cell penetration agent to assist in the
intracellular delivery of the composition. A determination is made
of the dose of the composition required to produce the polypeptide
of interest in a substantial percentage of cells contained within
the predetermined volume of the target tissue (generally, without
inducing significant production of the polypeptide of interest in
tissue adjacent to the predetermined volume, or distally to the
target tissue). Subsequent to this determination, the determined
dose is introduced directly into the tissue of the mammalian
subject.
[0696] In one embodiment, the invention provides for the
polynucleotides, primary constructs or mmRNA to be delivered in
more than one injection or by split dose injections.
[0697] In one embodiment, the invention may be retained near target
tissue using a small disposable drug reservoir, patch pump or
osmotic pump. Non-limiting examples of patch pumps include those
manufactured and/or sold by BD.RTM. (Franklin Lakes, N.J.), Insulet
Corporation (Bedford, Mass.), SteadyMed Therapeutics (San
Francisco, Calif.), Medtronic (Minneapolis, Minn.) (e.g., MiniMed),
UniLife (York, Pa.), Valeritas (Bridgewater, N.J.), and SpringLeaf
Therapeutics (Boston, Mass.). A non-limiting example of an osmotic
pump include those manufactured by DURECT.RTM. (Cupertino, Calif.)
(e.g., DUROS.RTM. and ALZET.RTM.).
Pulmonary Administration
[0698] A pharmaceutical composition may be prepared, packaged,
and/or sold in a formulation suitable for pulmonary administration
via the buccal cavity. Such a formulation may comprise dry
particles which comprise the active ingredient and which have a
diameter in the range from about 0.5 nm to about 7 nm or from about
1 nm to about 6 nm. Such compositions are suitably in the form of
dry powders for administration using a device comprising a dry
powder reservoir to which a stream of propellant may be directed to
disperse the powder and/or using a self propelling solvent/powder
dispensing container such as a device comprising the active
ingredient dissolved and/or suspended in a low-boiling propellant
in a sealed container. Such powders comprise particles wherein at
least 98% of the particles by weight have a diameter greater than
0.5 nm and at least 95% of the particles by number have a diameter
less than 7 nm. Alternatively, at least 95% of the particles by
weight have a diameter greater than 1 nm and at least 90% of the
particles by number have a diameter less than 6 nm. Dry powder
compositions may include a solid fine powder diluent such as sugar
and are conveniently provided in a unit dose form.
[0699] Low boiling propellants generally include liquid propellants
having a boiling point of below 65.degree. F. at atmospheric
pressure. Generally the propellant may constitute 50% to 99.9%
(w/w) of the composition, and active ingredient may constitute 0.1%
to 20% (w/w) of the composition. A propellant may further comprise
additional ingredients such as a liquid non-ionic and/or solid
anionic surfactant and/or a solid diluent (which may have a
particle size of the same order as particles comprising the active
ingredient).
[0700] As a non-limiting example, the polynucleotides, primary
constructs and/or mmRNA described herein may be formulated for
pulmonary delivery by the methods described in U.S. Pat. No.
8,257,685; herein incorporated by reference in its entirety.
[0701] Pharmaceutical compositions formulated for pulmonary
delivery may provide an active ingredient in the form of droplets
of a solution and/or suspension. Such formulations may be prepared,
packaged, and/or sold as aqueous and/or dilute alcoholic solutions
and/or suspensions, optionally sterile, comprising active
ingredient, and may conveniently be administered using any
nebulization and/or atomization device. Such formulations may
further comprise one or more additional ingredients including, but
not limited to, a flavoring agent such as saccharin sodium, a
volatile oil, a buffering agent, a surface active agent, and/or a
preservative such as methylhydroxybenzoate. Droplets provided by
this route of administration may have an average diameter in the
range from about 0.1 nm to about 200 nm.
Intranasal, Nasal and Buccal Administration
[0702] Formulations described herein as being useful for pulmonary
delivery are useful for intranasal delivery of a pharmaceutical
composition. Another formulation suitable for intranasal
administration is a coarse powder comprising the active ingredient
and having an average particle from about 0.2 .mu.m to 500 .mu.m.
Such a formulation is administered in the manner in which snuff is
taken, i.e. by rapid inhalation through the nasal passage from a
container of the powder held close to the nose.
[0703] Formulations suitable for nasal administration may, for
example, comprise from about as little as 0.1% (w/w) and as much as
100% (w/w) of active ingredient, and may comprise one or more of
the additional ingredients described herein. A pharmaceutical
composition may be prepared, packaged, and/or sold in a formulation
suitable for buccal administration. Such formulations may, for
example, be in the form of tablets and/or lozenges made using
conventional methods, and may, for example, 0.1% to 20% (w/w)
active ingredient, the balance comprising an orally dissolvable
and/or degradable composition and, optionally, one or more of the
additional ingredients described herein. Alternately, formulations
suitable for buccal administration may comprise a powder and/or an
aerosolized and/or atomized solution and/or suspension comprising
active ingredient. Such powdered, aerosolized, and/or aerosolized
formulations, when dispersed, may have an average particle and/or
droplet size in the range from about 0.1 nm to about 200 nm, and
may further comprise one or more of any additional ingredients
described herein.
Ophthalmic Administration
[0704] A pharmaceutical composition may be prepared, packaged,
and/or sold in a formulation suitable for ophthalmic
administration. Such formulations may, for example, be in the form
of eye drops including, for example, a 0.1/1.0% (w/w) solution
and/or suspension of the active ingredient in an aqueous or oily
liquid excipient. Such drops may further comprise buffering agents,
salts, and/or one or more other of any additional ingredients
described herein. Other ophthalmically-administrable formulations
which are useful include those which comprise the active ingredient
in microcrystalline form and/or in a liposomal preparation. Ear
drops and/or eye drops are contemplated as being within the scope
of this invention. A multilayer thin film device may be prepared to
contain a pharmaceutical composition for delivery to the eye and/or
surrounding tissue.
Payload Administration Detectable Agents and Therapeutic Agents
[0705] The polynucleotides, primary constructs or mmRNA described
herein can be used in a number of different scenarios in which
delivery of a substance (the "payload") to a biological target is
desired, for example delivery of detectable substances for
detection of the target, or delivery of a therapeutic agent.
Detection methods can include, but are not limited to, both imaging
in vitro and in vivo imaging methods, e.g., immunohistochemistry,
bioluminescence imaging (BLI), Magnetic Resonance Imaging (MRI),
positron emission tomography (PET), electron microscopy, X-ray
computed tomography, Raman imaging, optical coherence tomography,
absorption imaging, thermal imaging, fluorescence reflectance
imaging, fluorescence microscopy, fluorescence molecular
tomographic imaging, nuclear magnetic resonance imaging, X-ray
imaging, ultrasound imaging, photoacoustic imaging, lab assays, or
in any situation where tagging/staining/imaging is required.
[0706] The polynucleotides, primary constructs or mmRNA can be
designed to include both a linker and a payload in any useful
orientation. For example, a linker having two ends is used to
attach one end to the payload and the other end to the nucleobase,
such as at the C-7 or C-8 positions of the deaza-adenosine or
deaza-guanosine or to the N-3 or C-5 positions of cytosine or
uracil. The polynucleotide of the invention can include more than
one payload (e.g., a label and a transcription inhibitor), as well
as a cleavable linker. In one embodiment, the modified nucleotide
is a modified 7-deaza-adenosine triphosphate, where one end of a
cleavable linker is attached to the C7 position of 7-deaza-adenine,
the other end of the linker is attached to an inhibitor (e.g., to
the C5 position of the nucleobase on a cytidine), and a label
(e.g., Cy5) is attached to the center of the linker (see, e.g.,
compound 1 of A*pCp C5 Parg Capless in FIG. 5 and columns 9 and 10
of U.S. Pat. No. 7,994,304, incorporated herein by reference). Upon
incorporation of the modified 7-deaza-adenosine triphosphate to an
encoding region, the resulting polynucleotide having a cleavable
linker attached to a label and an inhibitor (e.g., a polymerase
inhibitor). Upon cleavage of the linker (e.g., with reductive
conditions to reduce a linker having a cleavable disulfide moiety),
the label and inhibitor are released. Additional linkers and
payloads (e.g., therapeutic agents, detectable labels, and cell
penetrating payloads) are described herein.
[0707] Scheme 12 below depicts an exemplary modified nucleotide
wherein the nucleobase, adenine, is attached to a linker at the C-7
carbon of 7-deaza adenine. In addition, Scheme 12 depicts the
modified nucleotide with the linker and payload, e.g., a detectable
agent, incorporated onto the 3' end of the mRNA. Disulfide cleavage
and 1,2-addition of the thiol group onto the propargyl ester
releases the detectable agent. The remaining structure (depicted,
for example, as pApC5Parg in Scheme 12) is the inhibitor. The
rationale for the structure of the modified nucleotides is that the
tethered inhibitor sterically interferes with the ability of the
polymerase to incorporate a second base. Thus, it is critical that
the tether be long enough to affect this function and that the
inhibitor be in a stereochemical orientation that inhibits or
prohibits second and follow on nucleotides into the growing
polynucleotide strand.
##STR00131## ##STR00132##
[0708] For example, the polynucleotides, primary constructs or
mmRNA described herein can be used in reprogramming induced
pluripotent stem cells (iPS cells), which can directly track cells
that are transfected compared to total cells in the cluster. In
another example, a drug that may be attached to the
polynucleotides, primary constructs or mmRNA via a linker and may
be fluorescently labeled can be used to track the drug in vivo,
e.g. intracellularly. Other examples include, but are not limited
to, the use of a polynucleotides, primary constructs or mmRNA in
reversible drug delivery into cells.
[0709] The polynucleotides, primary constructs or mmRNA described
herein can be used in intracellular targeting of a payload, e.g.,
detectable or therapeutic agent, to specific organelle. Exemplary
intracellular targets can include, but are not limited to, the
nuclear localization for advanced mRNA processing, or a nuclear
localization sequence (NLS) linked to the mRNA containing an
inhibitor.
[0710] In addition, the polynucleotides, primary constructs or
mmRNA described herein can be used to deliver therapeutic agents to
cells or tissues, e.g., in living animals. For example, the
polynucleotides, primary constructs or mmRNA described herein can
be used to deliver highly polar chemotherapeutics agents to kill
cancer cells. The polynucleotides, primary constructs or mmRNA
attached to the therapeutic agent through a linker can facilitate
member permeation allowing the therapeutic agent to travel into a
cell to reach an intracellular target.
[0711] In one example, the linker is attached at the 2'-position of
the ribose ring and/or at the 3' and/or 5' position of the
polynucleotides, primary constructs mmRNA (See e.g., International
Pub. No. WO2012030683, herein incorporated by reference in its
entirety). The linker may be any linker disclosed herein, known in
the art and/or disclosed in International Pub. No. WO2012030683,
herein incorporated by reference in its entirety.
[0712] In another example, the polynucleotides, primary constructs
or mmRNA can be attached to the polynucleotides, primary constructs
or mmRNA a viral inhibitory peptide (VIP) through a cleavable
linker. The cleavable linker can release the VIP and dye into the
cell. In another example, the polynucleotides, primary constructs
or mmRNA can be attached through the linker to an ADP-ribosylate,
which is responsible for the actions of some bacterial toxins, such
as cholera toxin, diphtheria toxin, and pertussis toxin. These
toxin proteins are ADP-ribosyltransferases that modify target
proteins in human cells. For example, cholera toxin ADP-ribosylates
G proteins modifies human cells by causing massive fluid secretion
from the lining of the small intestine, which results in
life-threatening diarrhea.
[0713] In some embodiments, the payload may be a therapeutic agent
such as a cytotoxin, radioactive ion, chemotherapeutic, or other
therapeutic agent. A cytotoxin or cytotoxic agent includes any
agent that may be detrimental to cells. Examples include, but are
not limited to, taxol, cytochalasin B, gramicidin D, ethidium
bromide, emetine, mitomycin, etoposide, teniposide, vincristine,
vinblastine, colchicine, doxorubicin, daunorubicin,
dihydroxyanthracinedione, mitoxantrone, mithramycin, actinomycin D,
1-dehydrotestosterone, glucocorticoids, procaine, tetracaine,
lidocaine, propranolol, puromycin, maytansinoids, e.g., maytansinol
(see U.S. Pat. No. 5,208,020 incorporated herein in its entirety),
rachelmycin (CC-1065, see U.S. Pat. Nos. 5,475,092, 5,585,499, and
5,846,545, all of which are incorporated herein by reference), and
analogs or homologs thereof. Radioactive ions include, but are not
limited to iodine (e.g., iodine 125 or iodine 131), strontium 89,
phosphorous, palladium, cesium, iridium, phosphate, cobalt, yttrium
90, samarium 153, and praseodymium. Other therapeutic agents
include, but are not limited to, antimetabolites (e.g.,
methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine,
5-fluorouracil decarbazine), alkylating agents (e.g.,
mechlorethamine, thiotepa chlorambucil, rachelmycin (CC-1065),
melphalan, carmustine (BSNU), lomustine (CCNU), cyclophosphamide,
busulfan, dibromomannitol, streptozotocin, mitomycin C, and
cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines
(e.g., daunorubicin (formerly daunomycin) and doxorubicin),
antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin,
mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g.,
vincristine, vinblastine, taxol and maytansinoids).
[0714] In some embodiments, the payload may be a detectable agent,
such as various organic small molecules, inorganic compounds,
nanoparticles, enzymes or enzyme substrates, fluorescent materials,
luminescent materials (e.g., luminol), bioluminescent materials
(e.g., luciferase, luciferin, and aequorin), chemiluminescent
materials, radioactive materials (e.g., .sup.18F, .sup.67Ga,
.sup.81mKr, .sup.82Rb, .sup.111In, .sup.123I, .sup.133Xe,
.sup.201Tl, .sup.125I, .sup.35S, .sup.3H, or .sup.99mTc (e.g., as
pertechnetate (technetate(VII), TcO.sub.4.sup.-)), and contrast
agents (e.g., gold (e.g., gold nanoparticles), gadolinium (e.g.,
chelated Gd), iron oxides (e.g., superparamagnetic iron oxide
(SPIO), monocrystalline iron oxide nanoparticles (MIONs), and
ultrasmall superparamagnetic iron oxide (USPIO)), manganese
chelates (e.g., Mn-DPDP), barium sulfate, iodinated contrast media
(iohexyl), microbubbles, or perfluorocarbons). Such
optically-detectable labels include for example, without
limitation, 4-acetamido-4'-isothiocyanatostilbene-2,2' disulfonic
acid; acridine and derivatives (e.g., acridine and acridine
isothiocyanate); 5-(2'-aminoethyl)aminonaphthalene-1-sulfonic acid
(EDANS); 4-amino-N-[3-vinylsulfonyl)phenyl]naphthalimide-3,5
disulfonate; N-(4-anilino-1-naphthyl)maleimide; anthranilamide;
BODIPY; Brilliant Yellow; coumarin and derivatives (e.g., coumarin,
7-amino-4-methylcoumarin (AMC, Coumarin 120), and
7-amino-4-trifluoromethylcoumarin (Coumarin 151)); cyanine dyes;
cyanosine; 4',6-diaminidino-2-phenylindole (DAPI); 5'
5''-dibromopyrogallol-sulfonaphthalein (Bromopyrogallol Red);
7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin;
diethylenetriamine pentaacetate;
4,4'-diisothiocyanatodihydro-stilbene-2,2'-disulfonic acid;
4,4'-diisothiocyanatostilbene-2,2'-disulfonic acid;
5-[dimethylamino]-naphthalene-1-sulfonyl chloride (DNS,
dansylchloride); 4-dimethylaminophenylazophenyl-4'-isothiocyanate
(DABITC); eosin and derivatives (e.g., eosin and eosin
isothiocyanate); erythrosin and derivatives (e.g., erythrosin B and
erythrosin isothiocyanate); ethidium; fluorescein and derivatives
(e.g., 5-carboxyfluorescein (FAM),
5-(4,6-dichlorotriazin-2-yl)aminofluorescein (DTAF),
2',7'-dimethoxy-4'5'-dichloro-6-carboxyfluorescein, fluorescein,
fluorescein isothiocyanate, X-rhodamine-5-(and -6)-isothiocyanate
(QFITC or XRITC), and fluorescamine);
2-[2-[3-[[1,3-dihydro-1,1-dimethyl-3-(3-sulfopropyl)-2H-benz[e]indol-2-yl-
idene]ethylidene]-2-[4-(ethoxycarbonyl)-1-piperazinyl]-1-cyclopenten-1-yl]-
ethenyl]-1,1-dimethyl-3-(3-sulforpropyl)-1H-benz[e]indolium
hydroxide, inner salt, compound with n,n-diethylethanamine (1:1)
(IR144);
5-chloro-2-[2-[3-[(5-chloro-3-ethyl-2(3H)-benzothiazol-ylidene)ethylidene-
]-2-(diphenylamino)-1-cyclopenten-1-yl]ethenyl]-3-ethyl
benzothiazolium perchlorate (IR140); Malachite Green
isothiocyanate; 4-methylumbelliferone orthocresolphthalein;
nitrotyrosine; pararosaniline; Phenol Red; B-phycoerythrin;
o-phthaldialdehyde; pyrene and derivatives (e.g., pyrene, pyrene
butyrate, and succinimidyl 1-pyrene); butyrate quantum dots;
Reactive Red 4 (CIBACRON.TM. Brilliant Red 3B-A); rhodamine and
derivatives (e.g., 6-carboxy-X-rhodamine (ROX), 6-carboxyrhodamine
(R6G), lissamine rhodamine B sulfonyl chloride rhodamine (Rhod),
rhodamine B, rhodamine 123, rhodamine X isothiocyanate,
sulforhodamine B, sulforhodamine 101, sulfonyl chloride derivative
of sulforhodamine 101 (Texas Red),
N,N,N',N'tetramethyl-6-carboxyrhodamine (TAMRA) tetramethyl
rhodamine, and tetramethyl rhodamine isothiocyanate (TRITC));
riboflavin; rosolic acid; terbium chelate derivatives; Cyanine-3
(Cy3); Cyanine-5 (Cy5); cyanine-5.5 (Cy5.5), Cyanine-7 (Cy7); IRD
700; IRD 800; Alexa 647; La Jolta Blue; phthalo cyanine; and
naphthalo cyanine.
[0715] In some embodiments, the detectable agent may be a
non-detectable pre-cursor that becomes detectable upon activation
(e.g., fluorogenic tetrazine-fluorophore constructs (e.g.,
tetrazine-BODIPY FL, tetrazine-Oregon Green 488, or
tetrazine-BODIPY TMR-X) or enzyme activatable fluorogenic agents
(e.g., PROSENSE.RTM. (VisEn Medical))). In vitro assays in which
the enzyme labeled compositions can be used include, but are not
limited to, enzyme linked immunosorbent assays (ELISAs),
immunoprecipitation assays, immunofluorescence, enzyme immunoassays
(EIA), radioimmunoassays (RIA), and Western blot analysis.
Combinations
[0716] The polynucleotides, primary constructs or mmRNA may be used
in combination with one or more other therapeutic, prophylactic,
diagnostic, or imaging agents. By "in combination with," it is not
intended to imply that the agents must be administered at the same
time and/or formulated for delivery together, although these
methods of delivery are within the scope of the present disclosure.
Compositions can be administered concurrently with, prior to, or
subsequent to, one or more other desired therapeutics or medical
procedures. In general, each agent will be administered at a dose
and/or on a time schedule determined for that agent. In some
embodiments, the present disclosure encompasses the delivery of
pharmaceutical, prophylactic, diagnostic, or imaging compositions
in combination with agents that may improve their bioavailability,
reduce and/or modify their metabolism, inhibit their excretion,
and/or modify their distribution within the body. As a non-limiting
example, the nucleic acids or mmRNA may be used in combination with
a pharmaceutical agent for the treatment of cancer or to control
hyperproliferative cells. In U.S. Pat. No. 7,964,571, herein
incorporated by reference in its entirety, a combination therapy
for the treatment of solid primary or metastasized tumor is
described using a pharmaceutical composition including a DNA
plasmid encoding for interleukin-12 with a lipopolymer and also
administering at least one anticancer agent or chemotherapeutic.
Further, the nucleic acids and mmRNA of the present invention that
encodes anti-proliferative molecules may be in a pharmaceutical
composition with a lipopolymer (see e.g., U.S. Pub. No.
20110218231, herein incorporated by reference in its entirety,
claiming a pharmaceutical composition comprising a DNA plasmid
encoding an anti-proliferative molecule and a lipopolymer) which
may be administered with at least one chemotherapeutic or
anticancer agent.
[0717] It will further be appreciated that therapeutically,
prophylactically, diagnostically, or imaging active agents utilized
in combination may be administered together in a single composition
or administered separately in different compositions. In general,
it is expected that agents utilized in combination with be utilized
at levels that do not exceed the levels at which they are utilized
individually. In some embodiments, the levels utilized in
combination will be lower than those utilized individually. In one
embodiment, the combinations, each or together may be administered
according to the split dosing regimens described herein.
Dosing
[0718] The present invention provides methods comprising
administering modified mRNAs and their encoded proteins or
complexes in accordance with the invention to a subject in need
thereof. Nucleic acids, proteins or complexes, or pharmaceutical,
imaging, diagnostic, or prophylactic compositions thereof, may be
administered to a subject using any amount and any route of
administration effective for preventing, treating, diagnosing, or
imaging a disease, disorder, and/or condition (e.g., a disease,
disorder, and/or condition relating to working memory deficits).
The exact amount required will vary from subject to subject,
depending on the species, age, and general condition of the
subject, the severity of the disease, the particular composition,
its mode of administration, its mode of activity, and the like.
Compositions in accordance with the invention are typically
formulated in dosage unit form for ease of administration and
uniformity of dosage. It will be understood, however, that the
total daily usage of the compositions of the present invention may
be decided by the attending physician within the scope of sound
medical judgment. The specific therapeutically effective,
prophylactically effective, or appropriate imaging dose level for
any particular patient will depend upon a variety of factors
including the disorder being treated and the severity of the
disorder; the activity of the specific compound employed; the
specific composition employed; the age, body weight, general
health, sex and diet of the patient; the time of administration,
route of administration, and rate of excretion of the specific
compound employed; the duration of the treatment; drugs used in
combination or coincidental with the specific compound employed;
and like factors well known in the medical arts.
[0719] In certain embodiments, compositions in accordance with the
present invention may be administered at dosage levels sufficient
to deliver from about 0.0001 mg/kg to about 100 mg/kg, from about
0.001 mg/kg to about 0.05 mg/kg, from about 0.005 mg/kg to about
0.05 mg/kg, from about 0.001 mg/kg to about 0.005 mg/kg, from about
0.05 mg/kg to about 0.5 mg/kg, from about 0.01 mg/kg to about 50
mg/kg, from about 0.1 mg/kg to about 40 mg/kg, from about 0.5 mg/kg
to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from
about 0.1 mg/kg to about 10 mg/kg, or from about 1 mg/kg to about
25 mg/kg, of subject body weight per day, one or more times a day,
to obtain the desired therapeutic, diagnostic, prophylactic, or
imaging effect. The desired dosage may be delivered three times a
day, two times a day, once a day, every other day, every third day,
every week, every two weeks, every three weeks, or every four
weeks. In certain embodiments, the desired dosage may be delivered
using multiple administrations (e.g., two, three, four, five, six,
seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or
more administrations). When multiple administrations are employed,
split dosing regimens such as those described herein may be
used.
[0720] According to the present invention, it has been discovered
that administration of mmRNA in split-dose regimens produce higher
levels of proteins in mammalian subjects. As used herein, a "split
dose" is the division of single unit dose or total daily dose into
two or more doses, e.g, two or more administrations of the single
unit dose. As used herein, a "single unit dose" is a dose of any
therapeutic administed in one dose/at one time/single route/single
point of contact, i.e., single administration event. As used
herein, a "total daily dose" is an amount given or prescribed in 24
hr period. It may be administered as a single unit dose. In one
embodiment, the mmRNA of the present invention are administed to a
subject in split doses. The mmRNA may be formulated in buffer only
or in a formulation described herein.
Dosage Forms
[0721] A pharmaceutical composition described herein can be
formulated into a dosage form described herein, such as a topical,
intranasal, intratracheal, or injectable (e.g., intravenous,
intraocular, intravitreal, intramuscular, intracardiac,
intraperitoneal, subcutaneous).
Liquid Dosage Forms
[0722] Liquid dosage forms for parenteral administration include,
but are not limited to, pharmaceutically acceptable emulsions,
microemulsions, solutions, suspensions, syrups, and/or elixirs. In
addition to active ingredients, liquid dosage forms may comprise
inert diluents commonly used in the art including, but not limited
to, water or other solvents, solubilizing agents and emulsifiers
such as ethyl alcohol, isopropyl alcohol, ethyl carbonate, ethyl
acetate, benzyl alcohol, benzyl benzoate, propylene glycol,
1,3-butylene glycol, dimethylformamide, oils (in particular,
cottonseed, groundnut, corn, germ, olive, castor, and sesame oils),
glycerol, tetrahydrofurfuryl alcohol, polyethylene glycols and
fatty acid esters of sorbitan, and mixtures thereof. In certain
embodiments for parenteral administration, compositions may be
mixed with solubilizing agents such as CREMOPHOR.RTM., alcohols,
oils, modified oils, glycols, polysorbates, cyclodextrins,
polymers, and/or combinations thereof.
Injectable
[0723] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions may be formulated according to
the known art and may include suitable dispersing agents, wetting
agents, and/or suspending agents. Sterile injectable preparations
may be sterile injectable solutions, suspensions, and/or emulsions
in nontoxic parenterally acceptable diluents and/or solvents, for
example, a solution in 1,3-butanediol. Among the acceptable
vehicles and solvents that may be employed include, but are not
limited to, water, Ringer's solution, U.S.P., and isotonic sodium
chloride solution. Sterile, fixed oils are conventionally employed
as a solvent or suspending medium. For this purpose any bland fixed
oil can be employed including synthetic mono- or diglycerides.
Fatty acids such as oleic acid can be used in the preparation of
injectables.
Injectable formulations can be sterilized, for example, by
filtration through a bacterial-retaining filter, and/or by
incorporating sterilizing agents in the form of sterile solid
compositions which can be dissolved or dispersed in sterile water
or other sterile injectable medium prior to use. In order to
prolong the effect of an active ingredient, it may be desirable to
slow the absorption of the active ingredient from subcutaneous or
intramuscular injection. This may be accomplished by the use of a
liquid suspension of crystalline or amorphous material with poor
water solubility. The rate of absorption of the polynucleotide,
primary construct or mmRNA then depends upon its rate of
dissolution which, in turn, may depend upon crystal size and
crystalline form. Alternatively, delayed absorption of a
parenterally administered polynucleotide, primary construct or
mmRNA may be accomplished by dissolving or suspending the
polynucleotide, primary construct or mmRNA in an oil vehicle.
Injectable depot forms are made by forming microencapsule matrices
of the polynucleotide, primary construct or mmRNA in biodegradable
polymers such as polylactide-polyglycolide. Depending upon the
ratio of polynucleotide, primary construct or mmRNA to polymer and
the nature of the particular polymer employed, the rate of
polynucleotide, primary construct or mmRNA release can be
controlled. Examples of other biodegradable polymers include, but
are not limited to, poly(orthoesters) and poly(anhydrides). Depot
injectable formulations may be prepared by entrapping the
polynucleotide, primary construct or mmRNA in liposomes or
microemulsions which are compatible with body tissues.
Pulmonary
[0724] Formulations described herein as being useful for pulmonary
delivery may also be used for intranasal delivery of a
pharmaceutical composition. Another formulation suitable for
intranasal administration may be a coarse powder comprising the
active ingredient and having an average particle from about 0.2
.mu.m to 500 .mu.m. Such a formulation may be administered in the
manner in which snuff is taken, i.e. by rapid inhalation through
the nasal passage from a container of the powder held close to the
nose.
[0725] Formulations suitable for nasal administration may, for
example, comprise from about as little as 0.1% (w/w) and as much as
100% (w/w) of active ingredient, and may comprise one or more of
the additional ingredients described herein. A pharmaceutical
composition may be prepared, packaged, and/or sold in a formulation
suitable for buccal administration. Such formulations may, for
example, be in the form of tablets and/or lozenges made using
conventional methods, and may, for example, contain about 0.1% to
20% (w/w) active ingredient, where the balance may comprise an
orally dissolvable and/or degradable composition and, optionally,
one or more of the additional ingredients described herein.
Alternately, formulations suitable for buccal administration may
comprise a powder and/or an aerosolized and/or atomized solution
and/or suspension comprising active ingredient. Such powdered,
aerosolized, and/or aerosolized formulations, when dispersed, may
have an average particle and/or droplet size in the range from
about 0.1 nm to about 200 nm, and may further comprise one or more
of any additional ingredients described herein.
[0726] General considerations in the formulation and/or manufacture
of pharmaceutical agents may be found, for example, in Remington:
The Science and Practice of Pharmacy 21.sup.st ed., Lippincott
Williams & Wilkins, 2005 (incorporated herein by reference in
its entirety).
Coatings or Shells
[0727] Solid dosage forms of tablets, dragees, capsules, pills, and
granules can be prepared with coatings and shells such as enteric
coatings and other coatings well known in the pharmaceutical
formulating art. They may optionally comprise opacifying agents and
can be of a composition that they release the active ingredient(s)
only, or preferentially, in a certain part of the intestinal tract,
optionally, in a delayed manner. Examples of embedding compositions
which can be used include polymeric substances and waxes. Solid
compositions of a similar type may be employed as fillers in soft
and hard-filled gelatin capsules using such excipients as lactose
or milk sugar as well as high molecular weight polyethylene glycols
and the like.
Properties of Pharmaceutical Compositions
[0728] The pharmaceutical compositions described herein can be
characterized by one or more of bioavailability, therapeutic window
and/or volume of distribution.
Bioavailability
[0729] The polynucleotides, primary constructs or mmRNA, when
formulated into a composition with a delivery agent as described
herein, can exhibit an increase in bioavailability as compared to a
composition lacking a delivery agent as described herein. As used
herein, the term "bioavailability" refers to the systemic
availability of a given amount of polynucleotides, primary
constructs or mmRNA administered to a mammal. Bioavailability can
be assessed by measuring the area under the curve (AUC) or the
maximum serum or plasma concentration (C.sub.max) of the unchanged
form of a compound following administration of the compound to a
mammal. AUC is a determination of the area under the curve plotting
the serum or plasma concentration of a compound along the ordinate
(Y-axis) against time along the abscissa (X-axis). Generally, the
AUC for a particular compound can be calculated using methods known
to those of ordinary skill in the art and as described in G. S.
Banker, Modern Pharmaceutics, Drugs and the Pharmaceutical
Sciences, v. 72, Marcel Dekker, New York, Inc., 1996, herein
incorporated by reference in its entirety.
[0730] The C.sub.max value is the maximum concentration of the
compound achieved in the serum or plasma of a mammal following
administration of the compound to the mammal. The C.sub.max value
of a particular compound can be measured using methods known to
those of ordinary skill in the art. The phrases "increasing
bioavailability" or "improving the pharmacokinetics," as used
herein mean that the systemic availability of a first
polynucleotide, primary construct or mmRNA, measured as AUC,
C.sub.max, or C.sub.min in a mammal is greater, when
co-administered with a delivery agent as described herein, than
when such co-administration does not take place. In some
embodiments, the bioavailability of the polynucleotide, primary
construct or mmRNA can increase by at least about 2%, at least
about 5%, at least about 10%, at least about 15%, at least about
20%, at least about 25%, at least about 30%, at least about 35%, at
least about 40%, at least about 45%, at least about 50%, at least
about 55%, at least about 60%, at least about 65%, at least about
70%, at least about 75%, at least about 80%, at least about 85%, at
least about 90%, at least about 95%, or about 100%.
Therapeutic Window
[0731] The polynucleotides, primary constructs or mmRNA, when
formulated into a composition with a delivery agent as described
herein, can exhibit an increase in the therapeutic window of the
administered polynucleotide, primary construct or mmRNA composition
as compared to the therapeutic window of the administered
polynucleotide, primary construct or mmRNA composition lacking a
delivery agent as described herein. As used herein "therapeutic
window" refers to the range of plasma concentrations, or the range
of levels of therapeutically active substance at the site of
action, with a high probability of eliciting a therapeutic effect.
In some embodiments, the therapeutic window of the polynucleotide,
primary construct or mmRNA when co-administered with a delivery
agent as described herein can increase by at least about 2%, at
least about 5%, at least about 10%, at least about 15%, at least
about 20%, at least about 25%, at least about 30%, at least about
35%, at least about 40%, at least about 45%, at least about 50%, at
least about 55%, at least about 60%, at least about 65%, at least
about 70%, at least about 75%, at least about 80%, at least about
85%, at least about 90%, at least about 95%, or about 100%.
Volume of Distribution
[0732] The polynucleotides, primary constructs or mmRNA, when
formulated into a composition with a delivery agent as described
herein, can exhibit an improved volume of distribution
(V.sub.dist), e.g., reduced or targeted, relative to a composition
lacking a delivery agent as described herein. The volume of
distribution (Vdist) relates the amount of the drug in the body to
the concentration of the drug in the blood or plasma. As used
herein, the term "volume of distribution" refers to the fluid
volume that would be required to contain the total amount of the
drug in the body at the same concentration as in the blood or
plasma: Vdist equals the amount of drug in the body/concentration
of drug in blood or plasma. For example, for a 10 mg dose and a
plasma concentration of 10 mg/L, the volume of distribution would
be 1 liter. The volume of distribution reflects the extent to which
the drug is present in the extravascular tissue. A large volume of
distribution reflects the tendency of a compound to bind to the
tissue components compared with plasma protein binding. In a
clinical setting, Vdist can be used to determine a loading dose to
achieve a steady state concentration. In some embodiments, the
volume of distribution of the polynucleotide, primary construct or
mmRNA when co-administered with a delivery agent as described
herein can decrease at least about 2%, at least about 5%, at least
about 10%, at least about 15%, at least about 20%, at least about
25%, at least about 30%, at least about 35%, at least about 40%, at
least about 45%, at least about 50%, at least about 55%, at least
about 60%, at least about 65%, at least about 70%.
Biological Effect
[0733] In one embodiment, the biological effect of the modified
mRNA delivered to the animals may be categorized by analyzing the
protein expression in the animals. The protein expression may be
determined from analyzing a biological sample collected from a
mammal administered the modified mRNA of the present invention. In
one embodiment, the expression protein encoded by the modified mRNA
administered to the mammal of at least 50 pg/ml may be preferred.
For example, a protein expression of 50-200 pg/ml for the protein
encoded by the modified mRNA delivered to the mammal may be seen as
a therapeutically effective amount of protein in the mammal.
Detection of Modified Nucleic Acids by Mass Spectrometry
[0734] Mass spectrometry (MS) is an analytical technique that can
provide structural and molecular mass/concentration information on
molecules after their conversion to ions. The molecules are first
ionized to acquire positive or negative charges and then they
travel through the mass analyzer to arrive at different areas of
the detector according to their mass/charge (m/z) ratio.
[0735] Mass spectrometry is performed using a mass spectrometer
which includes an ion source for ionizing the fractionated sample
and creating charged molecules for further analysis. For example
ionization of the sample may be performed by electrospray
ionization (ESI), atmospheric pressure chemical ionization (APCI),
photoionization, electron ionization, fast atom bombardment
(FAB)/liquid secondary ionization (LSIMS), matrix assisted laser
desorption/ionization (MALDI), field ionization, field desorption,
thermospray/plasmaspray ionization, and particle beam ionization.
The skilled artisan will understand that the choice of ionization
method can be determined based on the analyte to be measured, type
of sample, the type of detector, the choice of positive versus
negative mode, etc.
[0736] After the sample has been ionized, the positively charged or
negatively charged ions thereby created may be analyzed to
determine a mass-to-charge ratio (i.e., m/z). Suitable analyzers
for determining mass-to-charge ratios include quadropole analyzers,
ion traps analyzers, and time-of-flight analyzers. The ions may be
detected using several detection modes. For example, selected ions
may be detected (i.e., using a selective ion monitoring mode
(SIM)), or alternatively, ions may be detected using a scanning
mode, e.g., multiple reaction monitoring (MRM) or selected reaction
monitoring (SRM).
[0737] Liquid chromatography-multiple reaction monitoring
(LC-MS/MRM) coupled with stable isotope labeled dilution of peptide
standards has been shown to be an effective method for protein
verification (e.g., Keshishian et al., Mol Cell Proteomics 2009 8:
2339-2349; Kuhn et al., Clin Chem 2009 55:1108-1117; Lopez et al.,
Clin Chem 2010 56:281-290; each of which are herein incorporated by
reference in its entirety). Unlike untargeted mass spectrometry
frequently used in biomarker discovery studies, targeted MS methods
are peptide sequence-based modes of MS that focus the full
analytical capacity of the instrument on tens to hundreds of
selected peptides in a complex mixture. By restricting detection
and fragmentation to only those peptides derived from proteins of
interest, sensitivity and reproducibility are improved dramatically
compared to discovery-mode MS methods. This method of mass
spectrometry-based multiple reaction monitoring (MRM) quantitation
of proteins can dramatically impact the discovery and quantitation
of biomarkers via rapid, targeted, multiplexed protein expression
profiling of clinical samples.
[0738] In one embodiment, a biological sample which may contain at
least one protein encoded by at least one modified mRNA of the
present invention may be analyzed by the method of MRM-MS. The
quantification of the biological sample may further include, but is
not limited to, isotopically labeled peptides or proteins as
internal standards.
[0739] According to the present invention, the biological sample,
once obtained from the subject, may be subjected to enzyme
digestion. As used herein, the term "digest" means to break apart
into shorter peptides. As used herein, the phrase "treating a
sample to digest proteins" means manipulating a sample in such a
way as to break down proteins in a sample. These enzymes include,
but are not limited to, trypsin, endoproteinase Glu-C and
chymotrypsin. In one embodiment, a biological sample which may
contain at least one protein encoded by at least one modified mRNA
of the present invention may be digested using enzymes.
[0740] In one embodiment, a biological sample which may contain
protein encoded by modified mRNA of the present invention may be
analyzed for protein using electrospray ionization. Electrospray
ionization (ESI) mass spectrometry (ESIMS) uses electrical energy
to aid in the transfer of ions from the solution to the gaseous
phase before they are analyzed by mass spectrometry. Samples may be
analyzed using methods known in the art (e.g., Ho et al., Clin
Biochem Rev. 2003 24(1):3-12; herein incorporated by reference in
its entirety). The ionic species contained in solution may be
transferred into the gas phase by dispersing a fine spray of charge
droplets, evaporating the solvent and ejecting the ions from the
charged droplets to generate a mist of highly charged droplets. The
mist of highly charged droplets may be analyzed using at least 1,
at least 2, at least 3 or at least 4 mass analyzers such as, but
not limited to, a quadropole mass analyzer. Further, the mass
spectrometry method may include a purification step. As a
non-limiting example, the first quadrapole may be set to select a
single m/z ratio so it may filter out other molecular ions having a
different m/z ratio which may eliminate complicated and
time-consuming sample purification procedures prior to MS
analysis.
[0741] In one embodiment, a biological sample which may contain
protein encoded by modified mRNA of the present invention may be
analyzed for protein in a tandem ESIMS system (e.g., MS/MS). As
non-limiting examples, the droplets may be analyzed using a product
scan (or daughter scan) a precursor scan (parent scan) a neutral
loss or a multiple reaction monitoring.
[0742] In one embodiment, a biological sample which may contain
protein encoded by modified mRNA of the present invention may be
analyzed using matrix-assisted laser desorption/ionization (MALDI)
mass spectrometry (MALDIMS). MALDI provides for the nondestructive
vaporization and ionization of both large and small molecules, such
as proteins. In MALDI analysis, the analyte is first
co-crystallized with a large molar excess of a matrix compound,
which may also include, but is not limited to, an ultraviolet
absorbing weak organic acid. Non-limiting examples of matrices used
in MALDI are .alpha.-cyano-4-hydroxycinnamic acid,
3,5-dimethoxy-4-hydroxycinnamic acid and 2,5-dihydroxybenzoic acid.
Laser radiation of the analyte-matrix mixture may result in the
vaporization of the matrix and the analyte. The laser induced
desorption provides high ion yields of the intact analyte and
allows for measurement of compounds with high accuracy. Samples may
be analyzed using methods known in the art (e.g., Lewis, Wei and
Siuzdak, Encyclopedia of Analytical Chemistry 2000:5880-5894;
herein incorporated by reference in its entirety). As non-limiting
examples, mass analyzers used in the MALDI analysis may include a
linear time-of-flight (TOF), a TOF reflectron or a Fourier
transform mass analyzer.
[0743] In one embodiment, the analyte-matrix mixture may be formed
using the dried-droplet method. A biologic sample is mixed with a
matrix to create a saturated matrix solution where the
matrix-to-sample ratio is approximately 5000:1. An aliquot
(approximately 0.5-2.0 uL) of the saturated matrix solution is then
allowed to dry to form the analyte-matrix mixture.
[0744] In one embodiment, the analyte-matrix mixture may be formed
using the thin-layer method. A matrix homogeneous film is first
formed and then the sample is then applied and may be absorbed by
the matrix to form the analyte-matrix mixture.
[0745] In one embodiment, the analyte-matrix mixture may be formed
using the thick-layer method. A matrix homogeneous film is formed
with a nitro-cellulose matrix additive. Once the uniform
nitro-cellulose matrix layer is obtained the sample is applied and
absorbed into the matrix to form the analyte-matrix mixture.
[0746] In one embodiment, the analyte-matrix mixture may be formed
using the sandwich method. A thin layer of matrix crystals is
prepared as in the thin-layer method followed by the addition of
droplets of aqueous trifluoroacetic acid, the sample and matrix.
The sample is then absorbed into the matrix to form the
analyte-matrix mixture.
V. USES OF POLYNUCLEOTIDES, PRIMARY CONSTRUCTS AND mmRNA OF THE
INVENTION
[0747] The polynucleotides, primary constructs and mmRNA of the
present invention are designed, in preferred embodiments, to
provide for avoidance or evasion of deleterious bio-responses such
as the immune response and/or degradation pathways, overcoming the
threshold of expression and/or improving protein production
capacity, improved expression rates or translation efficiency,
improved drug or protein half life and/or protein concentrations,
optimized protein localization, to improve one or more of the
stability and/or clearance in tissues, receptor uptake and/or
kinetics, cellular access by the compositions, engagement with
translational machinery, secretion efficiency (when applicable),
accessibility to circulation, and/or modulation of a cell's status,
function and/or activity.
Therapeutics
Therapeutic Agents
[0748] The polynucleotides, primary constructs or mmRNA of the
present invention, such as modified nucleic acids and modified
RNAs, and the proteins translated from them described herein can be
used as therapeutic or prophylactic agents. They are provided for
use in medicine. For example, a polynucleotide, primary construct
or mmRNA described herein can be administered to a subject, wherein
the polynucleotide, primary construct or mmRNA is translated in
vivo to produce a therapeutic or prophylactic polypeptide in the
subject. Provided are compositions, methods, kits, and reagents for
diagnosis, treatment or prevention of a disease or condition in
humans and other mammals. The active therapeutic agents of the
invention include polynucleotides, primary constructs or mmRNA,
cells containing polynucleotides, primary constructs or mmRNA or
polypeptides translated from the polynucleotides, primary
constructs or mmRNA.
[0749] In certain embodiments, provided herein are combination
therapeutics containing one or more polynucleotide, primary
construct or mmRNA containing translatable regions that encode for
a protein or proteins that boost a mammalian subject's immunity
along with a protein that induces antibody-dependent cellular
toxicity. For example, provided herein are therapeutics containing
one or more nucleic acids that encode trastuzumab and
granulocyte-colony stimulating factor (G-CSF). In particular, such
combination therapeutics are useful in Her2+ breast cancer patients
who develop induced resistance to trastuzumab. (See, e.g.,
Albrecht, Immunotherapy. 2(6):795-8 (2010)).
[0750] Provided herein are methods of inducing translation of a
recombinant polypeptide in a cell population using the
polynucleotide, primary construct or mmRNA described herein. Such
translation can be in vivo, ex vivo, in culture, or in vitro. The
cell population is contacted with an effective amount of a
composition containing a nucleic acid that has at least one
nucleoside modification, and a translatable region encoding the
recombinant polypeptide. The population is contacted under
conditions such that the nucleic acid is localized into one or more
cells of the cell population and the recombinant polypeptide is
translated in the cell from the nucleic acid.
[0751] An "effective amount" of the composition is provided based,
at least in part, on the target tissue, target cell type, means of
administration, physical characteristics of the nucleic acid (e.g.,
size, and extent of modified nucleosides), and other determinants.
In general, an effective amount of the composition provides
efficient protein production in the cell, preferably more efficient
than a composition containing a corresponding unmodified nucleic
acid. Increased efficiency may be demonstrated by increased cell
transfection (i.e., the percentage of cells transfected with the
nucleic acid), increased protein translation from the nucleic acid,
decreased nucleic acid degradation (as demonstrated, e.g., by
increased duration of protein translation from a modified nucleic
acid), or reduced innate immune response of the host cell.
[0752] Aspects of the invention are directed to methods of inducing
in vivo translation of a recombinant polypeptide in a mammalian
subject in need thereof. Therein, an effective amount of a
composition containing a nucleic acid that has at least one
structural or chemical modification and a translatable region
encoding the recombinant polypeptide is administered to the subject
using the delivery methods described herein. The nucleic acid is
provided in an amount and under other conditions such that the
nucleic acid is localized into a cell of the subject and the
recombinant polypeptide is translated in the cell from the nucleic
acid. The cell in which the nucleic acid is localized, or the
tissue in which the cell is present, may be targeted with one or
more than one rounds of nucleic acid administration.
[0753] In certain embodiments, the administered polynucleotide,
primary construct or mmRNA directs production of one or more
recombinant polypeptides that provide a functional activity which
is substantially absent in the cell, tissue or organism in which
the recombinant polypeptide is translated. For example, the missing
functional activity may be enzymatic, structural, or gene
regulatory in nature. In related embodiments, the administered
polynucleotide, primary construct or mmRNA directs production of
one or more recombinant polypeptides that increases (e.g.,
synergistically) a functional activity which is present but
substantially deficient in the cell in which the recombinant
polypeptide is translated.
[0754] In other embodiments, the administered polynucleotide,
primary construct or mmRNA directs production of one or more
recombinant polypeptides that replace a polypeptide (or multiple
polypeptides) that is substantially absent in the cell in which the
recombinant polypeptide is translated. Such absence may be due to
genetic mutation of the encoding gene or regulatory pathway
thereof. In some embodiments, the recombinant polypeptide increases
the level of an endogenous protein in the cell to a desirable
level; such an increase may bring the level of the endogenous
protein from a subnormal level to a normal level or from a normal
level to a super-normal level.
[0755] Alternatively, the recombinant polypeptide functions to
antagonize the activity of an endogenous protein present in, on the
surface of, or secreted from the cell. Usually, the activity of the
endogenous protein is deleterious to the subject; for example, due
to mutation of the endogenous protein resulting in altered activity
or localization. Additionally, the recombinant polypeptide
antagonizes, directly or indirectly, the activity of a biological
moiety present in, on the surface of, or secreted from the cell.
Examples of antagonized biological moieties include lipids (e.g.,
cholesterol), a lipoprotein (e.g., low density lipoprotein), a
nucleic acid, a carbohydrate, a protein toxin such as shiga and
tetanus toxins, or a small molecule toxin such as botulinum,
cholera, and diphtheria toxins. Additionally, the antagonized
biological molecule may be an endogenous protein that exhibits an
undesirable activity, such as a cytotoxic or cytostatic
activity.
[0756] The recombinant proteins described herein may be engineered
for localization within the cell, potentially within a specific
compartment such as the nucleus, or are engineered for secretion
from the cell or translocation to the plasma membrane of the
cell.
[0757] In some embodiments, modified mRNAs and their encoded
polypeptides in accordance with the present invention may be used
for treatment of any of a variety of diseases, disorders, and/or
conditions, including but not limited to one or more of the
following: autoimmune disorders (e.g. diabetes, lupus, multiple
sclerosis, psoriasis, rheumatoid arthritis); inflammatory disorders
(e.g. arthritis, pelvic inflammatory disease); infectious diseases
(e.g. viral infections (e.g., HIV, HCV, RSV), bacterial infections,
fungal infections, sepsis); neurological disorders (e.g.
Alzheimer's disease, Huntington's disease; autism; Duchenne
muscular dystrophy); cardiovascular disorders (e.g.
atherosclerosis, hypercholesterolemia, thrombosis, clotting
disorders, angiogenic disorders such as macular degeneration);
proliferative disorders (e.g. cancer, benign neoplasms);
respiratory disorders (e.g. chronic obstructive pulmonary disease);
digestive disorders (e.g. inflammatory bowel disease, ulcers);
musculoskeletal disorders (e.g. fibromyalgia, arthritis);
endocrine, metabolic, and nutritional disorders (e.g. diabetes,
osteoporosis); urological disorders (e.g. renal disease);
psychological disorders (e.g. depression, schizophrenia); skin
disorders (e.g. wounds, eczema); blood and lymphatic disorders
(e.g. anemia, hemophilia); etc.
[0758] Diseases characterized by dysfunctional or aberrant protein
activity include cystic fibrosis, sickle cell anemia, epidermolysis
bullosa, amyotrophic lateral sclerosis, and glucose-6-phosphate
dehydrogenase deficiency. The present invention provides a method
for treating such conditions or diseases in a subject by
introducing nucleic acid or cell-based therapeutics containing the
polynucleotide, primary construct or mmRNA provided herein, wherein
the polynucleotide, primary construct or mmRNA encode for a protein
that antagonizes or otherwise overcomes the aberrant protein
activity present in the cell of the subject. Specific examples of a
dysfunctional protein are the missense mutation variants of the
cystic fibrosis transmembrane conductance regulator (CFTR) gene,
which produce a dysfunctional protein variant of CFTR protein,
which causes cystic fibrosis.
[0759] Diseases characterized by missing (or substantially
diminished such that proper (normal or physiological protein
function does not occur) protein activity include cystic fibrosis,
Niemann-Pick type C, .beta. thalassemia major, Duchenne muscular
dystrophy, Hurler Syndrome, Hunter Syndrome, and Hemophilia A. Such
proteins may not be present, or are essentially non-functional. The
present invention provides a method for treating such conditions or
diseases in a subject by introducing nucleic acid or cell-based
therapeutics containing the polynucleotide, primary construct or
mmRNA provided herein, wherein the polynucleotide, primary
construct or mmRNA encode for a protein that replaces the protein
activity missing from the target cells of the subject. Specific
examples of a dysfunctional protein are the nonsense mutation
variants of the cystic fibrosis transmembrane conductance regulator
(CFTR) gene, which produce a nonfunctional protein variant of CFTR
protein, which causes cystic fibrosis.
[0760] Thus, provided are methods of treating cystic fibrosis in a
mammalian subject by contacting a cell of the subject with a
polynucleotide, primary construct or mmRNA having a translatable
region that encodes a functional CFTR polypeptide, under conditions
such that an effective amount of the CTFR polypeptide is present in
the cell. Preferred target cells are epithelial, endothelial and
mesothelial cells, such as the lung, and methods of administration
are determined in view of the target tissue; i.e., for lung
delivery, the RNA molecules are formulated for administration by
inhalation.
[0761] In another embodiment, the present invention provides a
method for treating hyperlipidemia in a subject, by introducing
into a cell population of the subject with a modified mRNA molecule
encoding Sortilin, a protein recently characterized by genomic
studies, thereby ameliorating the hyperlipidemia in a subject. The
SORT1 gene encodes a trans-Golgi network (TGN) transmembrane
protein called Sortilin. Genetic studies have shown that one of
five individuals has a single nucleotide polymorphism, rs12740374,
in the 1p13 locus of the SORT1 gene that predisposes them to having
low levels of low-density lipoprotein (LDL) and very-low-density
lipoprotein (VLDL). Each copy of the minor allele, present in about
30% of people, alters LDL cholesterol by 8 mg/dL, while two copies
of the minor allele, present in about 5% of the population, lowers
LDL cholesterol 16 mg/dL. Carriers of the minor allele have also
been shown to have a 40% decreased risk of myocardial infarction.
Functional in vivo studies in mice describes that overexpression of
SORT1 in mouse liver tissue led to significantly lower
LDL-cholesterol levels, as much as 80% lower, and that silencing
SORT1 increased LDL cholesterol approximately 200% (Musunuru K et
al. From noncoding variant to phenotype via SORT1 at the 1p13
cholesterol locus. Nature 2010; 466: 714-721).
[0762] In another embodiment, the present invention provides a
method for treating hematopoietic disorders, cardiovascular
disease, oncology, diabetes, cystic fibrosis, neurological
diseases, inborn errors of metabolism, skin and systemic disorders,
and blindness. The identity of molecular targets to treat these
specific diseases has been described (Templeton ed., Gene and Cell
Therapy: Therapeutic Mechanisms and Strategies, 3.sup.rd Edition,
Bota Raton, Fla.:CRC Press; herein incorporated by reference in its
entirety).
[0763] Provided herein, are methods to prevent infection and/or
sepsis in a subject at risk of developing infection and/or sepsis,
the method comprising administering to a subject in need of such
prevention a composition comprising a polynucleotide, primary
construct or mmRNA precursor encoding an anti-microbial polypeptide
(e.g., an anti-bacterial polypeptide), or a partially or fully
processed form thereof in an amount sufficient to prevent infection
and/or sepsis. In certain embodiments, the subject at risk of
developing infection and/or sepsis may be a cancer patient. In
certain embodiments, the cancer patient may have undergone a
conditioning regimen. In some embodiments, the conditioning
regiment may include, but is not limited to, chemotherapy,
radiation therapy, or both. As a non-limiting example, a
polynucleotide, primary construct or mmRNA can encode Protein C,
its zymogen or prepro-protein, the activated form of Protein C
(APC) or variants of Protein C which are known in the art. The
polynucleotides, primary constructs or mmRNA may be chemically
modified and delivered to cells. Non-limiting examples of
polypeptides which may be encoded within the chemically modified
mRNAs of the present invention include those taught in U.S. Pat.
Nos. 7,226,999; 7,498,305; 6,630,138 each of which is incorporated
herein by reference in its entirety. These patents teach Protein C
like molecules, variants and derivatives, any of which may be
encoded within the chemically modified molecules of the present
invention.
[0764] Further provided herein, are methods to treat infection
and/or sepsis in a subject, the method comprising administering to
a subject in need of such treatment a composition comprising a
polynucleotide, primary construct or mmRNA precursor encoding an
anti-microbial polypeptide (e.g., an anti-bacterial polypeptide),
e.g., an anti-microbial polypeptide described herein, or a
partially or fully processed form thereof in an amount sufficient
to treat an infection and/or sepsis. In certain embodiments, the
subject in need of treatment is a cancer patient. In certain
embodiments, the cancer patient has undergone a conditioning
regimen. In some embodiments, the conditioning regiment may
include, but is not limited to, chemotherapy, radiation therapy, or
both.
[0765] In certain embodiments, the subject may exhibits acute or
chronic microbial infections (e.g., bacterial infections). In
certain embodiments, the subject may have received or may be
receiving a therapy. In certain embodiments, the therapy may
include, but is not limited to, radiotherapy, chemotherapy,
steroids, ultraviolet radiation, or a combination thereof. In
certain embodiments, the patient may suffer from a microvascular
disorder. In some embodiments, the microvascular disorder may be
diabetes. In certain embodiments, the patient may have a wound. In
some embodiments, the wound may be an ulcer. In a specific
embodiment, the wound may be a diabetic foot ulcer. In certain
embodiments, the subject may have one or more burn wounds. In
certain embodiments, the administration may be local or systemic.
In certain embodiments, the administration may be subcutaneous. In
certain embodiments, the administration may be intravenous. In
certain embodiments, the administration may be oral. In certain
embodiments, the administration may be topical. In certain
embodiments, the administration may be by inhalation. In certain
embodiments, the administration may be rectal. In certain
embodiments, the administration may be vaginal.
[0766] Other aspects of the present disclosure relate to
transplantation of cells containing polynucleotide, primary
construct, or mmRNA to a mammalian subject. Administration of cells
to mammalian subjects is known to those of ordinary skill in the
art, and include, but is not limited to, local implantation (e.g.,
topical or subcutaneous administration), organ delivery or systemic
injection (e.g., intravenous injection or inhalation), and the
formulation of cells in pharmaceutically acceptable carrier. Such
compositions containing polynucleotide, primary construct, or mmRNA
can be formulated for administration intramuscularly,
transarterially, intraperitoneally, intravenously, intranasally,
subcutaneously, endoscopically, transdermally, or intrathecally. In
some embodiments, the composition may be formulated for extended
release.
[0767] The subject to whom the therapeutic agent may be
administered suffers from or may be at risk of developing a
disease, disorder, or deleterious condition. Provided are methods
of identifying, diagnosing, and classifying subjects on these
bases, which may include clinical diagnosis, biomarker levels,
genome-wide association studies (GWAS), and other methods known in
the art.
Wound Management
[0768] The polynucleotides, primary constructs or mmRNA of the
present invention may be used for wound treatment, e.g. of wounds
exhibiting delayed healing. Provided herein are methods comprising
the administration of polynucleotide, primary construct or mmRNA in
order to manage the treatment of wounds. The methods herein may
further comprise steps carried out either prior to, concurrent with
or post administration of the polynucleotide, primary construct or
mmRNA. For example, the wound bed may need to be cleaned and
prepared in order to facilitate wound healing and hopefully obtain
closure of the wound. Several strategies may be used in order to
promote wound healing and achieve wound closure including, but not
limited to: (i) debridement, optionally repeated, sharp debridement
(surgical removal of dead or infected tissue from a wound),
optionally including chemical debriding agents, such as enzymes, to
remove necrotic tissue; (ii) wound dressings to provide the wound
with a moist, warm environment and to promote tissue repair and
healing.
[0769] Examples of materials that are used in formulating wound
dressings include, but are not limited to: hydrogels (e.g.,
AQUASORB.RTM.; DUODERM.RTM.), hydrocolloids (e.g., AQUACEL.RTM.;
COMFEEL.RTM.), foams (e.g., LYOFOAM.RTM.; SPYROSORB.RTM.), and
alginates (e.g., ALGISITE.RTM.; CURASORB.RTM.); (iii) additional
growth factors to stimulate cell division and proliferation and to
promote wound healing e.g. becaplermin (REGRANEX GEL.RTM.), a human
recombinant platelet-derived growth factor that is approved by the
FDA for the treatment of neuropathic foot ulcers; (iv) soft-tissue
wound coverage, a skin graft may be necessary to obtain coverage of
clean, non-healing wounds. Examples of skin grafts that may be used
for soft-tissue coverage include, but are not limited to:
autologous skin grafts, cadaveric skin graft, bioengineered skin
substitutes (e.g., APLIGRAF.RTM.; DERMAGRAFT.RTM.).
[0770] In certain embodiments, the polynucleotide, primary
construct or mmRNA of the present invention may further include
hydrogels (e.g., AQUASORB.RTM.; DUODERM.RTM.), hydrocolloids (e.g.,
AQUACEL.RTM.; COMFEEL.RTM.), foams (e.g., LYOFOAM.RTM.;
SPYROSORB.RTM.), and/or alginates (e.g., ALGISITE.RTM.;
CURASORB.RTM.). In certain embodiments, the polynucleotide, primary
construct or mmRNA of the present invention may be used with skin
grafts including, but not limited to, autologous skin grafts,
cadaveric skin graft, or bioengineered skin substitutes (e.g.,
APLIGRAF.RTM.; DERMAGRAFT.RTM.). In some embodiments, the
polynucleotide, primary construct or mmRNA may be applied with
would dressing formulations and/or skin grafts or they may be
applied separately but methods such as, but not limited to, soaking
or spraying.
[0771] In some embodiments, compositions for wound management may
comprise a polynucleotide, primary construct or mmRNA encoding for
an anti-microbial polypeptide (e.g., an anti-bacterial polypeptide)
and/or an anti-viral polypeptide. A precursor or a partially or
fully processed form of the anti-microbial polypeptide may be
encoded. The composition may be formulated for administration using
a bandage (e.g., an adhesive bandage). The anti-microbial
polypeptide and/or the anti-viral polypeptide may be intermixed
with the dressing compositions or may be applied separately, e.g.,
by soaking or spraying.
Production of Antibodies
[0772] In one embodiment of the invention, the polynucleotides,
primary constructs or mmRNA may encode antibodies and fragments of
such antibodies. These may be produced by any one of the methods
described herein. The antibodies may be of any of the different
subclasses or isotypes of immunoglobulin such as, but not limited
to, IgA, IgG, or IgM, or any of the other subclasses. Exemplary
antibody molecules and fragments that may be prepared according to
the invention include, but are not limited to, immunoglobulin
molecules, substantially intact immunoglobulin molecules and those
portions of an immunoglobulin molecule that may contain the
paratope. Such portion of antibodies that contain the paratope
include, but are not limited to Fab, Fab', F(ab').sub.2, F(v) and
those portions known in the art.
[0773] The polynucleotides of the invention may encode variant
antibody polypeptides which may have a certain identity with a
reference polypeptide sequence, or have a similar or dissimilar
binding characteristic with the reference polypeptide sequence.
[0774] Antibodies obtained by the methods of the present invention
may be chimeric antibodies comprising non-human antibody-derived
variable region(s) sequences, derived from the immunized animals,
and human antibody-derived constant region(s) sequences. In
addition, they can also be humanized antibodies comprising
complementary determining regions (CDRs) of non-human antibodies
derived from the immunized animals and the framework regions (FRs)
and constant regions derived from human antibodies. In another
embodiment, the methods provided herein may be useful for enhancing
antibody protein product yield in a cell culture process.
Managing Infection
[0775] In one embodiment, provided are methods for treating or
preventing a microbial infection (e.g., a bacterial infection)
and/or a disease, disorder, or condition associated with a
microbial or viral infection, or a symptom thereof, in a subject,
by administering a polynucleotide, primary construct or mmRNA
encoding an anti-microbial polypeptide. Said administration may be
in combination with an anti-microbial agent (e.g., an
anti-bacterial agent), e.g., an anti-microbial polypeptide or a
small molecule anti-microbial compound described herein. The
anti-microbial agents include, but are not limited to,
anti-bacterial agents, anti-viral agents, anti-fungal agents,
anti-protozoal agents, anti-parasitic agents, and anti-prion
agents.
[0776] The agents can be administered simultaneously, for example
in a combined unit dose (e.g., providing simultaneous delivery of
both agents). The agents can also be administered at a specified
time interval, such as, but not limited to, an interval of minutes,
hours, days or weeks. Generally, the agents may be concurrently
bioavailable, e.g., detectable, in the subject. In some
embodiments, the agents may be administered essentially
simultaneously, for example two unit dosages administered at the
same time, or a combined unit dosage of the two agents. In other
embodiments, the agents may be delivered in separate unit dosages.
The agents may be administered in any order, or as one or more
preparations that includes two or more agents. In a preferred
embodiment, at least one administration of one of the agents, e.g.,
the first agent, may be made within minutes, one, two, three, or
four hours, or even within one or two days of the other agent,
e.g., the second agent. In some embodiments, combinations can
achieve synergistic results, e.g., greater than additive results,
e.g., at least 25, 50, 75, 100, 200, 300, 400, or 500% greater than
additive results.
Conditions Associated with Bacterial Infection
[0777] Diseases, disorders, or conditions which may be associated
with bacterial infections include, but are not limited to one or
more of the following: abscesses, actinomycosis, acute prostatitis,
aeromonas hydrophila, annual ryegrass toxicity, anthrax, bacillary
peliosis, bacteremia, bacterial gastroenteritis, bacterial
meningitis, bacterial pneumonia, bacterial vaginosis,
bacterium-related cutaneous conditions, bartonellosis, BCG-oma,
botryomycosis, botulism, Brazilian purpuric fever, Brodie abscess,
brucellosis, Buruli ulcer, campylobacteriosis, caries, Carrion's
disease, cat scratch disease, cellulitis, chlamydia infection,
cholera, chronic bacterial prostatitis, chronic recurrent
multifocal osteomyelitis, clostridial necrotizing enteritis,
combined periodontic-endodontic lesions, contagious bovine
pleuropneumonia, diphtheria, diphtheritic stomatitis, ehrlichiosis,
erysipelas, piglottitis, erysipelas, Fitz-Hugh-Curtis syndrome,
flea-borne spotted fever, foot rot (infectious pododermatitis),
Garre's sclerosing osteomyelitis, Gonorrhea, Granuloma inguinale,
human granulocytic anaplasmosis, human monocytotropic ehrlichiosis,
hundred days' cough, impetigo, late congenital syphilitic
oculopathy, legionellosis, Lemierre's syndrome, leprosy (Hansen's
Disease), leptospirosis, listeriosis, Lyme disease, lymphadenitis,
melioidosis, meningococcal disease, meningococcal septicaemia,
methicillin-resistant Staphylococcus aureus (MRSA) infection,
mycobacterium avium-intracellulare (MAI), mycoplasma pneumonia,
necrotizing fasciitis, nocardiosis, noma (cancrum oris or
gangrenous stomatitis), omphalitis, orbital cellulitis,
osteomyelitis, overwhelming post-splenectomy infection (OPSI),
ovine brucellosis, pasteurellosis, periorbital cellulitis,
pertussis (whooping cough), plague, pneumococcal pneumonia, Pott
disease, proctitis, pseudomonas infection, psittacosis, pyaemia,
pyomyositis, Q fever, relapsing fever (typhinia), rheumatic fever,
Rocky Mountain spotted fever (RMSF), rickettsiosis, salmonellosis,
scarlet fever, sepsis, serratia infection, shigellosis, southern
tick-associated rash illness, staphylococcal scalded skin syndrome,
streptococcal pharyngitis, swimming pool granuloma, swine
brucellosis, syphilis, syphilitic aortitis, tetanus, toxic shock
syndrome (TSS), trachoma, trench fever, tropical ulcer,
tuberculosis, tularemia, typhoid fever, typhus, urogenital
tuberculosis, urinary tract infections, vancomycin-resistant
Staphylococcus aureus infection, Waterhouse-Friderichsen syndrome,
pseudotuberculosis (Yersinia) disease, and yersiniosis. Other
diseases, disorders, and/or conditions associated with bacterial
infections can include, for example, Alzheimer's disease, anorexia
nervosa, asthma, atherosclerosis, attention deficit hyperactivity
disorder, autism, autoimmune diseases, bipolar disorder, cancer
(e.g., colorectal cancer, gallbladder cancer, lung cancer,
pancreatic cancer, and stomach cancer), chronic fatigue syndrome,
chronic obstructive pulmonary disease, Crohn's disease, coronary
heart disease, dementia, depression, Guillain-Barre syndrome,
metabolic syndrome, multiple sclerosis, myocardial infarction,
obesity, obsessive-compulsive disorder, panic disorder, psoriasis,
rheumatoid arthritis, sarcoidosis, schizophrenia, stroke,
thromboangiitis obliterans (Buerger's disease), and Tourette
syndrome.
Bacterial Pathogens
[0778] The bacterium described herein can be a Gram-positive
bacterium or a Gram-negative bacterium. Bacterial pathogens
include, but are not limited to, Acinetobacter baumannii, Bacillus
anthracis, Bacillus subtilis, Bordetella pertussis, Borrelia
burgdorferi, Brucella abortus, Brucella canis, Brucella melitensis,
Brucella suis, Campylobacter jejuni, Chlamydia pneumoniae,
Chlamydia trachomatis, Chlamydophila psittaci, Clostridium
botulinum, Clostridium difficile, Clostridium perfringens,
Clostridium tetani, coagulase Negative Staphylococcus,
Corynebacterium diphtheria, Enterococcus faecalis, Enterococcus
faecium, Escherichia coli, enterotoxigenic Escherichia coli (ETEC),
enteropathogenic E. coli, E. coli O157:H7, Enterobacter sp.,
Francisella tularensis, Haemophilus influenzae, Helicobacter
pylori, Klebsiella pneumoniae, Legionella pneumophila, Leptospira
interrogans, Listeria monocytogenes, Moraxella catarralis,
Mycobacterium leprae, Mycobacterium tuberculosis, Mycoplasma
pneumoniae, Neisseria gonorrhoeae, Neisseria meningitides, Preteus
mirabilis, Proteus sps., Pseudomonas aeruginosa, Rickettsia
rickettsii, Salmonella typhi, Salmonella typhimurium, Serratia
marcesens, Shigella flexneri, Shigella sonnei, Staphylococcus
aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus,
Streptococcus agalactiae, Streptococcus mutans, Streptococcus
pneumoniae, Streptococcus pyogenes, Treponema pallidum, Vibrio
cholerae, and Yersinia pestis. Bacterial pathogens may also include
bacteria that cause resistant bacterial infections, for example,
clindamycin-resistant Clostridium difficile,
fluoroquinolon-resistant Clostridium difficile,
methicillin-resistant Staphylococcus aureus (MRSA),
multidrug-resistant Enterococcus faecalis, multidrug-resistant
Enterococcus faecium, multidrug-resistance Pseudomonas aeruginosa,
multidrug-resistant Acinetobacter baumannii, and
vancomycin-resistant Staphylococcus aureus (VRSA).
Antibiotic Combinations
[0779] In one embodiment, the modified mRNA of the present
invention may be administered in conjunction with one or more
antibiotics. These include, but are not limited to Aknilox,
Ambisome, Amoxycillin, Ampicillin, Augmentin, Avelox, Azithromycin,
Bactroban, Betadine, Betnovate, Blephamide, Cefaclor, Cefadroxil,
Cefdinir, Cefepime, Cefix, Cefixime, Cefoxitin, Cefpodoxime,
Cefprozil, Cefuroxime, Cefzil, Cephalexin, Cephazolin, Ceptaz,
Chloramphenicol, Chlorhexidine, Chloromycetin, Chlorsig,
Ciprofloxacin, Clarithromycin, Clindagel, Clindamycin, Clindatech,
Cloxacillin, Colistin, Co-trimoxazole, Demeclocycline, Diclocil,
Dicloxacillin, Doxycycline, Duricef, Erythromycin, Flamazine,
Floxin, Framycetin, Fucidin, Furadantin, Fusidic, Gatifloxacin,
Gemifloxacin, Gemifloxacin, Ilosone, Iodine, Levaquin,
Levofloxacin, Lomefloxacin, Maxaquin, Mefoxin, Meronem,
Minocycline, Moxifloxacin, Myambutol, Mycostatin, Neosporin,
Netromycin, Nitrofurantoin, Norfloxacin, Norilet, Ofloxacin,
Omnicef, Ospamox, Oxytetracycline, Paraxin, Penicillin, Pneumovax,
Polyfax, Povidone, Rifadin, Rifampin, Rifaximin, Rifinah,
Rimactane, Rocephin, Roxithromycin, Seromycin, Soframycin,
Sparfloxacin, Staphlex, Targocid, Tetracycline, Tetradox,
Tetralysal, tobramycin, Tobramycin, Trecator, Tygacil, Vancocin,
Velosef, Vibramycin, Xifaxan, Zagam, Zitrotek, Zoderm, Zymar, and
Zyvox.
Antibacterial Agents
[0780] Exemplary anti-bacterial agents include, but are not limited
to, aminoglycosides (e.g., amikacin (AMIKIN.RTM.), gentamicin
(GARAMYCIN.RTM.), kanamycin (KANTREX.RTM.), neomycin
(MYCIFRADIN.RTM.), netilmicin (NETROMYCIN.RTM.), tobramycin
(NEBCIN.RTM.), Paromomycin (HUMATIN.RTM.)), ansamycins (e.g.,
geldanamycin, herbimycin), carbacephem (e.g., loracarbef
(LORABID.RTM.), Carbapenems (e.g., ertapenem (INVANZ.RTM.),
doripenem (DORIBAX.RTM.), imipenem/cilastatin (PRIMAXIN.RTM.),
meropenem (MERREM.RTM.), cephalosporins (first generation) (e.g.,
cefadroxil (DURICEF.RTM.), cefazolin (ANCEF.RTM.), cefalotin or
cefalothin (KEFLIN.RTM.), cefalexin (KEFLEX.RTM.), cephalosporins
(second generation) (e.g., cefaclor (CECLOR.RTM.), cefamandole
(MANDOL.RTM.), cefoxitin (MEFOXIN.RTM.), cefprozil (CEFZIL.RTM.),
cefuroxime (CEFTIN.RTM., ZINNAT.RTM.)), cephalosporins (third
generation) (e.g., cefixime (SUPRAX.RTM.), cefdinir (OMNICEF.RTM.,
CEFDIEL.RTM.), cefditoren (SPECTRACEF.RTM.), cefoperazone
(CEFOBID.RTM.), cefotaxime (CLAFORAN.RTM.), cefpodoxime
(VANTIN.RTM.), ceftazidime (FORTAZ.RTM.), ceftibuten (CEDAX.RTM.),
ceftizoxime (CEFIZOX.RTM.), ceftriaxone (ROCEPHIN.RTM.)),
cephalosporins (fourth generation) (e.g., cefepime
(MAXIPIME.RTM.)), cephalosporins (fifth generation) (e.g.,
ceftobiprole (ZEFTERA.RTM.)), glycopeptides (e.g., teicoplanin
(TARGOCID.RTM.), vancomycin (VANCOCIN.RTM.), telavancin
(VIBATIV.RTM.)), lincosamides (e.g., clindamycin (CLEOCIN.RTM.),
lincomycin (LINCOCIN.RTM.)), lipopeptide (e.g., daptomycin
(CUBICIN.RTM.)), macrolides (e.g., azithromycin (ZITHROMAX.RTM.,
SUMAMED.RTM., ZITROCIN.RTM.), clarithromycin (BIAXIN.RTM.),
dirithromycin (DYNABAC.RTM.), erythromycin (ERYTHOCIN.RTM.,
ERYTHROPED.RTM.), roxithromycin, troleandomycin (TAO.RTM.),
telithromycin (KETEK.RTM.), spectinomycin (TROBICIN.RTM.)),
monobactams (e.g., aztreonam (AZACTAM.RTM.)), nitrofurans (e.g.,
furazolidone (FUROXONE.RTM.), nitrofurantoin (MACRODANTIN.RTM.,
MACROBID.RTM.)), penicillins (e.g., amoxicillin (NOVAMOX.RTM.,
AMOXIL.RTM.), ampicillin (PRINCIPEN.RTM.), azlocillin,
carbenicillin (GEOCILLIN.RTM.), cloxacillin (TEGOPEN.RTM.),
dicloxacillin (DYNAPEN.RTM.), flucloxacillin (FLOXAPEN.RTM.),
mezlocillin (MEZLIN.RTM.), methicillin (STAPHClLLIN.RTM.),
nafcillin (UNIPEN.RTM.), oxacillin (PROSTAPHLIN.RTM.), penicillin G
(PENTIDS.RTM.), penicillin V (PEN-VEE-K.RTM.), piperacillin
(PIPRACIL.RTM.), temocillin (NEGABAN.RTM.), ticarcillin
(TICAR.RTM.)), penicillin combinations (e.g.,
amoxicillin/clavulanate (AUGMENTIN.RTM.), ampicillin/sulbactam
(UNASYN.RTM.), piperacillin/tazobactam (ZOSYN.RTM.),
ticarcillin/clavulanate (TIMENTIN.RTM.)), polypeptides (e.g.,
bacitracin, colistin (COLY-MYCIN-S.RTM.), polymyxin B, quinolones
(e.g., ciprofloxacin (CIPRO.RTM., CIPROXIN.RTM., CIPROBAY.RTM.),
enoxacin (PENETREX.RTM.), gatifloxacin (TEQUIN.RTM.), levofloxacin
(LEVAQUIN.RTM.), lomefloxacin (MAXAQUIN.RTM.), moxifloxacin
(AVELOX.RTM.), nalidixic acid (NEGGRAM.RTM.), norfloxacin
(NOROXIN.RTM.), ofloxacin (FLOXIN.RTM., OCUFLOX.RTM.),
trovafloxacin (TROVAN.RTM.), grepafloxacin (RAXAR.RTM.),
sparfloxacin (ZAGAM.RTM.), temafloxacin (OMNIFLOX.RTM.)),
sulfonamides (e.g., mafenide (SULFAMYLON.RTM.),
sulfonamidochrysoidine (PRONTOSIL.RTM.), sulfacetamide
(SULAMYD.RTM., BLEPH-10.RTM.), sulfadiazine (MICRO-SULFON.RTM.),
silver sulfadiazine (SILVADENE.RTM.), sulfamethizole (THIOSULFIL
FORTE.RTM.), sulfamethoxazole (GANTANOL.RTM.), sulfanilimide,
sulfasalazine (AZULFIDINE.RTM.), sulfisoxazole (GANTRISIN.RTM.),
trimethoprim (PROLOPRIM.RTM.), TRIMPEX.RTM.),
trimethoprim-sulfamethoxazole (co-trimoxazole) (TMP-SMX)
(BACTRIM.RTM., SEPTRA.RTM.)), tetracyclines (e.g., demeclocycline
(DECLOMYCIN.RTM.), doxycycline (VIBRAMYCIN.RTM.), minocycline
(MINOCIN.RTM.), oxytetracycline (TERRAMYCIN.RTM.), tetracycline
(SUMYCIN.RTM., ACHROMYCIN.RTM. V, STECLIN.RTM.)), drugs against
mycobacteria (e.g., clofazimine (LAMPRENE.RTM.), dapsone
(AVLOSULFON.RTM.), capreomycin (CAPASTAT.RTM.), cycloserine
(SEROMYCIN.RTM.), ethambutol (MYAMBUTOL.RTM.), ethionamide
(TRECATOR.RTM.), isoniazid (I.N.H..RTM.), pyrazinamide
(ALDINAMIDE.RTM.), rifampin (RIFADIN.RTM., RIMACTANE.RTM.),
rifabutin (MYCOBUTIN.RTM.), rifapentine (PRIFTIN.RTM.),
streptomycin), and others (e.g., arsphenamine (SALVARSAN.RTM.),
chloramphenicol (CHLOROMYCETIN.RTM.), fosfomycin (MONUROL.RTM.),
fusidic acid (FUCIDIN.RTM.), linezolid (ZYVOX.RTM.), metronidazole
(FLAGYL.RTM.), mupirocin (BACTROBAN.RTM.), platensimycin,
quinupristin/dalfopristin (SYNERCID.RTM.), rifaximin
(XIFAXAN.RTM.), thiamphenicol, tigecycline (TIGACYL.RTM.),
timidazole (TINDAMAX.RTM., FASIGYN.RTM.)).
Conditions Associated with Viral Infection
[0781] In another embodiment, provided are methods for treating or
preventing a viral infection and/or a disease, disorder, or
condition associated with a viral infection, or a symptom thereof,
in a subject, by administering a polynucleotide, primary construct
or mmRNA encoding an anti-viral polypeptide, e.g., an anti-viral
polypeptide described herein in combination with an anti-viral
agent, e.g., an anti-viral polypeptide or a small molecule
anti-viral agent described herein.
[0782] Diseases, disorders, or conditions associated with viral
infections include, but are not limited to, acute febrile
pharyngitis, pharyngoconjunctival fever, epidemic
keratoconjunctivitis, infantile gastroenteritis, Coxsackie
infections, infectious mononucleosis, Burkitt lymphoma, acute
hepatitis, chronic hepatitis, hepatic cirrhosis, hepatocellular
carcinoma, primary HSV-1 infection (e.g., gingivostomatitis in
children, tonsillitis and pharyngitis in adults,
keratoconjunctivitis), latent HSV-1 infection (e.g., herpes
labialis and cold sores), primary HSV-2 infection, latent HSV-2
infection, aseptic meningitis, infectious mononucleosis,
Cytomegalic inclusion disease, Kaposi sarcoma, multicentric
Castleman disease, primary effusion lymphoma, AIDS, influenza, Reye
syndrome, measles, postinfectious encephalomyelitis, Mumps,
hyperplastic epithelial lesions (e.g., common, flat, plantar and
anogenital warts, laryngeal papillomas, epidermodysplasia
verruciformis), cervical carcinoma, squamous cell carcinomas,
croup, pneumonia, bronchiolitis, common cold, Poliomyelitis,
Rabies, bronchiolitis, pneumonia, influenza-like syndrome, severe
bronchiolitis with pneumonia, German measles, congenital rubella,
Varicella, and herpes zoster.
Viral Pathogens
[0783] Viral pathogens include, but are not limited to, adenovirus,
coxsackievirus, dengue virus, encephalitis virus, Epstein-Barr
virus, hepatitis A virus, hepatitis B virus, hepatitis C virus,
herpes simplex virus type 1, herpes simplex virus type 2,
cytomegalovirus, human herpesvirus type 8, human immunodeficiency
virus, influenza virus, measles virus, mumps virus, human
papillomavirus, parainfluenza virus, poliovirus, rabies virus,
respiratory syncytial virus, rubella virus, varicella-zoster virus,
West Nile virus, and yellow fever virus. Viral pathogens may also
include viruses that cause resistant viral infections.
Antiviral Agents
[0784] Exemplary anti-viral agents include, but are not limited to,
abacavir (ZIAGEN.RTM.), abacavir/lamivudine/zidovudine
(Trizivir.RTM.), aciclovir or acyclovir (CYCLOVIR.RTM.,
HERPEX.RTM., ACIVIR.RTM., ACIVIRAX.RTM., ZOVIRAX.RTM., ZOVIR.RTM.),
adefovir (Preveon.RTM., Hepsera.RTM.), amantadine (SYMMETREL.RTM.),
amprenavir (AGENERASE.RTM.), ampligen, arbidol, atazanavir
(REYATAZ.RTM.), boceprevir, cidofovir, darunavir (PREZISTA.RTM.),
delavirdine (RESCRIPTOR.RTM.), didanosine (VIDEX.RTM.), docosanol
(ABREVA.RTM.), edoxudine, efavirenz (SUSTIVA.RTM., STOCRIN.RTM.),
emtricitabine (EMTRIVA.RTM.), emtricitabine/tenofovir/efavirenz
(ATRIPLA.RTM.), enfuvirtide (FUZEON.RTM.), entecavir
(BARACLUDE.RTM., ENTAVIR.RTM.), famciclovir (FAMVIR.RTM.),
fomivirsen (VITRAVENE.RTM.), fosamprenavir (LEXIVA.RTM.,
TELZIR.RTM.), foscarnet (FOSCAVIR.RTM.), fosfonet, ganciclovir
(CYTOVENE.RTM., CYMEVENE.RTM., VITRASERT.RTM.), GS 9137
(ELVITEGRAVIR.RTM.), imiquimod (ALDARA.RTM., ZYCLARA.RTM.,
BESELNA.RTM.), indinavir (CRIXIVAN.RTM.), inosine, inosine pranobex
(IMUNOVIR.RTM.), interferon type I, interferon type II, interferon
type III, kutapressin (NEXAVIR.RTM.), lamivudine (ZEFFIX.RTM.,
HEPTOVIR.RTM., EPIVIR.RTM.), lamivudine/zidovudine (COMBIVIR.RTM.),
lopinavir, loviride, maraviroc (SELZENTRY.RTM., CELSENTRI.RTM.),
methisazone, MK-2048, moroxydine, nelfinavir (VIRACEPT.RTM.),
nevirapine (VIRAMUNE.RTM.), oseltamivir (TAMIFLU.RTM.),
peginterferon alfa-2a (PEGASYS.RTM.), penciclovir (DENAVIR.RTM.),
peramivir, pleconaril, podophyllotoxin (CONDYLOX.RTM.), raltegravir
(ISENTRESS.RTM.), ribavirin (COPEGUs.RTM., REBETOL.RTM.,
RIBASPHERE.RTM., VILONA.RTM. AND VIRAZOLE.RTM.), rimantadine
(FLUMADINE.RTM.), ritonavir (NORVIR.RTM.), pyramidine, saquinavir
(INVIRASE.RTM., FORTOVASE.RTM.), stavudine, tea tree oil (melaleuca
oil), tenofovir (VIREAD.RTM.), tenofovir/emtricitabine
(TRUVADA.RTM.), tipranavir (APTIVUS.RTM.), trifluridine
(VIROPTIC.RTM.), tromantadine (VIRU-MERZ.RTM.), valaciclovir
(VALTREX.RTM.), valganciclovir (VALCYTE.RTM.), vicriviroc,
vidarabine, viramidine, zalcitabine, zanamivir (RELENZA.RTM.), and
zidovudine (azidothymidine (AZT), RETROVIR.RTM.,
RETROVIS.RTM.).
Conditions Associated with Fungal Infections
[0785] Diseases, disorders, or conditions associated with fungal
infections include, but are not limited to, aspergilloses,
blastomycosis, candidasis, coccidioidomycosis, cryptococcosis,
histoplasmosis, mycetomas, paracoccidioidomycosis, and tinea pedis.
Furthermore, persons with immuno-deficiencies are particularly
susceptible to disease by fungal genera such as Aspergillus,
Candida, Cryptoccocus, Histoplasma, and Pneumocystis. Other fungi
can attack eyes, nails, hair, and especially skin, the so-called
dermatophytic fungi and keratinophilic fungi, and cause a variety
of conditions, of which ringworms such as athlete's foot are
common. Fungal spores are also a major cause of allergies, and a
wide range of fungi from different taxonomic groups can evoke
allergic reactions in some people.
Fungal Pathogens
[0786] Fungal pathogens include, but are not limited to, Ascomycota
(e.g., Fusarium oxysporum, Pneumocystis jirovecii, Aspergillus
spp., Coccidioides immitis/posadasii, Candida albicans),
Basidiomycota (e.g., Filobasidiella neoformans, Trichosporon),
Microsporidia (e.g., Encephalitozoon cuniculi, Enterocytozoon
bieneusi), and Mucoromycotina (e.g., Mucor circinelloides, Rhizopus
oryzae, Lichtheimia corymbifera).
Anti-Fungal Agents
[0787] Exemplary anti-fungal agents include, but are not limited
to, polyene antifungals (e.g., natamycin, rimocidin, filipin,
nystatin, amphotericin B, candicin, hamycin), imidazole antifungals
(e.g., miconazole (MICATIN.RTM., DAKTARIN.RTM.), ketoconazole
(NIZORAL.RTM., FUNGORAL.RTM., SEBIZOLE.RTM.), clotrimazole
(LOTRIMIN.RTM., LOTRIMIN.RTM. AF, CANESTEN.RTM.), econazole,
omoconazole, bifonazole, butoconazole, fenticonazole, isoconazole,
oxiconazole, sertaconazole (ERTACZO.RTM.), sulconazole,
tioconazole), triazole antifungals (e.g., albaconazole fluconazole,
itraconazole, isavuconazole, ravuconazole, posaconazole,
voriconazole, terconazole), thiazole antifungals (e.g., abafungin),
allylamines (e.g., terbinafine (LAMISIL.RTM.), naftifine
(NAFTIN.RTM.), butenafine (LOTRIMIN.RTM. Ultra)), echinocandins
(e.g., anidulafungin, caspofungin, micafungin), and others (e.g.,
polygodial, benzoic acid, ciclopirox, tolnaftate (TINACTIN.RTM.,
DESENEX.RTM., AFTATE.RTM.), undecylenic acid, flucytosine or
5-fluorocytosine, griseofulvin, haloprogin, sodium bicarbonate,
allicin).
Conditions Associated with Protozoal Infection
[0788] Diseases, disorders, or conditions associated with protozoal
infections include, but are not limited to, amoebiasis, giardiasis,
trichomoniasis, African Sleeping Sickness, American Sleeping
Sickness, leishmaniasis (Kala-Azar), balantidiasis, toxoplasmosis,
malaria, acanthamoeba keratitis, and babesiosis.
Protozoan Pathogens
[0789] Protozoal pathogens include, but are not limited to,
Entamoeba histolytica, Giardia lambila, Trichomonas vaginalis,
Trypanosoma brucei, T. cruzi, Leishmania donovani, Balantidium
coli, Toxoplasma gondii, Plasmodium spp., and Babesia microti.
Anti-Protozoan Agents
[0790] Exemplary anti-protozoal agents include, but are not limited
to, eflornithine, furazolidone (FUROXONE.RTM., DEPENDAL-M.RTM.),
melarsoprol, metronidazole (FLAGYL.RTM.), ornidazole, paromomycin
sulfate (HUMATIN.RTM.), pentamidine, pyrimethamine (DARAPRIM.RTM.),
and timidazole (TINDAMAX.RTM., FASIGYN.RTM.).
Conditions Associated with Parasitic Infection
[0791] Diseases, disorders, or conditions associated with parasitic
infections include, but are not limited to, acanthamoeba keratitis,
amoebiasis, ascariasis, babesiosis, balantidiasis,
baylisascariasis, chagas disease, clonorchiasis, cochliomyia,
cryptosporidiosis, diphyllobothriasis, dracunculiasis,
echinococcosis, elephantiasis, enterobiasis, fascioliasis,
fasciolopsiasis, filariasis, giardiasis, gnathostomiasis,
hymenolepiasis, isosporiasis, katayama fever, leishmaniasis, lyme
disease, malaria, metagonimiasis, myiasis, onchocerciasis,
pediculosis, scabies, schistosomiasis, sleeping sickness,
strongyloidiasis, taeniasis, toxocariasis, toxoplasmosis,
trichinosis, and trichuriasis.
Parasitic Pathogens
[0792] Parasitic pathogens include, but are not limited to,
Acanthamoeba, Anisakis, Ascaris lumbricoides, botfly, Balantidium
coli, bedbug, Cestoda, chiggers, Cochliomyia hominivorax, Entamoeba
histolytica, Fasciola hepatica, Giardia lamblia, hookworm,
Leishmania, Linguatula serrata, liver fluke, Loa boa, Paragonimus,
pinworm, Plasmodium falciparum, Schistosoma, Strongyloides
stercoralis, mite, tapeworm, Toxoplasma gondii, Trypanosoma,
whipworm, Wuchereria bancrofti.
Anti-Parasitic Agents
[0793] Exemplary anti-parasitic agents include, but are not limited
to, antinematodes (e.g., mebendazole, pyrantel pamoate,
thiabendazole, diethylcarbamazine, ivermectin), anticestodes (e.g.,
niclosamide, praziquantel, albendazole), antitrematodes (e.g.,
praziquantel), antiamoebics (e.g., rifampin, amphotericin B), and
antiprotozoals (e.g., melarsoprol, eflornithine, metronidazole,
tinidazole).
Conditions Associated with Prion Infection
[0794] Diseases, disorders, or conditions associated with prion
infections include, but are not limited to Creutzfeldt-Jakob
disease (CJD), iatrogenic Creutzfeldt-Jakob disease (iCJD), variant
Creutzfeldt-Jakob disease (vCJD), familial Creutzfeldt-Jakob
disease (fCJD), sporadic Creutzfeldt-Jakob disease (sCJD),
Gerstmann-Stra ussler-Scheinker syndrome (GSS), fatal familial
insomnia (FFI), Kuru, Scrapie, bovine spongiform encephalopathy
(BSE), mad cow disease, transmissible mink encephalopathy (TME),
chronic wasting disease (CWD), feline spongiform encephalopathy
(FSE), exotic ungulate encephalopathy (EUE), and spongiform
encephalopathy.
Anti-Prion Agents
[0795] Exemplary anti-prion agents include, but are not limited to,
flupirtine, pentosan polysuphate, quinacrine, and tetracyclic
compounds.
Modulation of the Immune Response
Avoidance of the Immune Response
[0796] As described herein, a useful feature of the
polynucleotides, primary constructs or mmRNA of the invention is
the capacity to reduce, evade or avoid the innate immune response
of a cell. In one aspect, provided herein are polynucleotides,
primary constructs or mmRNA encoding a polypeptide of interest
which when delivered to cells, results in a reduced immune response
from the host as compared to the response triggered by a reference
compound, e.g. an unmodified polynucleotide corresponding to a
polynucleotide, primary construct or mmRNA of the invention, or a
different polynucleotide, primary construct or mmRNA of the
invention. As used herein, a "reference compound" is any molecule
or substance which when administered to a mammal, results in an
innate immune response having a known degree, level or amount of
immune stimmulation. A reference compound need not be a nucleic
acid molecule and it need not be any of the polynucleotides,
primary constructs or mmRNA of the invention. Hence, the measure of
a polynucleotides, primary constructs or mmRNA avoidance, evasion
or failure to trigger an immune response can be expressed in terms
relative to any compound or substance which is known to trigger
such a response.
[0797] The term "innate immune response" includes a cellular
response to exogenous single stranded nucleic acids, generally of
viral or bacterial origin, which involves the induction of cytokine
expression and release, particularly the interferons, and cell
death. As used herein, the innate immune response or interferon
response operates at the single cell level causing cytokine
expression, cytokine release, global inhibition of protein
synthesis, global destruction of cellular RNA, upregulation of
major histocompatibility molecules, and/or induction of apoptotic
death, induction of gene transcription of genes involved in
apoptosis, anti-growth, and innate and adaptive immune cell
activation. Some of the genes induced by type I IFNs include PKR,
ADAR (adenosine deaminase acting on RNA), OAS (2',5'-oligoadenylate
synthetase), RNase L, and Mx proteins. PKR and ADAR lead to
inhibition of translation initiation and RNA editing, respectively.
OAS is a dsRNA-dependent synthetase that activates the
endoribonuclease RNase L to degrade ssRNA.
[0798] In some embodiments, the innate immune response comprises
expression of a Type I or Type II interferon, and the expression of
the Type I or Type II interferon is not increased more than
two-fold compared to a reference from a cell which has not been
contacted with a polynucleotide, primary construct or mmRNA of the
invention.
[0799] In some embodiments, the innate immune response comprises
expression of one or more IFN signature genes and where the
expression of the one of more IFN signature genes is not increased
more than three-fold compared to a reference from a cell which has
not been contacted with the polynucleotide, primary construct or
mmRNA of the invention.
[0800] While in some circumstances, it might be advantageous to
eliminate the innate immune response in a cell, the invention
provides polynucleotides, primary constructs and mmRNA that upon
administration result in a substantially reduced (significantly
less) the immune response, including interferon signaling, without
entirely eliminating such a response.
[0801] In some embodiments, the immune response is lower by 10%,
20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.9%, or greater
than 99.9% as compared to the immune response induced by a
reference compound. The immune response itself may be measured by
determining the expression or activity level of Type 1 interferons
or the expression of interferon-regulated genes such as the
toll-like receptors (e.g., TLR7 and TLR8). Reduction of innate
immune response can also be measured by measuring the level of
decreased cell death following one or more administrations to a
cell population; e.g., cell death is 10%, 25%, 50%, 75%, 85%, 90%,
95%, or over 95% less than the cell death frequency observed with a
reference compound. Moreover, cell death may affect fewer than 50%,
40%, 30%, 20%, 10%, 5%, 1%, 0.1%, 0.01% or fewer than 0.01% of
cells contacted with the polynucleotide, primary construct or
mmRNA.
[0802] In another embodiment, the polynucleotide, primary construct
or mmRNA of the present invention is significantly less immunogenic
than an unmodified in vitro-synthesized RNA molecule
polynucleotide, or primary construct with the same sequence or a
reference compound. As used herein, "significantly less
immunogenic" refers to a detectable decrease in immunogenicity. In
another embodiment, the term refers to a fold decrease in
immunogenicity. In another embodiment, the term refers to a
decrease such that an effective amount of the polynucleotide,
primary construct or mmRNA can be administered without triggering a
detectable immune response. In another embodiment, the term refers
to a decrease such that the polynucleotide, primary construct or
mmRNA can be repeatedly administered without eliciting an immune
response sufficient to detectably reduce expression of the
recombinant protein. In another embodiment, the decrease is such
that the polynucleotide, primary construct or mmRNA can be
repeatedly administered without eliciting an immune response
sufficient to eliminate detectable expression of the recombinant
protein.
[0803] In another embodiment, the polynucleotide, primary construct
or mmRNA is 2-fold less immunogenic than its unmodified counterpart
or reference compound. In another embodiment, immunogenicity is
reduced by a 3-fold factor. In another embodiment, immunogenicity
is reduced by a 5-fold factor. In another embodiment,
immunogenicity is reduced by a 7-fold factor. In another
embodiment, immunogenicity is reduced by a 10-fold factor. In
another embodiment, immunogenicity is reduced by a 15-fold factor.
In another embodiment, immunogenicity is reduced by a fold factor.
In another embodiment, immunogenicity is reduced by a 50-fold
factor. In another embodiment, immunogenicity is reduced by a
100-fold factor. In another embodiment, immunogenicity is reduced
by a 200-fold factor. In another embodiment, immunogenicity is
reduced by a 500-fold factor. In another embodiment, immunogenicity
is reduced by a 1000-fold factor. In another embodiment,
immunogenicity is reduced by a 2000-fold factor. In another
embodiment, immunogenicity is reduced by another fold
difference.
[0804] Methods of determining immunogenicity are well known in the
art, and include, e.g. measuring secretion of cytokines (e.g.
IL-12, IFNalpha, TNF-alpha, RANTES, MIP-1alpha or beta, IL-6,
IFN-beta, or IL-8), measuring expression of DC activation markers
(e.g. CD83, HLA-DR, CD80 and CD86), or measuring ability to act as
an adjuvant for an adaptive immune response.
[0805] The polynucleotide, primary construct or mmRNA of the
invention, including the combination of modifications taught herein
may have superior properties making them more suitable as
therapeutic modalities.
[0806] It has been determined that the "all or none" model in the
art is sorely insufficient to describe the biological phenomena
associated with the therapeutic utility of modified mRNA. The
present inventors have determined that to improve protein
production, one may consider the nature of the modification, or
combination of modifications, the percent modification and survey
more than one cytokine or metric to determine the efficacy and risk
profile of a particular modified mRNA.
[0807] In one aspect of the invention, methods of determining the
effectiveness of a modified mRNA as compared to unmodified involves
the measure and analysis of one or more cytokines whose expression
is triggered by the administration of the exogenous nucleic acid of
the invention. These values are compared to administration of an
umodified nucleic acid or to a standard metric such as cytokine
response, PolylC, R-848 or other standard known in the art.
[0808] One example of a standard metric developed herein is the
measure of the ratio of the level or amount of encoded polypeptide
(protein) produced in the cell, tissue or organism to the level or
amount of one or more (or a panel) of cytokines whose expression is
triggered in the cell, tissue or organism as a result of
administration or contact with the modified nucleic acid. Such
ratios are referred to herein as the Protein:Cytokine Ratio or "PC"
Ratio. The higher the PC ratio, the more efficacioius the modified
nucleic acid (polynucleotide encoding the protein measured).
Preferred PC Ratios, by cytokine, of the present invention may be
greater than 1, greater than 10, greater than 100, greater than
1000, greater than 10,000 or more. Modified nucleic acids having
higher PC Ratios than a modified nucleic acid of a different or
unmodified construct are preferred.
[0809] The PC ratio may be further qualified by the percent
modification present in the polynucleotide. For example, normalized
to a 100% modified nucleic acid, the protein production as a
function of cytokine (or risk) or cytokine profile can be
determined.
[0810] In one embodiment, the present invention provides a method
for determining, across chemistries, cytokines or percent
modification, the relative efficacy of any particular modified the
polynucleotide, primary construct or mmRNA by comparing the PC
Ratio of the modified nucleic acid (polynucleotide, primary
construct or mmRNA).
[0811] mmRNA containing varying levels of nucleobase substitutions
could be produced that maintain increased protein production and
decreased immunostimulatory potential. The relative percentage of
any modified nucleotide to its naturally occurring nucleotide
counterpart can be varied during the IVT reaction (for instance,
100, 50, 25, 10, 5, 2.5, 1, 0.1, 0.01% 5 methyl cytidine usage
versus cytidine; 100, 50, 25, 10, 5, 2.5, 1, 0.1, 0.01%
pseudouridine or N1-methyl-pseudouridine usage versus uridine).
mmRNA can also be made that utilize different ratios using 2 or
more different nucleotides to the same base (for instance,
different ratios of pseudouridine and N1-methyl-pseudouridine).
mmRNA can also be made with mixed ratios at more than 1 "base"
position, such as ratios of 5 methyl cytidine/cytidine and
pseudouridine/N1-methyl-pseudouridine/uridine at the same time. Use
of modified mRNA with altered ratios of modified nucleotides can be
beneficial in reducing potential exposure to chemically modified
nucleotides. Lastly, positional introduction of modified
nucleotides into the mmRNA which modulate either protein production
or immunostimulatory potential or both is also possible. The
ability of such mmRNA to demonstrate these improved properties can
be assessed in vitro (using assays such as the PBMC assay described
herein), and can also be assessed in vivo through measurement of
both mmRNA-encoded protein production and mediators of innate
immune recognition such as cytokines.
[0812] In another embodiment, the relative immunogenicity of the
polynucleotide, primary construct or mmRNA and its unmodified
counterpart are determined by determining the quantity of the
polynucleotide, primary construct or mmRNA required to elicit one
of the above responses to the same degree as a given quantity of
the unmodified nucleotide or reference compound. For example, if
twice as much polynucleotide, primary construct or mmRNA is
required to elicit the same response, than the polynucleotide,
primary construct or mmRNA is two-fold less immunogenic than the
unmodified nucleotide or the reference compound.
[0813] In another embodiment, the relative immunogenicity of the
polynucleotide, primary construct or mmRNA and its unmodified
counterpart are determined by determining the quantity of cytokine
(e.g. IL-12, IFNalpha, TNF-alpha, RANTES, MIP-1alpha or beta, IL-6,
IFN-beta, or IL-8) secreted in response to administration of the
polynucleotide, primary construct or mmRNA, relative to the same
quantity of the unmodified nucleotide or reference compound. For
example, if one-half as much cytokine is secreted, than the
polynucleotide, primary construct or mmRNA is two-fold less
immunogenic than the unmodified nucleotide. In another embodiment,
background levels of stimulation are subtracted before calculating
the immunogenicity in the above methods.
[0814] Provided herein are also methods for performing the
titration, reduction or elimination of the immune response in a
cell or a population of cells. In some embodiments, the cell is
contacted with varied doses of the same polynucleotides, primary
constructs or mmRNA and dose response is evaluated. In some
embodiments, a cell is contacted with a number of different
polynucleotides, primary constructs or mmRNA at the same or
different doses to determine the optimal composition for producing
the desired effect. Regarding the immune response, the desired
effect may be to avoid, evade or reduce the immune response of the
cell. The desired effect may also be to alter the efficiency of
protein production.
[0815] The polynucleotides, primary constructs and/or mmRNA of the
present invention may be used to reduce the immune response using
the method described in International Publication No. WO2013003475,
herein incorporated by reference in its entirety.
Activation of the Immune Response: Vaccines
[0816] Additionally, certain modified nucleosides, or combinations
thereof, when introduced into the polynucleotides, primary
constructs or mmRNA of the invention will activate the innate
immune response. Such activating molecules are useful as adjuvants
when combined with polypeptides and/or other vaccines. In certain
embodiments, the activating molecules contain a translatable region
which encodes for a polypeptide sequence useful as a vaccine, thus
providing the ability to be a self-adjuvant.
[0817] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA of the invention may encode an immunogen. The delivery
of the polynucleotides, primary constructs and/or mmRNA encoding an
immunogen may activate the immune response. As a non-limiting
example, the polynucleotides, primary constructs and/or mmRNA
encoding an immunogen may be delivered to cells to trigger multiple
innate response pathways (see International Pub. No. WO2012006377;
herein incorporated by reference in its entirety). As another
non-limiting example, the polynucleotides, primary constructs and
mmRNA of the present invention encoding an immunogen may be
delivered to a vertebrate in a dose amount large enough to be
immunogenic to the vertebrate (see International Pub. No.
WO2012006372 and WO2012006369; each of which is herein incorporated
by reference in their entirety).
[0818] The polynucleotides, primary constructs or mmRNA of
invention may encode a polypeptide sequence for a vaccine and may
further comprise an inhibitor. The inhibitor may impair antigen
presentation and/or inhibit various pathways known in the art. As a
non-limiting example, the polynucleotides, primary constructs or
mmRNA of the invention may be used for a vaccine in combination
with an inhibitor which can impair antigen presentation (see
International Pub. No. WO2012089225 and WO2012089338; each of which
is herein incorporated by reference in their entirety).
[0819] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the invention may be self-replicating RNA.
Self-replicating RNA molecules can enhance efficiency of RNA
delivery and expression of the enclosed gene product. In one
embodiment, the polynucleotides, primary constructs or mmRNA may
comprise at least one modification described herein and/or known in
the art. In one embodiment, the self-replicating RNA can be
designed so that the self-replicating RNA does not induce
production of infectious viral particles. As a non-limiting example
the self-replicating RNA may be designed by the methods described
in US Pub. No. US20110300205 and International Pub. No.
WO2011005799, each of which is herein incorporated by reference in
their entirety.
[0820] In one embodiment, the self-replicating polynucleotides,
primary constructs or mmRNA of the invention may encode a protein
which may raise the immune response. As a non-limiting example, the
polynucleotides, primary constructs or mmRNA may be
self-replicating mRNA may encode at least one antigen (see US Pub.
No. US20110300205 and International Pub. Nos. WO2011005799,
WO2013006838 and WO2013006842; each of which is herein incorporated
by reference in their entirety).
[0821] In one embodiment, the self-replicating polynucleotides,
primary constructs or mmRNA of the invention may be formulated
using methods described herein or known in the art. As a
non-limiting example, the self-replicating RNA may be formulated
for delivery by the methods described in Geall et al (Nonviral
delivery of self-amplifying RNA vaccines, PNAS 2012; PMID:
22908294).
[0822] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the present invention may encode amphipathic and/or
immunogenic amphipathic peptides.
[0823] In on embodiment, a formulation of the polynucleotides,
primary constructs or mmRNA of the present invention may further
comprise an amphipathic and/or immunogenic amphipathic peptide. As
a non-limiting example, the polynucleotides, primary constructs or
mmRNA comprising an amphipathic and/or immunogenic amphipathic
peptide may be formulated as described in US. Pub. No.
US20110250237 and International Pub. Nos. WO2010009277 and
WO2010009065; each of which is herein incorporated by reference in
their entirety.
[0824] In one embodiment, the polynucleotides, primary constructs
or mmRNA of the present invention may be immunostimultory. As a
non-limiting example, the polynucleotides, primary constructs or
mmRNA may encode all or a part of a positive-sense or a
negative-sense stranded RNA virus genome (see International Pub No.
WO2012092569 and US Pub No. US20120177701, each of which is herein
incorporated by reference in their entirety). In another
non-limiting example, the immunostimultory polynucleotides, primary
constructs or mmRNA of the present invention may be formulated with
an excipient for administration as described herein and/or known in
the art (see International Pub No. WO2012068295 and US Pub No.
US20120213812, each of which is herein incorporated by reference in
their entirety).
[0825] In one embodiment, the response of the vaccine formulated by
the methods described herein may be enhanced by the addition of
various compounds to induce the therapeutic effect. As a
non-limiting example, the vaccine formulation may include a MHC II
binding peptide or a peptide having a similar sequence to a MHC II
binding peptide (see International Pub Nos. WO2012027365,
WO2011031298 and US Pub No. US20120070493, US20110110965, each of
which is herein incorporated by reference in their entirety). As
another example, the vaccine formulations may comprise modified
nicotinic compounds which may generate an antibody response to
nicotine residue in a subject (see International Pub No.
WO2012061717 and US Pub No. US20120114677, each of which is herein
incorporated by reference in their entirety).
Naturally Occurring Mutants
[0826] In another embodiment, the polynucleotides, primary
construct and/or mmRNA can be utilized to express variants of
naturally occurring proteins that have an improved disease
modifying activity, including increased biological activity,
improved patient outcomes, or a protective function, etc. Many such
modifier genes have been described in mammals (Nadeau, Current
Opinion in Genetics & Development 2003 13:290-295; Hamilton and
Yu, PLoS Genet. 2012; 8:e1002644; Corder et al., Nature Genetics
1994 7:180-184; all herein incorporated by reference in their
entireties). Examples in humans include Apo E2 protein, Apo A-I
variant proteins (Apo A-I Milano, Apo A-I Paris), hyperactive
Factor IX protein (Factor IX Padua Arg338Lys), transthyretin
mutants (TTR Thr119Met). Expression of ApoE2 (cys112, cys158) has
been shown to confer protection relative to other ApoE isoforms
(ApoE3 (cyst 12, arg158), and ApoE4 (arg112, arg158)) by reducing
susceptibility to Alzheimer's disease and possibly other conditions
such as cardiovascular disease (Corder et al., Nature Genetics 1994
7:180-184; Seripa et al., Rejuvenation Res. 2011 14:491-500; Liu et
al. Nat Rev Neurol. 2013 9:106-118; all herein incorporated by
reference in their entireties). Expression of Apo A-I variants has
been associated with reduced cholesterol (deGoma and Rader, 2011
Nature Rev Cardiol 8:266-271; Nissen et al., 2003 JAMA
290:2292-2300; all herein incorporated by reference in its
entirety). The amino acid sequence of ApoA-I in certain populations
has been changed to cysteine in Apo A-I Milano (Arg 173 changed to
Cys) and in Apo A-I Paris (Arg 151 changed to Cys). Factor IX
mutation at position R338L (FIX Padua) results in a Factor IX
protein that has .about.10-fold increased activity (Simioni et al.,
N Engl J Med. 2009 361:1671-1675; Finn et al., Blood. 2012
120:4521-4523; Cantore et al., Blood. 2012 120:4517-20; all herein
incorporated by reference in their entireties). Mutation of
transthyretin at positions 104 or 119 (Arg104 H is, Thrl 19Met) has
been shown to provide protection to patients also harboring the
disease causing Va13OMet mutations (Saraiva, Hum Mutat. 2001
17:493-503; DATA BASE ON TRANSTHYRETIN MUTATIONS
http://www.ibmc.up.pt/mjsaraiva/ttrmut.html; all herein
incorporated by reference in its entirety). Differences in clinical
presentation and severity of symptoms among Portuguese and Japanese
Met 30 patients carrying respectively the Met 119 and the H is 104
mutations are observed with a clear protective effect exerted by
the non pathogenic mutant (Coelho et al. 1996 Neuromuscular
Disorders (Suppl) 6: S20; Terazaki et al. 1999. Biochem Biophys Res
Commun 264: 365-370; all herein incorporated by reference in its
entirety), which confer more stability to the molecule. A modified
mRNA encoding these protective TTR alleles can be expressed in TTR
amyloidosis patients, thereby reducing the effect of the pathogenic
mutant TTR protein.
Major Groove Interacting Partners
[0827] As described herein, the phrase "major groove interacting
partner" refers to RNA recognition receptors that detect and
respond to RNA ligands through interactions, e.g. binding, with the
major groove face of a nucleotide or nucleic acid. As such, RNA
ligands comprising modified nucleotides or nucleic acids such as
the polynucleotide, primary construct or mmRNA as described herein
decrease interactions with major groove binding partners, and
therefore decrease an innate immune response.
[0828] Example major groove interacting, e.g. binding, partners
include, but are not limited to the following nucleases and
helicases. Within membranes, TLRs (Toll-like Receptors) 3, 7, and 8
can respond to single- and double-stranded RNAs. Within the
cytoplasm, members of the superfamily 2 class of DEX(D/H) helicases
and ATPases can sense RNAs to initiate antiviral responses. These
helicases include the RIG-I (retinoic acid-inducible gene I) and
MDA5 (melanoma differentiation-associated gene 5). Other examples
include laboratory of genetics and physiology 2 (LGP2), HIN-200
domain containing proteins, or Helicase-domain containing
proteins.
Targeting of Pathogenic Organisms or Diseased Cells
[0829] Provided herein are methods for targeting pathogenic
microorganisms, such as bacteria, yeast, protozoa, helminthes and
the like, or diseased cells such as cancer cells using
polynucleotides, primary constructs or mmRNA that encode cytostatic
or cytotoxic polypeptides. Preferably the mRNA introduced contains
modified nucleosides or other nucleic acid sequence modifications
that are translated exclusively, or preferentially, in the target
pathogenic organism, to reduce possible off-target effects of the
therapeutic. Such methods are useful for removing pathogenic
organisms or killing diseased cells found in any biological
material, including blood, semen, eggs, and transplant materials
including embryos, tissues, and organs.
Bioprocessing
[0830] The methods provided herein may be useful for enhancing
protein product yield in a cell culture process. In a cell culture
containing a plurality of host cells, introduction of a
polynucleotide, primary construct or mmRNA described herein results
in increased protein production efficiency relative to a
corresponding unmodified nucleic acid. Such increased protein
production efficiency can be demonstrated, e.g., by showing
increased cell transfection, increased protein translation from the
polynucleotide, primary construct or mmRNA, decreased nucleic acid
degradation, and/or reduced innate immune response of the host
cell. Protein production can be measured by enzyme-linked
immunosorbent assay (ELISA), and protein activity can be measured
by various functional assays known in the art. The protein
production may be generated in a continuous or a batch-fed
mammalian process.
[0831] Additionally, it is useful to optimize the expression of a
specific polypeptide in a cell line or collection of cell lines of
potential interest, particularly a polypeptide of interest such as
a protein variant of a reference protein having a known activity.
In one embodiment, provided is a method of optimizing expression of
a polypeptide of interest in a target cell, by providing a
plurality of target cell types, and independently contacting with
each of the plurality of target cell types a polynucleotide,
primary construct or mmRNA encoding a polypeptide of interest. The
cells may be transfected with two or more polynucleotide, primary
construct or mmRNA simultaneously or sequentially.
[0832] In certain embodiments, multiple rounds of the methods
described herein may be used to obtain cells with increased
expression of one or more nucleic acids or proteins of interest.
For example, cells may be transfected with one or more
polynucleotide, primary construct or mmRNA that encode a nucleic
acid or protein of interest. The cells may be isolated according to
methods described herein before being subjected to further rounds
of transfections with one or more other nucleic acids which encode
a nucleic acid or protein of interest before being isolated again.
This method may be useful for generating cells with increased
expression of a complex of proteins, nucleic acids or proteins in
the same or related biological pathway, nucleic acids or proteins
that act upstream or downstream of each other, nucleic acids or
proteins that have a modulating, activating or repressing function
to each other, nucleic acids or proteins that are dependent on each
other for function or activity, or nucleic acids or proteins that
share homology.
[0833] Additionally, culture conditions may be altered to increase
protein production efficiency. Subsequently, the presence and/or
level of the polypeptide of interest in the plurality of target
cell types is detected and/or quantitated, allowing for the
optimization of a polypeptide's expression by selection of an
efficient target cell and cell culture conditions relating thereto.
Such methods are particularly useful when the polypeptide contains
one or more post-translational modifications or has substantial
tertiary structure, situations which often complicate efficient
protein production.
[0834] In one embodiment, the cells used in the methods of the
present invention may be cultured. The cells may be cultured in
suspension or as adherent cultures. The cells may be cultured in a
varied of vessels including, but not limited to, bioreactors, cell
bags, wave bags, culture plates, flasks and other vessels well
known to those of ordinary skill in the art. Cells may be cultured
in IMDM (Invitrogen, Catalog number 12440-53) or any other suitable
media including, but not limited to, chemically defined media
formulations. The ambient conditions which may be suitable for cell
culture, such as temperature and atmospheric composition, are well
known to those skilled in the art. The methods of the invention may
be used with any cell that is suitable for use in protein
production.
[0835] The invention provides for the repeated introduction (e.g.,
transfection) of modified nucleic acids into a target cell
population, e.g., in vitro, ex vivo, in situ, or in vivo. For
example, contacting the same cell population may be repeated one or
more times (such as two, three, four, five or more than five
times). In some embodiments, the step of contacting the cell
population with the polynucleotides, primary constructs or mmRNA is
repeated a number of times sufficient such that a predetermined
efficiency of protein translation in the cell population is
achieved. Given the often reduced cytotoxicity of the target cell
population provided by the nucleic acid modifications, repeated
transfections are achievable in a diverse array of cell types and
within a variety of tissues, as provided herein.
[0836] In one embodiment, the bioprocessing methods of the present
invention may be used to produce antibodies or functional fragments
thereof. The functional fragments may comprise a Fab, Fab',
F(ab').sub.2, an Fv domain, an scFv, or a diabody. They may be
variable in any region including the complement determining region
(CDR). In one embodiment, there is complete diversity in the CDR3
region. In another embodiment, the antibody is substantially
conserved except in the CDR3 region.
[0837] Antibodies may be made which bind or associate with any
biomolecule, whether human, pathogenic or non-human in origin. The
pathogen may be present in a non-human mammal, a clinical specimen
or from a commercial product such as a cosmetic or pharmaceutical
material. They may also bind to any specimen or sample including
clinical specimens or tissue samples from any organism.
[0838] In some embodiments, the contacting step is repeated
multiple times at a frequency selected from the group consisting
of: 6 hour, 12 hour, 24 hour, 36 hour, 48 hour, 72 hour, 84 hour,
96 hour, and 108 hour and at concentrations of less than 20 nM,
less than 50 nM, less than 80 nM or less than 100 nM. Compositions
may also be administered at less than 1 mM, less than 5 mM, less
than 10 mM, less than 100 mM or less than 500 mM.
[0839] In some embodiments, the polynucleotides, primary constructs
or mmRNA are added at an amount of 50 molecules per cell, 100
molecules/cell, 200 molecules/cell, 300 molecules/cell, 400
molecules/cell, 500 molecules/cell, 600 molecules/cell, 700
molecules/cell, 800 molecules/cell, 900 molecules/cell, 1000
molecules/cell, 2000 molecules/cell, or 5000 molecules/cell.
[0840] In other embodiments, the polynucleotides, primary
constructs or mmRNA are added at a concentration selected from the
group consisting of: 0.01 fmol/106 cells, 0.1 fmol/106 cells, 0.5
fmol/106 cells, 0.75 fmol/106 cells, 1 fmol/106 cells, 2 fmol/106
cells, 5 fmol/106 cells, 10 fmol/106 cells, 20 fmol/106 cells, 30
fmol/106 cells, 40 fmol/106 cells, 50 fmol/106 cells, 60 fmol/106
cells, 100 fmol/106 cells, 200 fmol/106 cells, 300 fmol/106 cells,
400 fmol/106 cells, 500 fmol/106 cells, 700 fmol/106 cells, 800
fmol/106 cells, 900 fmol/106 cells, and 1 pmol/106 cells.
[0841] In some embodiments, the production of a biological product
upon is detected by monitoring one or more measurable bioprocess
parameters, such as a parameter selected from the group consisting
of: cell density, pH, oxygen levels, glucose levels, lactic acid
levels, temperature, and protein production. Protein production can
be measured as specific productivity (SP) (the concentration of a
product, such as a heterologously expressed polypeptide, in
solution) and can be expressed as mg/L or g/L; in the alternative,
specific productivity can be expressed as pg/cell/day. An increase
in SP can refer to an absolute or relative increase in the
concentration of a product produced under two defined set of
conditions (e.g., when compared with controls not treated with
modified mRNA(s)).
Cells
[0842] In one embodiment, the cells are selected from the group
consisting of mammalian cells, bacterial cells, plant, microbial,
algal and fungal cells. In some embodiments, the cells are
mammalian cells, such as, but not limited to, human, mouse, rat,
goat, horse, rabbit, hamster or cow cells. In a further embodiment,
the cells may be from an established cell line, including, but not
limited to, HeLa, NS0, SP2/0, KEK 293T, Vero, Caco, Caco-2, MDCK,
COS-1, COS-7, K562, Jurkat, CHO-K1, DG44, CHOK1SV, CHO-S, Huvec,
CV-1, Huh-7, NIH3T3, HEK293, 293, A549, HepG2, IMR-90, MCF-7,
U-20S, Per.C6, SF9, SF21 or Chinese Hamster Ovary (CHO) cells.
[0843] In certain embodiments, the cells are fungal cells, such as,
but not limited to, Chrysosporium cells, Aspergillus cells,
Trichoderma cells, Dictyostelium cells, Candida cells,
Saccharomyces cells, Schizosaccharomyces cells, and Penicillium
cells.
[0844] In certain embodiments, the cells are bacterial cells such
as, but not limited to, E. coli, B. subtilis, or BL21 cells.
Primary and secondary cells to be transfected by the methods of the
invention can be obtained from a variety of tissues and include,
but are not limited to, all cell types which can be maintained in
culture. For examples, primary and secondary cells which can be
transfected by the methods of the invention include, but are not
limited to, fibroblasts, keratinocytes, epithelial cells (e.g.,
mammary epithelial cells, intestinal epithelial cells), endothelial
cells, glial cells, neural cells, formed elements of the blood
(e.g., lymphocytes, bone marrow cells), muscle cells and precursors
of these somatic cell types. Primary cells may also be obtained
from a donor of the same species or from another species (e.g.,
mouse, rat, rabbit, cat, dog, pig, cow, bird, sheep, goat,
horse).
Purification and Isolation
[0845] Those of ordinary skill in the art should be able to make a
determination of the methods to use to purify or isolate of a
protein of interest from cultured cells. Generally, this is done
through a capture method using affinity binding or non-affinity
purification. If the protein of interest is not secreted by the
cultured cells, then a lysis of the cultured cells should be
performed prior to purification or isolation. One may use
unclarified cell culture fluid containing the protein of interest
along with cell culture media components as well as cell culture
additives, such as anti-foam compounds and other nutrients and
supplements, cells, cellular debris, host cell proteins, DNA,
viruses and the like in the present invention. The process may be
conducted in the bioreactor itself. The fluid may either be
preconditioned to a desired stimulus such as pH, temperature or
other stimulus characteristic or the fluid can be conditioned upon
the addition of polymer(s) or the polymer(s) can be added to a
carrier liquid that is properly conditioned to the required
parameter for the stimulus condition required for that polymer to
be solubilized in the fluid. The polymer may be allowed to
circulate thoroughly with the fluid and then the stimulus may be
applied (change in pH, temperature, salt concentration, etc) and
the desired protein and polymer(s) precipitate can out of the
solution. The polymer and the desired protein(s) can be separated
from the rest of the fluid and optionally washed one or more times
to remove any trapped or loosely bound contaminants. The desired
protein may then be recovered from the polymer(s) by, for example,
elution and the like. Preferably, the elution may be done under a
set of conditions such that the polymer remains in its precipitated
form and retains any impurities to it during the selected elution
of the desired protein. The polymer and protein as well as any
impurities may be solubilized in a new fluid such as water or a
buffered solution and the protein may be recovered by a means such
as affinity, ion exchanged, hydrophobic, or some other type of
chromatography that has a preference and selectivity for the
protein over that of the polymer or impurities. The eluted protein
may then be recovered and may be subjected to additional processing
steps, either batch like steps or continuous flow through steps if
appropriate.
[0846] In another embodiment, it may be useful to optimize the
expression of a specific polypeptide in a cell line or collection
of cell lines of potential interest, particularly a polypeptide of
interest such as a protein variant of a reference protein having a
known activity. In one embodiment, provided is a method of
optimizing expression of a polypeptide of interest in a target
cell, by providing a plurality of target cell types, and
independently contacting with each of the plurality of target cell
types a modified mRNA encoding a polypeptide. Additionally, culture
conditions may be altered to increase protein production
efficiency. Subsequently, the presence and/or level of the
polypeptide of interest in the plurality of target cell types is
detected and/or quantitated, allowing for the optimization of a
polypeptide of interest's expression by selection of an efficient
target cell and cell culture conditions relating thereto. Such
methods may be useful when the polypeptide of interest contains one
or more post-translational modifications or has substantial
tertiary structure, which often complicate efficient protein
production.
Protein Recovery
[0847] The protein of interest may be preferably recovered from the
culture medium as a secreted polypeptide, or it can be recovered
from host cell lysates if expressed without a secretory signal. It
may be necessary to purify the protein of interest from other
recombinant proteins and host cell proteins in a way that
substantially homogenous preparations of the protein of interest
are obtained. The cells and/or particulate cell debris may be
removed from the culture medium or lysate. The product of interest
may then be purified from contaminant soluble proteins,
polypeptides and nucleic acids by, for example, fractionation on
immunoaffinity or ion-exchange columns, ethanol precipitation,
reverse phase HPLC(RP-HPLC), SEPHADEX.RTM. chromatography,
chromatography on silica or on a cation exchange resin such as
DEAE. Methods of purifying a protein heterologous expressed by a
host cell are well known in the art.
[0848] Methods and compositions described herein may be used to
produce proteins which are capable of attenuating or blocking the
endogenous agonist biological response and/or antagonizing a
receptor or signaling molecule in a mammalian subject. For example,
IL-12 and IL-23 receptor signaling may be enhanced in chronic
autoimmune disorders such as multiple sclerosis and inflammatory
diseases such as rheumatoid arthritis, psoriasis, lupus
erythematosus, ankylosing spondylitis and Chron's disease (Kikly K,
Liu L, Na S, Sedgwich J D (2006) Cur. Opin. Immunol. 18(6): 670-5).
In another embodiment, a nucleic acid encodes an antagonist for
chemokine receptors. Chemokine receptors CXCR-4 and CCR-5 are
required for HIV enry into host cells (Arenzana-Seisdedos F et al,
(1996) Nature. October 3; 383 (6599):400).
Gene Silencing
[0849] The polynucleotides, primary constructs and mmRNA described
herein are useful to silence (i.e., prevent or substantially
reduce) expression of one or more target genes in a cell
population. A polynucleotide, primary construct or mmRNA encoding a
polypeptide of interest capable of directing sequence-specific
histone H3 methylation is introduced into the cells in the
population under conditions such that the polypeptide is translated
and reduces gene transcription of a target gene via histone H3
methylation and subsequent heterochromatin formation. In some
embodiments, the silencing mechanism is performed on a cell
population present in a mammalian subject. By way of non-limiting
example, a useful target gene is a mutated Janus Kinase-2 family
member, wherein the mammalian subject expresses the mutant target
gene suffers from a myeloproliferative disease resulting from
aberrant kinase activity.
[0850] Co-administration of polynucleotides, primary constructs and
mmRNA and RNAi agents are also provided herein.
Modulation of Biological Pathways
[0851] The rapid translation polynucleotides, primary constructs
and mmRNA introduced into cells provides a desirable mechanism of
modulating target biological pathways. Such modulation includes
antagonism or agonism of a given pathway. In one embodiment, a
method is provided for antagonizing a biological pathway in a cell
by contacting the cell with an effective amount of a composition
comprising a polynucleotide, primary construct or mmRNA encoding a
polypeptide of interest, under conditions such that the
polynucleotides, primary constructs and mmRNA is localized into the
cell and the polypeptide is capable of being translated in the cell
from the polynucleotides, primary constructs and mmRNA, wherein the
polypeptide inhibits the activity of a polypeptide functional in
the biological pathway. Exemplary biological pathways are those
defective in an autoimmune or inflammatory disorder such as
multiple sclerosis, rheumatoid arthritis, psoriasis, lupus
erythematosus, ankylosing spondylitis colitis, or Crohn's disease;
in particular, antagonism of the IL-12 and IL-23 signaling pathways
are of particular utility. (See Kikly K, Liu L, Na S, Sedgwick J D
(2006) Curr. Opin. Immunol. 18 (6): 670-5).
[0852] Further, provided are polynucleotide, primary construct or
mmRNA encoding an antagonist for chemokine receptors; chemokine
receptors CXCR-4 and CCR-5 are required for, e.g., HIV entry into
host cells (Arenzana-Seisdedos F et al, (1996) Nature. October 3;
383(6599):400).
[0853] Alternatively, provided are methods of agonizing a
biological pathway in a cell by contacting the cell with an
effective amount of a polynucleotide, primary construct or mmRNA
encoding a recombinant polypeptide under conditions such that the
nucleic acid is localized into the cell and the recombinant
polypeptide is capable of being translated in the cell from the
nucleic acid, and the recombinant polypeptide induces the activity
of a polypeptide functional in the biological pathway. Exemplary
agonized biological pathways include pathways that modulate cell
fate determination. Such agonization is reversible or,
alternatively, irreversible.
Expression of Ligand or Receptor on Cell Surface
[0854] In some aspects and embodiments of the aspects described
herein, the polynucleotides, primary constructs or mmRNA described
herein can be used to express a ligand or ligand receptor on the
surface of a cell (e.g., a homing moiety). A ligand or ligand
receptor moiety attached to a cell surface can permit the cell to
have a desired biological interaction with a tissue or an agent in
vivo. A ligand can be an antibody, an antibody fragment, an
aptamer, a peptide, a vitamin, a carbohydrate, a protein or
polypeptide, a receptor, e.g., cell-surface receptor, an adhesion
molecule, a glycoprotein, a sugar residue, a therapeutic agent, a
drug, a glycosaminoglycan, or any combination thereof. For example,
a ligand can be an antibody that recognizes a cancer-cell specific
antigen, rendering the cell capable of preferentially interacting
with tumor cells to permit tumor-specific localization of a
modified cell. A ligand can confer the ability of a cell
composition to accumulate in a tissue to be treated, since a
preferred ligand may be capable of interacting with a target
molecule on the external face of a tissue to be treated. Ligands
having limited cross-reactivity to other tissues are generally
preferred.
[0855] In some cases, a ligand can act as a homing moiety which
permits the cell to target to a specific tissue or interact with a
specific ligand. Such homing moieties can include, but are not
limited to, any member of a specific binding pair, antibodies,
monoclonal antibodies, or derivatives or analogs thereof, including
without limitation: Fv fragments, single chain Fv (scFv) fragments,
Fab' fragments, F(ab')2 fragments, single domain antibodies,
camelized antibodies and antibody fragments, humanized antibodies
and antibody fragments, and multivalent versions of the foregoing;
multivalent binding reagents including without limitation:
monospecific or bispecific antibodies, such as disulfide stabilized
Fv fragments, scFv tandems ((SCFV)2 fragments), diabodies,
tribodies or tetrabodies, which typically are covalently linked or
otherwise stabilized (i.e., leucine zipper or helix stabilized)
scFv fragments; and other homing moieties include for example,
aptamers, receptors, and fusion proteins.
[0856] In some embodiments, the homing moiety may be a
surface-bound antibody, which can permit tuning of cell targeting
specificity. This is especially useful since highly specific
antibodies can be raised against an epitope of interest for the
desired targeting site. In one embodiment, multiple antibodies are
expressed on the surface of a cell, and each antibody can have a
different specificity for a desired target. Such approaches can
increase the avidity and specificity of homing interactions.
[0857] A skilled artisan can select any homing moiety based on the
desired localization or function of the cell, for example an
estrogen receptor ligand, such as tamoxifen, can target cells to
estrogen-dependent breast cancer cells that have an increased
number of estrogen receptors on the cell surface. Other
non-limiting examples of ligand/receptor interactions include CCRI
(e.g., for treatment of inflamed joint tissues or brain in
rheumatoid arthritis, and/or multiple sclerosis), CCR7, CCR8 (e.g.,
targeting to lymph node tissue), CCR6, CCR9, CCR10 (e.g., to target
to intestinal tissue), CCR4, CCR10 (e.g., for targeting to skin),
CXCR4 (e.g., for general enhanced transmigration), HCELL (e.g., for
treatment of inflammation and inflammatory disorders, bone marrow),
Alpha4beta7 (e.g., for intestinal mucosa targeting), VLA-4NCAM-1
(e.g., targeting to endothelium). In general, any receptor involved
in targeting (e.g., cancer metastasis) can be harnessed for use in
the methods and compositions described herein.
Modulation of Cell Lineage
[0858] Provided are methods of inducing an alteration in cell fate
in a target mammalian cell. The target mammalian cell may be a
precursor cell and the alteration may involve driving
differentiation into a lineage, or blocking such differentiation.
Alternatively, the target mammalian cell may be a differentiated
cell, and the cell fate alteration includes driving
de-differentiation into a pluripotent precursor cell, or blocking
such de-differentiation, such as the dedifferentiation of cancer
cells into cancer stem cells. In situations where a change in cell
fate is desired, effective amounts of mRNAs encoding a cell fate
inductive polypeptide is introduced into a target cell under
conditions such that an alteration in cell fate is induced. In some
embodiments, the modified mRNAs are useful to reprogram a
subpopulation of cells from a first phenotype to a second
phenotype. Such a reprogramming may be temporary or permanent.
[0859] Optionally, the reprogramming induces a target cell to adopt
an intermediate phenotype.
[0860] Additionally, the methods of the present invention are
particularly useful to generate induced pluripotent stem cells (iPS
cells) because of the high efficiency of transfection, the ability
to re-transfect cells, and the tenability of the amount of
recombinant polypeptides produced in the target cells. Further, the
use of iPS cells generated using the methods described herein is
expected to have a reduced incidence of teratoma formation.
[0861] Also provided are methods of reducing cellular
differentiation in a target cell population. For example, a target
cell population containing one or more precursor cell types is
contacted with a composition having an effective amount of a
polynucleotides, primary constructs and mmRNA encoding a
polypeptide, under conditions such that the polypeptide is
translated and reduces the differentiation of the precursor cell.
In non-limiting embodiments, the target cell population contains
injured tissue in a mammalian subject or tissue affected by a
surgical procedure. The precursor cell is, e.g., a stromal
precursor cell, a neural precursor cell, or a mesenchymal precursor
cell.
[0862] In a specific embodiment, provided are polynucleotide,
primary construct or mmRNA that encode one or more differentiation
factors Gata4, Mef2c and Tbx4. These mRNA-generated factors are
introduced into fibroblasts and drive the reprogramming into
cardiomyocytes. Such a reprogramming can be performed in vivo, by
contacting an mRNA-containing patch or other material to damaged
cardiac tissue to facilitate cardiac regeneration. Such a process
promotes cardiomyocyte genesis as opposed to fibrosis.
Mediation of Cell Death
[0863] In one embodiment, polynucleotides, primary constructs or
mmRNA compositions can be used to induce apoptosis in a cell (e.g.,
a cancer cell) by increasing the expression of a death receptor, a
death receptor ligand or a combination thereof. This method can be
used to induce cell death in any desired cell and has particular
usefulness in the treatment of cancer where cells escape natural
apoptotic signals.
[0864] Apoptosis can be induced by multiple independent signaling
pathways that converge upon a final effector mechanism consisting
of multiple interactions between several "death receptors" and
their ligands, which belong to the tumor necrosis factor (TNF)
receptor/ligand superfamily. The best-characterized death receptors
are CD95 ("Fas"), TNFRI (p55), death receptor 3 (DR3 or
Apo3/TRAMO), DR4 and DR5 (apo2-TRAIL-R2). The final effector
mechanism of apoptosis may be the activation of a series of
proteinases designated as caspases. The activation of these
caspases results in the cleavage of a series of vital cellular
proteins and cell death. The molecular mechanism of death
receptors/ligands-induced apoptosis is well known in the art. For
example, Fas/FasL-mediated apoptosis is induced by binding of three
FasL molecules which induces trimerization of Fas receptor via
C-terminus death domains (DDs), which in turn recruits an adapter
protein FADD (Fas-associated protein with death domain) and
Caspase-8. The oligomerization of this trimolecular complex,
Fas/FAIDD/caspase-8, results in proteolytic cleavage of proenzyme
caspase-8 into active caspase-8 that, in turn, initiates the
apoptosis process by activating other downstream caspases through
proteolysis, including caspase-3. Death ligands in general are
apoptotic when formed into trimers or higher order of structures.
As monomers, they may serve as antiapoptotic agents by competing
with the trimers for binding to the death receptors.
[0865] In one embodiment, the polynucleotides, primary constructs
or mmRNA composition encodes for a death receptor (e.g., Fas,
TRAIL, TRAMO, TNFR, TLR etc). Cells made to express a death
receptor by transfection of polynucleotides, primary constructs and
mmRNA become susceptible to death induced by the ligand that
activates that receptor. Similarly, cells made to express a death
ligand, e.g., on their surface, will induce death of cells with the
receptor when the transfected cell contacts the target cell. In
another embodiment, the polynucleotides, primary constructs and
mmRNA composition encodes for a death receptor ligand (e.g., FasL,
TNF, etc). In another embodiment, the polynucleotides, primary
constructs and mmRNA composition encodes a caspase (e.g., caspase
3, caspase 8, caspase 9 etc). Where cancer cells often exhibit a
failure to properly differentiate to a non-proliferative or
controlled proliferative form, in another embodiment, the
synthetic, polynucleotides, primary constructs and mmRNA
composition encodes for both a death receptor and its appropriate
activating ligand. In another embodiment, the synthetic,
polynucleotides, primary constructs and mmRNA composition encodes
for a differentiation factor that when expressed in the cancer
cell, such as a cancer stem cell, will induce the cell to
differentiate to a non-pathogenic or nonself-renewing phenotype
(e.g., reduced cell growth rate, reduced cell division etc) or to
induce the cell to enter a dormant cell phase (e.g., G.sub.o
resting phase).
[0866] One of skill in the art will appreciate that the use of
apoptosis-inducing techniques may require that the polynucleotides,
primary constructs or mmRNA are appropriately targeted to e.g.,
tumor cells to prevent unwanted wide-spread cell death. Thus, one
can use a delivery mechanism (e.g., attached ligand or antibody,
targeted liposome etc) that recognizes a cancer antigen such that
the polynucleotides, primary constructs or mmRNA are expressed only
in cancer cells.
Cosmetic Applications
[0867] In one embodiment, the polynucleotides, primary constructs
and/or mmRNA may be used in the treatment, amelioration or
prophylaxis of cosmetic conditions. Such conditions include acne,
rosacea, scarring, wrinkles, eczema, shingles, psoriasis, age
spots, birth marks, dry skin, calluses, rash (e.g., diaper, heat),
scabies, hives, warts, insect bites, vitiligo, dandruff, freckles,
and general signs of aging.
VI. KITS AND DEVICES
Kits
[0868] The invention provides a variety of kits for conveniently
and/or effectively carrying out methods of the present invention.
Typically kits will comprise sufficient amounts and/or numbers of
components to allow a user to perform multiple treatments of a
subject(s) and/or to perform multiple experiments.
[0869] In one aspect, the present invention provides kits
comprising the molecules (polynucleotides, primary constructs or
mmRNA) of the invention. In one embodiment, the kit comprises one
or more functional antibodies or function fragments thereof.
[0870] Said kits can be for protein production, comprising a first
polynucleotide, primary construct or mmRNA comprising a
translatable region. The kit may further comprise packaging and
instructions and/or a delivery agent to form a formulation
composition. The delivery agent may comprise a saline, a buffered
solution, a lipidoid or any delivery agent disclosed herein.
[0871] In one embodiment, the buffer solution may include sodium
chloride, calcium chloride, phosphate and/or EDTA. In another
embodiment, the buffer solution may include, but is not limited to,
saline, saline with 2 mM calcium, 5% sucrose, 5% sucrose with 2 mM
calcium, 5% Mannitol, 5% Mannitol with 2 mM calcium, Ringer's
lactate, sodium chloride, sodium chloride with 2 mM calcium and
mannose (See e.g., U.S. Pub. No. 20120258046; herein incorporated
by reference in its entirety). In a further embodiment, the buffer
solutions may be precipitated or it may be lyophilized. The amount
of each component may be varied to enable consistent, reproducible
higher concentration saline or simple buffer formulations. The
components may also be varied in order to increase the stability of
modified RNA in the buffer solution over a period of time and/or
under a variety of conditions. In one aspect, the present invention
provides kits for protein production, comprising: a polynucleotide,
primary construct or mmRNA comprising a translatable region,
provided in an amount effective to produce a desired amount of a
protein encoded by the translatable region when introduced into a
target cell; a second polynucleotide comprising an inhibitory
nucleic acid, provided in an amount effective to substantially
inhibit the innate immune response of the cell; and packaging and
instructions.
[0872] In one aspect, the present invention provides kits for
protein production, comprising a polynucleotide, primary construct
or mmRNA comprising a translatable region, wherein the
polynucleotide exhibits reduced degradation by a cellular nuclease,
and packaging and instructions.
[0873] In one aspect, the present invention provides kits for
protein production, comprising a polynucleotide, primary construct
or mmRNA comprising a translatable region, wherein the
polynucleotide exhibits reduced degradation by a cellular nuclease,
and a mammalian cell suitable for translation of the translatable
region of the first nucleic acid.
[0874] In one embodiment, the levels of Protein C may be measured
by immunoassay. The assay may be purchased and is available from
any number of suppliers including BioMerieux, Inc. (Durham, N.C.),
Abbott Laboratories (Abbott Park, Ill.), Siemens Medical Solutions
USA, Inc. (Malvern, Pa.), BIOPORTO.RTM. Diagnostics A/S (Gentofte,
Denmark), USCN.RTM. Life Science Inc. (Houston, Tex.) or Roche
Diagnostic Corporation (Indianapolis, Ind.). In this embodiment,
the assay may be used to assess levels of Protein C or its
activated form or a variant delivered as or in response to
administration of a modified mRNA molecule.
Devices
[0875] The present invention provides for devices which may
incorporate polynucleotides, primary constructs or mmRNA that
encode polypeptides of interest. These devices contain in a stable
formulation the reagents to synthesize a polynucleotide in a
formulation available to be immediately delivered to a subject in
need thereof, such as a human patient. Non-limiting examples of
such a polypeptide of interest include a growth factor and/or
angiogenesis stimulator for wound healing, a peptide antibiotic to
facilitate infection control, and an antigen to rapidly stimulate
an immune response to a newly identified virus.
[0876] Devices may also be used in conjunction with the present
invention. In one embodiment, a device is used to assess levels of
a protein which has been administered in the form of a modified
mRNA. The device may comprise a blood, urine or other biofluidic
test. It may be as large as to include an automated central lab
platform or a small decentralized bench top device. It may be point
of care or a handheld device. In this embodiment, for example,
Protein C or APC may be quatitated before, during or after
treatment with a modified mRNA encoding Protein C (its zymogen),
APC or any variants thereof. Protein C, also known as
autoprothrombin IIA and blood coagulation factor XIV is a zymogen,
or precursor, of a serine protease which plays an important role in
the regulation of blood coagulation and generation of fibrinolytic
activity in vivo. It is synthesized in the liver as a single-chain
polypeptide but undergoes posttranslational processing to give rise
to a two-chain intermediate. The intermediate form of Protein C is
converted via thrombin-mediated cleavage of a 12-residue peptide
from the amino-terminus of the heavy chain to of the molecule to
the active form, known as "activated protein C" (APC). The device
may be useful in drug discovery efforts as a companion diagnostic
test associated with Protein C, or APC treatment such as for sepsis
or severe sepsis. In early studies it was suggested that APC had
the ability to reduce mortality in severe sepsis. Following this
line of work, clinical studies lead to the FDA approval of one
compound, activated drotrecogin alfa (recombinant protein C).
However, in late 2011, the drug was withdrawn from sale in all
markets following results of the PROWESS-SHOCK study, which showed
the study did not meet the primary endpoint of a statistically
significant reduction in 28-day all-cause mortality in patients
with septic shock. The present invention provides modified mRNA
molecules which may be used in the diagnosis and treatment of
sepsis, severe sepsis and septicemia which overcome prior issues or
problems associated with increasing protein expression efficiencies
in mammals.
[0877] In some embodiments the device is self-contained, and is
optionally capable of wireless remote access to obtain instructions
for synthesis and/or analysis of the generated polynucleotide,
primary construct or mmRNA. The device is capable of mobile
synthesis of at least one polynucleotide, primary construct or
mmRNA and preferably an unlimited number of different
polynucleotides, primary constructs or mmRNA. In certain
embodiments, the device is capable of being transported by one or a
small number of individuals. In other embodiments, the device is
scaled to fit on a benchtop or desk. In other embodiments, the
device is scaled to fit into a suitcase, backpack or similarly
sized object. In another embodiment, the device may be a point of
care or handheld device. In further embodiments, the device is
scaled to fit into a vehicle, such as a car, truck or ambulance, or
a military vehicle such as a tank or personnel carrier. The
information necessary to generate a modified mRNA encoding
polypeptide of interest is present within a computer readable
medium present in the device.
[0878] In one embodiment, a device may be used to assess levels of
a protein which has been administered in the form of a
polynucleotide, primary construct or mmRNA. The device may comprise
a blood, urine or other biofluidic test.
[0879] In some embodiments, the device is capable of communication
(e.g., wireless communication) with a database of nucleic acid and
polypeptide sequences. The device contains at least one sample
block for insertion of one or more sample vessels. Such sample
vessels are capable of accepting in liquid or other form any number
of materials such as template DNA, nucleotides, enzymes, buffers,
and other reagents. The sample vessels are also capable of being
heated and cooled by contact with the sample block. The sample
block is generally in communication with a device base with one or
more electronic control units for the at least one sample block.
The sample block preferably contains a heating module, such heating
molecule capable of heating and/or cooling the sample vessels and
contents thereof to temperatures between about -20 C and above +100
C. The device base is in communication with a voltage supply such
as a battery or external voltage supply. The device also contains
means for storing and distributing the materials for RNA
synthesis.
[0880] Optionally, the sample block contains a module for
separating the synthesized nucleic acids. Alternatively, the device
contains a separation module operably linked to the sample block.
Preferably the device contains a means for analysis of the
synthesized nucleic acid. Such analysis includes sequence identity
(demonstrated such as by hybridization), absence of non-desired
sequences, measurement of integrity of synthesized mRNA (such has
by microfluidic viscometry combined with spectrophotometry), and
concentration and/or potency of modified RNA (such as by
spectrophotometry).
[0881] In certain embodiments, the device is combined with a means
for detection of pathogens present in a biological material
obtained from a subject, e.g., the IBIS PLEX-ID system (Abbott,
Abbott Park, Ill.) for microbial identification.
[0882] Suitable devices for use in delivering intradermal
pharmaceutical compositions described herein include short needle
devices such as those described in U.S. Pat. Nos. 4,886,499;
5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235; 5,141,496;
and 5,417,662; each of which is herein incorporated by reference in
their entirety. Intradermal compositions may be administered by
devices which limit the effective penetration length of a needle
into the skin, such as those described in PCT publication WO
99/34850 (herein incorporated by reference in its entirety) and
functional equivalents thereof. Jet injection devices which deliver
liquid compositions to the dermis via a liquid jet injector and/or
via a needle which pierces the stratum corneum and produces a jet
which reaches the dermis are suitable. Jet injection devices are
described, for example, in U.S. Pat. Nos. 5,480,381; 5,599,302;
5,334,144; 5,993,412; 5,649,912; 5,569,189; 5,704,911; 5,383,851;
5,893,397; 5,466,220; 5,339,163; 5,312,335; 5,503,627; 5,064,413;
5,520,639; 4,596,556; 4,790,824; 4,941,880; 4,940,460; and PCT
publications WO 97/37705 and WO 97/13537; each of which are hrein
incorporated by reference in their entirety. Ballistic
powder/particle delivery devices which use compressed gas to
accelerate vaccine in powder form through the outer layers of the
skin to the dermis are suitable. Alternatively or additionally,
conventional syringes may be used in the classical mantoux method
of intradermal administration.
[0883] In some embodiments, the device may be a pump or comprise a
catheter for administration of compounds or compositions of the
invention across the blood brain barrier. Such devices include but
are not limited to a pressurized olfactory delivery device,
iontophoresis devices, multi-layered microfluidic devices, and the
like. Such devices may be portable or stationary. They may be
implantable or externally tethered to the body or combinations
thereof.
[0884] Devices for administration may be employed to deliver the
polynucleotides, primary constructs or mmRNA of the present
invention according to single, multi- or split-dosing regimens
taught herein. Such devices are described below.
[0885] Method and devices known in the art for multi-administration
to cells, organs and tissues are contemplated for use in
conjunction with the methods and compositions disclosed herein as
embodiments of the present invention. These include, for example,
those methods and devices having multiple needles, hybrid devices
employing for example lumens or catheters as well as devices
utilizing heat, electric current or radiation driven
mechanisms.
[0886] According to the present invention, these
multi-administration devices may be utilized to deliver the single,
multi- or split doses contemplated herein.
[0887] A method for delivering therapeutic agents to a solid tissue
has been described by Bahrami et al. and is taught for example in
US Patent Publication 20110230839, the contents of which are
incorporated herein by reference in their entirety. According to
Bahrami, an array of needles is incorporated into a device which
delivers a substantially equal amount of fluid at any location in
said solid tissue along each needle's length.
[0888] A device for delivery of biological material across the
biological tissue has been described by Kodgule et al. and is
taught for example in US Patent Publication 20110172610, the
contents of which are incorporated herein by reference in their
entirety. According to Kodgule, multiple hollow micro-needles made
of one or more metals and having outer diameters from about 200
microns to about 350 microns and lengths of at least 100 microns
are incorporated into the device which delivers peptides, proteins,
carbohydrates, nucleic acid molecules, lipids and other
pharmaceutically active ingredients or combinations thereof.
[0889] A delivery probe for delivering a therapeutic agent to a
tissue has been described by Gunday et al. and is taught for
example in US Patent Publication 20110270184, the contents of each
of which are incorporated herein by reference in their entirety.
According to Gunday, multiple needles are incorporated into the
device which moves the attached capsules between an activated
position and an inactivated position to force the agent out of the
capsules through the needles.
[0890] A multiple-injection medical apparatus has been described by
Assaf and is taught for example in US Patent Publication
20110218497, the contents of which are incorporated herein by
reference in their entirety. According to Assaf, multiple needles
are incorporated into the device which has a chamber connected to
one or more of said needles and a means for continuously refilling
the chamber with the medical fluid after each injection.
[0891] In one embodiment, the polynucleotide, primary construct, or
mmRNA is administered subcutaneously or intramuscularly via at
least 3 needles to three different, optionally adjacent, sites
simultaneously, or within a 60 minutes period (e.g., administration
to 4, 5, 6, 7, 8, 9, or 10 sites simultaneously or within a 60
minute period). The split doses can be administered simultaneously
to adjacent tissue using the devices described in U.S. Patent
Publication Nos. 20110230839 and 20110218497, each of which is
incorporated herein by reference in their entirety.
[0892] An at least partially implantable system for injecting a
substance into a patient's body, in particular a penis erection
stimulation system has been described by Forsell and is taught for
example in US Patent Publication 20110196198, the contents of which
are incorporated herein by reference in their entirety. According
to Forsell, multiple needles are incorporated into the device which
is implanted along with one or more housings adjacent the patient's
left and right corpora cavernosa. A reservoir and a pump are also
implanted to supply drugs through the needles.
[0893] A method for the transdermal delivery of a therapeutic
effective amount of iron has been described by Berenson and is
taught for example in US Patent Publication 20100130910, the
contents of which are incorporated herein by reference in their
entirety. According to Berenson, multiple needles may be used to
create multiple micro channels in stratum corneum to enhance
transdermal delivery of the ionic iron on an iontophoretic
patch.
[0894] A method for delivery of biological material across the
biological tissue has been described by Kodgule et al and is taught
for example in US Patent Publication 20110196308, the contents of
which are incorporated herein by reference in their entirety.
According to Kodgule, multiple biodegradable microneedles
containing a therapeutic active ingredient are incorporated in a
device which delivers proteins, carbohydrates, nucleic acid
molecules, lipids and other pharmaceutically active ingredients or
combinations thereof
[0895] A transdermal patch comprising a botulinum toxin composition
has been described by Donovan and is taught for example in US
Patent Publication 20080220020, the contents of which are
incorporated herein by reference in their entirety. According to
Donovan, multiple needles are incorporated into the patch which
delivers botulinum toxin under stratum corneum through said needles
which project through the stratum corneum of the skin without
rupturing a blood vessel.
[0896] A small, disposable drug reservoir, or patch pump, which can
hold approximately 0.2 to 15 mL of liquid formulations can be
placed on the skin and deliver the formulation continuously
subcutaneously using a small bore needed (e.g., 26 to 34 gauge). As
non-limiting examples, the patch pump may be 50 mm by 76 mm by 20
mm spring loaded having a 30 to 34 gauge needle (BD.TM.
Microinfuser, Franklin Lakes N.J.), 41 mm by 62 mm by 17 mm with a
2 mL reservoir used for drug delivery such as insulin
(OMNIPOD.RTM., Insulet Corporation Bedford, Mass.), or 43-60 mm
diameter, 10 mm thick with a 0.5 to 10 mL reservoir
(PATCHPUMP.RTM., SteadyMed Therapeutics, San Francisco, Calif.).
Further, the patch pump may be battery powered and/or
rechargeable.
[0897] A cryoprobe for administration of an active agent to a
location of cryogenic treatment has been described by Toubia and is
taught for example in US Patent Publication 20080140061, the
contents of which are incorporated herein by reference in their
entirety. According to Toubia, multiple needles are incorporated
into the probe which receives the active agent into a chamber and
administers the agent to the tissue.
[0898] A method for treating or preventing inflammation or
promoting healthy joints has been described by Stock et al and is
taught for example in US Patent Publication 20090155186, the
contents of which are incorporated herein by reference in their
entirety. According to Stock, multiple needles are incorporated in
a device which administers compositions containing signal
transduction modulator compounds.
[0899] A multi-site injection system has been described by Kimmell
et al. and is taught for example in US Patent Publication
20100256594, the contents of which are incorporated herein by
reference in their entirety. According to Kimmell, multiple needles
are incorporated into a device which delivers a medication into a
stratum corneum through the needles.
[0900] A method for delivering interferons to the intradermal
compartment has been described by Dekker et al. and is taught for
example in US Patent Publication 20050181033, the contents of which
are incorporated herein by reference in their entirety. According
to Dekker, multiple needles having an outlet with an exposed height
between 0 and 1 mm are incorporated into a device which improves
pharmacokinetics and bioavailability by delivering the substance at
a depth between 0.3 mm and 2 mm.
[0901] A method for delivering genes, enzymes and biological agents
to tissue cells has described by Desai and is taught for example in
US Patent Publication 20030073908, the contents of which are
incorporated herein by reference in their entirety. According to
Desai, multiple needles are incorporated into a device which is
inserted into a body and delivers a medication fluid through said
needles.
[0902] A method for treating cardiac arrhythmias with fibroblast
cells has been described by Lee et al and is taught for example in
US Patent Publication 20040005295, the contents of which are
incorporated herein by reference in their entirety. According to
Lee, multiple needles are incorporated into the device which
delivers fibroblast cells into the local region of the tissue.
[0903] A method using a magnetically controlled pump for treating a
brain tumor has been described by Shachar et al. and is taught for
example in U.S. Pat. No. 7,799,012 (method) and 7,799,016 (device),
the contents of which are incorporated herein by reference in their
entirety. According Shachar, multiple needles were incorporated
into the pump which pushes a medicating agent through the needles
at a controlled rate.
[0904] Methods of treating functional disorders of the bladder in
mammalian females have been described by Versi et al. and are
taught for example in U.S. Pat. No. 8,029,496, the contents of
which are incorporated herein by reference in their entirety.
According to Versi, an array of micro-needles is incorporated into
a device which delivers a therapeutic agent through the needles
directly into the trigone of the bladder.
[0905] A micro-needle transdermal transport device has been
described by Angel et al and is taught for example in U.S. Pat. No.
7,364,568, the contents of which are incorporated herein by
reference in their entirety. According to Angel, multiple needles
are incorporated into the device which transports a substance into
a body surface through the needles which are inserted into the
surface from different directions. The micro-needle transdermal
transport device may be a solid micro-needle system or a hollow
micro-needle system. As a non-limiting example, the solid
micro-needle system may have up to a 0.5 mg capacity, with 300-1500
solid micro-needles per cm.sup.2 about 150-700 lam tall coated with
a drug. The micro-needles penetrate the stratum corneum and remain
in the skin for short duration (e.g., 20 seconds to 15 minutes). In
another example, the hollow micro-needle system has up to a 3 mL
capacity to deliver liquid formulations using 15-20 microneedles
per cm2 being approximately 950 .mu.m tall. The micro-needles
penetrate the skin to allow the liquid formulations to flow from
the device into the skin. The hollow micro-needle system may be
worn from 1 to 30 minutes depending on the formulation volume and
viscocity.
[0906] A device for subcutaneous infusion has been described by
Dalton et al and is taught for example in U.S. Pat. No. 7,150,726,
the contents of which are incorporated herein by reference in their
entirety. According to Dalton, multiple needles are incorporated
into the device which delivers fluid through the needles into a
subcutaneous tissue.
[0907] A device and a method for intradermal delivery of vaccines
and gene therapeutic agents through microcannula have been
described by Mikszta et al. and are taught for example in U.S. Pat.
No. 7,473,247, the contents of which are incorporated herein by
reference in their entirety. According to Mitszta, at least one
hollow micro-needle is incorporated into the device which delivers
the vaccines to the subject's skin to a depth of between 0.025 mm
and 2 mm.
[0908] A method of delivering insulin has been described by Pettis
et al and is taught for example in U.S. Pat. No. 7,722,595, the
contents of which are incorporated herein by reference in their
entirety. According to Pettis, two needles are incorporated into a
device wherein both needles insert essentially simultaneously into
the skin with the first at a depth of less than 2.5 mm to deliver
insulin to intradermal compartment and the second at a depth of
greater than 2.5 mm and less than 5.0 mm to deliver insulin to
subcutaneous compartment.
[0909] Cutaneous injection delivery under suction has been
described by Kochamba et al. and is taught for example in U.S. Pat.
No. 6,896,666, the contents of which are incorporated herein by
reference in their entirety. According to Kochamba, multiple
needles in relative adjacency with each other are incorporated into
a device which injects a fluid below the cutaneous layer.
[0910] A device for withdrawing or delivering a substance through
the skin has been described by Down et al and is taught for example
in U.S. Pat. No. 6,607,513, the contents of which are incorporated
herein by reference in their entirety. According to Down, multiple
skin penetrating members which are incorporated into the device
have lengths of about 100 microns to about 2000 microns and are
about 30 to 50 gauge.
[0911] A device for delivering a substance to the skin has been
described by Palmer et al and is taught for example in U.S. Pat.
No. 6,537,242, the contents of which are incorporated herein by
reference in their entirety. According to Palmer, an array of
micro-needles is incorporated into the device which uses a
stretching assembly to enhance the contact of the needles with the
skin and provides a more uniform delivery of the substance.
[0912] A perfusion device for localized drug delivery has been
described by Zamoyski and is taught for example in U.S. Pat. No.
6,468,247, the contents of which are incorporated herein by
reference in their entirety. According to Zamoyski, multiple
hypodermic needles are incorporated into the device which injects
the contents of the hypodermics into a tissue as said hypodermics
are being retracted.
[0913] A method for enhanced transport of drugs and biological
molecules across tissue by improving the interaction between
micro-needles and human skin has been described by Prausnitz et al.
and is taught for example in U.S. Pat. No. 6,743,211, the contents
of which are incorporated herein by reference in their entirety.
According to Prausnitz, multiple micro-needles are incorporated
into a device which is able to present a more rigid and less
deformable surface to which the micro-needles are applied.
[0914] A device for intraorgan administration of medicinal agents
has been described by Ting et al and is taught for example in U.S.
Pat. No. 6,077,251, the contents of which are incorporated herein
by reference in their entirety. According to Ting, multiple needles
having side openings for enhanced administration are incorporated
into a device which by extending and retracting said needles from
and into the needle chamber forces a medicinal agent from a
reservoir into said needles and injects said medicinal agent into a
target organ.
[0915] A multiple needle holder and a subcutaneous multiple channel
infusion port has been described by Brown and is taught for example
in U.S. Pat. No. 4,695,273, the contents of which are incorporated
herein by reference in their entirety. According to Brown, multiple
needles on the needle holder are inserted through the septum of the
infusion port and communicate with isolated chambers in said
infusion port.
[0916] A dual hypodermic syringe has been described by Horn and is
taught for example in U.S. Pat. No. 3,552,394, the contents of
which are incorporated herein by reference in their entirety.
According to Horn, two needles incorporated into the device are
spaced apart less than 68 mm and may be of different styles and
lengths, thus enabling injections to be made to different
depths.
[0917] A syringe with multiple needles and multiple fluid
compartments has been described by Hershberg and is taught for
example in U.S. Pat. No. 3,572,336, the contents of which are
incorporated herein by reference in their entirety. According to
Hershberg, multiple needles are incorporated into the syringe which
has multiple fluid compartments and is capable of simultaneously
administering incompatible drugs which are not able to be mixed for
one injection.
[0918] A surgical instrument for intradermal injection of fluids
has been described by Eliscu et al. and is taught for example in
U.S. Pat. No. 2,588,623, the contents of which are incorporated
herein by reference in their entirety. According to Eliscu,
multiple needles are incorporated into the instrument which injects
fluids intradermally with a wider disperse.
[0919] An apparatus for simultaneous delivery of a substance to
multiple breast milk ducts has been described by Hung and is taught
for example in EP 1818017, the contents of which are incorporated
herein by reference in their entirety. According to Hung, multiple
lumens are incorporated into the device which inserts though the
orifices of the ductal networks and delivers a fluid to the ductal
networks.
[0920] A catheter for introduction of medications to the tissue of
a heart or other organs has been described by Tkebuchava and is
taught for example in WO2006138109, the contents of which are
incorporated herein by reference in their entirety. According to
Tkebuchava, two curved needles are incorporated which enter the
organ wall in a flattened trajectory.
[0921] Devices for delivering medical agents have been described by
Mckay et al. and are taught for example in WO2006118804, the
content of which are incorporated herein by reference in their
entirety. According to Mckay, multiple needles with multiple
orifices on each needle are incorporated into the devices to
facilitate regional delivery to a tissue, such as the interior disc
space of a spinal disc.
[0922] A method for directly delivering an immunomodulatory
substance into an intradermal space within a mammalian skin has
been described by Pettis and is taught for example in WO2004020014,
the contents of which are incorporated herein by reference in their
entirety. According to Pettis, multiple needles are incorporated
into a device which delivers the substance through the needles to a
depth between 0.3 mm and 2 mm.
[0923] Methods and devices for administration of substances into at
least two compartments in skin for systemic absorption and improved
pharmacokinetics have been described by Pettis et al. and are
taught for example in WO2003094995, the contents of which are
incorporated herein by reference in their entirety. According to
Pettis, multiple needles having lengths between about 300 .mu.m and
about 5 mm are incorporated into a device which delivers to
intradermal and subcutaneous tissue compartments
simultaneously.
[0924] A drug delivery device with needles and a roller has been
described by Zimmerman et al. and is taught for example in
WO2012006259, the contents of which are incorporated herein by
reference in their entirety. According to Zimmerman, multiple
hollow needles positioned in a roller are incorporated into the
device which delivers the content in a reservoir through the
needles as the roller rotates.
[0925] A drug delivery device such as a stent is known in the art
and is taught for example in U.S. Pat. No. 8,333,799, U.S. Pub.
Nos. US20060020329, US20040172127 and US20100161032; the contents
of each of which are herein incorporated by reference in their
entirety. Formulations of the polynucleotides, primary constructs,
mmRNA described herein may be delivered using stents. Additionally,
stents used herein may be able to deliver multiple polynucleotides,
primary constructs and/or mmRNA and/or formulations at the same or
varied rates of delivery. Non-limiting examples of manufacturers of
stents include CORDIS.RTM. (Miami, Fla.) (CYPHER.RTM.), Boston
Scientific Corporation (Natick, Mass.) (TAXUS.RTM.), Medtronic
(Minneapolis, Minn.) (ENDEAVOUR.RTM.) and Abbott (Abbott Park,
Ill.) (XIENCE V.RTM.).
Methods and Devices Utilizing Catheters and/or Lumens
[0926] Methods and devices using catheters and lumens may be
employed to administer the mmRNA of the present invention on a
single, multi- or split dosing schedule. Such methods and devices
are described below.
[0927] A catheter-based delivery of skeletal myoblasts to the
myocardium of damaged hearts has been described by Jacoby et al and
is taught for example in US Patent Publication 20060263338, the
contents of which are incorporated herein by reference in their
entirety. According to Jacoby, multiple needles are incorporated
into the device at least part of which is inserted into a blood
vessel and delivers the cell composition through the needles into
the localized region of the subject's heart.
[0928] An apparatus for treating asthma using neurotoxin has been
described by Deem et al and is taught for example in US Patent
Publication 20060225742, the contents of which are incorporated
herein by reference in their entirety. According to Deem, multiple
needles are incorporated into the device which delivers neurotoxin
through the needles into the bronchial tissue.
[0929] A method for administering multiple-component therapies has
been described by Nayak and is taught for example in U.S. Pat. No.
7,699,803, the contents of which are incorporated herein by
reference in their entirety. According to Nayak, multiple injection
cannulas may be incorporated into a device wherein depth slots may
be included for controlling the depth at which the therapeutic
substance is delivered within the tissue.
[0930] A surgical device for ablating a channel and delivering at
least one therapeutic agent into a desired region of the tissue has
been described by McIntyre et al and is taught for example in U.S.
Pat. No. 8,012,096, the contents of which are incorporated herein
by reference in their entirety. According to McIntyre, multiple
needles are incorporated into the device which dispenses a
therapeutic agent into a region of tissue surrounding the channel
and is particularly well suited for transmyocardial
revascularization operations.
[0931] Methods of treating functional disorders of the bladder in
mammalian females have been described by Versi et al and are taught
for example in U.S. Pat. No. 8,029,496, the contents of which are
incorporated herein by reference in their entirety. According to
Versi, an array of micro-needles is incorporated into a device
which delivers a therapeutic agent through the needles directly
into the trigone of the bladder.
[0932] A device and a method for delivering fluid into a flexible
biological barrier have been described by Yeshurun et al. and are
taught for example in U.S. Pat. No. 7,998,119 (device) and
8,007,466 (method), the contents of which are incorporated herein
by reference in their entirety. According to Yeshurun, the
micro-needles on the device penetrate and extend into the flexible
biological barrier and fluid is injected through the bore of the
hollow micro-needles.
[0933] A method for epicardially injecting a substance into an area
of tissue of a heart having an epicardial surface and disposed
within a torso has been described by Bonner et al and is taught for
example in U.S. Pat. No. 7,628,780, the contents of which are
incorporated herein by reference in their entirety. According to
Bonner, the devices have elongate shafts and distal injection heads
for driving needles into tissue and injecting medical agents into
the tissue through the needles.
[0934] A device for sealing a puncture has been described by
Nielsen et al and is taught for example in U.S. Pat. No. 7,972,358,
the contents of which are incorporated herein by reference in their
entirety. According to Nielsen, multiple needles are incorporated
into the device which delivers a closure agent into the tissue
surrounding the puncture tract.
[0935] A method for myogenesis and angiogenesis has been described
by Chiu et al. and is taught for example in U.S. Pat. No.
6,551,338, the contents of which are incorporated herein by
reference in their entirety. According to Chiu, 5 to 15 needles
having a maximum diameter of at least 1.25 mm and a length
effective to provide a puncture depth of 6 to 20 mm are
incorporated into a device which inserts into proximity with a
myocardium and supplies an exogeneous angiogenic or myogenic factor
to said myocardium through the conduits which are in at least some
of said needles.
[0936] A method for the treatment of prostate tissue has been
described by Bolmsj et al. and is taught for example in U.S. Pat.
No. 6,524,270, the contents of which are incorporated herein by
reference in their entirety. According to Bolmsj, a device
comprising a catheter which is inserted through the urethra has at
least one hollow tip extendible into the surrounding prostate
tissue. An astringent and analgesic medicine is administered
through said tip into said prostate tissue.
[0937] A method for infusing fluids to an intraosseous site has
been described by Findlay et al. and is taught for example in U.S.
Pat. No. 6,761,726, the contents of which are incorporated herein
by reference in their entirety. According to Findlay, multiple
needles are incorporated into a device which is capable of
penetrating a hard shell of material covered by a layer of soft
material and delivers a fluid at a predetermined distance below
said hard shell of material.
[0938] A device for injecting medications into a vessel wall has
been described by Vigil et al. and is taught for example in U.S.
Pat. No. 5,713,863, the contents of which are incorporated herein
by reference in their entirety. According to Vigil, multiple
injectors are mounted on each of the flexible tubes in the device
which introduces a medication fluid through a multi-lumen catheter,
into said flexible tubes and out of said injectors for infusion
into the vessel wall.
[0939] A catheter for delivering therapeutic and/or diagnostic
agents to the tissue surrounding a bodily passageway has been
described by Faxon et al. and is taught for example in U.S. Pat.
No. 5,464,395, the contents of which are incorporated herein by
reference in their entirety. According to Faxon, at least one
needle cannula is incorporated into the catheter which delivers the
desired agents to the tissue through said needles which project
outboard of the catheter.
[0940] Balloon catheters for delivering therapeutic agents have
been described by Orr and are taught for example in WO2010024871,
the contents of which are incorporated herein by reference in their
entirety. According to Orr, multiple needles are incorporated into
the devices which deliver the therapeutic agents to different
depths within the tissue. In another aspect, drug-eluting balloons
may be used to deliver the formulations described herein. The
drug-eluting balloons may be used in target lesion applications
such as, but are not limited to, in-stent restenosis, treating
lesion in tortuous vessels, bifurcation lesions, femoral/popliteal
lesions and below the knee lesions.
[0941] A device for deliverying therapeutic agents (e.g.,
polynucleotides, primary constructs or mmRNA) to tissue disposed
about a lumin has been described by Perry et al. and is taught for
example in U.S. Pat. Pub. US20100125239, the contents of which are
herein incorporated by reference in their entirety. According to
Perry, the catheter has a balloon which may be coated with a
therapeutic agent by methods known in the art and described in
Perry. When the balloon expands, the therapeutic agent will contact
the surrounding tissue. The device may additionally have a heat
source to change the temperature of the coating on the balloon to
release the thereapeutic agent to the tissue.
Methods and Devices Utilizing Electrical Current
[0942] Methods and devices utilizing electric current may be
employed to deliver the mmRNA of the present invention according to
the single, multi- or split dosing regimens taught herein. Such
methods and devices are described below.
[0943] An electro collagen induction therapy device has been
described by Marquez and is taught for example in US Patent
Publication 20090137945, the contents of which are incorporated
herein by reference in their entirety. According to Marquez,
multiple needles are incorporated into the device which repeatedly
pierce the skin and draw in the skin a portion of the substance
which is applied to the skin first.
[0944] An electrokinetic system has been described by Etheredge et
al. and is taught for example in US Patent Publication 20070185432,
the contents of which are incorporated herein by reference in their
entirety. According to Etheredge, micro-needles are incorporated
into a device which drives by an electrical current the medication
through the needles into the targeted treatment site.
[0945] An iontophoresis device has been described by Matsumura et
al. and is taught for example in U.S. Pat. No. 7,437,189, the
contents of which are incorporated herein by reference in their
entirety. According to Matsumura, multiple needles are incorporated
into the device which is capable of delivering ionizable drug into
a living body at higher speed or with higher efficiency.
[0946] Intradermal delivery of biologically active agents by
needle-free injection and electroporation has been described by
Hoffmann et al and is taught for example in U.S. Pat. No.
7,171,264, the contents of which are incorporated herein by
reference in their entirety. According to Hoffmann, one or more
needle-free injectors are incorporated into an electroporation
device and the combination of needle-free injection and
electroporation is sufficient to introduce the agent into cells in
skin, muscle or mucosa.
[0947] A method for electropermeabilization-mediated intracellular
delivery has been described by Lundkvist et al. and is taught for
example in U.S. Pat. No. 6,625,486, the contents of which are
incorporated herein by reference in their entirety. According to
Lundkvist, a pair of needle electrodes is incorporated into a
catheter. Said catheter is positioned into a body lumen followed by
extending said needle electrodes to penetrate into the tissue
surrounding said lumen. Then the device introduces an agent through
at least one of said needle electrodes and applies electric field
by said pair of needle electrodes to allow said agent pass through
the cell membranes into the cells at the treatment site.
[0948] A delivery system for transdermal immunization has been
described by Levin et al. and is taught for example in
WO2006003659, the contents of which are incorporated herein by
reference in their entirety. According to Levin, multiple
electrodes are incorporated into the device which applies
electrical energy between the electrodes to generate micro channels
in the skin to facilitate transdermal delivery.
[0949] A method for delivering RF energy into skin has been
described by Schomacker and is taught for example in WO2011163264,
the contents of which are incorporated herein by reference in their
entirety. According to Schomacker, multiple needles are
incorporated into a device which applies vacuum to draw skin into
contact with a plate so that needles insert into skin through the
holes on the plate and deliver RF energy.
VII. DEFINITIONS
[0950] At various places in the present specification, substituents
of compounds of the present disclosure are disclosed in groups or
in ranges. It is specifically intended that the present disclosure
include each and every individual subcombination of the members of
such groups and ranges. For example, the term "C.sub.1-6 alkyl" is
specifically intended to individually disclose methyl, ethyl,
C.sub.3 alkyl, C.sub.4 alkyl, C.sub.5 alkyl, and C.sub.6 alkyl.
[0951] About: As used herein, the term "about" means+/-10% of the
recited value.
[0952] Administered in combination: As used herein, the term
"administered in combination" or "combined administration" means
that two or more agents are administered to a subject at the same
time or within an interval such that there may be an overlap of an
effect of each agent on the patient. In some embodiments, they are
administered within about 60, 30, 15, 10, 5, or 1 minute of one
another. In some embodiments, the administrations of the agents are
spaced sufficiently closely together such that a combinatorial
(e.g., a synergistic) effect is achieved.
[0953] Animal: As used herein, the term "animal" refers to any
member of the animal kingdom. In some embodiments, "animal" refers
to humans at any stage of development. In some embodiments,
"animal" refers to non-human animals at any stage of development.
In certain embodiments, the non-human animal is a mammal (e.g., a
rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep,
cattle, a primate, or a pig). In some embodiments, animals include,
but are not limited to, mammals, birds, reptiles, amphibians, fish,
and worms. In some embodiments, the animal is a transgenic animal,
genetically-engineered animal, or a clone.
[0954] Antigens of interest or desired antigens: As used herein,
the terms "antigens of interest" or "desired antigens" include
those proteins and other biomolecules provided herein that are
immunospecifically bound by the antibodies and fragments, mutants,
variants, and alterations thereof described herein. Examples of
antigens of interest include, but are not limited to, insulin,
insulin-like growth factor, hGH, tPA, cytokines, such as
interleukins (IL), e.g., IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7,
IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17,
IL-18, interferon (IFN) alpha, IFN beta, IFN gamma, IFN omega or
IFN tau, tumor necrosis factor (TNF), such as TNF alpha and TNF
beta, TNF gamma, TRAIL; G-CSF, GM-CSF, M-CSF, MCP-1 and VEGF.
[0955] Approximately: As used herein, the term "approximately" or
"about," as applied to one or more values of interest, refers to a
value that is similar to a stated reference value. In certain
embodiments, the term "approximately" or "about" refers to a range
of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%,
13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in
either direction (greater than or less than) of the stated
reference value unless otherwise stated or otherwise evident from
the context (except where such number would exceed 100% of a
possible value).
[0956] Associated with: As used herein, the terms "associated
with," "conjugated," "linked," "attached," and "tethered," when
used with respect to two or more moieties, means that the moieties
are physically associated or connected with one another, either
directly or via one or more additional moieties that serves as a
linking agent, to form a structure that is sufficiently stable so
that the moieties remain physically associated under the conditions
in which the structure is used, e.g., physiological conditions. An
"association" need not be strictly through direct covalent chemical
bonding. It may also suggest ionic or hydrogen bonding or a
hybridization based connectivity sufficiently stable such that the
"associated" entities remain physically associated.
[0957] Bifunctional: As used herein, the term "bifunctional" refers
to any substance, molecule or moiety which is capable of or
maintains at least two functions. The functions may effect the same
outcome or a different outcome. The structure that produces the
function may be the same or different. For example, bifunctional
modified RNAs of the present invention may encode a cytotoxic
peptide (a first function) while those nucleosides which comprise
the encoding RNA are, in and of themselves, cytotoxic (second
function). In this example, delivery of the bifunctional modified
RNA to a cancer cell would produce not only a peptide or protein
molecule which may ameliorate or treat the cancer but would also
deliver a cytotoxic payload of nucleosides to the cell should
degradation, instead of translation of the modified RNA, occur.
[0958] Biocompatible: As used herein, the term "biocompatible"
means compatible with living cells, tissues, organs or systems
posing little to no risk of injury, toxicity or rejection by the
immune system.
[0959] Biodegradable: As used herein, the term "biodegradable"
means capable of being broken down into innocuous products by the
action of living things.
[0960] Biologically active: As used herein, the phrase
"biologically active" refers to a characteristic of any substance
that has activity in a biological system and/or organism. For
instance, a substance that, when administered to an organism, has a
biological effect on that organism, is considered to be
biologically active. In particular embodiments, a polynucleotide,
primary construct or mmRNA of the present invention may be
considered biologically active if even a portion of the
polynucleotide, primary construct or mmRNA is biologically active
or mimics an activity considered biologically relevant.
[0961] Chemical terms: The following provides the definition of
various chemical terms from "acyl" to "thiol."
[0962] The term "acyl," as used herein, represents a hydrogen or an
alkyl group (e.g., a haloalkyl group), as defined herein, that is
attached to the parent molecular group through a carbonyl group, as
defined herein, and is exemplified by formyl (i.e., a
carboxyaldehyde group), acetyl, propionyl, butanoyl and the like.
Exemplary unsubstituted acyl groups include from 1 to 7, from 1 to
11, or from 1 to 21 carbons. In some embodiments, the alkyl group
is further substituted with 1, 2, 3, or 4 substituents as described
herein.
[0963] The term "acylamino," as used herein, represents an acyl
group, as defined herein, attached to the parent molecular group
though an amino group, as defined herein (i.e.,
--N(R.sup.N1)--C(O)--R, where R is H or an optionally substituted
C.sub.1-6, C.sub.1-10, or C.sub.1-20 alkyl group and R.sup.N1 is as
defined herein). Exemplary unsubstituted acylamino groups include
from 1 to 41 carbons (e.g., from 1 to 7, from 1 to 13, from 1 to
21, from 2 to 7, from 2 to 13, from 2 to 21, or from 2 to 41
carbons). In some embodiments, the alkyl group is further
substituted with 1, 2, 3, or 4 substituents as described herein,
and/or the amino group is --NH.sub.2 or --NHR.sup.N1, wherein
R.sup.N1 is, independently, OH, NO.sub.2, NH.sub.2,
NR.sup.N2.sub.2, SO.sub.2OR.sup.N2, SO.sub.2R.sup.N2, SOR.sup.N2,
alkyl, or aryl, and each R.sup.N2 can be H, alkyl, or aryl.
[0964] The term "acyloxy," as used herein, represents an acyl
group, as defined herein, attached to the parent molecular group
though an oxygen atom (i.e., --O--C(O)--R, where R is H or an
optionally substituted C.sub.1-6, C.sub.1-10, or C.sub.1-20 alkyl
group). Exemplary unsubstituted acyloxy groups include from 1 to 21
carbons (e.g., from 1 to 7 or from 1 to 11 carbons). In some
embodiments, the alkyl group is further substituted with 1, 2, 3,
or 4 substituents as described herein, and/or the amino group is
--NH.sub.2 or --NHR.sup.N1, wherein R.sup.N1 is, independently, OH,
NO.sub.2, NH.sub.2, NR.sup.N2.sub.2, SO.sub.2OR.sup.N2,
SO.sub.2R.sup.N2, SOR.sup.N2, alkyl, or aryl, and each R.sup.N2 can
be H, alkyl, or aryl.
[0965] The term "alkaryl," as used herein, represents an aryl
group, as defined herein, attached to the parent molecular group
through an alkylene group, as defined herein. Exemplary
unsubstituted alkaryl groups are from 7 to 30 carbons (e.g., from 7
to 16 or from 7 to 20 carbons, such as C.sub.1-6 alk-C.sub.6-10
aryl, C.sub.1-10 alk-C.sub.6-10 aryl, or C.sub.1-20 alk-C.sub.6-10
aryl). In some embodiments, the alkylene and the aryl each can be
further substituted with 1, 2, 3, or 4 substituent groups as
defined herein for the respective groups. Other groups preceded by
the prefix "alk-" are defined in the same manner, where "alk"
refers to a C.sub.1-6 alkylene, unless otherwise noted, and the
attached chemical structure is as defined herein.
[0966] The term "alkcycloalkyl" represents a cycloalkyl group, as
defined herein, attached to the parent molecular group through an
alkylene group, as defined herein (e.g., an alkylene group of from
1 to 4, from 1 to 6, from 1 to 10, or form 1 to 20 carbons). In
some embodiments, the alkylene and the cycloalkyl each can be
further substituted with 1, 2, 3, or 4 substituent groups as
defined herein for the respective group.
[0967] The term "alkenyl," as used herein, represents monovalent
straight or branched chain groups of, unless otherwise specified,
from 2 to 20 carbons (e.g., from 2 to 6 or from 2 to 10 carbons)
containing one or more carbon-carbon double bonds and is
exemplified by ethenyl, 1-propenyl, 2-propenyl,
2-methyl-1-propenyl, 1-butenyl, 2-butenyl, and the like. Alkenyls
include both cis and trans isomers. Alkenyl groups may be
optionally substituted with 1, 2, 3, or 4 substituent groups that
are selected, independently, from amino, aryl, cycloalkyl, or
heterocyclyl (e.g., heteroaryl), as defined herein, or any of the
exemplary alkyl substituent groups described herein.
[0968] The term "alkenyloxy" represents a chemical substituent of
formula --OR, where R is a C.sub.2-20 alkenyl group (e.g.,
C.sub.2-6 or C.sub.2-10 alkenyl), unless otherwise specified.
Exemplary alkenyloxy groups include ethenyloxy, propenyloxy, and
the like. In some embodiments, the alkenyl group can be further
substituted with 1, 2, 3, or 4 substituent groups as defined herein
(e.g., a hydroxy group).
[0969] The term "alkheteroaryl" refers to a heteroaryl group, as
defined herein, attached to the parent molecular group through an
alkylene group, as defined herein. Exemplary unsubstituted
alkheteroaryl groups are from 2 to 32 carbons (e.g., from 2 to 22,
from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2 to
14, from 2 to 13, or from 2 to 12 carbons, such as C.sub.1-6
alk-C.sub.1-12 heteroaryl, C.sub.1-10 alk-C.sub.1-12 heteroaryl, or
C.sub.1-20 alk-C.sub.1-12 heteroaryl). In some embodiments, the
alkylene and the heteroaryl each can be further substituted with 1,
2, 3, or 4 substituent groups as defined herein for the respective
group. Alkheteroaryl groups are a subset of alkheterocyclyl
groups.
[0970] The term "alkheterocyclyl" represents a heterocyclyl group,
as defined herein, attached to the parent molecular group through
an alkylene group, as defined herein. Exemplary unsubstituted
alkheterocyclyl groups are from 2 to 32 carbons (e.g., from 2 to
22, from 2 to 18, from 2 to 17, from 2 to 16, from 3 to 15, from 2
to 14, from 2 to 13, or from 2 to 12 carbons, such as C.sub.1-6
alk-C.sub.1-12 heterocyclyl, C.sub.1-10 alk-C.sub.1-12
heterocyclyl, or C.sub.1-20 alk-C.sub.1-12 heterocyclyl). In some
embodiments, the alkylene and the heterocyclyl each can be further
substituted with 1, 2, 3, or 4 substituent groups as defined herein
for the respective group.
[0971] The term "alkoxy" represents a chemical substituent of
formula --OR, where R is a C.sub.1-20 alkyl group (e.g., C.sub.1-6
or C.sub.1-10 alkyl), unless otherwise specified. Exemplary alkoxy
groups include methoxy, ethoxy, propoxy (e.g., n-propoxy and
isopropoxy), t-butoxy, and the like. In some embodiments, the alkyl
group can be further substituted with 1, 2, 3, or 4 substituent
groups as defined herein (e.g., hydroxy or alkoxy).
[0972] The term "alkoxyalkoxy" represents an alkoxy group that is
substituted with an alkoxy group. Exemplary unsubstituted
alkoxyalkoxy groups include between 2 to 40 carbons (e.g., from 2
to 12 or from 2 to 20 carbons, such as C.sub.1-6 alkoxy-C.sub.1-6
alkoxy, C.sub.1-10 alkoxy-C.sub.1-10 alkoxy, or C.sub.1-20
alkoxy-C.sub.1-20 alkoxy). In some embodiments, the each alkoxy
group can be further substituted with 1, 2, 3, or 4 substituent
groups as defined herein.
[0973] The term "alkoxyalkyl" represents an alkyl group that is
substituted with an alkoxy group. Exemplary unsubstituted
alkoxyalkyl groups include between 2 to 40 carbons (e.g., from 2 to
12 or from 2 to 20 carbons, such as C.sub.1-6 alkoxy-C.sub.1-6
alkyl, C.sub.1-10 alkoxy-C.sub.1-10 alkyl, or C.sub.1-20
alkoxy-C.sub.1-20 alkyl). In some embodiments, the alkyl and the
alkoxy each can be further substituted with 1, 2, 3, or 4
substituent groups as defined herein for the respective group.
[0974] The term "alkoxycarbonyl," as used herein, represents an
alkoxy, as defined herein, attached to the parent molecular group
through a carbonyl atom (e.g., --C(O)--OR, where R is H or an
optionally substituted C.sub.1-6, C.sub.1-10, or C.sub.1-20 alkyl
group). Exemplary unsubstituted alkoxycarbonyl include from 1 to 21
carbons (e.g., from 1 to 11 or from 1 to 7 carbons). In some
embodiments, the alkoxy group is further substituted with 1, 2, 3,
or 4 substituents as described herein.
[0975] The term "alkoxycarbonylalkoxy," as used herein, represents
an alkoxy group, as defined herein, that is substituted with an
alkoxycarbonyl group, as defined herein (e.g., --O-alkyl-C(O)--OR,
where R is an optionally substituted C.sub.1-6, C.sub.1-10, or
C.sub.1-20 alkyl group). Exemplary unsubstituted
alkoxycarbonylalkoxy include from 3 to 41 carbons (e.g., from 3 to
10, from 3 to 13, from 3 to 17, from 3 to 21, or from 3 to 31
carbons, such as C.sub.1-6 alkoxycarbonyl-C.sub.1-6 alkoxy,
C.sub.1-10 alkoxycarbonyl-C.sub.1-10 alkoxy, or C.sub.1-20
alkoxycarbonyl-C.sub.1-20 alkoxy). In some embodiments, each alkoxy
group is further independently substituted with 1, 2, 3, or 4
substituents, as described herein (e.g., a hydroxy group).
[0976] The term "alkoxycarbonylalkyl," as used herein, represents
an alkyl group, as defined herein, that is substituted with an
alkoxycarbonyl group, as defined herein (e.g., -alkyl-C(O)--OR,
where R is an optionally substituted C.sub.1-20, C.sub.1-10, or
C.sub.1-6 alkyl group). Exemplary unsubstituted alkoxycarbonylalkyl
include from 3 to 41 carbons (e.g., from 3 to 10, from 3 to 13,
from 3 to 17, from 3 to 21, or from 3 to 31 carbons, such as
C.sub.1-6 alkoxycarbonyl-C.sub.1-6 alkyl, C.sub.1-10
alkoxycarbonyl-C.sub.1-10 alkyl, or C.sub.1-20
alkoxycarbonyl-C.sub.1-20 alkyl). In some embodiments, each alkyl
and alkoxy group is further independently substituted with 1, 2, 3,
or 4 substituents as described herein (e.g., a hydroxy group).
[0977] The term "alkyl," as used herein, is inclusive of both
straight chain and branched chain saturated groups from 1 to 20
carbons (e.g., from 1 to 10 or from 1 to 6), unless otherwise
specified. Alkyl groups are exemplified by methyl, ethyl, n- and
iso-propyl, n-, sec-, iso- and tert-butyl, neopentyl, and the like,
and may be optionally substituted with one, two, three, or, in the
case of alkyl groups of two carbons or more, four substituents
independently selected from the group consisting of: (1) C.sub.1-6
alkoxy; (2) C.sub.1-6 alkylsulfinyl; (3) amino, as defined herein
(e.g., unsubstituted amino (i.e., --NH.sub.2) or a substituted
amino (i.e., --N(R.sup.N1).sub.2, where R.sup.N1 is as defined for
amino); (4) C.sub.6-10 aryl-C.sub.1-6 alkoxy; (5) azido; (6) halo;
(7) (C.sub.2-9 heterocyclyl)oxy; (8) hydroxy; (9) nitro; (10) oxo
(e.g., carboxyaldehyde or acyl); (11) C.sub.1-7 spirocyclyl; (12)
thioalkoxy; (13) thiol; (14) --CO.sub.2R.sup.A', where R.sup.A' is
selected from the group consisting of (a) C.sub.1-20 alkyl (e.g.,
C.sub.1-6 alkyl), (b) C.sub.2-20 alkenyl (e.g., C.sub.2-6 alkenyl),
(c) C.sub.6-10 aryl, (d) hydrogen, (e) C.sub.1-6 alk-C.sub.6-10
aryl, (f) amino-C.sub.1-20 alkyl, (g) polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (15)
--C(O)NR.sup.B'R.sup.C', where each of R.sup.B' and R.sup.C' is,
independently, selected from the group consisting of (a) hydrogen,
(b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6
alk-C.sub.6-10 aryl; (16) --SO.sub.2R.sup.D', where R.sup.D' is
selected from the group consisting of (a) C.sub.1-6 alkyl, (b)
C.sub.6-10 aryl, (c) C.sub.1-6 alk-C.sub.6-10 aryl, and (d)
hydroxy; (17) --SO.sub.2NR.sup.E'R.sup.F', where each of R.sup.E'
and R.sup.F' is, independently, selected from the group consisting
of (a) hydrogen, (b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl and (d)
C.sub.1-6 alk-C.sub.6-10 aryl; (18) --C(O)R.sup.G', where R.sup.G'
is selected from the group consisting of (a) C.sub.1-20 alkyl
(e.g., C.sub.1-6 alkyl), (b) C.sub.2-20 alkenyl (e.g., C.sub.2-6
alkenyl), (c) C.sub.6-10 aryl, (d) hydrogen, (e) C.sub.1-6
alk-C.sub.6-10 aryl, (f) amino-C.sub.1-20 alkyl, (g) polyethylene
glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (19)
--NR.sup.H'C(O)R.sup.I', wherein R.sup.H' is selected from the
group consisting of (a1) hydrogen and (b1) C.sub.1-6 alkyl, and
R.sup.I' is selected from the group consisting of (a2) C.sub.1-20
alkyl (e.g., C.sub.1-6 alkyl), (b2) C.sub.2-20 alkenyl (e.g.,
C.sub.2-6 alkenyl), (c2) C.sub.6-10 aryl, (d2) hydrogen, (e2)
C.sub.1-6 alk-C.sub.6-10 aryl, (f2) amino-C.sub.1-20 alkyl, (g2)
polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h2)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (20)
--NR.sup.J'C(O)OR.sup.K', wherein R.sup.J' is selected from the
group consisting of (a1) hydrogen and (b1) C.sub.1-6 alkyl, and
R.sup.K' is selected from the group consisting of (a2) C.sub.1-20
alkyl (e.g., C.sub.1-6 alkyl), (b2) C.sub.2-20 alkenyl (e.g.,
C.sub.2-6 alkenyl), (c2) C.sub.6-10 aryl, (d2) hydrogen, (e2)
C.sub.1-6 alk-C.sub.6-10 aryl, (f2) amino-C.sub.1-20 alkyl, (g2)
polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h2)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; and (21)
amidine. In some embodiments, each of these groups can be further
substituted as described herein. For example, the alkylene group of
a C.sub.1-alkaryl can be further substituted with an oxo group to
afford the respective aryloyl substituent.
[0978] The term "alkylene" and the prefix "alk-," as used herein,
represent a saturated divalent hydrocarbon group derived from a
straight or branched chain saturated hydrocarbon by the removal of
two hydrogen atoms, and is exemplified by methylene, ethylene,
isopropylene, and the like. The term "C.sub.x-y alkylene" and the
prefix "C.sub.x-y alk-" represent alkylene groups having between x
and y carbons. Exemplary values for x are 1, 2, 3, 4, 5, and 6, and
exemplary values for y are 2, 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16,
18, or 20 (e.g., C.sub.1-6, C.sub.1-10, C.sub.2-20, C.sub.2-6,
C.sub.2-10, or C.sub.2-20 alkylene). In some embodiments, the
alkylene can be further substituted with 1, 2, 3, or 4 substituent
groups as defined herein for an alkyl group.
[0979] The term "alkylsulfinyl," as used herein, represents an
alkyl group attached to the parent molecular group through an
--S(O)-- group. Exemplary unsubstituted alkylsulfinyl groups are
from 1 to 6, from 1 to 10, or from 1 to 20 carbons. In some
embodiments, the alkyl group can be further substituted with 1, 2,
3, or 4 substituent groups as defined herein.
[0980] The term "alkylsulfinylalkyl," as used herein, represents an
alkyl group, as defined herein, substituted by an alkylsulfinyl
group. Exemplary unsubstituted alkylsulfinylalkyl groups are from 2
to 12, from 2 to 20, or from 2 to 40 carbons. In some embodiments,
each alkyl group can be further substituted with 1, 2, 3, or 4
substituent groups as defined herein.
[0981] The term "alkynyl," as used herein, represents monovalent
straight or branched chain groups from 2 to 20 carbon atoms (e.g.,
from 2 to 4, from 2 to 6, or from 2 to 10 carbons) containing a
carbon-carbon triple bond and is exemplified by ethynyl,
1-propynyl, and the like. Alkynyl groups may be optionally
substituted with 1, 2, 3, or 4 substituent groups that are
selected, independently, from aryl, cycloalkyl, or heterocyclyl
(e.g., heteroaryl), as defined herein, or any of the exemplary
alkyl substituent groups described herein.
[0982] The term "alkynyloxy" represents a chemical substituent of
formula --OR, where R is a C.sub.2-20 alkynyl group (e.g.,
C.sub.2-6 or C.sub.2-10 alkynyl), unless otherwise specified.
Exemplary alkynyloxy groups include ethynyloxy, propynyloxy, and
the like. In some embodiments, the alkynyl group can be further
substituted with 1, 2, 3, or 4 substituent groups as defined herein
(e.g., a hydroxy group).
[0983] The term "amidine," as used herein, represents a
--C(.dbd.NH)NH.sub.2 group.
[0984] The term "amino," as used herein, represents
--N(R.sup.N1).sub.2, wherein each R.sup.N1 is, independently, H,
OH, NO.sub.2, N(R.sup.N2).sub.2, SO.sub.2OR.sup.N2,
SO.sub.2R.sup.N2, SOR.sup.N2, an N-protecting group, alkyl,
alkenyl, alkynyl, alkoxy, aryl, alkaryl, cycloalkyl, alkcycloalkyl,
carboxyalkyl, sulfoalkyl, heterocyclyl (e.g., heteroaryl), or
alkheterocyclyl (e.g., alkheteroaryl), wherein each of these
recited R.sup.N1 groups can be optionally substituted, as defined
herein for each group; or two R.sup.N1 combine to form a
heterocyclyl or an N-protecting group, and wherein each R.sup.N2
is, independently, H, alkyl, or aryl. The amino groups of the
invention can be an unsubstituted amino (i.e., --NH.sub.2) or a
substituted amino (i.e., --N(R.sup.N1).sub.2). In a preferred
embodiment, amino is --NH.sub.2 or --NHR.sup.N1, wherein R.sup.N1
is, independently, OH, NO.sub.2, NH.sub.2, NR.sup.N2.sub.2,
SO.sub.2OR.sup.N2, SO.sub.2R.sup.N2, SOR.sup.N2, alkyl,
carboxyalkyl, sulfoalkyl, or aryl, and each R.sup.N2 can be H,
C.sub.1-20 alkyl (e.g., C.sub.1-6 alkyl), or C.sub.6-10 aryl.
[0985] The term "amino acid," as described herein, refers to a
molecule having a side chain, an amino group, and an acid group
(e.g., a carboxy group of --CO.sub.2H or a sulfo group of
--SO.sub.3H), wherein the amino acid is attached to the parent
molecular group by the side chain, amino group, or acid group
(e.g., the side chain). In some embodiments, the amino acid is
attached to the parent molecular group by a carbonyl group, where
the side chain or amino group is attached to the carbonyl group.
Exemplary side chains include an optionally substituted alkyl,
aryl, heterocyclyl, alkaryl, alkheterocyclyl, aminoalkyl,
carbamoylalkyl, and carboxyalkyl. Exemplary amino acids include
alanine, arginine, asparagine, aspartic acid, cysteine, glutamic
acid, glutamine, glycine, histidine, hydroxynorvaline, isoleucine,
leucine, lysine, methionine, norvaline, ornithine, phenylalanine,
proline, pyrrolysine, selenocysteine, serine, taurine, threonine,
tryptophan, tyrosine, and valine. Amino acid groups may be
optionally substituted with one, two, three, or, in the case of
amino acid groups of two carbons or more, four substituents
independently selected from the group consisting of: (1) C.sub.1-6
alkoxy; (2) C.sub.1-6 alkylsulfinyl; (3) amino, as defined herein
(e.g., unsubstituted amino (i.e., --NH.sub.2) or a substituted
amino (i.e., --N(R.sup.N1).sub.2, where R.sup.N1 is as defined for
amino); (4) C.sub.6-10 aryl-C.sub.1-6 alkoxy; (5) azido; (6) halo;
(7) (C.sub.2-9 heterocyclyl)oxy; (8) hydroxy; (9) nitro; (10) oxo
(e.g., carboxyaldehyde or acyl); (11) C.sub.1-7 spirocyclyl; (12)
thioalkoxy; (13) thiol; (14) --CO.sub.2R.sup.A', where R.sup.A' is
selected from the group consisting of (a) C.sub.1-20 alkyl (e.g.,
C.sub.1-6 alkyl), (b) C.sub.2-20 alkenyl (e.g., C.sub.2-6 alkenyl),
(c) C.sub.6-10 aryl, (d) hydrogen, (e) C.sub.1-6 alk-C.sub.6-10
aryl, (f) amino-C.sub.1-20 alkyl, (g) polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (15)
--C(O)NR.sup.B'R.sup.C', where each of R.sup.B' and R.sup.C' is,
independently, selected from the group consisting of (a) hydrogen,
(b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6
alk-C.sub.6-10 aryl; (16) --SO.sub.2R.sup.D', where R.sup.D' is
selected from the group consisting of (a) C.sub.1-6 alkyl, (b)
C.sub.6-10 aryl, (c) C.sub.1-6 alk-C.sub.6-10 aryl, and (d)
hydroxy; (17) --SO.sub.2NR.sup.E'R.sup.F', where each of R.sup.E'
and R.sup.F' is, independently, selected from the group consisting
of (a) hydrogen, (b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl and (d)
C.sub.1-6 alk-C.sub.6-10 aryl; (18) --C(O)R.sup.G', where R.sup.G'
is selected from the group consisting of (a) C.sub.1-20 alkyl
(e.g., C.sub.1-6 alkyl), (b) C.sub.2-20 alkenyl (e.g., C.sub.2-6
alkenyl), (c) C.sub.6-10 aryl, (d) hydrogen, (e) C.sub.1-6
alk-C.sub.6-10 aryl, (f) amino-C.sub.1-20 alkyl, (g) polyethylene
glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (19)
--NR.sup.H'C(O)R.sup.I', wherein R.sup.H' is selected from the
group consisting of (a1) hydrogen and (b1) C.sub.1-6 alkyl, and
R.sup.I' is selected from the group consisting of (a2) C.sub.1-20
alkyl (e.g., C.sub.1-6 alkyl), (b2) C.sub.2-20 alkenyl (e.g.,
C.sub.2-6 alkenyl), (c2) C.sub.6-10 aryl, (d2) hydrogen, (e2)
C.sub.1-6 alk-C.sub.6-10 aryl, (f2) amino-C.sub.1-20 alkyl, (g2)
polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h2)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; (20)
--NR.sup.J'C(O)OR.sup.K', wherein R.sup.J' is selected from the
group consisting of (a1) hydrogen and (b1) C.sub.1-6 alkyl, and
R.sup.K' is selected from the group consisting of (a2) C.sub.1-20
alkyl (e.g., C.sub.1-6 alkyl), (b2) C.sub.2-20 alkenyl (e.g.,
C.sub.2-6 alkenyl), (c2) C.sub.6-10 aryl, (d2) hydrogen, (e2)
C.sub.1-6 alk-C.sub.6-10 aryl, (f2) amino-C.sub.1-20 alkyl, (g2)
polyethylene glycol of
--(CH.sub.2).sub.s2(OCH.sub.2CH.sub.2).sub.s1(CH.sub.2).sub.s3OR',
wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6 or from 1
to 4), each of s2 and s3, independently, is an integer from 0 to 10
(e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1 to 6, or from
1 to 10), and R' is H or C.sub.1-20 alkyl, and (h2)
amino-polyethylene glycol of
--NR.sup.N1(CH.sub.2).sub.s2(CH.sub.2CH.sub.2O).sub.s1(CH.sub.2).sub.s3NR-
.sup.N1, wherein s1 is an integer from 1 to 10 (e.g., from 1 to 6
or from 1 to 4), each of s2 and s3, independently, is an integer
from 0 to 10 (e.g., from 0 to 4, from 0 to 6, from 1 to 4, from 1
to 6, or from 1 to 10), and each R.sup.N1 is, independently,
hydrogen or optionally substituted C.sub.1-6 alkyl; and (21)
amidine. In some embodiments, each of these groups can be further
substituted as described herein.
[0986] The term "aminoalkoxy," as used herein, represents an alkoxy
group, as defined herein, substituted by an amino group, as defined
herein. The alkyl and amino each can be further substituted with 1,
2, 3, or 4 substituent groups as described herein for the
respective group (e.g., CO.sub.2R.sup.A', where R.sup.A' is
selected from the group consisting of (a) C.sub.1-6 alkyl, (b)
C.sub.6-10 aryl, (c) hydrogen, and (d) C.sub.1-6 alk-C.sub.6-10
aryl, e.g., carboxy).
[0987] The term "aminoalkyl," as used herein, represents an alkyl
group, as defined herein, substituted by an amino group, as defined
herein. The alkyl and amino each can be further substituted with 1,
2, 3, or 4 substituent groups as described herein for the
respective group (e.g., CO.sub.2R.sup.A', where R.sup.A' is
selected from the group consisting of (a) C.sub.1-6 alkyl, (b)
C.sub.6-10 aryl, (c) hydrogen, and (d) C.sub.1-6 alk-C.sub.6-10
aryl, e.g., carboxy).
[0988] The term "aryl," as used herein, represents a mono-,
bicyclic, or multicyclic carbocyclic ring system having one or two
aromatic rings and is exemplified by phenyl, naphthyl,
1,2-dihydronaphthyl, 1,2,3,4-tetrahydronaphthyl, anthracenyl,
phenanthrenyl, fluorenyl, indanyl, indenyl, and the like, and may
be optionally substituted with 1, 2, 3, 4, or 5 substituents
independently selected from the group consisting of: (1) C.sub.1-7
acyl (e.g., carboxyaldehyde); (2) C.sub.1-20 alkyl (e.g., C.sub.1-6
alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.1-6
alkylsulfinyl-C.sub.1-6 alkyl, amino-C.sub.1-6 alkyl,
azido-C.sub.1-6 alkyl, (carboxyaldehyde)-C.sub.1-6 alkyl,
halo-C.sub.1-6 alkyl (e.g., perfluoroalkyl), hydroxy-C.sub.1-6
alkyl, nitro-C.sub.1-6 alkyl, or C.sub.1-6 thioalkoxy-C.sub.1-6
alkyl); (3) C.sub.1-20 alkoxy (e.g., C.sub.1-6 alkoxy, such as
perfluoroalkoxy); (4) C.sub.1-6 alkylsulfinyl; (5) C.sub.6-10 aryl;
(6) amino; (7) C.sub.1-6 alk-C.sub.6-10 aryl; (8) azido; (9)
C.sub.3-8 cycloalkyl; (10) C.sub.1-6 alk-C.sub.3-8 cycloalkyl; (11)
halo; (12) C.sub.1-12 heterocyclyl (e.g., C.sub.1-12 heteroaryl);
(13) (C.sub.1-12 heterocyclyl)oxy; (14) hydroxy; (15) nitro; (16)
C.sub.1-20 thioalkoxy (e.g., C.sub.1-6 thioalkoxy); (17)
--(CH.sub.2).sub.gCO.sub.2R.sup.A', where q is an integer from zero
to four, and R.sup.A' is selected from the group consisting of (a)
C.sub.1-6 alkyl, (b) C.sub.6-10 aryl, (c) hydrogen, and (d)
C.sub.1-6 alk-C.sub.6-10 aryl; (18)
--(CH.sub.2).sub.qCONR.sup.B'R.sup.C', where q is an integer from
zero to four and where R.sup.B' and R.sup.C' are independently
selected from the group consisting of (a) hydrogen, (b) C.sub.1-6
alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6 alk-C.sub.6-10 aryl;
(19) --(CH.sub.2).sub.qSO.sub.2R.sup.D', where q is an integer from
zero to four and where R.sup.D' is selected from the group
consisting of (a) alkyl, (b) C.sub.6-10 aryl, and (c)
alk-C.sub.6-10 aryl; (20)
--(CH.sub.2).sub.qSO.sub.2NR.sup.E'R.sup.F', where q is an integer
from zero to four and where each of R.sup.E' and R.sup.F' is,
independently, selected from the group consisting of (a) hydrogen,
(b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6
alk-C.sub.6-10 aryl; (21) thiol; (22) C.sub.6-10 aryloxy; (23)
C.sub.3-8 cycloalkoxy; (24) C.sub.6-10 aryl-C.sub.1-6 alkoxy; (25)
C.sub.1-6 alk-C.sub.1-12 heterocyclyl (e.g., C.sub.1-6
alk-C.sub.1-12 heteroaryl); (26) C.sub.2-20 alkenyl; and (27)
C.sub.2-20 alkynyl. In some embodiments, each of these groups can
be further substituted as described herein. For example, the
alkylene group of a C.sub.1-alkaryl or a C.sub.1-alkheterocyclyl
can be further substituted with an oxo group to afford the
respective aryloyl and (heterocyclyl)oyl substituent group.
[0989] The term "arylalkoxy," as used herein, represents an alkaryl
group, as defined herein, attached to the parent molecular group
through an oxygen atom. Exemplary unsubstituted alkoxyalkyl groups
include from 7 to 30 carbons (e.g., from 7 to 16 or from 7 to 20
carbons, such as C.sub.6-10 aryl-C.sub.1-6 alkoxy, C.sub.6-10
aryl-C.sub.1-10 alkoxy, or C.sub.6-10 aryl-C.sub.1-20 alkoxy). In
some embodiments, the arylalkoxy group can be substituted with 1,
2, 3, or 4 substituents as defined herein
[0990] The term "aryloxy" represents a chemical substituent of
formula --OR', where R' is an aryl group of 6 to 18 carbons, unless
otherwise specified. In some embodiments, the aryl group can be
substituted with 1, 2, 3, or 4 substituents as defined herein.
[0991] The term "aryloyl," as used herein, represents an aryl
group, as defined herein, that is attached to the parent molecular
group through a carbonyl group. Exemplary unsubstituted aryloyl
groups are of 7 to 11 carbons. In some embodiments, the aryl group
can be substituted with 1, 2, 3, or 4 substituents as defined
herein.
[0992] The term "azido" represents an --N.sub.3 group, which can
also be represented as --N.dbd.N.dbd.N.
[0993] The term "bicyclic," as used herein, refer to a structure
having two rings, which may be aromatic or non-aromatic. Bicyclic
structures include spirocyclyl groups, as defined herein, and two
rings that share one or more bridges, where such bridges can
include one atom or a chain including two, three, or more atoms.
Exemplary bicyclic groups include a bicyclic carbocyclyl group,
where the first and second rings are carbocyclyl groups, as defined
herein; a bicyclic aryl groups, where the first and second rings
are aryl groups, as defined herein; bicyclic heterocyclyl groups,
where the first ring is a heterocyclyl group and the second ring is
a carbocyclyl (e.g., aryl) or heterocyclyl (e.g., heteroaryl)
group; and bicyclic heteroaryl groups, where the first ring is a
heteroaryl group and the second ring is a carbocyclyl (e.g., aryl)
or heterocyclyl (e.g., heteroaryl) group. In some embodiments, the
bicyclic group can be substituted with 1, 2, 3, or 4 substituents
as defined herein for cycloalkyl, heterocyclyl, and aryl
groups.
[0994] The terms "carbocyclic" and "carbocyclyl," as used herein,
refer to an optionally substituted C.sub.3-12 monocyclic, bicyclic,
or tricyclic structure in which the rings, which may be aromatic or
non-aromatic, are formed by carbon atoms. Carbocyclic structures
include cycloalkyl, cycloalkenyl, and aryl groups.
[0995] The term "carbamoyl," as used herein, represents
--C(O)--N(R.sup.N1).sub.2, where the meaning of each R.sup.N1 is
found in the definition of "amino" provided herein.
[0996] The term "carbamoylalkyl," as used herein, represents an
alkyl group, as defined herein, substituted by a carbamoyl group,
as defined herein. The alkyl group can be further substituted with
1, 2, 3, or 4 substituent groups as described herein.
[0997] The term "carbamyl," as used herein, refers to a carbamate
group having the structure --NR.sup.N1C(.dbd.O)OR or
--OC(.dbd.O)N(R.sup.N1).sub.2, where the meaning of each R.sup.N1
is found in the definition of "amino" provided herein, and R is
alkyl, cycloalkyl, alkcycloalkyl, aryl, alkaryl, heterocyclyl
(e.g., heteroaryl), or alkheterocyclyl (e.g., alkheteroaryl), as
defined herein.
[0998] The term "carbonyl," as used herein, represents a C(O)
group, which can also be represented as C.dbd.O.
[0999] The term "carboxyaldehyde" represents an acyl group having
the structure --CHO.
[1000] The term "carboxy," as used herein, means --CO.sub.2H.
[1001] The term "carboxyalkoxy," as used herein, represents an
alkoxy group, as defined herein, substituted by a carboxy group, as
defined herein. The alkoxy group can be further substituted with 1,
2, 3, or 4 substituent groups as described herein for the alkyl
group.
[1002] The term "carboxyalkyl," as used herein, represents an alkyl
group, as defined herein, substituted by a carboxy group, as
defined herein. The alkyl group can be further substituted with 1,
2, 3, or 4 substituent groups as described herein.
[1003] The term "cyano," as used herein, represents an --CN
group.
[1004] The term "cycloalkoxy" represents a chemical substituent of
formula --OR, where R is a C.sub.3-8 cycloalkyl group, as defined
herein, unless otherwise specified. The cycloalkyl group can be
further substituted with 1, 2, 3, or 4 substituent groups as
described herein. Exemplary unsubstituted cycloalkoxy groups are
from 3 to 8 carbons. In some embodiment, the cycloalkyl group can
be further substituted with 1, 2, 3, or 4 substituent groups as
described herein.
[1005] The term "cycloalkyl," as used herein represents a
monovalent saturated or unsaturated non-aromatic cyclic hydrocarbon
group from three to eight carbons, unless otherwise specified, and
is exemplified by cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl,
cycloheptyl, bicyclo[2.2.1]heptyl, and the like. When the
cycloalkyl group includes one carbon-carbon double bond, the
cycloalkyl group can be referred to as a "cycloalkenyl" group.
Exemplary cycloalkenyl groups include cyclopentenyl, cyclohexenyl,
and the like. The cycloalkyl groups of this invention can be
optionally substituted with: (1) C.sub.1-7 acyl (e.g.,
carboxyaldehyde); (2) C.sub.1-20 alkyl (e.g., C.sub.1-6 alkyl,
C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.1-6 alkylsulfinyl-C.sub.1-6
alkyl, amino-C.sub.1-6 alkyl, azido-C.sub.1-6 alkyl,
(carboxyaldehyde)-C.sub.1-6 alkyl, halo-C.sub.1-6 alkyl (e.g.,
perfluoroalkyl), hydroxy-C.sub.1-6 alkyl, nitro-C.sub.1-6 alkyl, or
C.sub.1-6 thioalkoxy-C.sub.1-6 alkyl); (3) C.sub.1-20 alkoxy (e.g.,
C.sub.1-6 alkoxy, such as perfluoroalkoxy); (4) C.sub.1-6
alkylsulfinyl; (5) C.sub.6-10 aryl; (6) amino; (7) C.sub.1-6
alk-C.sub.6-10 aryl; (8) azido; (9) C.sub.3-8 cycloalkyl; (10)
C.sub.1-6 alk-C.sub.3-8 cycloalkyl; (11) halo; (12) C.sub.1-12
heterocyclyl (e.g., C.sub.1-12 heteroaryl); (13) (C.sub.1-12
heterocyclyl)oxy; (14) hydroxy; (15) nitro; (16) C.sub.1-20
thioalkoxy (e.g., C.sub.1-6 thioalkoxy); (17)
--(CH.sub.2).sub.qCO.sub.2R.sup.A', where q is an integer from zero
to four, and R.sup.A' is selected from the group consisting of (a)
C.sub.1-6 alkyl, (b) C.sub.6-10 aryl, (c) hydrogen, and (d)
C.sub.1-6 alk-C.sub.6-10 aryl; (18)
--(CH.sub.2).sub.qCONR.sup.B'R.sup.C', where q is an integer from
zero to four and where R.sup.B' and R.sup.C' are independently
selected from the group consisting of (a) hydrogen, (b) C.sub.6-10
alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6 alk-C.sub.6-10 aryl;
(19) --(CH.sub.2).sub.qSO.sub.2R.sup.D', where q is an integer from
zero to four and where R.sup.D' is selected from the group
consisting of (a) C.sub.6-10 alkyl, (b) C.sub.6-10 aryl, and (c)
C.sub.1-6 alk-C.sub.6-10 aryl; (20)
--(CH.sub.2).sub.qSO.sub.2NR.sup.E'R.sup.F', where q is an integer
from zero to four and where each of R.sup.E' and R.sup.F' is,
independently, selected from the group consisting of (a) hydrogen,
(b) C.sub.6-10 alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6
alk-C.sub.6-10 aryl; (21) thiol; (22) C.sub.6-10 aryloxy; (23)
C.sub.3-8 cycloalkoxy; (24) C.sub.6-10 aryl-C.sub.1-6 alkoxy; (25)
C.sub.1-6 alk-C.sub.1-12 heterocyclyl (e.g., C.sub.1-6
alk-C.sub.1-12 heteroaryl); (26) oxo; (27) C.sub.2-20 alkenyl; and
(28) C.sub.2-20 alkynyl. In some embodiments, each of these groups
can be further substituted as described herein. For example, the
alkylene group of a C.sub.1-alkaryl or a C.sub.1-alkheterocyclyl
can be further substituted with an oxo group to afford the
respective aryloyl and (heterocyclyl)oyl substituent group.
[1006] The term "diastereomer," as used herein means stereoisomers
that are not mirror images of one another and are
non-superimposable on one another.
[1007] The term "effective amount" of an agent, as used herein, is
that amount sufficient to effect beneficial or desired results, for
example, clinical results, and, as such, an "effective amount"
depends upon the context in which it is being applied. For example,
in the context of administering an agent that treats cancer, an
effective amount of an agent is, for example, an amount sufficient
to achieve treatment, as defined herein, of cancer, as compared to
the response obtained without administration of the agent.
[1008] The term "enantiomer," as used herein, means each individual
optically active form of a compound of the invention, having an
optical purity or enantiomeric excess (as determined by methods
standard in the art) of at least 80% (i.e., at least 90% of one
enantiomer and at most 10% of the other enantiomer), preferably at
least 90% and more preferably at least 98%.
[1009] The term "halo," as used herein, represents a halogen
selected from bromine, chlorine, iodine, or fluorine.
[1010] The term "haloalkoxy," as used herein, represents an alkoxy
group, as defined herein, substituted by a halogen group (i.e., F,
Cl, Br, or I). A haloalkoxy may be substituted with one, two,
three, or, in the case of alkyl groups of two carbons or more, four
halogens. Haloalkoxy groups include perfluoroalkoxys (e.g.,
--OCF.sub.3), --OCHF.sub.2, --OCH.sub.2F, --OCCl.sub.3,
--OCH.sub.2CH.sub.2Br, --OCH.sub.2CH(CH.sub.2CH.sub.2Br)CH.sub.3,
and --OCHICH.sub.3. In some embodiments, the haloalkoxy group can
be further substituted with 1, 2, 3, or 4 substituent groups as
described herein for alkyl groups.
[1011] The term "haloalkyl," as used herein, represents an alkyl
group, as defined herein, substituted by a halogen group (i.e., F,
Cl, Br, or I). A haloalkyl may be substituted with one, two, three,
or, in the case of alkyl groups of two carbons or more, four
halogens. Haloalkyl groups include perfluoroalkyls (e.g.,
--CF.sub.3), --CHF.sub.2, --CH.sub.2F, --CCl.sub.3,
--CH.sub.2CH.sub.2Br, --CH.sub.2CH(CH.sub.2CH.sub.2Br)CH.sub.3, and
--CHICH.sub.3. In some embodiments, the haloalkyl group can be
further substituted with 1, 2, 3, or 4 substituent groups as
described herein for alkyl groups.
[1012] The term "heteroalkylene," as used herein, refers to an
alkylene group, as defined herein, in which one or two of the
constituent carbon atoms have each been replaced by nitrogen,
oxygen, or sulfur. In some embodiments, the heteroalkylene group
can be further substituted with 1, 2, 3, or 4 substituent groups as
described herein for alkylene groups.
[1013] The term "heteroaryl," as used herein, represents that
subset of heterocyclyls, as defined herein, which are aromatic:
i.e., they contain 4n+2 .mu.l electrons within the mono- or
multicyclic ring system. Exemplary unsubstituted heteroaryl groups
are of 1 to 12 (e.g., 1 to 11, 1 to 10, 1 to 9, 2 to 12, 2 to 11, 2
to 10, or 2 to 9) carbons. In some embodiment, the heteroaryl is
substituted with 1, 2, 3, or 4 substituents groups as defined for a
heterocyclyl group.
[1014] The term "heterocyclyl," as used herein represents a 5-, 6-
or 7-membered ring, unless otherwise specified, containing one,
two, three, or four heteroatoms independently selected from the
group consisting of nitrogen, oxygen, and sulfur. The 5-membered
ring has zero to two double bonds, and the 6- and 7-membered rings
have zero to three double bonds. Exemplary unsubstituted
heterocyclyl groups are of 1 to 12 (e.g., 1 to 11, 1 to 10, 1 to 9,
2 to 12, 2 to 11, 2 to 10, or 2 to 9) carbons. The term
"heterocyclyl" also represents a heterocyclic compound having a
bridged multicyclic structure in which one or more carbons and/or
heteroatoms bridges two non-adjacent members of a monocyclic ring,
e.g., a quinuclidinyl group. The term "heterocyclyl" includes
bicyclic, tricyclic, and tetracyclic groups in which any of the
above heterocyclic rings is fused to one, two, or three carbocyclic
rings, e.g., an aryl ring, a cyclohexane ring, a cyclohexene ring,
a cyclopentane ring, a cyclopentene ring, or another monocyclic
heterocyclic ring, such as indolyl, quinolyl, isoquinolyl,
tetrahydroquinolyl, benzofuryl, benzothienyl and the like. Examples
of fused heterocyclyls include tropanes and
1,2,3,5,8,8a-hexahydroindolizine. Heterocyclics include pyrrolyl,
pyrrolinyl, pyrrolidinyl, pyrazolyl, pyrazolinyl, pyrazolidinyl,
imidazolyl, imidazolinyl, imidazolidinyl, pyridyl, piperidinyl,
homopiperidinyl, pyrazinyl, piperazinyl, pyrimidinyl, pyridazinyl,
oxazolyl, oxazolidinyl, isoxazolyl, isoxazolidiniyl, morpholinyl,
thiomorpholinyl, thiazolyl, thiazolidinyl, isothiazolyl,
isothiazolidinyl, indolyl, indazolyl, quinolyl, isoquinolyl,
quinoxalinyl, dihydroquinoxalinyl, quinazolinyl, cinnolinyl,
phthalazinyl, benzimidazolyl, benzothiazolyl, benzoxazolyl,
benzothiadiazolyl, furyl, thienyl, thiazolidinyl, isothiazolyl,
triazolyl, tetrazolyl, oxadiazolyl (e.g., 1,2,3-oxadiazolyl),
purinyl, thiadiazolyl (e.g., 1,2,3-thiadiazolyl),
tetrahydrofuranyl, dihydrofuranyl, tetrahydrothienyl,
dihydrothienyl, dihydroindolyl, dihydroquinolyl,
tetrahydroquinolyl, tetrahydroisoquinolyl, dihydroisoquinolyl,
pyranyl, dihydropyranyl, dithiazolyl, benzofuranyl,
isobenzofuranyl, benzothienyl, and the like, including dihydro and
tetrahydro forms thereof, where one or more double bonds are
reduced and replaced with hydrogens. Still other exemplary
heterocyclyls include: 2,3,4,5-tetrahydro-2-oxo-oxazolyl;
2,3-dihydro-2-oxo-1H-imidazolyl;
2,3,4,5-tetrahydro-5-oxo-1H-pyrazolyl (e.g.,
2,3,4,5-tetrahydro-2-phenyl-5-oxo-1H-pyrazolyl);
2,3,4,5-tetrahydro-2,4-dioxo-1H-imidazolyl (e.g.,
2,3,4,5-tetrahydro-2,4-dioxo-5-methyl-5-phenyl-1H-imidazolyl);
2,3-dihydro-2-thioxo-1,3,4-oxadiazolyl (e.g.,
2,3-dihydro-2-thioxo-5-phenyl-1,3,4-oxadiazolyl);
4,5-dihydro-5-oxo-1H-triazolyl (e.g., 4,5-dihydro-3-methyl-4-amino
5-oxo-1H-triazolyl); 1,2,3,4-tetrahydro-2,4-dioxopyridinyl (e.g.,
1,2,3,4-tetrahydro-2,4-dioxo-3,3-diethylpyridinyl);
2,6-dioxo-piperidinyl (e.g.,
2,6-dioxo-3-ethyl-3-phenylpiperidinyl);
1,6-dihydro-6-oxopyridiminyl; 1,6-dihydro-4-oxopyrimidinyl (e.g.,
2-(methylthio)-1,6-dihydro-4-oxo-5-methylpyrimidin-1-yl);
1,2,3,4-tetrahydro-2,4-dioxopyrimidinyl (e.g.,
1,2,3,4-tetrahydro-2,4-dioxo-3-ethylpyrimidinyl);
1,6-dihydro-6-oxo-pyridazinyl (e.g.,
1,6-dihydro-6-oxo-3-ethylpyridazinyl);
1,6-dihydro-6-oxo-1,2,4-triazinyl (e.g.,
1,6-dihydro-5-isopropyl-6-oxo-1,2,4-triazinyl);
2,3-dihydro-2-oxo-1H-indolyl (e.g.,
3,3-dimethyl-2,3-dihydro-2-oxo-1H-indolyl and
2,3-dihydro-2-oxo-3,3'-spiropropane-1H-indol-1-yl);
1,3-dihydro-1-oxo-2H-iso-indolyl;
1,3-dihydro-1,3-dioxo-2H-iso-indolyl; 1H-benzopyrazolyl (e.g.,
1-(ethoxycarbonyl)-1H-benzopyrazolyl);
2,3-dihydro-2-oxo-1H-benzimidazolyl (e.g.,
3-ethyl-2,3-dihydro-2-oxo-1H-benzimidazolyl);
2,3-dihydro-2-oxo-benzoxazolyl (e.g.,
5-chloro-2,3-dihydro-2-oxo-benzoxazolyl);
2,3-dihydro-2-oxo-benzoxazolyl; 2-oxo-2H-benzopyranyl;
1,4-benzodioxanyl; 1,3-benzodioxanyl; 2,3-dihydro-3-oxo,
4H-1,3-benzothiazinyl; 3,4-dihydro-4-oxo-3H-quinazolinyl (e.g.,
2-methyl-3,4-dihydro-4-oxo-3H-quinazolinyl);
1,2,3,4-tetrahydro-2,4-dioxo-3H-quinazolyl (e.g.,
1-ethyl-1,2,3,4-tetrahydro-2,4-dioxo-3H-quinazolyl);
1,2,3,6-tetrahydro-2,6-dioxo-7H-purinyl (e.g.,
1,2,3,6-tetrahydro-1,3-dimethyl-2,6-dioxo-7H-purinyl);
1,2,3,6-tetrahydro-2,6-dioxo-1H-purinyl (e.g.,
1,2,3,6-tetrahydro-3,7-dimethyl-2,6-dioxo-1H-purinyl);
2-oxobenz[c,d/]indolyl; 1,1-dioxo-2H-naphth[1,8-c,d/]isothiazolyl;
and 1,8-naphthylenedicarboxamido. Additional heterocyclics include
3,3a,4,5,6,6a-hexahydro-pyrrolo[3,4-b]pyrrol-(2H)-yl, and
2,5-diazabicyclo[2.2.1]heptan-2-yl, homopiperazinyl (or
diazepanyl), tetrahydropyranyl, dithiazolyl, benzofuranyl,
benzothienyl, oxepanyl, thiepanyl, azocanyl, oxecanyl, and
thiocanyl. Heterocyclic groups also include groups of the
formula
##STR00133##
where
[1015] E' is selected from the group consisting of --N-- and
--CH--; F' is selected from the group consisting of --N.dbd.CH--,
--NH--CH.sub.2--, --NH--C(O)--, --NH--, --CH.dbd.N--,
--CH.sub.2--NH--, --C(O)--NH--, --CH.dbd.CH--, --CH.sub.2--,
--CH.sub.2CH.sub.2--, --CH.sub.2O--, --OCH.sub.2--, --O--, and
--S--; and G' is selected from the group consisting of --CH-- and
--N--. Any of the heterocyclyl groups mentioned herein may be
optionally substituted with one, two, three, four or five
substituents independently selected from the group consisting of:
(1) C.sub.1-7 acyl (e.g., carboxyaldehyde); (2) C.sub.1-20 alkyl
(e.g., C.sub.1-6 alkyl, C.sub.1-6 alkoxy-C.sub.1-6 alkyl, C.sub.1-6
alkylsulfinyl-C.sub.1-6 alkyl, amino-C.sub.1-6 alkyl,
azido-C.sub.1-6 alkyl, (carboxyaldehyde)-C.sub.1-6 alkyl,
halo-C.sub.1-6 alkyl (e.g., perfluoroalkyl), hydroxy-C.sub.1-6
alkyl, nitro-C.sub.1-6 alkyl, or C.sub.1-6 thioalkoxy-C.sub.1-6
alkyl); (3) C.sub.1-20 alkoxy (e.g., C.sub.1-6 alkoxy, such as
perfluoroalkoxy); (4) C.sub.1-6 alkylsulfinyl; (5) C.sub.6-10 aryl;
(6) amino; (7) C.sub.1-6 alk-C.sub.6-10 aryl; (8) azido; (9)
C.sub.3-8 cycloalkyl; (10) C.sub.1-6 alk-C.sub.3-8 cycloalkyl; (11)
halo; (12) C.sub.1-12 heterocyclyl (e.g., C.sub.2-12 heteroaryl);
(13) (C.sub.1-12 heterocyclyl)oxy; (14) hydroxy; (15) nitro; (16)
C.sub.1-20 thioalkoxy (e.g., C.sub.1-6 thioalkoxy); (17)
--(CH.sub.2).sub.qCO.sub.2R.sup.A', where q is an integer from zero
to four, and R.sup.A' is selected from the group consisting of (a)
C.sub.1-6 alkyl, (b) C.sub.6-10 aryl, (c) hydrogen, and (d)
C.sub.1-6 alk-C.sub.6-10 aryl; (18)
--(CH.sub.2).sub.qCONR.sup.B'R.sup.C', where q is an integer from
zero to four and where R.sup.B' and R.sup.C' are independently
selected from the group consisting of (a) hydrogen, (b) C.sub.1-6
alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6 alk-C.sub.6-10 aryl;
(19) --(CH.sub.2).sub.qSO.sub.2R.sup.D', where q is an integer from
zero to four and where R.sup.D' is selected from the group
consisting of (a) C.sub.1-6 alkyl, (b) C.sub.6-10 aryl, and (c)
C.sub.1-6 alk-C.sub.6-10 aryl; (20)
--(CH.sub.2).sub.qSO.sub.2NR.sup.E'R.sup.F', where q is an integer
from zero to four and where each of R.sup.E' and R.sup.F' is,
independently, selected from the group consisting of (a) hydrogen,
(b) C.sub.1-6 alkyl, (c) C.sub.6-10 aryl, and (d) C.sub.1-6
alk-C.sub.6-10 aryl; (21) thiol; (22) C.sub.6-10 aryloxy; (23)
C.sub.3-8 cycloalkoxy; (24) arylalkoxy; (25) C.sub.1-6
alk-C.sub.1-12 heterocyclyl (e.g., C.sub.1-6 alk-C.sub.1-12
heteroaryl); (26) oxo; (27) (C.sub.1-12 heterocyclyl)imino; (28)
C.sub.2-20 alkenyl; and (29) C.sub.2-20 alkynyl. In some
embodiments, each of these groups can be further substituted as
described herein. For example, the alkylene group of a
C.sub.1-alkaryl or a C.sub.1-alkheterocyclyl can be further
substituted with an oxo group to afford the respective aryloyl and
(heterocyclyl)oyl substituent group.
[1016] The term "(heterocyclyl)imino," as used herein, represents a
heterocyclyl group, as defined herein, attached to the parent
molecular group through an imino group. In some embodiments, the
heterocyclyl group can be substituted with 1, 2, 3, or 4
substituent groups as defined herein.
[1017] The term "(heterocyclyl)oxy," as used herein, represents a
heterocyclyl group, as defined herein, attached to the parent
molecular group through an oxygen atom. In some embodiments, the
heterocyclyl group can be substituted with 1, 2, 3, or 4
substituent groups as defined herein.
[1018] The term "(heterocyclyl)oyl," as used herein, represents a
heterocyclyl group, as defined herein, attached to the parent
molecular group through a carbonyl group. In some embodiments, the
heterocyclyl group can be substituted with 1, 2, 3, or 4
substituent groups as defined herein.
[1019] The term "hydrocarbon," as used herein, represents a group
consisting only of carbon and hydrogen atoms.
[1020] The term "hydroxy," as used herein, represents an --OH
group.
[1021] The term "hydroxyalkenyl," as used herein, represents an
alkenyl group, as defined herein, substituted by one to three
hydroxy groups, with the proviso that no more than one hydroxy
group may be attached to a single carbon atom of the alkyl group,
and is exemplified by dihydroxypropenyl, hydroxyisopentenyl, and
the like.
[1022] The term "hydroxyalkyl," as used herein, represents an alkyl
group, as defined herein, substituted by one to three hydroxy
groups, with the proviso that no more than one hydroxy group may be
attached to a single carbon atom of the alkyl group, and is
exemplified by hydroxymethyl, dihydroxypropyl, and the like.
[1023] The term "isomer," as used herein, means any tautomer,
stereoisomer, enantiomer, or diastereomer of any compound of the
invention. It is recognized that the compounds of the invention can
have one or more chiral centers and/or double bonds and, therefore,
exist as stereoisomers, such as double-bond isomers (i.e.,
geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e.,
(+) or (-)) or cis/trans isomers). According to the invention, the
chemical structures depicted herein, and therefore the compounds of
the invention, encompass all of the corresponding stereoisomers,
that is, both the stereomerically pure form (e.g., geometrically
pure, enantiomerically pure, or diastereomerically pure) and
enantiomeric and stereoisomeric mixtures, e.g., racemates.
Enantiomeric and stereoisomeric mixtures of compounds of the
invention can typically be resolved into their component
enantiomers or stereoisomers by well-known methods, such as
chiral-phase gas chromatography, chiral-phase high performance
liquid chromatography, crystallizing the compound as a chiral salt
complex, or crystallizing the compound in a chiral solvent.
Enantiomers and stereoisomers can also be obtained from
stereomerically or enantiomerically pure intermediates, reagents,
and catalysts by well-known asymmetric synthetic methods.
[1024] The term "N-protected amino," as used herein, refers to an
amino group, as defined herein, to which is attached one or two
N-protecting groups, as defined herein.
[1025] The term "N-protecting group," as used herein, represents
those groups intended to protect an amino group against undesirable
reactions during synthetic procedures. Commonly used N-protecting
groups are disclosed in Greene, "Protective Groups in Organic
Synthesis," 3.sup.rd Edition (John Wiley & Sons, New York,
1999), which is incorporated herein by reference. N-protecting
groups include acyl, aryloyl, or carbamyl groups such as formyl,
acetyl, propionyl, pivaloyl, t-butylacetyl, 2-chloroacetyl,
2-bromoacetyl, trifluoroacetyl, trichloroacetyl, phthalyl,
o-nitrophenoxyacetyl, .alpha.-chlorobutyryl, benzoyl,
4-chlorobenzoyl, 4-bromobenzoyl, 4-nitrobenzoyl, and chiral
auxiliaries such as protected or unprotected D, L or D, L-amino
acids such as alanine, leucine, phenylalanine, and the like;
sulfonyl-containing groups such as benzenesulfonyl,
p-toluenesulfonyl, and the like; carbamate forming groups such as
benzyloxycarbonyl, p-chlorobenzyloxycarbonyl,
p-methoxybenzyloxycarbonyl, p-nitrobenzyloxycarbonyl,
2-nitrobenzyloxycarbonyl, p-bromobenzyloxycarbonyl,
3,4-dimethoxybenzyloxycarbonyl, 3,5-dimethoxybenzyloxycarbonyl,
2,4-dimethoxybenzyloxycarbonyl, 4-methoxybenzyloxycarbonyl,
2-nitro-4,5-dimethoxybenzyloxycarbonyl,
3,4,5-trimethoxybenzyloxycarbonyl,
1-(p-biphenylyl)-1-methylethoxycarbonyl,
.alpha.,.alpha.-dimethyl-3,5-dimethoxybenzyloxycarbonyl,
benzhydryloxy carbonyl, t-butyloxycarbonyl,
diisopropylmethoxycarbonyl, isopropyloxycarbonyl, ethoxycarbonyl,
methoxycarbonyl, allyloxycarbonyl, 2,2,2,-trichloroethoxycarbonyl,
phenoxycarbonyl, 4-nitrophenoxy carbonyl,
fluorenyl-9-methoxycarbonyl, cyclopentyloxycarbonyl,
adamantyloxycarbonyl, cyclohexyloxycarbonyl, phenylthiocarbonyl,
and the like, alkaryl groups such as benzyl, triphenylmethyl,
benzyloxymethyl, and the like and silyl groups, such as
trimethylsilyl, and the like. Preferred N-protecting groups are
formyl, acetyl, benzoyl, pivaloyl, t-butylacetyl, alanyl,
phenylsulfonyl, benzyl, t-butyloxycarbonyl (Boc), and
benzyloxycarbonyl (Cbz).
[1026] The term "nitro," as used herein, represents an --NO.sub.2
group.
[1027] The term "oxo" as used herein, represents .dbd.O.
[1028] The term "perfluoroalkyl," as used herein, represents an
alkyl group, as defined herein, where each hydrogen radical bound
to the alkyl group has been replaced by a fluoride radical.
Perfluoroalkyl groups are exemplified by trifluoromethyl,
pentafluoroethyl, and the like.
[1029] The term "perfluoroalkoxy," as used herein, represents an
alkoxy group, as defined herein, where each hydrogen radical bound
to the alkoxy group has been replaced by a fluoride radical.
Perfluoroalkoxy groups are exemplified by trifluoromethoxy,
pentafluoroethoxy, and the like.
[1030] The term "spirocyclyl," as used herein, represents a
C.sub.2-7 alkylene diradical, both ends of which are bonded to the
same carbon atom of the parent group to form a spirocyclic group,
and also a C.sub.1-6 heteroalkylene diradical, both ends of which
are bonded to the same atom. The heteroalkylene radical forming the
spirocyclyl group can containing one, two, three, or four
heteroatoms independently selected from the group consisting of
nitrogen, oxygen, and sulfur. In some embodiments, the spirocyclyl
group includes one to seven carbons, excluding the carbon atom to
which the diradical is attached. The spirocyclyl groups of the
invention may be optionally substituted with 1, 2, 3, or 4
substituents provided herein as optional substituents for
cycloalkyl and/or heterocyclyl groups.
[1031] The term "stereoisomer," as used herein, refers to all
possible different isomeric as well as conformational forms which a
compound may possess (e.g., a compound of any formula described
herein), in particular all possible stereochemically and
conformationally isomeric forms, all diastereomers, enantiomers
and/or conformers of the basic molecular structure. Some compounds
of the present invention may exist in different tautomeric forms,
all of the latter being included within the scope of the present
invention.
[1032] The term "sulfoalkyl," as used herein, represents an alkyl
group, as defined herein, substituted by a sulfo group of
--SO.sub.3H. In some embodiments, the alkyl group can be further
substituted with 1, 2, 3, or 4 substituent groups as described
herein.
[1033] The term "sulfonyl," as used herein, represents an
--S(O).sub.2-- group.
[1034] The term "thioalkaryl," as used herein, represents a
chemical substituent of formula --SR, where R is an alkaryl group.
In some embodiments, the alkaryl group can be further substituted
with 1, 2, 3, or 4 substituent groups as described herein.
[1035] The term "thioalkheterocyclyl," as used herein, represents a
chemical substituent of formula --SR, where R is an alkheterocyclyl
group. In some embodiments, the alkheterocyclyl group can be
further substituted with 1, 2, 3, or 4 substituent groups as
described herein.
[1036] The term "thioalkoxy," as used herein, represents a chemical
substituent of formula --SR, where R is an alkyl group, as defined
herein. In some embodiments, the alkyl group can be further
substituted with 1, 2, 3, or 4 substituent groups as described
herein.
[1037] The term "thiol" represents an --SH group.
[1038] Compound: As used herein, the term "compound," is meant to
include all stereoisomers, geometric isomers, tautomers, and
isotopes of the structures depicted.
[1039] The compounds described herein can be asymmetric (e.g.,
having one or more stereocenters). All stereoisomers, such as
enantiomers and diastereomers, are intended unless otherwise
indicated. Compounds of the present disclosure that contain
asymmetrically substituted carbon atoms can be isolated in
optically active or racemic forms. Methods on how to prepare
optically active forms from optically active starting materials are
known in the art, such as by resolution of racemic mixtures or by
stereoselective synthesis. Many geometric isomers of olefins,
C.dbd.N double bonds, and the like can also be present in the
compounds described herein, and all such stable isomers are
contemplated in the present disclosure. Cis and trans geometric
isomers of the compounds of the present disclosure are described
and may be isolated as a mixture of isomers or as separated
isomeric forms.
[1040] Compounds of the present disclosure also include tautomeric
forms. Tautomeric forms result from the swapping of a single bond
with an adjacent double bond and the concomitant migration of a
proton. Tautomeric forms include prototropic tautomers which are
isomeric protonation states having the same empirical formula and
total charge. Examples prototropic tautomers include ketone-enol
pairs, amide-imidic acid pairs, lactam-lactim pairs, amide-imidic
acid pairs, enamine-imine pairs, and annular forms where a proton
can occupy two or more positions of a heterocyclic system, such as,
1H- and 3H-imidazole, 1H-, 2H- and 4H-1,2,4-triazole, 1H- and
2H-isoindole, and 1H- and 2H-pyrazole. Tautomeric forms can be in
equilibrium or sterically locked into one form by appropriate
substitution.
[1041] Compounds of the present disclosure also include all of the
isotopes of the atoms occurring in the intermediate or final
compounds. "Isotopes" refers to atoms having the same atomic number
but different mass numbers resulting from a different number of
neutrons in the nuclei. For example, isotopes of hydrogen include
tritium and deuterium.
[1042] The compounds and salts of the present disclosure can be
prepared in combination with solvent or water molecules to form
solvates and hydrates by routine methods.
[1043] Conserved: As used herein, the term "conserved" refers to
nucleotides or amino acid residues of a polynucleotide sequence or
polypeptide sequence, respectively, that are those that occur
unaltered in the same position of two or more sequences being
compared. Nucleotides or amino acids that are relatively conserved
are those that are conserved amongst more related sequences than
nucleotides or amino acids appearing elsewhere in the
sequences.
[1044] In some embodiments, two or more sequences are said to be
"completely conserved" if they are 100% identical to one another.
In some embodiments, two or more sequences are said to be "highly
conserved" if they are at least 70% identical, at least 80%
identical, at least 90% identical, or at least 95% identical to one
another. In some embodiments, two or more sequences are said to be
"highly conserved" if they are about 70% identical, about 80%
identical, about 90% identical, about 95%, about 98%, or about 99%
identical to one another. In some embodiments, two or more
sequences are said to be "conserved" if they are at least 30%
identical, at least 40% identical, at least 50% identical, at least
60% identical, at least 70% identical, at least 80% identical, at
least 90% identical, or at least 95% identical to one another. In
some embodiments, two or more sequences are said to be "conserved"
if they are about 30% identical, about 40% identical, about 50%
identical, about 60% identical, about 70% identical, about 80%
identical, about 90% identical, about 95% identical, about 98%
identical, or about 99% identical to one another. Conservation of
sequence may apply to the entire length of an oligonucleotide or
polypeptide or may apply to a portion, region or feature
thereof.
[1045] Controlled Release: As used herein, the term "controlled
release" refers to a pharmaceutical composition or compound release
profile that conforms to a particular pattern of release to effect
a therapeutic outcome.
[1046] Cyclic or Cyclized: As used herein, the term "cyclic" refers
to the presence of a continuous loop. Cyclic molecules need not be
circular, only joined to form an unbroken chain of subunits. Cyclic
molecules such as the engineered RNA or mRNA of the present
invention may be single units or multimers or comprise one or more
components of a complex or higher order structure.
[1047] Cytostatic: As used herein, "cytostatic" refers to
inhibiting, reducing, suppressing the growth, division, or
multiplication of a cell (e.g., a mammalian cell (e.g., a human
cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a
combination thereof
[1048] Cytotoxic: As used herein, "cytotoxic" refers to killing or
causing injurious, toxic, or deadly effect on a cell (e.g., a
mammalian cell (e.g., a human cell)), bacterium, virus, fungus,
protozoan, parasite, prion, or a combination thereof.
[1049] Delivery: As used herein, "delivery" refers to the act or
manner of delivering a compound, substance, entity, moiety, cargo
or payload.
[1050] Delivery Agent: As used herein, "delivery agent" refers to
any substance which facilitates, at least in part, the in vivo
delivery of a polynucleotide, primary construct or mmRNA to
targeted cells.
[1051] Destabilized: As used herein, the term "destable,"
"destabilize," or "destabilizing region" means a region or molecule
that is less stable than a starting, wild-type or native form of
the same region or molecule.
[1052] Detectable label: As used herein, "detectable label" refers
to one or more markers, signals, or moieties which are attached,
incorporated or associated with another entity that is readily
detected by methods known in the art including radiography,
fluorescence, chemiluminescence, enzymatic activity, absorbance and
the like. Detectable labels include radioisotopes, fluorophores,
chromophores, enzymes, dyes, metal ions, ligands such as biotin,
avidin, streptavidin and haptens, quantum dots, and the like.
Detectable labels may be located at any position in the peptides or
proteins disclosed herein. They may be within the amino acids, the
peptides, or proteins, or located at the N- or C-termini.
[1053] Digest: As used herein, the term "digest" means to break
apart into smaller pieces or components. When referring to
polypeptides or proteins, digestion results in the production of
peptides.
[1054] Distal: As used herein, the term "distal" means situated
away from the center or away from a point or region of
interest.
[1055] Dosing regimen: As used herein, a "dosing regimen" is a
schedule of administration or physician determined regimen of
treatment, prophylaxis, or palliative care.
[1056] Dose splitting factor (DSF)-ratio of PUD of dose split
treatment divided by PUD of total daily dose or single unit dose.
The value is derived from comparison of dosing regimens groups.
[1057] Encapsulate: As used herein, the term "encapsulate" means to
enclose, surround or encase.
[1058] Encoded protein cleavage signal: As used herein, "encoded
protein cleavage signal" refers to the nucleotide sequence which
encodes a protein cleavage signal.
[1059] Engineered: As used herein, embodiments of the invention are
"engineered" when they are designed to have a feature or property,
whether structural or chemical, that varies from a starting point,
wild type or native molecule.
[1060] Exosome: As used herein, "exosome" is a vesicle secreted by
mammalian cells or a complex involved in RNA degradation.
[1061] Expression: As used herein, "expression" of a nucleic acid
sequence refers to one or more of the following events: (1)
production of an RNA template from a DNA sequence (e.g., by
transcription); (2) processing of an RNA transcript (e.g., by
splicing, editing, 5' cap formation, and/or 3' end processing); (3)
translation of an RNA into a polypeptide or protein; and (4)
post-translational modification of a polypeptide or protein.
[1062] Feature: As used herein, a "feature" refers to a
characteristic, a property, or a distinctive element.
[1063] Formulation: As used herein, a "formulation" includes at
least a polynucleotide, primary construct or mmRNA and a delivery
agent.
[1064] Fragment: A "fragment," as used herein, refers to a portion.
For example, fragments of proteins may comprise polypeptides
obtained by digesting full-length protein isolated from cultured
cells.
[1065] Functional: As used herein, a "functional" biological
molecule is a biological molecule in a form in which it exhibits a
property and/or activity by which it is characterized.
[1066] Homology: As used herein, the term "homology" refers to the
overall relatedness between polymeric molecules, e.g. between
nucleic acid molecules (e.g. DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. In some embodiments,
polymeric molecules are considered to be "homologous" to one
another if their sequences are at least 25%, 30%, 35%, 40%, 45%,
50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identical
or similar. The term "homologous" necessarily refers to a
comparison between at least two sequences (polynucleotide or
polypeptide sequences). In accordance with the invention, two
polynucleotide sequences are considered to be homologous if the
polypeptides they encode are at least about 50%, 60%, 70%, 80%,
90%, 95%, or even 99% for at least one stretch of at least about 20
amino acids. In some embodiments, homologous polynucleotide
sequences are characterized by the ability to encode a stretch of
at least 4-5 uniquely specified amino acids. For polynucleotide
sequences less than 60 nucleotides in length, homology is
determined by the ability to encode a stretch of at least 4-5
uniquely specified amino acids. In accordance with the invention,
two protein sequences are considered to be homologous if the
proteins are at least about 50%, 60%, 70%, 80%, or 90% identical
for at least one stretch of at least about 20 amino acids.
[1067] Identity: As used herein, the term "identity" refers to the
overall relatedness between polymeric molecules, e.g., between
oligonucleotide molecules (e.g. DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. Calculation of the percent
identity of two polynucleotide sequences, for example, can be
performed by aligning the two sequences for optimal comparison
purposes (e.g., gaps can be introduced in one or both of a first
and a second nucleic acid sequences for optimal alignment and
non-identical sequences can be disregarded for comparison
purposes). In certain embodiments, the length of a sequence aligned
for comparison purposes is at least 30%, at least 40%, at least
50%, at least 60%, at least 70%, at least 80%, at least 90%, at
least 95%, or 100% of the length of the reference sequence. The
nucleotides at corresponding nucleotide positions are then
compared. When a position in the first sequence is occupied by the
same nucleotide as the corresponding position in the second
sequence, then the molecules are identical at that position. The
percent identity between the two sequences is a function of the
number of identical positions shared by the sequences, taking into
account the number of gaps, and the length of each gap, which needs
to be introduced for optimal alignment of the two sequences. The
comparison of sequences and determination of percent identity
between two sequences can be accomplished using a mathematical
algorithm. For example, the percent identity between two nucleotide
sequences can be determined using methods such as those described
in Computational Molecular Biology, Lesk, A. M., ed., Oxford
University Press, New York, 1988; Biocomputing: Informatics and
Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993;
Sequence Analysis in Molecular Biology, von Heinje, G., Academic
Press, 1987; Computer Analysis of Sequence Data, Part I, Griffin,
A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994;
and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds.,
M Stockton Press, New York, 1991; each of which is incorporated
herein by reference. For example, the percent identity between two
nucleotide sequences can be determined using the algorithm of
Meyers and Miller (CABIOS, 1989, 4:11-17), which has been
incorporated into the ALIGN program (version 2.0) using a PAM120
weight residue table, a gap length penalty of 12 and a gap penalty
of 4. The percent identity between two nucleotide sequences can,
alternatively, be determined using the GAP program in the GCG
software package using an NWSgapdna.CMP matrix. Methods commonly
employed to determine percent identity between sequences include,
but are not limited to those disclosed in Carillo, H., and Lipman,
D., SIAM J Applied Math., 48:1073 (1988); incorporated herein by
reference. Techniques for determining identity are codified in
publicly available computer programs. Exemplary computer software
to determine homology between two sequences include, but are not
limited to, GCG program package, Devereux, J., et al., Nucleic
Acids Research, 12(1), 387 (1984)), BLASTP, BLASTN, and FASTA
Altschul, S. F. et al., J. Molec. Biol., 215, 403 (1990)).
[1068] Inhibit expression of a gene: As used herein, the phrase
"inhibit expression of a gene" means to cause a reduction in the
amount of an expression product of the gene. The expression product
can be an RNA transcribed from the gene (e.g., an mRNA) or a
polypeptide translated from an mRNA transcribed from the gene.
Typically a reduction in the level of an mRNA results in a
reduction in the level of a polypeptide translated therefrom. The
level of expression may be determined using standard techniques for
measuring mRNA or protein.
[1069] In vitro: As used herein, the term "in vitro" refers to
events that occur in an artificial environment, e.g., in a test
tube or reaction vessel, in cell culture, in a Petri dish, etc.,
rather than within an organism (e.g., animal, plant, or
microbe).
[1070] In vivo: As used herein, the term "in vivo" refers to events
that occur within an organism (e.g., animal, plant, or microbe or
cell or tissue thereof).
[1071] Isolated: As used herein, the term "isolated" refers to a
substance or entity that has been separated from at least some of
the components with which it was associated (whether in nature or
in an experimental setting). Isolated substances may have varying
levels of purity in reference to the substances from which they
have been associated. Isolated substances and/or entities may be
separated from at least about 10%, about 20%, about 30%, about 40%,
about 50%, about 60%, about 70%, about 80%, about 90%, or more of
the other components with which they were initially associated. In
some embodiments, isolated agents are more than about 80%, about
85%, about 90%, about 91%, about 92%, about 93%, about 94%, about
95%, about 96%, about 97%, about 98%, about 99%, or more than about
99% pure. As used herein, a substance is "pure" if it is
substantially free of other components. Substantially isolated: By
"substantially isolated" is meant that the compound is
substantially separated from the environment in which it was formed
or detected. Partial separation can include, for example, a
composition enriched in the compound of the present disclosure.
Substantial separation can include compositions containing at least
about 50%, at least about 60%, at least about 70%, at least about
80%, at least about 90%, at least about 95%, at least about 97%, or
at least about 99% by weight of the compound of the present
disclosure, or salt thereof. Methods for isolating compounds and
their salts are routine in the art.
[1072] Linker: As used herein, a linker refers to a group of atoms,
e.g., 10-1,000 atoms, and can be comprised of the atoms or groups
such as, but not limited to, carbon, amino, alkylamino, oxygen,
sulfur, sulfoxide, sulfonyl, carbonyl, and imine. The linker can be
attached to a modified nucleoside or nucleotide on the nucleobase
or sugar moiety at a first end, and to a payload, e.g., a
detectable or therapeutic agent, at a second end. The linker may be
of sufficient length as to not interfere with incorporation into a
nucleic acid sequence. The linker can be used for any useful
purpose, such as to form mmRNA multimers (e.g., through linkage of
two or more polynucleotides, primary constructs, or mmRNA
molecules) or mmRNA conjugates, as well as to administer a payload,
as described herein. Examples of chemical groups that can be
incorporated into the linker include, but are not limited to,
alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester,
alkylene, heteroalkylene, aryl, or heterocyclyl, each of which can
be optionally substituted, as described herein. Examples of linkers
include, but are not limited to, unsaturated alkanes, polyethylene
glycols (e.g., ethylene or propylene glycol monomeric units, e.g.,
diethylene glycol, dipropylene glycol, triethylene glycol,
tripropylene glycol, tetraethylene glycol, or tetraethylene
glycol), and dextran polymers and derivatives thereof, Other
examples include, but are not limited to, cleavable moieties within
the linker, such as, for example, a disulfide bond (--S--S--) or an
azo bond (--N.dbd.N--), which can be cleaved using a reducing agent
or photolysis. Non-limiting examples of a selectively cleavable
bond include an amido bond can be cleaved for example by the use of
tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents,
and/or photolysis, as well as an ester bond can be cleaved for
example by acidic or basic hydrolysis.
[1073] MicroRNA (miRNA) binding site: As used herein, a microRNA
(miRNA) binding site represents a nucleotide location or region of
a nucleic acid transcript to which at least the "seed" region of a
miRNA binds.
[1074] Modified: As used herein "modified" refers to a changed
state or structure of a molecule of the invention. Molecules may be
modified in many ways including chemically, structurally, and
functionally. In one embodiment, the mRNA molecules of the present
invention are modified by the introduction of non-natural
nucleosides and/or nucleotides, e.g., as it relates to the natural
ribonucleotides A, U, G, and C. Noncanonical nucleotides such as
the cap structures are not considered "modified" although they
differ from the chemical structure of the A, C, G, U
ribonucleotides.
[1075] Mucus: As used herein, "mucus" refers to the natural
substance that is viscous and comprises mucin glycoproteins.
[1076] Naturally occurring: As used herein, "naturally occurring"
means existing in nature without artificial aid.
[1077] Non-human vertebrate: As used herein, a "non human
vertebrate" includes all vertebrates except Homo sapiens, including
wild and domesticated species. Examples of non-human vertebrates
include, but are not limited to, mammals, such as alpaca, banteng,
bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea
pig, horse, llama, mule, pig, rabbit, reindeer, sheep water
buffalo, and yak.
[1078] Off-target: As used herein, "off target" refers to any
unintended effect on any one or more target, gene, or cellular
transcript.
[1079] Open reading frame: As used herein, "open reading frame" or
"ORF" refers to a sequence which does not contain a stop codon in a
given reading frame.
[1080] Operably linked: As used herein, the phrase "operably
linked" refers to a functional connection between two or more
molecules, constructs, transcripts, entities, moieties or the
like.
[1081] Optionally substituted: Herein a phrase of the form
"optionally substituted X" (e.g., optionally substituted alkyl) is
intended to be equivalent to "X, wherein X is optionally
substituted" (e.g., "alkyl, wherein said alkyl is optionally
substituted"). It is not intended to mean that the feature "X"
(e.g. alkyl) per se is optional.
[1082] Peptide: As used herein, "peptide" is less than or equal to
50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45,
or 50 amino acids long.
[1083] Paratope: As used herein, a "paratope" refers to the
antigen-binding site of an antibody.
[1084] Patient: As used herein, "patient" refers to a subject who
may seek or be in need of treatment, requires treatment, is
receiving treatment, will receive treatment, or a subject who is
under care by a trained professional for a particular disease or
condition.
[1085] Pharmaceutically acceptable: The phrase "pharmaceutically
acceptable" is employed herein to refer to those compounds,
materials, compositions, and/or dosage forms which are, within the
scope of sound medical judgment, suitable for use in contact with
the tissues of human beings and animals without excessive toxicity,
irritation, allergic response, or other problem or complication,
commensurate with a reasonable benefit/risk ratio.
[1086] Pharmaceutically acceptable excipients: The phrase
"pharmaceutically acceptable excipient," as used herein, refers any
ingredient other than the compounds described herein (for example,
a vehicle capable of suspending or dissolving the active compound)
and having the properties of being substantially nontoxic and
non-inflammatory in a patient. Excipients may include, for example:
antiadherents, antioxidants, binders, coatings, compression aids,
disintegrants, dyes (colors), emollients, emulsifiers, fillers
(diluents), film formers or coatings, flavors, fragrances, glidants
(flow enhancers), lubricants, preservatives, printing inks,
sorbents, suspensing or dispersing agents, sweeteners, and waters
of hydration. Exemplary excipients include, but are not limited to:
butylated hydroxytoluene (BHT), calcium carbonate, calcium
phosphate (dibasic), calcium stearate, croscarmellose, crosslinked
polyvinyl pyrrolidone, citric acid, crospovidone, cysteine,
ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl
methylcellulose, lactose, magnesium stearate, maltitol, mannitol,
methionine, methylcellulose, methyl paraben, microcrystalline
cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone,
pregelatinized starch, propyl paraben, retinyl palmitate, shellac,
silicon dioxide, sodium carboxymethyl cellulose, sodium citrate,
sodium starch glycolate, sorbitol, starch (corn), stearic acid,
sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C,
and xylitol.
[1087] Pharmaceutically acceptable salts: The present disclosure
also includes pharmaceutically acceptable salts of the compounds
described herein. As used herein, "pharmaceutically acceptable
salts" refers to derivatives of the disclosed compounds wherein the
parent compound is modified by converting an existing acid or base
moiety to its salt form (e.g., by reacting the free base group with
a suitable organic acid). Examples of pharmaceutically acceptable
salts include, but are not limited to, mineral or organic acid
salts of basic residues such as amines; alkali or organic salts of
acidic residues such as carboxylic acids; and the like.
Representative acid addition salts include acetate, adipate,
alginate, ascorbate, aspartate, benzenesulfonate, benzoate,
bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate,
cyclopentanepropionate, digluconate, dodecylsulfate,
ethanesulfonate, fumarate, glucoheptonate, glycerophosphate,
hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride,
hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate,
laurate, lauryl sulfate, malate, maleate, malonate,
methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate,
oleate, oxalate, palmitate, pamoate, pectinate, persulfate,
3-phenylpropionate, phosphate, picrate, pivalate, propionate,
stearate, succinate, sulfate, tartrate, thiocyanate,
toluenesulfonate, undecanoate, valerate salts, and the like.
Representative alkali or alkaline earth metal salts include sodium,
lithium, potassium, calcium, magnesium, and the like, as well as
nontoxic ammonium, quaternary ammonium, and amine cations,
including, but not limited to ammonium, tetramethylammonium,
tetraethylammonium, methylamine, dimethylamine, trimethylamine,
triethylamine, ethylamine, and the like. The pharmaceutically
acceptable salts of the present disclosure include the conventional
non-toxic salts of the parent compound formed, for example, from
non-toxic inorganic or organic acids. The pharmaceutically
acceptable salts of the present disclosure can be synthesized from
the parent compound which contains a basic or acidic moiety by
conventional chemical methods. Generally, such salts can be
prepared by reacting the free acid or base forms of these compounds
with a stoichiometric amount of the appropriate base or acid in
water or in an organic solvent, or in a mixture of the two;
generally, nonaqueous media like ether, ethyl acetate, ethanol,
isopropanol, or acetonitrile are preferred. Lists of suitable salts
are found in Remington's Pharmaceutical Sciences, 17.sup.th ed.,
Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical
Salts: Properties, Selection, and Use, P. H. Stahl and C. G.
Wermuth (eds.), Wiley-VCH, 2008, and Berge et al., Journal of
Pharmaceutical Science, 66, 1-19 (1977), each of which is
incorporated herein by reference in its entirety.
[1088] Pharmaceutically acceptable solvate: The term
"pharmaceutically acceptable solvate," as used herein, means a
compound of the invention wherein molecules of a suitable solvent
are incorporated in the crystal lattice. A suitable solvent is
physiologically tolerable at the dosage administered. For example,
solvates may be prepared by crystallization, recrystallization, or
precipitation from a solution that includes organic solvents,
water, or a mixture thereof. Examples of suitable solvents are
ethanol, water (for example, mono-, di-, and tri-hydrates),
N-methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO),
N,N'-dimethylformamide (DMF), N,N'-dimethylacetamide (DMAC),
1,3-dimethyl-2-imidazolidinone (DMEU),
1,3-dimethyl-3,4,5,6-tetrahydro-2-(1H)-pyrimidinone (DMPU),
acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl
alcohol, 2-pyrrolidone, benzyl benzoate, and the like. When water
is the solvent, the solvate is referred to as a "hydrate."
[1089] Pharmacokinetic: As used herein, "pharmacokinetic" refers to
any one or more properties of a molecule or compound as it relates
to the determination of the fate of substances administered to a
living organism. Pharmacokinetics is divided into several areas
including the extent and rate of absorption, distribution,
metabolism and excretion. This is commonly referred to as ADME
where: (A) Absorption is the process of a substance entering the
blood circulation; (D) Distribution is the dispersion or
dissemination of substances throughout the fluids and tissues of
the body; (M) Metabolism (or Biotransformation) is the irreversible
transformation of parent compounds into daughter metabolites; and
(E) Excretion (or Elimination) refers to the elimination of the
substances from the body. In rare cases, some drugs irreversibly
accumulate in body tissue.
[1090] Physicochemical: As used herein, "physicochemical" means of
or relating to a physical and/or chemical property.
[1091] Polypeptide per unit drug (PUD): As used herein, a PUD or
product per unit drug, is defined as a subdivided portion of total
daily dose, usually 1 mg, pg, kg, etc., of a product (such as a
polypeptide) as measured in body fluid or tissue, usually defined
in concentration such as pmol/mL, mmol/mL, etc divided by the
measure in the body fluid.
[1092] Preventing: As used herein, the term "preventing" refers to
partially or completely delaying onset of an infection, disease,
disorder and/or condition; partially or completely delaying onset
of one or more symptoms, features, or clinical manifestations of a
particular infection, disease, disorder, and/or condition;
partially or completely delaying onset of one or more symptoms,
features, or manifestations of a particular infection, disease,
disorder, and/or condition; partially or completely delaying
progression from an infection, a particular disease, disorder
and/or condition; and/or decreasing the risk of developing
pathology associated with the infection, the disease, disorder,
and/or condition.
[1093] Prodrug: The present disclosure also includes prodrugs of
the compounds described herein. As used herein, "prodrugs" refer to
any substance, molecule or entity which is in a form predicate for
that substance, molecule or entity to act as a therapeutic upon
chemical or physical alteration. Prodrugs may by covalently bonded
or sequestered in some way and which release or are converted into
the active drug moiety prior to, upon or after administered to a
mammalian subject. Prodrugs can be prepared by modifying functional
groups present in the compounds in such a way that the
modifications are cleaved, either in routine manipulation or in
vivo, to the parent compounds. Prodrugs include compounds wherein
hydroxyl, amino, sulfhydryl, or carboxyl groups are bonded to any
group that, when administered to a mammalian subject, cleaves to
form a free hydroxyl, amino, sulfhydryl, or carboxyl group
respectively. Preparation and use of prodrugs is discussed in T.
Higuchi and V. Stella, "Pro-drugs as Novel Delivery Systems," Vol.
14 of the A.C.S. Symposium Series, and in Bioreversible Carriers in
Drug Design, ed. Edward B. Roche, American Pharmaceutical
Association and Pergamon Press, 1987, both of which are hereby
incorporated by reference in their entirety.
[1094] Proliferate: As used herein, the term "proliferate" means to
grow, expand or increase or cause to grow, expand or increase
rapidly. "Proliferative" means having the ability to proliferate.
"Anti-proliferative" means having properties counter to or
inapposite to proliferative properties.
[1095] Protein cleavage site: As used herein, "protein cleavage
site" refers to a site where controlled cleavage of the amino acid
chain can be accomplished by chemical, enzymatic or photochemical
means.
[1096] Protein cleavage signal: As used herein "protein cleavage
signal" refers to at least one amino acid that flags or marks a
polypeptide for cleavage.
[1097] Protein of interest: As used herein, the terms "proteins of
interest" or "desired proteins" include those provided herein and
fragments, mutants, variants, and alterations thereof
[1098] Proximal: As used herein, the term "proximal" means situated
nearer to the center or to a point or region of interest.
[1099] Pseudouridine: As used herein, pseudouridine refers to the
C-glycoside isomer of the nucleoside uridine. A "pseudouridine
analog" is any modification, variant, isoform or derivative of
pseudouridine. For example, pseudouridine analogs include but are
not limited to 1-carboxymethyl-pseudouridine,
1-propynyl-pseudouridine, 1-taurinomethyl-pseudouridine,
1-taurinomethyl-4-thio-pseudouridine, 1-methylpseudouridine
(m.sup.1.psi.), 1-methyl-4-thio-pseudouridine
(m.sup.1s.sup.4.psi.), 4-thio-1-methyl-pseudouridine,
3-methyl-pseudouridine (m.sup.3.psi.),
2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine,
2-thio-1-methyl-1-deaza-pseudouridine, dihydropseudouridine,
2-thio-dihydropseudouridine, 2-methoxyuridine,
2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine,
4-methoxy-2-thio-pseudouridine, N1-methyl-pseudouridine,
1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp.sup.3.psi.),
and 2'-O-methyl-pseudouridine (.psi.m).
[1100] Purified: As used herein, "purify," "purified,"
"purification" means to make substantially pure or clear from
unwanted components, material defilement, admixture or
imperfection.
[1101] Sample: As used herein, the term "sample" or "biological
sample" refers to a subset of its tissues, cells or component parts
(e.g. body fluids, including but not limited to blood, mucus,
lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva,
amniotic fluid, amniotic cord blood, urine, vaginal fluid and
semen). A sample further may include a homogenate, lysate or
extract prepared from a whole organism or a subset of its tissues,
cells or component parts, or a fraction or portion thereof,
including but not limited to, for example, plasma, serum, spinal
fluid, lymph fluid, the external sections of the skin, respiratory,
intestinal, and genitourinary tracts, tears, saliva, milk, blood
cells, tumors, organs. A sample further refers to a medium, such as
a nutrient broth or gel, which may contain cellular components,
such as proteins or nucleic acid molecule.
[1102] Signal Sequences: As used herein, the phrase "signal
sequences" refers to a sequence which can direct the transport or
localization of a protein.
[1103] Single unit dose: As used herein, a "single unit dose" is a
dose of any therapeutic administed in one dose/at one time/single
route/single point of contact, i.e., single administration
event.
[1104] Similarity: As used herein, the term "similarity" refers to
the overall relatedness between polymeric molecules, e.g. between
polynucleotide molecules (e.g. DNA molecules and/or RNA molecules)
and/or between polypeptide molecules. Calculation of percent
similarity of polymeric molecules to one another can be performed
in the same manner as a calculation of percent identity, except
that calculation of percent similarity takes into account
conservative substitutions as is understood in the art.
[1105] Split dose: As used herein, a "split dose" is the division
of single unit dose or total daily dose into two or more doses.
[1106] Stable: As used herein "stable" refers to a compound that is
sufficiently robust to survive isolation to a useful degree of
purity from a reaction mixture, and preferably capable of
formulation into an efficacious therapeutic agent.
[1107] Stabilized: As used herein, the term "stabilize",
"stabilized," "stabilized region" means to make or become
stable.
[1108] Subject: As used herein, the term "subject" or "patient"
refers to any organism to which a composition in accordance with
the invention may be administered, e.g., for experimental,
diagnostic, prophylactic, and/or therapeutic purposes. Typical
subjects include animals (e.g., mammals such as mice, rats,
rabbits, non-human primates, and humans) and/or plants.
[1109] Substantially: As used herein, the term "substantially"
refers to the qualitative condition of exhibiting total or
near-total extent or degree of a characteristic or property of
interest. One of ordinary skill in the biological arts will
understand that biological and chemical phenomena rarely, if ever,
go to completion and/or proceed to completeness or achieve or avoid
an absolute result. The term "substantially" is therefore used
herein to capture the potential lack of completeness inherent in
many biological and chemical phenomena.
[1110] Substantially equal: As used herein as it relates to time
differences between doses, the term means plus/minus 2%.
[1111] Substantially simultaneously: As used herein and as it
relates to plurality of doses, the term means within 2 seconds.
[1112] Suffering from: An individual who is "suffering from" a
disease, disorder, and/or condition has been diagnosed with or
displays one or more symptoms of a disease, disorder, and/or
condition.
[1113] Susceptible to: An individual who is "susceptible to" a
disease, disorder, and/or condition has not been diagnosed with
and/or may not exhibit symptoms of the disease, disorder, and/or
condition but harbors a propensity to develop a disease or its
symptoms. In some embodiments, an individual who is susceptible to
a disease, disorder, and/or condition (for example, cancer) may be
characterized by one or more of the following: (1) a genetic
mutation associated with development of the disease, disorder,
and/or condition; (2) a genetic polymorphism associated with
development of the disease, disorder, and/or condition; (3)
increased and/or decreased expression and/or activity of a protein
and/or nucleic acid associated with the disease, disorder, and/or
condition; (4) habits and/or lifestyles associated with development
of the disease, disorder, and/or condition; (5) a family history of
the disease, disorder, and/or condition; and (6) exposure to and/or
infection with a microbe associated with development of the
disease, disorder, and/or condition. In some embodiments, an
individual who is susceptible to a disease, disorder, and/or
condition will develop the disease, disorder, and/or condition. In
some embodiments, an individual who is susceptible to a disease,
disorder, and/or condition will not develop the disease, disorder,
and/or condition.
[1114] Sustained release: As used herein, the term "sustained
release" refers to a pharmaceutical composition or compound release
profile that conforms to a release rate over a specific period of
time.
[1115] Synthetic: The term "synthetic" means produced, prepared,
and/or manufactured by the hand of man. Synthesis of
polynucleotides or polypeptides or other molecules of the present
invention may be chemical or enzymatic.
[1116] Targeted Cells: As used herein, "targeted cells" refers to
any one or more cells of interest. The cells may be found in vitro,
in vivo, in situ or in the tissue or organ of an organism. The
organism may be an animal, preferably a mammal, more preferably a
human and most preferably a patient.
[1117] Therapeutic Agent: The term "therapeutic agent" refers to
any agent that, when administered to a subject, has a therapeutic,
diagnostic, and/or prophylactic effect and/or elicits a desired
biological and/or pharmacological effect.
[1118] Therapeutically effective amount: As used herein, the term
"therapeutically effective amount" means an amount of an agent to
be delivered (e.g., nucleic acid, drug, therapeutic agent,
diagnostic agent, prophylactic agent, etc.) that is sufficient,
when administered to a subject suffering from or susceptible to an
infection, disease, disorder, and/or condition, to treat, improve
symptoms of, diagnose, prevent, and/or delay the onset of the
infection, disease, disorder, and/or condition.
[1119] Therapeutically effective outcome: As used herein, the term
"therapeutically effective outcome" means an outcome that is
sufficient in a subject suffering from or susceptible to an
infection, disease, disorder, and/or condition, to treat, improve
symptoms of, diagnose, prevent, and/or delay the onset of the
infection, disease, disorder, and/or condition.
[1120] Total daily dose: As used herein, a "total daily dose" is an
amount given or prescribed in 24 hr period. It may be administered
as a single unit dose.
[1121] Transcription factor: As used herein, the term
"transcription factor" refers to a DNA-binding protein that
regulates transcription of DNA into RNA, for example, by activation
or repression of transcription. Some transcription factors effect
regulation of transcription alone, while others act in concert with
other proteins. Some transcription factor can both activate and
repress transcription under certain conditions. In general,
transcription factors bind a specific target sequence or sequences
highly similar to a specific consensus sequence in a regulatory
region of a target gene. Transcription factors may regulate
transcription of a target gene alone or in a complex with other
molecules.
[1122] Treating: As used herein, the term "treating" refers to
partially or completely alleviating, ameliorating, improving,
relieving, delaying onset of, inhibiting progression of, reducing
severity of, and/or reducing incidence of one or more symptoms or
features of a particular infection, disease, disorder, and/or
condition. For example, "treating" cancer may refer to inhibiting
survival, growth, and/or spread of a tumor. Treatment may be
administered to a subject who does not exhibit signs of a disease,
disorder, and/or condition and/or to a subject who exhibits only
early signs of a disease, disorder, and/or condition for the
purpose of decreasing the risk of developing pathology associated
with the disease, disorder, and/or condition.
[1123] Unmodified: As used herein, "unmodified" refers to any
substance, compound or molecule prior to being changed in any way.
Unmodified may, but does not always, refer to the wild type or
native form of a biomolecule. Molecules may undergo a series of
modifications whereby each modified molecule may serve as the
"unmodified" starting molecule for a subsequent modification.
EQUIVALENTS AND SCOPE
[1124] Those skilled in the art will recognize, or be able to
ascertain using no more than routine experimentation, many
equivalents to the specific embodiments in accordance with the
invention described herein. The scope of the present invention is
not intended to be limited to the above Description, but rather is
as set forth in the appended claims.
[1125] In the claims, articles such as "a," "an," and "the" may
mean one or more than one unless indicated to the contrary or
otherwise evident from the context. Claims or descriptions that
include "or" between one or more members of a group are considered
satisfied if one, more than one, or all of the group members are
present in, employed in, or otherwise relevant to a given product
or process unless indicated to the contrary or otherwise evident
from the context. The invention includes embodiments in which
exactly one member of the group is present in, employed in, or
otherwise relevant to a given product or process. The invention
includes embodiments in which more than one, or all of the group
members are present in, employed in, or otherwise relevant to a
given product or process.
[1126] It is also noted that the term "comprising" is intended to
be open and permits but does not require the inclusion of
additional elements or steps. When the term "comprising" is used
herein, the term "consisting of" is thus also encompassed and
disclosed.
[1127] Where ranges are given, endpoints are included. Furthermore,
it is to be understood that unless otherwise indicated or otherwise
evident from the context and understanding of one of ordinary skill
in the art, values that are expressed as ranges can assume any
specific value or subrange within the stated ranges in different
embodiments of the invention, to the tenth of the unit of the lower
limit of the range, unless the context clearly dictates
otherwise.
[1128] In addition, it is to be understood that any particular
embodiment of the present invention that falls within the prior art
may be explicitly excluded from any one or more of the claims.
Since such embodiments are deemed to be known to one of ordinary
skill in the art, they may be excluded even if the exclusion is not
set forth explicitly herein. Any particular embodiment of the
compositions of the invention (e.g., any nucleic acid or protein
encoded thereby; any method of production; any method of use; etc.)
can be excluded from any one or more claims, for any reason,
whether or not related to the existence of prior art.
[1129] All cited sources, for example, references, publications,
databases, database entries, and art cited herein, are incorporated
into this application by reference, even if not expressly stated in
the citation. In case of conflicting statements of a cited source
and the instant application, the statement in the instant
application shall control.
[1130] Section and table headings are not intended to be
limiting.
EXAMPLES
Example 1
Modified mRNA Production
[1131] Modified mRNAs (mmRNA) according to the invention may be
made using standard laboratory methods and materials. The open
reading frame (ORF) of the gene of interest may be flanked by a 5'
untranslated region (UTR) which may contain a strong Kozak
translational initiation signal and/or an alpha-globin 3' UTR which
may include an oligo(dT) sequence for templated addition of a
poly-A tail. The modified mRNAs may be modified to reduce the
cellular innate immune response. The modifications to reduce the
cellular response may include pseudouridine (.psi.) and
5-methyl-cytidine (5meC, 5mc or m.sup.5C). (See, Kariko K et al.
Immunity 23:165-75 (2005), Kariko K et al. Mol Ther 16:1833-40
(2008), Anderson B R et al. NAR (2010); each of which are herein
incorporated by reference in their entireties).
[1132] The ORF may also include various upstream or downstream
additions (such as, but not limited to, (3-globin, tags, etc.) may
be ordered from an optimization service such as, but limited to,
DNA2.0 (Menlo Park, Calif.) and may contain multiple cloning sites
which may have XbaI recognition. Upon receipt of the construct, it
may be reconstituted and transformed into chemically competent E.
coli.
[1133] For the present invention, NEB DH5-alpha Competent E. coli
are used. Transformations are performed according to NEB
instructions using 100 ng of plasmid. The protocol is as follows:
[1134] 1 Thaw a tube of NEB 5-alpha Competent E. coli cells on ice
for 10 minutes. [1135] 2 Add 1-5 .mu.l containing 1 pg-100 ng of
plasmid DNA to the cell mixture. Carefully flick the tube 4-5 times
to mix cells and DNA. Do not vortex. [1136] 3 Place the mixture on
ice for 30 minutes. Do not mix. [1137] 4 Heat shock at 42.degree.
C. for exactly 30 seconds. Do not mix. [1138] 5 Place on ice for 5
minutes. Do not mix. [1139] 6 Pipette 950 .mu.l of room temperature
SOC into the mixture. [1140] 7 Place at 37.degree. C. for 60
minutes. Shake vigorously (250 rpm) or rotate. [1141] 8 Warm
selection plates to 37.degree. C. [1142] 9 Mix the cells thoroughly
by flicking the tube and inverting.
[1143] Spread 50-100 .mu.l of each dilution onto a selection plate
and incubate overnight at 37.degree. C. Alternatively, incubate at
30.degree. C. for 24-36 hours or 25.degree. C. for 48 hours.
[1144] A single colony is then used to inoculate 5 ml of LB growth
media using the appropriate antibiotic and then allowed to grow
(250 RPM, 37.degree. C.) for 5 hours. This is then used to
inoculate a 200 ml culture medium and allowed to grow overnight
under the same conditions.
[1145] To isolate the plasmid (up to 850 .mu.g), a maxi prep is
performed using the Invitrogen PURELINK.TM. HiPure Maxiprep Kit
(Carlsbad, Calif.), following the manufacturer's instructions.
[1146] In order to generate cDNA for In Vitro Transcription (IVT),
the plasmid (an Example of which is shown in FIG. 3) is first
linearized using a restriction enzyme such as XbaI. A typical
restriction digest with XbaI will comprise the following: Plasmid
1.0 .mu.g; 10.times. Buffer 1.0 .mu.l; XbaI 1.5 .mu.l; dH.sub.2O up
to 10 .mu.l; incubated at 37.degree. C. for 1 hr. If performing at
lab scale (<5 .mu.g), the reaction is cleaned up using
Invitrogen's PURELINK.TM. PCR Micro Kit (Carlsbad, Calif.) per
manufacturer's instructions. Larger scale purifications may need to
be done with a product that has a larger load capacity such as
Invitrogen's standard PURELINK.TM. PCR Kit (Carlsbad, Calif.).
Following the cleanup, the linearized vector is quantified using
the NanoDrop and analyzed to confirm linearization using agarose
gel electrophoresis.
[1147] The methods described herein to make modified mRNA may be
used to produce molecules of all sizes including long molecules.
Modified mRNA using the described methods has been made for
different sized molecules including glucosidase, alpha; acid (GAA)
(3.2 kb), cystic fibrosis transmembrane conductance regulator
(CFTR) (4.7 kb), Factor VII (7.3 kb), lysosomal acid lipase (45.4
kDa), glucocerebrosidase (59.7 kDa) and iduronate 2-sulfatase (76
kDa).
[1148] As a non-limiting example, G-CSF may represent the
polypeptide of interest. Sequences used in the steps outlined in
Examples 1-5 are shown in Table 11. It should be noted that the
start codon (ATG) has been underlined in each sequence of Table
11.
TABLE-US-00010 TABLE 11 G-CSF Sequences SEQ ID NO Description
251430 cDNA sequence:
ATGGCTGGACCTGCCACCCAGAGCCCCATGAAGCTGATGGCCCTGC
AGCTGCTGCTGTGGCACAGTGCACTCTGGACAGTGCAGGAAGCCAC
CCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGT
GCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCC
AGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCT
GGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGC
AGCTGCCCCAGCCAGGCCCTGCAGCTGGCAGGCTGCTTGAGCCAAC
TCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGCAGGCCCTGGA
AGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTGCAGCTG
GACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAAC
TGGGAATGGCCCCTGCCCTGCAGCCCACCCAGGGTGCCATGCCGGC
CTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTGCCT
CCCATCTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCA CCTTGCCCAGCCCTGA
251431 cDNA having T7 polymerase site, AfeI and Xba restriction
site: TAATACGACTCACTATA
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGCC ACC
ATGGCTGGACCTGCCACCCAGAGCCCCATGAAGCTGATGGCCCTGC
AGCTGCTGCTGTGGCACAGTGCACTCTGGACAGTGCAGGAAGCCAC
CCCCCTGGGCCCTGCCAGCTCCCTGCCCCAGAGCTTCCTGCTCAAGT
GCTTAGAGCAAGTGAGGAAGATCCAGGGCGATGGCGCAGCGCTCC
AGGAGAAGCTGTGTGCCACCTACAAGCTGTGCCACCCCGAGGAGCT
GGTGCTGCTCGGACACTCTCTGGGCATCCCCTGGGCTCCCCTGAGC
AGCTGCCCCAGCCAGGCCCTGCAGCTGGCAGGCTGCTTGAGCCAAC
TCCATAGCGGCCTTTTCCTCTACCAGGGGCTCCTGCAGGCCCTGGA
AGGGATCTCCCCCGAGTTGGGTCCCACCTTGGACACACTGCAGCTG
GACGTCGCCGACTTTGCCACCACCATCTGGCAGCAGATGGAAGAAC
TGGGAATGGCCCCTGCCCTGCAGCCCACCCAGGGTGCCATGCCGGC
CTTCGCCTCTGCTTTCCAGCGCCGGGCAGGAGGGGTCCTGGTTGCCT
CCCATCTGCAGAGCTTCCTGGAGGTGTCGTACCGCGTTCTACGCCA CCTTGCCCAGCCCTGA
AGCGCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTCTC
TCCCTTGCACCTGTACCTCTTGGTCTTTGAATAAAGCCTGAGTAGGA
AGGCGGCCGCTCGAGCATGCATCTAGA 251432 Optimized sequence; containing
T7 polymerase site, AfeI and Xba restriction site TAATACGACTCACTATA
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGCC ACC
ATGGCCGGTCCCGCGACCCAAAGCCCCATGAAACTTATGGCCCTGC
AGTTGCTGCTTTGGCACTCGGCCCTCTGGACAGTCCAAGAAGCGAC
TCCTCTCGGACCTGCCTCATCGTTGCCGCAGTCATTCCTTTTGAAGT
GTCTGGAGCAGGTGCGAAAGATTCAGGGCGATGGAGCCGCACTCC
AAGAGAAGCTCTGCGCGACATACAAACTTTGCCATCCCGAGGAGCT
CGTACTGCTCGGGCACAGCTTGGGGATTCCCTGGGCTCCTCTCTCGT
CCTGTCCGTCGCAGGCTTTGCAGTTGGCAGGGTGCCTTTCCCAGCTC
CACTCCGGTTTGTTCTTGTATCAGGGACTGCTGCAAGCCCTTGAGGG
AATCTCGCCAGAATTGGGCCCGACGCTGGACACGTTGCAGCTCGAC
GTGGCGGATTTCGCAACAACCATCTGGCAGCAGATGGAGGAACTG
GGGATGGCACCCGCGCTGCAGCCCACGCAGGGGGCAATGCCGGCC
TTTGCGTCCGCGTTTCAGCGCAGGGCGGGTGGAGTCCTCGTAGCGA
GCCACCTTCAATCATTTTTGGAAGTCTCGTACCGGGTGCTGAGACAT CTTGCGCAGCCGTGA
AGCGCTGCCTTCTGCGGGGCTTGCCTTCTGGCCATGCCCTTCTTCTC
TCCCTTGCACCTGTACCTCTTGGTCTTTGAATAAAGCCTGAGTAGGA
AGGCGGCCGCTCGAGCATGCATCTAGA 251433 mRNA sequence (transcribed)
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCC ACC
AUGGCCGGUCCCGCGACCCAAAGCCCCAUGAAACUUAUGGCCCUG
CAGUUGCUGCUUUGGCACUCGGCCCUCUGGACAGUCCAAGAAGCG
ACUCCUCUCGGACCUGCCUCAUCGUUGCCGCAGUCAUUCCUUUUG
AAGUGUCUGGAGCAGGUGCGAAAGAUUCAGGGCGAUGGAGCCGC
ACUCCAAGAGAAGCUCUGCGCGACAUACAAACUUUGCCAUCCCGA
GGAGCUCGUACUGCUCGGGCACAGCUUGGGGAUUCCCUGGGCUCC
UCUCUCGUCCUGUCCGUCGCAGGCUUUGCAGUUGGCAGGGUGCCU
UUCCCAGCUCCACUCCGGUUUGUUCUUGUAUCAGGGACUGCUGCA
AGCCCUUGAGGGAAUCUCGCCAGAAUUGGGCCCGACGCUGGACAC
GUUGCAGCUCGACGUGGCGGAUUUCGCAACAACCAUCUGGCAGC
AGAUGGAGGAACUGGGGAUGGCACCCGCGCUGCAGCCCACGCAG
GGGGCAAUGCCGGCCUUUGCGUCCGCGUUUCAGCGCAGGGCGGG
UGGAGUCCUCGUAGCGAGCCACCUUCAAUCAUUUUUGGAAGUCU
CGUACCGGGUGCUGAGACAUCUUGCGCAGCCGUGA
AGCGCUGCCUUCUGCGGGGCUUGCCUUCUGGCCAUGCCCUUCUUC
UCUCCCUUGCACCUGUACCUCUUGGUCUUUGAAUAAAGCCUGAG UAGGAAG
Example 2
PCR for cDNA Production
[1149] PCR procedures for the preparation of cDNA are performed
using 2.times.KAPA HIFI.TM. HotStart ReadyMix by Kapa Biosystems
(Woburn, Mass.). This system includes 2.times.KAPA ReadyMixl2.5
.mu.l; Forward Primer (10 uM) 0.75 .mu.l; Reverse Primer (10 uM)
0.75 .mu.l; Template cDNA 100 ng; and dH.sub.2O diluted to 25.0
.mu.l. The reaction conditions are at 95.degree. C. for 5 min. and
25 cycles of 98.degree. C. for 20 sec, then 58.degree. C. for 15
sec, then 72.degree. C. for 45 sec, then 72.degree. C. for 5 min.
then 4.degree. C. to termination.
[1150] The reverse primer of the instant invention incorporates a
poly-T.sub.120 for a poly-A.sub.120 in the mRNA. Other reverse
primers with longer or shorter poly(T) tracts can be used to adjust
the length of the poly(A) tail in the mRNA.
[1151] The reaction is cleaned up using Invitrogen's PURELINK.TM.
PCR Micro Kit (Carlsbad, Calif.) per manufacturer's instructions
(up to 5 .mu.g). Larger reactions will require a cleanup using a
product with a larger capacity. Following the cleanup, the cDNA is
quantified using the NANODROP.TM. and analyzed by agarose gel
electrophoresis to confirm the cDNA is the expected size. The cDNA
is then submitted for sequencing analysis before proceeding to the
in vitro transcription reaction.
Example 3
In Vitro Transcription (IVT)
[1152] The in vitro transcription reaction generates mRNA
containing modified nucleotides or modified RNA. The input
nucleotide triphosphate (NTP) mix is made in-house using natural
and un-natural NTPs.
[1153] A typical in vitro transcription reaction includes the
following:
TABLE-US-00011 1 Template cDNA 1.0 .mu.g 2 10x transcription buffer
(400 mM 2.0 .mu.l Tris-HCl pH 8.0, 190 mM MgCl.sub.2, 50 mM DTT, 10
mM Spermidine) 3 Custom NTPs (25 mM each) 7.2 .mu.l 4 RNase
Inhibitor 20 U 5 T7 RNA polymerase 3000 U 6 dH.sub.20 Up to 20.0
.mu.l. and 7 Incubation at 37.degree. C. for 3 hr-5 hrs.
[1154] The crude IVT mix may be stored at 4.degree. C. overnight
for cleanup the next day. 1 U of RNase-free DNase is then used to
digest the original template. After 15 minutes of incubation at
37.degree. C., the mRNA is purified using Ambion's MEGACLEAR.TM.
Kit (Austin, Tex.) following the manufacturer's instructions. This
kit can purify up to 500 .mu.g of RNA. Following the cleanup, the
RNA is quantified using the NanoDrop and analyzed by agarose gel
electrophoresis to confirm the RNA is the proper size and that no
degradation of the RNA has occurred.
Example 4
Enzymatic Capping of mRNA
[1155] Capping of the mRNA is performed as follows where the
mixture includes: IVT RNA 60 .mu.g-180 .mu.g and dH.sub.2O up to 72
.mu.l. The mixture is incubated at 65.degree. C. for 5 minutes to
denature RNA, and then is transferred immediately to ice.
[1156] The protocol then involves the mixing of 10.times. Capping
Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KCl, 12.5 mM MgCl.sub.2)
(10.0 .mu.l); 20 mM GTP (5.0 .mu.l); 20 mM S-Adenosyl Methionine
(2.5 .mu.l); RNase Inhibitor (100 U); 2'-O-Methyltransferase
(400U); Vaccinia capping enzyme (Guanylyl transferase) (40 U);
dH.sub.2O (Up to 28 .mu.l); and incubation at 37.degree. C. for 30
minutes for 60 .mu.g RNA or up to 2 hours for 180 .mu.g of RNA.
[1157] The mRNA is then purified using Ambion's MEGACLEAR.TM. Kit
(Austin, Tex.) following the manufacturer's instructions. Following
the cleanup, the RNA is quantified using the NANODROP.TM.
(ThermoFisher, Waltham, Mass.) and analyzed by agarose gel
electrophoresis to confirm the RNA is the proper size and that no
degradation of the RNA has occurred. The RNA product may also be
sequenced by running a reverse-transcription-PCR to generate the
cDNA for sequencing.
Example 5
PolyA Tailing Reaction
[1158] Without a poly-T in the cDNA, a poly-A tailing reaction must
be performed before cleaning the final product. This is done by
mixing Capped IVT RNA (100 .mu.l); RNase Inhibitor (20 U);
10.times. Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100
mM MgCl.sub.2)(12.0 .mu.L1); 20 mM ATP (6.0 .mu.l); Poly-A
Polymerase (20 U); dH.sub.2O up to 123.5 IA and incubation at
37.degree. C. for 30 min. If the poly-A tail is already in the
transcript, then the tailing reaction may be skipped and proceed
directly to cleanup with Ambion's MEGACLEAR.TM. kit (Austin, Tex.)
(up to 500 .mu.g). Poly-A Polymerase is preferably a recombinant
enzyme expressed in yeast.
[1159] For studies performed and described herein, the poly-A tail
is encoded in the IVT template to comprise 160 nucleotides in
length. However, it should be understood that the processivity or
integrity of the polyA tailing reaction may not always result in
exactly 160 nucleotides. Hence polyA tails of approximately 160
nucleotides, e.g, about 150-165, 155, 156, 157, 158, 159, 160, 161,
162, 163, 164 or 165 are within the scope of the invention.
Example 6
Natural 5' Caps and 5' Cap Analogues
[1160] 5'-capping of modified RNA may be completed concomitantly
during the in vitro-transcription reaction using the following
chemical RNA cap analogs to generate the 5'-guanosine cap structure
according to manufacturer protocols: 3'-O-Me-m7G(5')ppp(5') G [the
ARCA cap]; G(5)ppp(5')A; G(5')ppp(5')G; m7G(5')ppp(5')A;
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). 5'-capping
of modified RNA may be completed post-transcriptionally using a
Vaccinia Virus Capping Enzyme to generate the "Cap 0" structure:
m7G(5')ppp(5')G (New England BioLabs, Ipswich, Mass.). Cap 1
structure may be generated using both Vaccinia Virus Capping Enzyme
and a 2'-O methyl-transferase to generate:
m7G(5')ppp(5')G-2'-O-methyl. Cap 2 structure may be generated from
the Cap 1 structure followed by the 2'-O-methylation of the
5'-antepenultimate nucleotide using a 2'-O methyl-transferase. Cap
3 structure may be generated from the Cap 2 structure followed by
the 2'-O-methylation of the 5'-preantepenultimate nucleotide using
a 2'-O methyl-transferase. Enzymes are preferably derived from a
recombinant source.
[1161] When transfected into mammalian cells, the modified mRNAs
have a stability of between 12-18 hours or more than 18 hours,
e.g., 24, 36, 48, 60, 72 or greater than 72 hours.
Example 7
Capping
[1162] A. Protein Expression Assay
[1163] Synthetic mRNAs encoding human G-CSF (cDNA shown in SEQ ID
NO: 251430; mRNA sequence fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site
shown in SEQ ID NO: 251433 with a polyA tail approximately 160
nucletodies in length not shown in sequence) containing the ARCA
(3' O-Me-m7G(5)ppp(5')G) cap analog or the Cap1structure can be
transfected into human primary keratinocytes at equal
concentrations. 6, 12, 24 and 36 hours post-transfection the amount
of G-CSF secreted into the culture medium can be assayed by ELISA.
Synthetic mRNAs that secrete higher levels of G-CSF into the medium
would correspond to a synthetic mRNA with a higher
translationally-competent Cap structure.
[1164] B. Purity Analysis Synthesis
[1165] Synthetic mRNAs encoding human G-CSF (cDNA shown in SEQ ID
NO: 251430; mRNA sequence fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site
shown in SEQ ID NO: 251433 with a polyA tail approximately 160
nucletodies in length not shown in sequence) containing the ARCA
cap analog or the Cap1structure crude synthesis products can be
compared for purity using denaturing Agarose-Urea gel
electrophoresis or HPLC analysis. Synthetic mRNAs with a single,
consolidated band by electrophoresis correspond to the higher
purity product compared to a synthetic mRNA with multiple bands or
streaking bands. Synthetic mRNAs with a single HPLC peak would also
correspond to a higher purity product. The capping reaction with a
higher efficiency would provide a more pure mRNA population.
[1166] C. Cytokine Analysis
[1167] Synthetic mRNAs encoding human G-CSF (cDNA shown in SEQ ID
NO: 251430; mRNA sequence fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site
shown in SEQ ID NO: 251433 with a polyA tail approximately 160
nucleotides in length not shown in sequence) containing the ARCA
cap analog or the Cap 1 structure can be transfected into human
primary keratinocytes at multiple concentrations. 6, 12, 24 and 36
hours post-transfection the amount of pro-inflammatory cytokines
such as TNF-alpha and IFN-beta secreted into the culture medium can
be assayed by ELISA. Synthetic mRNAs that secrete higher levels of
pro-inflammatory cytokines into the medium would correspond to a
synthetic mRNA containing an immune-activating cap structure.
[1168] D. Capping Reaction Efficiency
[1169] Synthetic mRNAs encoding human G-CSF (cDNA shown in SEQ ID
NO: 251430; mRNA sequence fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site
shown in SEQ ID NO: 251433 with a polyA tail approximately 160
nucleotides in length not shown in sequence) containing the ARCA
cap analog or the Cap1structure can be analyzed for capping
reaction efficiency by LC-MS after capped mRNA nuclease treatment.
Nuclease treatment of capped mRNAs would yield a mixture of free
nucleotides and the capped 5'-5-triphosphate cap structure
detectable by LC-MS. The amount of capped product on the LC-MS
spectra can be expressed as a percent of total mRNA from the
reaction and would correspond to capping reaction efficiency. The
cap structure with higher capping reaction efficiency would have a
higher amount of capped product by LC-MS.
Example 8
Agarose Gel Electrophoresis of Modified RNA or RT PCR Products
[1170] Individual modified RNAs (200-400 ng in a 20 .mu.l volume)
or reverse transcribed PCR products (200-400 ng) are loaded into a
well on a non-denaturing 1.2% Agarose E-Gel (Invitrogen, Carlsbad,
Calif.) and run for 12-15 minutes according to the manufacturer
protocol.
Example 9
Nanodrop Modified RNA Quantification and UV Spectral Data
[1171] Modified RNAs in TE buffer (1 .mu.l) are used for Nanodrop
UV absorbance readings to quantitate the yield of each modified RNA
from an in vitro transcription reaction.
Example 10
Formulation of Modified mRNA Using Lipidoids
[1172] Modified mRNAs (mmRNA) are formulated for in vitro
experiments by mixing the mmRNA with the lipidoid at a set ratio
prior to addition to cells. In vivo formulation may require the
addition of extra ingredients to facilitate circulation throughout
the body. To test the ability of these lipidoids to form particles
suitable for in vivo work, a standard formulation process used for
siRNA-lipidoid formulations was used as a starting point. Initial
mmRNA-lipidoid formulations may consist of particles composed of
42% lipidoid, 48% cholesterol and 10% PEG, with further
optimization of ratios possible. After formation of the particle,
mmRNA is added and allowed to integrate with the complex. The
encapsulation efficiency is determined using a standard dye
exclusion assays.
Materials and Methods for Examples 11-15
[1173] A. Lipid Synthesis
[1174] Six lipids, DLin-DMA, DLin-K-DMA, DLin-KC2-DMA, 98N12-5,
C12-200 and DLin-MC3-DMA, were synthesized by methods outlined in
the art in order to be formulated with modified RNA. DLin-DMA and
precursorswere synthesized as described in Heyes et. al, J. Control
Release, 2005, 107, 276-287. DLin-K-DMA and DLin-KC2-DMA and
precursors were synthesized as described in Semple et. al, Nature
Biotechnology, 2010, 28, 172-176. 98N12-5 and precursor were
synthesized as described in Akinc et. al, Nature Biotechnology,
2008, 26, 561-569.
[1175] C12-200 and precursors were synthesized according to the
method outlined in Love et. al, PNAS, 2010, 107, 1864-1869.
2-epoxydodecane (5.10 g, 27.7 mmol, 8.2 eq) was added to a vial
containing Amine 200 (0.723 g, 3.36 mmol, 1 eq) and a stirring bar.
The vial was sealed and warmed to 80.degree. C. The reaction was
stirred for 4 days at 80.degree. C. Then the mixture was purified
by silica gel chromatography using a gradient from pure
dichloromethane (DCM) to DCM:MeOH 98:2. The target compound was
further purified by RP-HPLC to afford the desired compound.
[1176] DLin-MC3-DMA and precursors were synthesized according to
procedures described in WO 2010054401 herein incorporated by
reference in its entirety. A mixture of dilinoleyl methanol (1.5 g,
2.8 mmol, 1 eq), N,N-dimethylaminobutyric acid (1.5 g, 2.8 mmol, 1
eq), DIPEA (0.73 mL, 4.2 mmol, 1.5 eq) and TBTU (1.35 g, 4.2 mmol,
1.5 eq) in 10 mL of DMF was stirred for 10 h at room temperature.
Then the reaction mixture was diluted in ether and washed with
water. The organic layer was dried over anhydrous sodium sulfate,
filtrated and concentrated under reduced pressure. The crude
product was purified by silica gel chromatography using a gradient
DCM to DCM:MeOH 98:2. Subsequently the target compound was
subjected to an additional RP-HPLC purification which was done
using a YMC-Pack C4 column to afford the target compound.
[1177] B. Formulation of Modified RNA Nanoparticles
[1178] Solutions of synthesized lipid,
1,2-distearoyl-3-phosphatidylcholine (DSPC) (Avanti Polar Lipids,
Alabaster, Ala.), cholesterol (Sigma-Aldrich, Taufkirchen,
Germany), and
.alpha.-[3'-(1,2-dimyristoyl-3-propanoxy)-carboxamide-propyl]-w-methoxy-p-
olyoxyethylene (PEG-c-DOMG) (NOF, Bouwelven, Belgium) were prepared
at concentrations of 50 mM in ethanol and stored at -20.degree. C.
The lipids were combined to yield molar ratio of 50:10:38.5:1.5
(Lipid: DSPC: Cholesterol: PEG-c-DOMG) and diluted with ethanol to
a final lipid concentration of 25 mM. Solutions of modified mRNA at
a concentration of 1-2 mg/mL in water were diluted in 50 mM sodium
citrate buffer at a pH of 3 to form a stock modified mRNA solution.
Formulations of the lipid and modified mRNA were prepared by
combining the synthesized lipid solution with the modified mRNA
solution at total lipid to modified mRNA weight ratio of 10:1,
15:1, 20:1 and 30:1. The lipid ethanolic solution was rapidly
injected into aqueous modified mRNA solution to afford a suspension
containing 33% ethanol. The solutions were injected either manually
(MI) or by the aid of a syringe pump (SP) (Harvard Pump 33 Dual
Syringe Pump Harvard Apparatus Holliston, Mass.).
[1179] To remove the ethanol and to achieve the buffer exhange, the
formulations were dialyzed twice against phosphate buffered saline
(PBS), pH 7.4 at volumes 200-times of the primary product using a
Slide-A-Lyzer cassettes (Thermo Fisher Scientific Inc. Rockford,
Ill.) with a molecular weight cutoff (MWCO) of 10 kD. The first
dialysis was carried at room temperature for 3 hours and then the
formulations were dialyzed overnight at 4.degree. C. The resulting
nanoparticle suspension was filtered through 0.2 .mu.m sterile
filter (Sarstedt, Niimbrecht, Germany) into glass vials and sealed
with a crimp closure.
[1180] C. Characterization of Formulations
[1181] A Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern,
Worcestershire, UK) was used to determine the particle size, the
polydispersity index (PDI) and the zeta potential of the modified
mRNA nanoparticles in 1.times.PBS in determining particle size and
15 mM PBS in determining zeta potential.
[1182] Ultraviolet-visible spectroscopy was used to determine the
concentration of modified mRNA nanoparticle formulation. 100 .mu.L
of the diluted formulation in 1.times.PBS was added to 900 .mu.L of
a 4:1 (v/v) mixture of methanol and chloroform. After mixing, the
absorbance spectrum of the solution was recorded between 230 nm and
330 nm on a DU 800 spectrophotometer (Beckman Coulter, Beckman
Coulter, Inc., Brea, Calif.). The modified RNA concentration in the
nanoparicle formulation was calculated based on the extinction
coefficient of the modified RNA used in the formulation and on the
difference between the absorbance at a wavelength of 260 nm and the
baseline value at a wavelength of 330 nm.
[1183] QUANT-IT.TM. RIBOGREEN.RTM. RNA assay (Invitrogen
Corporation Carlsbad, Calif.) was used to evaluate the
encapsulation of modified RNA by the nanoparticle. The samples were
diluted to a concentration of approximately 5 .mu.g/mL in TE buffer
(10 mM Tris-HCl, 1 mM EDTA, pH 7.5). 50 .mu.L of the diluted
samples were transferred to a polystyrene 96 well plate, then
either 50 .mu.L of TE buffer or 50 .mu.L of a 2% Triton X-100
solution was added. The plate was incubated at a temperature of
37.degree. C. for 15 minutes. The RIBOGREEN.RTM. reagent was
diluted 1:100 in TE buffer, 100 .mu.L of this solution was added to
each well. The fluorescence intensity was measured using a
fluorescence plate reader (Wallac Victor 1420 Multilablel Counter;
Perkin Elmer, Waltham, Mass.) at an excitation wavelength of
.about.480 nm and an emission wavelength of .about.520 nm. The
fluorescence values of the reagent blank were subtracted from that
of each of the samples and the percentage of free modified RNA was
determined by dividing the fluorescence intensity of the intact
sample (without addition of Triton X-100) by the fluorescence value
of the disrupted sample (caused by the addition of Triton
X-100).
[1184] D. In Vitro Incubation
[1185] Human embryonic kidney epithelial (HEK293) and
hepatocellular carcinoma epithelial (HepG2) cells (LGC standards
GmbH, Wesel, Germany) were seeded on 96-well plates (Greiner
Bio-one GmbH, Frickenhausen, Germany) and plates for HEK293 cells
were precoated with collagen typel. HEK293 were seeded at a density
of 30,000 and HepG2 were seeded at a density of 35,000 cells per
well in 100 .mu.l cell culture medium. For HEK293 the cell culture
medium was DMEM, 10% FCS, adding 2 mM L-Glutamine, 1 mM
Sodiumpyruvate and 1.times. non-essential amino acids (Biochrom AG,
Berlin, Germany) and 1.2 mg/ml Sodiumbicarbonate (Sigma-Aldrich,
Munich, Germany) and for HepG2 the culture medium was MEM (Gibco
Life Technologies, Darmstadt, Germany), 10% FCS adding 2 mM
L-Glutamine, 1 mM Sodiumpyruvate and 1.times. non-essential amino
acids (Biochrom AG, Berlin, Germany. Formulations containing
mCherry mRNA (mRNA sequence shown in SEQ ID NO: 251434; polyA tail
of approximately 160 nucleotides not shown in sequence; 5' cap,
Cap1) were added in quadruplicates directly after seeding the cells
and incubated. The mCherry cDNA with the T7 promoter, 5'
untranslated region (UTR) and 3' UTR used in in vitro transcription
(IVT) is given in SEQ ID NO: 251435. The mCherry mRNA was modified
with a 5meC at each cytosine and pseudouridine replacement at each
uridine site.
[1186] Cells were harvested by transferring the culture media
supernatants to a 96-well Pro-Bind U-bottom plate (Beckton
Dickinson GmbH, Heidelberg, Germany). Cells were trypsinized with
1/2 volume Trypsin/EDTA (Biochrom AG, Berlin, Germany), pooled with
respective supernatants and fixed by adding one volume PBS/2% FCS
(both Biochrom AG, Berlin, Germany)/0.5% formaldehyde (Merck,
Darmstadt, Germany). Samples then were submitted to a flow
cytometer measurement with a 532 nm excitation laser and the 610/20
filter for PE-Texas Red in a LSRII cytometer (Beckton Dickinson
GmbH, Heidelberg, Germany). The mean fluorescence intensity (MFI)
of all events and the standard deviation of four independent wells
are presented in for samples analyzed.
Example 11
Purification of Nanoparticle Formulations
[1187] Nanoparticle formulations of DLin-KC2-DMA and 98N12-5 in
HEK293 and HepG2 were tested to determine if the mean fluorescent
intensity (MFI) was dependent on the lipid to modified RNA ratio
and/or purification. Three formulations of DLin-KC2-DMA and two
formulations of 98N12-5 were produced using a syringe pump to the
specifications described in Table 12. Purified samples were
purified by SEPHADEX.TM. G-25 DNA grade (GE Healthcare, Sweden).
Each formulation before and after purification (aP) was tested at
concentration of 250 ng modified RNA per well in a 24 well plate.
The percentage of cells that are positive for the marker for FL4
channel (% FL4-positive) when analyzed by the flow cytometer for
each formulation and the background sample, and the MFI of the
marker for the FL4 channel for each formulation and the background
sample are shown in Table 13. The formulations which had been
purified had a slightly higher MFI than those formulations tested
before purification.
TABLE-US-00012 TABLE 12 Formulations Formulation Lipid/RNA Mean
size # Lipid wt/wt (nm) NPA-001-1 DLin-KC2-DMA 10 155 nm PDI: 0.08
NPA-001-1 aP DLin-KC2-DMA 10 141 nm PDI: 0.14 NPA-002-1
DLin-KC2-DMA 15 140 nm PDI: 0.11 NPA-002-1 aP DLin-KC2-DMA 15 125
nm PDI: 0.12 NPA-003-1 DLin-KC2-DMA 20 114 nm PDI: 0.08 NPA-003-1
aP DLin-KC2-DMA 20 104 nm PDI: 0.06 NPA-005-1 98N12-5 15 127 nm
PDI: 0.12 NPA-005-1 aP 98N12-5 15 134 nm PDI: 0.17 NPA-006-1 98N12
20 126 nm PDI: 0.08 NPA-006-1 aP 98N12 20 118 nm PDI: 0.13
TABLE-US-00013 TABLE 13 HEK293 and HepG2, 24-well, 250 ng Modified
RNA/well % FL4-positive FL4 MFI Formulation HEK293 HepG2 HEK293
HepG2 Untreated 0.33 0.40 0.25 0.30 NPA-001-1 62.42 5.68 1.49 0.41
NPA-001-ap 87.32 9.02 3.23 0.53 NPA-002-1 91.28 9.90 4.43 0.59
NPA-002-ap 92.68 14.02 5.07 0.90 NPA-003-1 87.70 11.76 6.83 0.88
NPA-003-ap 88.88 15.46 8.73 1.06 NPA-005-1 50.60 4.75 1.83 0.46
NPA-005-ap 38.64 5.16 1.32 0.46 NPA-006-1 54.19 13.16 1.30 0.60
NPA-006-ap 49.97 13.74 1.27 0.61
Example 12
Concentration Response Curve
[1188] Nanoparticle formulations of 98N12-5 (NPA-005) and
DLin-KC2-DMA (NPA-003) were tested at varying concentrations to
determine the MFI of FL4 or mCherry (mRNA sequence shown in SEQ ID
NO: 251434; polyA tail of approximately 160 nucleotides not shown
in sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) over a range of doses. The formulations tested are
outlined in Table 14. To determine the optimal concentration of
nanoparticle formulations of 98N12-5, varying concentrations of
formulated modified RNA (100 ng, 10 ng, 1.0 ng, 0.1 ng and 0.01 ng
per well) were tested in a 24-well plate of HEK293, and the results
of the FL4 MFI of each dose are shown in Table 15. Likewise, to
determine the optimal concentration of nanoparticle formulations of
DLin-KC2-DMA, varying concentrations of formulated modified RNA
(250 ng 100 ng, 10 ng, 1.0 ng, 0.1 ng and 0.01 ng per well) were
tested in a 24-well plate of HEK293, and the results of the FL4 MFI
of each dose are shown in Table 16. Nanoparticle formulations of
DLin-KC2-DMA were also tested at varying concentrations of
formulated modified RNA (250 ng, 100 ng and 30 ng per well) in a 24
well plate of HEK293, and the results of the FL4 MFI of each dose
are shown in Table 17. A dose of 1 ng/well for 98N12-5 and a dose
of 10 ng/well for DLin-KC2-DMA were found to resemble the FL4 MFI
of the background.
[1189] To determine how close the concentrations resembled the
background, we utilized a flow cytometer with optimized filter sets
for detection of mCherry expression, and were able to obtain
results with increased sensitivity relative to background levels.
Doses of 25 ng/well, 0.25 ng/well, 0.025 ng/well and 0.0025 ng/well
were analyzed for 98N12-5 (NPA-005) and DLin-KC2-DMA (NPA-003) to
determine the MFI of mCherry. As shown in Table 18, the
concentration of 0.025 ng/well and lesser concentrations are
similar to the background MFI level of mCherry which is about
386.125.
TABLE-US-00014 TABLE 14 Formulations Formulation # NPA-003 NPA-005
Lipid DLin-KC2-DMA 98N12-5 Lipid/RNA 20 15 wt/wt Mean size 114 nm
106 nm PDI: 0.08 PDI: 0.12
TABLE-US-00015 TABLE 15 HEK293, NPA-005, 24-well, n = 4 Formulation
FL4 MFI Untreated control 0.246 NPA-005 100 ng 2.2175 NPA-005 10 ng
0.651 NPA-005 1.0 ng 0.28425 NPA-005 0.1 ng 0.27675 NPA-005 0.01 ng
0.2865
TABLE-US-00016 TABLE 16 HEK293, NPA-003, 24-well, n = 4 Formulation
FL4 MFI Untreated control 0.3225 NPA-003 250 ng 2.9575 NPA-003 100
ng 1.255 NPA-003 10 ng 0.40025 NPA-003 1 ng 0.33025 NPA-003 0.1 ng
0.34625 NPA-003 0.01 ng 0.3475
TABLE-US-00017 TABLE 17 HEK293, NPA-003, 24-well, n = 4 Formulation
FL4 MFI Untreated control 0.27425 NPA-003 250 ng 5.6075 NPA-003 100
ng 3.7825 NPA-003 30 ng 1.5525
TABLE-US-00018 TABLE 18 Concentration and MFI MFI mCherry
Formulation NPA-003 NPA-005 25 ng/well 11963.25 12256.75 0.25
ng/well 1349.75 2572.75 0.025 ng/well 459.50 534.75 0.0025 ng/well
310.75 471.75
Example 13
Manual Injection and Syringe Pump Formulations
[1190] Two formulations of DLin-KC2-DMA and 98N12-5 were prepared
by manual injection (MI) and syringe pump injection (SP) and
analyzed along with a background sample to compare the MFI of
mCherry (mRNA sequence shown in SEQ ID NO: 251434; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) of the
different formulations. Table 19 shows that the syringe pump
formulations had a higher MFI as compared to the manual injection
formulations of the same lipid and lipid/RNA ratio.
TABLE-US-00019 TABLE 19 Formulations and MFI Lipid/ Method
Formulation RNA Mean size of formu- # Lipid wt/wt (nm) lation MFI
Untreated N/A N/A N/A N/A 674.67 Control NPA-002 DLin-KC2- 15 140
nm MI 10318.25 DMA PDI: 0.11 NPA-002-2 DLin-KC2- 15 105 nm SP
37054.75 DMA PDI: 0.04 NPA-003 DLin-KC2- 20 114 nm MI 22037.5 DMA
PDI: 0.08 NPA-003-2 DLin-KC2- 20 95 nm SP 37868.75 DMA PDI: 0.02
NPA-005 98N12-5 15 127 nm MI 11504.75 PDI: 0.12 NPA-005-2 98N12-5
15 106 nm SP 9343.75 PDI: 0.07 NPA-006 98N12-5 20 126 nm MI
11182.25 PDI: 0.08 NPA-006-2 98N12-5 20 93 nm SP 5167 PDI: 0.08
Example 14
Lipid Nanoparticle Formulations
[1191] Formulations of DLin-DMA, DLin-K-DMA, DLin-KC2-DMA, 98N12-5,
C12-200 and DLin-MC3-DMA were incubated at a concentration of 60
ng/well or 62.5 ng/well in a plate of HEK293 and 62.5 ng/well in a
plate of HepG2 cells for 24 hours to determine the MFI of mCherry
(mRNA sequence shown in SEQ ID NO: 251434; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) for each
formulation. The formulations tested are outlined in Table 20
below. As shown in Table 21 for the 60 ng/well and Tables 22, 23,
24 and 25 for the 62.5 ng/well, the formulation of NPA-003 and
NPA-018 have the highest mCherry MFI and the formulations of
NPA-008, NPA-010 and NPA-013 are most the similar to the background
sample mCherry MFI value.
TABLE-US-00020 TABLE 20 Formulations Formulation Lipid/RNA Mean
size # Lipid wt/wt (nm) NPA-001 DLin-KC2-DMA 10 155 nm PDI: 0.08
NPA-002 DLin-KC2-DMA 15 140 nm PDI: 0.11 NPA-002-2 DLin-KC2-DMA 15
105 nm PDI: 0.04 NPA-003 DLin-KC2-DMA 20 114 nm PDI: 0.08 NPA-003-2
DLin-KC2-DMA 20 95 nm PDI: 0.02 NPA-005 98N12-5 15 127 nm PDI: 0.12
NPA-006 98N12-5 20 126 nm PDI: 0.08 NPA-007 DLin-DMA 15 148 nm PDI:
0.09 NPA-008 DLin-K-DMA 15 121 nm PDI: 0.08 NPA-009 C12-200 15 138
nm PDI: 0.15 NPA-010 DLin-MC3-DMA 15 126 nm PDI: 0.09 NPA-012
DLin-DMA 20 86 nm PDI: 0.08 NPA-013 DLin-K-DMA 20 104 nm PDI: 0.03
NPA-014 C12-200 20 101 nm PDI: 0.06 NPA-015 DLin-MC3-DMA 20 109 nm
PDI: 0.07
TABLE-US-00021 TABLE 21 HEK293, 96-well, 60 ng Modified RNA/well
Formulation MFI mCherry Untreated 871.81 NPA-001 6407.25 NPA-002
14995 NPA-003 29499.5 NPA-005 3762 NPA-006 2676 NPA-007 9905.5
NPA-008 1648.75 NPA-009 2348.25 NPA-010 4426.75 NPA-012 11466
NPA-013 2098.25 NPA-014 3194.25 NPA-015 14524
TABLE-US-00022 TABLE 22 HEK293, 62.5 ng/well Formulation MFI
mCherry Untreated 871.81 NPA-001 6407.25 NPA-002 14995 NPA-003
29499.5 NPA-005 3762 NPA-006 2676 NPA-007 9905.5 NPA-008 1648.75
NPA-009 2348.25 NPA-010 4426.75 NPA-012 11466 NPA-013 2098.25
NPA-014 3194.25 NPA-015 14524
TABLE-US-00023 TABLE 23 HEK293, 62.5 ng/well Formulation MFI
mCherry Untreated 295 NPA-007 3504 NPA-012 8286 NPA-017 6128
NPA-003-2 17528 NPA-018 34142 NPA-010 1095 NPA-015 5859 NPA-019
3229
TABLE-US-00024 TABLE 24 HepG2, 62.5 ng/well Formulation MFI mCherry
Untreated 649.94 NPA-001 6006.25 NPA-002 8705 NPA-002-2 15860.25
NPA-003 15059.25 NPA-003-2 28881 NPA-005 1676 NPA-006 1473 NPA-007
15678 NPA-008 2976.25 NPA-009 961.75 NPA-010 3301.75 NPA-012
18333.25 NPA-013 5853 NPA-014 2257 NPA-015 16225.75
TABLE-US-00025 TABLE 25 HepG2, 62.5 ng/well Formulation MFI mCherry
Untreated control 656 NPA-007 16798 NPA-012 21993 NPA-017 20377
NPA-003-2 35651 NPA-018 40154 NPA-010 2496 NPA-015 19741 NPA-019
16373
Example 15
In Vivo Formulation Studies
[1192] Rodents (n=5) are administered intravenously, subcutaneously
or intramuscularly a single dose of a formulation containing a
modified mRNA and a lipid. The modified mRNA administered to the
rodents is selected from G-CSF (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1), erythropoietin (EPO) (mRNA sequence shown
in SEQ ID NO: 251436; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1), Factor IX (mRNA sequence
shown in SEQ ID NO: 251437; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1) or mCherry (mRNA
sequence shown in SEQ ID NO: 251434; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1). The
erythropoietin cDNA with the T7 promoter, 5' untranslated region
(UTR) and 3' UTR used in in vitro transcription (IVT) is given in
SEQ ID NO: 251438 and SEQ ID NO: 251439.
[1193] Each formulation also contains a lipid which is selected
from one of DLin-DMA, DLin-K-DMA, DLin-KC2-DMA, 98N12-5, C12-200,
DLin-MC3-DMA, reLNP, ATUPLEX.RTM., DACC and DBTC. The rodents are
injected with 100 ug, 10 ug or 1 ug of the formulated modified mRNA
and samples are collected at specified time intervals.
[1194] Serum from the rodents administered formulations containing
human G-CSF modified mRNA are measured by specific G-CSF ELISA and
serum from mice administered human factor IX modified RNA is
analyzed by specific factor IX ELISA or chromogenic assay. The
liver and spleen from the mice administered with mCherry modified
mRNA are analyzed by immunohistochemistry (IHC) or
fluorescence-activated cell sorting (FACS). As a control, a group
of mice are not injected with any formulation and their serum and
tissue are collected analyzed by ELISA, FACS and/or IHC.
[1195] A. Time Course
[1196] The rodents are administered formulations containing at
least one modified mRNA to study the time course of protein
expression for the administered formulation. The rodents are bled
at specified time intervals prior to and after administration of
the modified mRNA formulations to determine protein expression and
complete blood count. Samples are also collected from the site of
administration of rodents administered modified mRNA formulations
subcutaneously and intramuscularly to determine the protein
expression in the tissue.
[1197] B. Dose Response
[1198] The rodents are administered formulations containing at
least one modified mRNA to determine dose response of each
formulation. The rodents are bled at specified time intervals prior
to and after administration of the modified mRNA formulations to
determine protein expression and complete blood count. The rodents
are also sacrified to analyze the effect of the modified mRNA
formulation on the internal tissue. Samples are also collected from
the site of administration of rodents administered modified mRNA
formulations subcutaneously and intramuscularly to determine the
protein expression in the tissue.
[1199] C. Toxicity
[1200] The rodents are administered formulations containing at
least one modified mRNA to study toxicity of each formulation. The
rodents are bled at specified time intervals prior to and after
administration of the modified mRNA formulations to determine
protein expression and complete blood count. The rodents are also
sacrificedto analyze the effect of the modified mRNA formulation on
the internal tissue. Samples are also collected from the site of
administration of rodents administered modified mRNA formulations
subcutaneously and intramuscularly to determine the protein
expression in the tissue.
Example 16
PLGA Microsphere Formulations
[1201] Optimization of parameters used in the formulation of PLGA
microspheres may allow for tunable release rates and high
encapsulation efficiencies while maintaining the integrity of the
modified RNA encapsulated in the microspheres. Parameters such as,
but not limited to, particle size, recovery rates and encapsulation
efficiency may be optimized to achieve the optimal formulation.
[1202] A. Synthesis of PLGA microspheres
[1203] Polylacticglycolic acid (PLGA) microspheres were synthesized
using the water/oil/water double emulsification methods known in
the art using PLGA (Lactel, Cat#B6010-2, inherent viscosity
0.55-0.75, 50:50 LA:GA), polyvinylalcohol (PVA) (Sigma,
Cat#348406-25G, MW 13-23 k) dichloromethane and water. Briefly, 0.1
ml of water (W1) was added to 2 ml of PLGA dissolved in
dichloromethane (DCM) (01) at concentrations ranging from 50-200
mg/ml of PLGA. The W1/O1 emulsion was homogenized (IKA Ultra-Turrax
Homogenizer, T18) for 30 seconds at speed 4 (15,000 rpm). The W1/O1
emulsion was then added to 100 to 200 ml of 0.3 to 1% PVA (W2) and
homogenized for 1 minute at varied speeds. Formulations were left
to stir for 3 hours and then washed by centrifugation (20-25 min,
4,000 rpm, 4.degree. C.). The supernatant was discarded and the
PLGA pellets were resuspended in 5-10 ml of water, which was
repeated 2.times.. Average particle size (represents 20-30
particles) for each formulation was determined by microscopy after
washing. Table 26 shows that an increase in the PLGA concentration
led to larger sized microspheres. A PLGA concentration of 200 mg/mL
gave an average particle size of 14.8 .mu.m, 100 mg/mL was 8.7
.mu.m, and 50 mg/mL of PLGA gave an average particle size of 4.0
.mu.m.
TABLE-US-00026 TABLE 26 Varied PLGA Concentration PLGA PVA O1 Con-
W2 Con- Average Sample Volume centration Volume centration Size ID
(mL) (mg/mL) (mL) (%) Speed (.mu.m) 1 2 200 100 0.3 5 14.8 2 2 100
100 0.3 5 8.7 3 2 50 100 0.3 5 4.0
[1204] Table 27 shows that decreasing the homogenization speed from
5 (.about.20,000 rpm) to speed 4 (.about.15,000 rpm) led to an
increase in particle size from 14.8 .mu.m to 29.7 .mu.m.
TABLE-US-00027 TABLE 27 Varied Homogenization Speed PLGA PVA O1
Con- W2 Con- Average Sample Volume centration Volume centration
Size ID (mL) (mg/mL) (mL) (%) Speed (.mu.m) 1 2 200 100 0.3 5 14.8
4 2 200 100 0.3 4 29.7
[1205] Table 28 shows that increasing the W2 volume (i.e.
increasing the ratio of W2:01 from 50:1 to 100:1), decreased
average particle size slightly. Altering the PVA concentration from
0.3 to 1 wt % had little impact on PLGA microsphere size.
TABLE-US-00028 TABLE 28 Varied W2 Volume and Concentration PLGA PVA
O1 Concen- W2 Concen- Average Sample Volume tration Volume tration
Size ID (mL) (mg/mL) (mL) (%) Speed (.mu.m) 1 2 200 100 0.3 5 14.8
5 2 200 200 0.3 5 11.7 6 2 200 190 0.3 5 11.4 7 2 200 190 1.0 5
12.3
[1206] B. Encapsulation of Modified mRNA
[1207] Modified G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433;
[1208] polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was dissolved in water at a concentration of 2 mg/ml
(W3). Three batches of PLGA microsphere formulations were made as
described above with the following parameters: 0.1 ml of W3 at 2
mg/ml, 1.6 ml of O1 at 200 mg/ml, 160 ml of W2 at 1%, and
homogenized at a speed of 4 for the first emulsion (W3/O1) and
homogenized at a speed of 5 for the second emulstion (W3/O1/W2).
After washing by centrifugation, the formulations were frozen in
liquid nitrogen and then lyophilized for 3 days. To test the
encapsulation efficiency of the formulations, the lyophilized
material was deformulated in DCM for 6 hours followed by an
overnight extraction in water. The modified RNA concentration in
the samples was then determined by OD260. Encapsulation efficiency
was calculated by taking the actual amount of modified RNA and
dividing by the starting amount of modified RNA. In the three
batches tested, there was an encapsulation efficiency of 59.2, 49.8
and 61.3.
[1209] C. Integrity of Modified mRNA Encapsulated in PLGA
Microspheres
[1210] Modified Factor IX mRNA (mRNA sequence shown in SEQ ID NO:
251437;
[1211] polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was dissolved in water at varied concentrations (W4)
to vary the weight percent loading in the formulation (mg modified
RNA/mg PLGA*100) and to determine encapsulation efficiency. The
parameters in Table 29 were used to make four different batches of
PLGA microsphere formulations with a homogenization speed of 4 for
the first emulsion (W4/O1) and a homogenization speed of 5 for the
second emulsion (W4/O1/W2).
TABLE-US-00029 TABLE 29 Factor IX PLGA Microsphere Formulation
Parameters Factor IX W4 Concen- Factor IX O1 PLGA W2 PVA Weight %
Vol. tration Amount Volume Concen. Volume Conc. (wt %) ID (uL)
(mg/ml) (ug) (ml) (mg/ml) (ml) (%) Loading A 100 2.0 200.0 2.0 200
200 1.0 0.05 B 100 4.0 400.0 2.0 200 200 1.0 0.10 C 400 2.0 800.0
2.0 200 200 1.0 0.20 D 400 4.0 1600.0 2.0 200 200 1.0 0.40
[1212] After lyophilization, PLGA microspheres were weighed out in
2 ml eppendorf tubes to correspond to .about.10 ug of modified RNA.
Lyophilization was found to not destroy the overall structure of
the PLGA microspheres. To increase weight percent loading (wt %)
for the PLGA microspheres, increasing amounts of modified RNA were
added to the samples. PLGA microspheres were deformulated by adding
1.0 ml of DCM to each tube and then shaking the samples for 6
hours. For modified RNA extraction, 0.5 ml of water was added to
each sample and the samples were shaken overnight before the
concentration of modified RNA in the samples was determined by
OD260. To determine the recovery of the extraction process,
unformulated Factor IX modified RNA (mRNA sequence shown in SEQ ID
NO: 251437; polyA tail of approximately 160 nucleotides not shown
in sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) (deformulation control) was spiked into DCM and was
subjected to the deformulation process. Table 30 shows the loading
and encapsulation efficiency for the samples. All encapsulation
efficiency samples were normalized to the deformulation
control.
TABLE-US-00030 TABLE 30 Weight Percent Loading and Encapsulation
Efficiency Theoretical Actual modified modified RNA RNA
Encapsulation ID loading (wt %) loading (wt %) Efficiency (%) A
0.05 0.06 97.1 B 0.10 0.10 85.7 C 0.20 0.18 77.6 D 0.40 0.31 68.1
Control -- -- 100.0
[1213] D. Release Study of Modified mRNA Encapsulated in PLGA
Microspheres
[1214] PLGA microspheres formulated with Factor IX modified RNA
(mRNA sequence shown in SEQ ID NO: 251437; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) were
deformulated as described above and the integrity of the extracted
modified RNA was determined by automated electrophoresis (Bio-Rad
Experion). The extracted modified mRNA was compared against
unformulated modified mRNA and the deformulation control in order
to test the integrity of the encapsulated modified mRNA. As shown
in FIG. 4, the majority of modRNA was intact for batch ID A, B, C
and D, for the deformulated control (Deform control) and the
unformulated control (Unform control).
[1215] E. Protein Expression of Modified mRNA Encapsulated in PLGA
Microspheres
[1216] PLGA microspheres formulated with Factor IX modified RNA
(mRNA sequence shown in SEQ ID NO: 251437; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) were
deformulated as described above and the protein expression of the
extracted modified RNA was determined by an in vitro transfection
assay. HEK293 cells were reverse transfected with 250 ng of Factor
IX modified RNA complexed with RNAiMAX (Invitrogen) in
triplicate.
[1217] Factor IX modified RNA was diluted in nuclease-free water to
a concentration of 25 ng/.mu.l and RNAiMAX was diluted 13.3.times.
in serum-free EMEM. Equal volumes of diluted modified RNA and
diluted RNAiMAX were mixed together and were allowed to stand for
20 to 30 minutes at room temperature. Subsequently, 20 .mu.l of the
transfection mix containing 250 ng of Factor IX modified RNA was
added to 80 .mu.l of a cell suspension containing 30,000 cells.
Cells were then incubated for 16 h in a humidified 37.degree. C./5%
CO2 cell culture incubator before harvesting the cell culture
supernatant. Factor 1.times. protein expression in the cell
supernatant was analyzed by an ELISA kit specific for Factor IX
(Molecular Innovations, Cat #HFIXKT-TOT) and the protein expression
is shown in Table 31 and FIG. 5. In all PLGA microsphere batches
tested, Factor IX modified RNA remained active and expressed Factor
1.times. protein after formulation in PLGA microspheres and
subsequent deformulation.
TABLE-US-00031 TABLE 31 Protein Expression Factor IX Protein Sample
Expression (ng/ml) Batch A 0.83 Batch B 1.83 Batch C 1.54 Batch D
2.52 Deformulated Control 4.34 Unformulated Control 3.35
[1218] F. Release Study of Modified mRNA Encapsulated in PLGA
Microspheres
[1219] PLGA micropsheres formulated with Factor IX modified RNA
(mRNA sequence shown in SEQ ID NO: 251437; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) were
resuspended in water to a PLGA microsphere concentration of 24
mg/ml. After resuspension, 150 ul of the PLGA microsphere
suspension was aliquoted into eppendorf tubes. Samples were kept
incubating and shaking at 37.degree. C. during the course of the
study. Triplicate samples were pulled at 0.2, 1, 2, 8, 14, and 21
days. To determine the amount of modified RNA released from the
PLGA microspheres, samples were centrifuged, the supernatant was
removed, and the modified RNA concentration in the supernatant was
determined by OD 260. The percent release, shown in Table 32, was
calculated based on the total amount of modified RNA in each
sample. After 31 days, 96% of the Factor IX modified RNA was
released from the PLGA microsphere formulations.
TABLE-US-00032 TABLE 32 Percent Release Time (days) % Release 0 0.0
0.2 27.0 1 37.7 2 45.3 4 50.9 8 57.0 14 61.8 21 75.5 31 96.4
[1220] G. Particle Size Reproducibility of PLGA Microspheres
[1221] Three batches of Factor IX modified RNA (mRNA sequence shown
in SEQ ID NO: 251437; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine) PLGA microspheres were made
using the same conditions described for Batch D, shown in Table 29,
(0.4 ml of W4 at 4 mg/ml, 2.0 ml of 01 at 200 mg/ml, 200 ml of W2
at 1%, and homogenized at a speed of 5 for the W4/O1/W2 emulsion).
To improve the homogeneity of the PLGA microsphere suspension,
filtration was incorporated prior to centrifugation. After stirring
for 3 hours and before centrifuging, all formulated material was
passed through a 100 .mu.m nylon mesh strainer (Fisherbrand Cell
Strainer, Cat #22-363-549) to remove larger aggregates. After
washing and resuspension with water, 100-200 .mu.l of a PLGA
microspheres sample was used to measure particle size of the
formulations by laser diffraction (Malvern Mastersizer2000). The
particle size of the samples is shown in Table 33.
TABLE-US-00033 TABLE 33 Particle Size Summary Volume Weighted ID
D10 (.mu.m) D50 (.mu.m) D90 (.mu.m) Mean (um) Filtration Control
19.2 62.5 722.4 223.1 No A 9.8 31.6 65.5 35.2 Yes B 10.5 32.3 66.9
36.1 Yes C 10.8 35.7 79.8 41.4 Yes
[1222] Results of the 3 PLGA microsphere batches using filtration
were compared to a PLGA microsphere batch made under the same
conditions without filtration. The inclusion of a filtration step
before washing reduced the mean particle size and demonstrated a
consistent particle size distribution between 3 PLGA microsphere
batches.
[1223] H. Serum Stability of Factor IX PLGA Microspheres
[1224] Factor IX mRNA RNA (mRNA sequence shown in SEQ ID NO:
251437; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) in buffer (TE) or 90% serum (Se), or Factor IX mRNA
in PLGA in buffer, 90% serum or 1% serum was incubated in buffer,
90% serum or 1% serum at an mRNA concentration of 50 ng/ul in a
total volume of 70 ul. The samples were removed at 0, 30, 60 or 120
minutes. RNases were inactivated with proteinase K digestion for 20
minutes at 55.degree. C. by adding 25 ul of 4.times. proteinase K
buffer (0.4 ml 1M TRIS-HCl pH 7.5, 0.1 ml 0.5M EDTA, 0.12 ml 5M
NaCl, and 0.4 ml 10% SDS) and 8 ul of proteinase K at 20 mg/ml. The
Factor IX mRNA was precipitated (add 250 ul 95% ethanol for 1 hour,
centrifuge for 10 min at 13 k rpm and remove supernatant, add 200
ul 70% ethanol to the pellet, centrifuge again for 5 min at 13 k
rpm and remove supernatant and resuspend the pellet in 70 ul water)
or extracted from PLGA microspheres (centrifuge 5 min at 13 k rpm
and remove supernatant, wash pellet with 1 ml water, centrifuge 5
min at 13 k rpm and remove supernatant, add 280 ul dichloromethane
to the pellet and shake for 15 minutes, add 70 ul water and then
shake for 2 hours and remove the aqueous phase) before being
analyzed by bioanalyzer. PLGA microspheres protect Factor IX
modified mRNA from degradation in 90% and 1% serum over 2 hours.
Factor IX modified mRNA completely degrades in 90% serum at the
initial time point.
Example 17
Lipid Nanoparticle In Vivo Studies
[1225] G-CSF (cDNA with the T7 promoter, 5' Untranslated region
(UTR) and 3'UTR used in in vitro transcription is given in SEQ ID
NO: 251432. mRNA sequence shown in SEQ ID NO: 251433; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap 1;
fully modified with 5-methylcytosine and pseudouridine) and Factor
IX (cDNA with the T7 promoter, 5' UTR and 3'UTR used in in vitro
transcription is given in SEQ ID NO: 251440. mRNA sequence shown in
SEQ ID NO: 251437; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap 1; fully modified with
5-methylcytosine and pseudouridine) modified mRNA were formulated
as lipid nanoparticles (LNPs) using the syringe pump method. The
LNPs were formulated at a 20:1 weight ratio of total lipid to
modified mRNA with a final lipid molar ratio of 50:10:38.5:1.5
(DLin-KC2-DMA: DSPC: Cholesterol: PEG-c-DOMG). Formulations, listed
in Table 34, were characterized by particle size, zeta potential,
and encapsulation.
TABLE-US-00034 TABLE 34 Formulations Formulation # NPA-029-1
NPA-030-1 Modified mRNA Factor IX G-CSF Mean size 91 nm 106 nm PDI:
0.04 PDI: 0.06 Zeta at pH 7.4 1.8 mV 0.9 mV Encaps. 92% 100%
(RiboGr)
[1226] LNP formulations were administered to mice (n=5)
intravenously at a modified mRNA dose of 100, 10, or 1 ug. Mice
were sacrificed at 8 hrs after dosing. Serum was collected by
cardiac puncture from mice that were administered with G-CSF or
Factor IX modified mRNA formulations. Protein expression was
determined by ELISA.
[1227] There was no significant body weight loss (<5%) in the
G-CSF or Factor IX dose groups. Protein expression for G-CSF or
Factor IX dose groups was determined by ELISA from a standard
curve. Serum samples were diluted (about 20-2500.times. for G-CSF
and about 10-250.times. for Factor IX) to ensure samples were
within the linear range of the standard curve. As shown in Table
35, G-CSF protein expression determined by ELISA was approximately
17, 1200, and 4700 ng/ml for the 1, 10, and 100 ug dose groups,
respectively. As shown in Table 36, Factor 1.times. protein
expression determined by ELISA was approximately 36, 380, and
3000-11000 ng/ml for the 1, 10, and 100 ug dose groups,
respectively.
TABLE-US-00035 TABLE 35 G-CSF Protein Expression Dose (ug) Conc
(ng/ml) Dilution Factor Sample Volume 1 17.73 20x 5 ul 10 1204.82
2500x 0.04 ul 100 4722.20 2500x 0.04 ul
TABLE-US-00036 TABLE 36 Factor IX Protein Expression Dose (ug) Conc
(ng/ml) Dilution Factor Sample Volume 1 36.05 10x 5 ul 10 383.04
10x 5 ul 100* 3247.75 50x 1 ul 100* 11177.20 250x 0.2 ul
[1228] As shown in Table 37, the LNP formulations described above
have about a 10,000-100.000-fold increase in protein production
compared to an administration of an intravenous (IV)-lipoplex
formulation for the same dosage of modified mRNA and intramuscular
(IM) or subcutaneous (SC) administration of the same dose of
modified mRNA in saline. As used in Table 37, the symbol ".about."
means about.
TABLE-US-00037 TABLE 37 Protein Production Serum Concentration
(pg/ml) G-CSF Dose (ug) 8-12 hours after administration IM 100
~20-80 SC 100 ~10-40 IV (Lipoplex) 100 ~30 IV (LNP) 100 ~5,000,000
IV (LNP) 10 ~1,000,000 IV (LNP) 1 ~20,000 Serum Concentration
(ng/ml) Factor IX Dose (ug) 8-12 hours after administration IM 2
.times. 100 ~1.6 ng/ml IV (LNP) 100 ~3,000-10,000 ng/ml IV (LNP) 10
~400 ng/ml IV (LNP) 1 ~40 ng/ml
Materials and Methods for Examples 18-23
[1229] G-CSF (mRNA sequence shown in SEQ ID NO: 251433; polyA tail
of approximately 160 nulceotides not shown in sequence; 5' cap, Cap
1; fully modified with 5-methylcytosine and pseudouridine) and EPO
(mRNA sequence shown in SEQ ID NO: 251436; polyA tail of
approximately 160 nulceotides not shown in sequence; 5' cap, Cap 1;
fully modified with 5-methylcytosine and pseudouridine) modified
mRNA were formulated as lipid nanoparticles (LNPs) using the
syringe pump method. The LNPs were formulated at a 20:1 weight
ratio of total lipid to modified mRNA with a final lipid molar
ratio of 50:10:38.5:1.5 (DLin-KC2-DMA: DSPC: Cholesterol:
PEG-c-DOMG). Formulations, listed in Table 38, were characterized
by particle size, zeta potential, and encapsulation.
TABLE-US-00038 TABLE 38 Formulations Formulation # NPA-030-2
NPA-060-1 Modified mRNA G-CSF EPO Mean size 84 nm 85 nm PDI: 0.04
PDI: 0.03 Zeta at pH 7.4 0.8 mV 1.5 mV Encapsulation 95% 98%
(RiboGreen)
Example 18
Lipid Nanoparticle In Vivo Studies with Modified mRNA
[1230] LNP formulations, shown in Table 38 (above), were
administered to rats (n=5) intravenously (IV), intramuscularly (IM)
or subcutaneously (SC) at a single modified mRNA dose of 0.05
mg/kg. A control group of rats (n=4) was untreated. The rats were
bled at 2 hours, 8 hours, 24 hours, 48 hours and 96 hours and after
they were administered with G-CSF or EPO modified mRNA formulations
to determine protein expression using ELISA. The rats administered
EPO modified mRNA intravenously were also bled at 7 days.
[1231] As shown in Table 39, EPO protein expression in the rats
intravenously administered modified EPO mRNA was detectable out to
5 days. G-CSF in the rats intravenously administered modified G-CSF
mRNA was detectable to 7 days. Subcutaneous and intramuscular
administration of EPO modified mRNA was detectable to at least 24
hours and G-CSF modified mRNA was detectable to at least 8 hours.
In Table 39, "OSC" refers to values that were outside the standard
curve and "NT" means not tested.
TABLE-US-00039 TABLE 39 G-CSF and EPO Protein Expression G-CSF
Serum EPO Serum Concentration Route Time Concentration (pg/ml)
(pg/ml) IV 2 hours 36,981.0 31,331.9 IV 8 hours 62,053.3 70,532.4
IV 24 hours 42,077.0 5,738.6 IV 48 hours 5,561.5 233.8 IV 5 days
0.0 60.4 IV 7 days 0.0 NT IM 2 hours 1395.4 1620.4 IM 8 hours
8974.6 7910.4 IM 24 hours 4678.3 893.3 IM 48 hours NT OSC IM 5 days
NT OSC SC 2 hours 386.2 80.3 SC 8 hours 985.6 164.2 SC 24 hours
544.2 OSC SC 48 hours NT OSC SC 5 days NT OSC Untreated All bleeds
0 0
Example 19
Time Course In Vivo Study
[1232] LNP formulations, shown in Table 38 (above), were
administered to mice (n=5) intravenously (IV) at a single modified
mRNA dose of 0.5, 0.05 or 0.005 mg/kg. The mice were bled at 8
hours, 24 hours, 72 hours and 6 days after they were administered
with G-CSF or EPO modified mRNA formulations to determine protein
expression using ELISA.
[1233] As shown in Table 40, EPO and G-CSF protein expression in
the mice administered with the modified mRNA intravenously was
detectable out to 72 hours for the mice dosed with 0.005 mg/kg and
0.05 mg/kg of modified mRNA and out to 6 days for the mice
administered the EPO modified mRNA. In Table 40, ">" means
greater than and "ND" means not detected.
TABLE-US-00040 TABLE 40 Protein Expression G-CSF Serum EPO Serum
Concentration Dose (mg/kg) Time Concentration (pg/ml) (pg/ml) 0.005
8 hours 12,508.3 11,550.6 0.005 24 hours 6,803.0 5,068.9 0.005 72
hours ND ND 0.005 6 days ND ND 0.05 8 hours 92,139.9 462,312.5 0.05
24 hours 54,389.4 80,903.8 0.05 72 hours ND ND 0.05 6 days ND ND
0.5 8 hours 498,515.3 >1,250,000 0.5 24 hours 160,566.3
495,812.5 0.5 72 hours 3,492.5 1,325.6 0.5 6 days 21.2 ND
Example 20
LNP Formulations In Vivo Study in Rodents
[1234] A. LNP Formulations in Mice
[1235] LNP formulations, shown in Table 38 (above), were
administered to mice (n=4) intravenously (IV) at a single modified
mRNA dose 0.05 mg/kg or 0.005 mg/kg. There was also 3 control
groups of mice (n=4) that were untreated. The mice were bled at 2
hours, 8 hours, 24 hours, 48 hours and 72 hours after they were
administered with G-CSF or EPO modified mRNA formulations to
determine the protein expression. Protein expression of G-CSF and
EPO were determined using ELISA.
[1236] As shown in Table 41, EPO and G-CSF protein expression in
the mice was detectable at least out to 48 hours for the mice that
received a dose of 0.005 mg/kg modified RNA and 72 hours for the
mice that received a dose of 0.05 mg/kg modified RNA. In Table 41,
"OSC" refers to values that were outside the standard curve and
"NT" means not tested.
TABLE-US-00041 TABLE 41 Protein Expression in Mice EPO Serum G-CSF
Serum Dose Concentration Concentration (mg/kg) Time (pg/ml) (pg/ml)
0.005 2 hours OSC 3,447.8 0.005 8 hours 1,632.8 11,454.0 0.005 24
hours 1,141.0 4,960.2 0.005 48 hours 137.4 686.4 0.005 72 hours 0
NT 0.05 2 hours 10,027.3 20,951.4 0.05 8 hours 56,547.2 70,012.8
0.05 24 hours 25,027.3 19,356.2 0.05 48 hours 1,432.3 1,963.0 0.05
72 hours 82.2 47.3
[1237] B. LNP Formulations in Rodents
[1238] LNP formulations, shown in Table 38 (above), are
administered to rats (n=4) intravenously (IV) at a single modified
mRNA dose 0.05 mg/kg. There is also a control group of rats (n=4)
that are untreated. The rats are bled at 2 hours, 8 hours, 24
hours, 48 hours, 72 hours, 7 days and 14 days after they were
administered with G-CSF or EPO modified mRNA formulations to
determine the protein expression. Protein expression of G-CSF and
EPO are determined using ELISA.
Example 21
Early Time Course Study of LNPs
[1239] LNP formulations, shown in Table 38 (above), are
administered to mammals intravenously (IV), intramuscularly (IM) or
subcutaneously (SC) at a single modified mRNA dose of 0.5 mg/kg,
0.05 mg/kg or 0.005 mg/kg. A control group of mammals are not
treated. The mammals are bled at 5 minutes, 10 minutes, 20 minutes,
30 minutes, 45 minutes, 1 hour, 1.5 hours and/or 2 hours after they
are administered with the modified mRNA LNP formulations to
determine protein expression using ELISA. The mammals are also bled
to determine the complete blood count such as the granulocyte
levels and red blood cell count.
Example 22
Non-Human Primate In Vivo Study
[1240] LNP formulations, shown in Table 38 (above), were
administered to non-human primates (NHP) (cynomolgus monkey) (n=2)
as a bolus intravenous injection (IV) over approximately 30 seconds
using a hypodermic needle, which may be attached to a
syringe/abbocath or butterfly if needed. The NHP were administered
a single modified mRNA IV dose of 0.05 mg/kg of EPO or G-CSF or
0.005 mg/kg of EPO in a dose volume of 0.5 mL/kg. The NHPs were
bled 5-6 days before dosing with the modified mRNA LNP formulations
to determine protein expression in the serum and a baseline
complete blood count. After administration with the modified mRNA
formulation the NHP were bled at 8, 24, 48 and 72 hours to
determined protein expression. At 24 and 72 hours after
administration the complete blood count of the NHP was also
determined. Protein expression of G-CSF and EPO was determined by
ELISA. Urine from the NHPs was collected over the course of the
entire experiment and analyzed to evaluate clinical safety. Samples
were collected from the NHPs after they were administered with
G-CSF or EPO modified mRNA formulations to determine protein
expression using ELISA. Clinical chemistry, hematology, urinalysis
and cytokines of the non-human primates were also analyzed.
[1241] As shown in Table 42, EPO protein expression in the NHPs
administered 0.05 mg/kg is detectable out to 72 hours and the 0.005
mg/kg dosing of the EPO formulation is detectable out to 48 hours.
In Table 42, the "<" means less than a given value. G-CSF
protein expression was seen out to 24 hours after administration
with the modified mRNA formulation. Preliminarily, there was an
increase in granulocytes and reticulocytes levels seen in the NHP
after administration with the modified mRNA formulations.
TABLE-US-00042 TABLE 42 Protein Expression in Non-Human Primates
Female NHP Male NHP Average Serum Serum Serum Concen- Concen-
Conen- Modified Dose tration tration tration mRNA (mg/kg) Time
(pg/ml) (pg/ml) (pg/ml) G-CSF 0.05 Pre-bleed 0 0 0 8 hours 3289
1722 2,506 24 hours 722 307 515 48 hours 0 0 0 72 hours 0 0 0 EPO
0.05 Pre-bleed 0 0 0 8 hours 19,858 7,072 13,465 24 hours 18,178
4,913 11,546 48 hours 5,291 498 2,895 72 hours 744 60 402 EPO 0.005
Pre-bleed 0 0 0 8 hours 523 250 387 24 hours 302 113 208 48 hours
<7.8 <7.8 <7.8 72 hours 0 0 0
Example 23
Non-Human Primate In Vivo Study for G-CSF and EPO
[1242] LNP formulations, shown in Table 38 (above), were
administered to non-human primates (NHP) (cynomolgus monkey) (n=2)
as intravenous injection (IV). The NHP were administered a single
modified mRNA IV dose of 0.5 mg/kg, 0.05 mg/kg or 0.005 mg/kg of
G-CSF or EPO in a dose volume of 0.5 mL/kg. The NHPs were bled
before dosing with the modified mRNA LNP formulations to determine
protein expression in the serum and a baseline complete blood
count. After administration with the G-CSF modified mRNA
formulation the NHP were bled at 8, 24, 48 and 72 hours to
determined protein expression. After administration with the EPO
modified mRNA formulation the NHP were bled at 8, 24, 48, 72 hours
and 7 days to determined protein expression.
[1243] Samples collected from the NHPs after they were administered
with G-CSF or EPO modified mRNA formulations were analyzed by ELISA
to determine protein expression. Neutrophil and reticulocyte count
was also determined pre-dose, 24 hours, 3 days, 7 days, 14 days and
18 days after administration of the modified G-CSF or EPO
formulation.
[1244] As shown in Table 43, G-CSF protein expression was not
detected beyond 72 hours. In Table 43, "<39" refers to a value
below the lower limit of detection of 39 pg/ml.
TABLE-US-00043 TABLE 43 G-CSF Protein Expression Female NHP Male
NHP Serum G-CSF Serum G-CSF Modified Dose Concentration
Concentration mRNA (mg/kg) Time (pg/ml) (pg/ml) G-CSF 0.5 Pre-bleed
<39 <39 8 hours 43,525 43,594 24 hours 11,374 3,628 48 hours
1,100 833 72 hours <39 306 G-CSF 0.05 Pre-bleed <39 <39 8
hours 3,289 1,722 24 hours 722 307 48 hours <39 <39 72 hours
<39 <39 G-CSF 0.005 Pre-bleed <39 <39 8 hours 559 700
24 hours 155 <39 48 hours <39 <39 72 hours <39
<39
[1245] As shown in Table 44, EPO protein expression was not
detected beyond 7 days. In Table 44, "<7.8" refers to a value
below the lower limit of detection of 7.8 pg/ml.
TABLE-US-00044 TABLE 44 EPO Protein Expression Female NHP Male NHP
Serum EPO Serum EPO Modified Dose Concentration Concentration mRNA
(mg/kg) Time (pg/ml) (pg/ml) EPO 0.5 Pre-bleed <7.8 <7.8 8
hours 158,771 119,086 24 hours 133,978 85,825 48 hours 45,250
64,793 72 hours 15,097 20,407 7 days <7.8 <7.8 EPO 0.05
Pre-bleed <7.8 <7.8 8 hours 19,858 7,072 24 hours 18,187
4,913 48 hours 5,291 498 72 hours 744 60 7 days <7.8 <7.8 EPO
0.005 Pre-bleed <7.8 <7.8 8 hours 523 250 24 hours 302 113 48
hours 11 29 72 hours <7.8 <7.8 7 days <7.8 <7.8
[1246] As shown in Table 45, there was an increase in neutrophils
in all G-CSF groups relative to pre-dose levels.
TABLE-US-00045 TABLE 45 Pharmacologic Effect of G-CSF mRNA in NHP
Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO) Female NHP (EPO)
Dose (mg/kg) Time Neutrophils (10.sup.9/L) Neutrophils (10.sup.9/L)
Neutrophils (10.sup.9/L) Neutrophils (10.sup.9/L) 0.5 Pre-dose 1.53
1.27 9.72 1.82 24 hours.sup. 14.92 13.96 7.5 11.85 3 days 9.76 13.7
11.07 5.22 7 days 2.74 3.81 11.8 2.85 14/18 days 2.58 1.98 7.16
2.36 0.05 Pre-dose 13.74 3.05 0.97 2.15 24 hours.sup. 19.92 29.91
2.51 2.63 3 days 7.49 10.77 1.73 4.08 7 days 4.13 3.8 1.23 2.77
14/18 days 3.59 1.82 1.53 1.27 0.005 Pre-dose 1.52 2.54 5.46 5.96
24 hours.sup. 16.44 8.6 5.37 2.59 3 days 3.74 1.78 6.08 2.83 7 days
7.28 2.27 3.51 2.23 14/18 days 4.31 2.28 1.52 2.54
[1247] As shown in Table 46, there was an increase in reticulocytes
in all EPO groups 3 days to 14/18 days after dosing relative to
reticulocyte levels 24 hours after dosing.
TABLE-US-00046 TABLE 46 Pharmacologic Effect of EPO mRNA on
Neutrophil Count Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO)
Female NHP (EPO) Dose (mg/kg) Time Neutrophils (10.sup.12/L)
Neutrophils (10.sup.12/L) Neutrophils (10.sup.12/L) Neutrophils
(10.sup.12/L) 0.5 Pre-dose 0.067 0.055 0.107 0.06 24 hours.sup.
0.032 0.046 0.049 0.045 3 days 0.041 0.017 0.09 0.064 7 days 0.009
0.021 0.35 0.367 14/18 days 0.029 0.071 0.066 0.071 0.05 Pre-dose
0.055 0.049 0.054 0.032 24 hours.sup. 0.048 0.046 0.071 0.04 3 days
0.101 0.061 0.102 0.105 7 days 0.157 0.094 0.15 0.241 14/18 days
0.107 0.06 0.067 0.055 0.005 Pre-dose 0.037 0.06 0.036 0.052 24
hours.sup. 0.037 0.07 0.034 0.061 3 days 0.037 0.054 0.079 0.118 7
days 0.046 0.066 0.049 0.087 14/18 days 0.069 0.057 0.037 0.06
[1248] As shown in Tables 47-49, the administration of EPO modified
RNA had an effect on other erythropoetic parameters including
hemoglobin (HGB), hematocrit (HCT) and red blood cell (RBC)
count.
TABLE-US-00047 TABLE 47 Pharmacologic Effect of EPO mRNA on
Hemoglobin Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO)
Female NHP (EPO) Dose (mg/kg) Time HGB (g/L) HGB (g/L) HGB (g/L)
HGB (g/L) 0.5 Pre-dose 133 129 134 123 24 hours.sup. 113 112 127
108 3 days 118 114 126 120 7 days 115 116 140 134 14/18 days 98 113
146 133 0.05 Pre-dose 137 129 133 133 24 hours.sup. 122 117 123 116
3 days 126 115 116 120 7 days 126 116 126 121 14/18 days 134 123
133 129 0.005 Pre-dose 128 129 132 136 24 hours.sup. 117 127 122
128 3 days 116 127 125 130 7 days 116 129 119 127 14/18 days 118
129 128 129
TABLE-US-00048 TABLE 48 Pharmacologic Effect of EPO mRNA on
Hematocrit Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO)
Female NHP (EPO) Dose (mg/kg) Time HCT (L/L) HCT (L/L) HCT (L/L)
HCT (L/L) 0.5 Pre-dose 0.46 0.43 0.44 0.4 24 hours.sup. 0.37 0.38
0.4 0.36 3 days 0.39 0.38 0.41 0.39 7 days 0.39 0.38 0.45 0.45
14/18 days 0.34 0.37 0.48 0.46 0.05 Pre-dose 0.44 0.44 0.45 0.43 24
hours.sup. 0.39 0.4 0.43 0.39 3 days 0.41 0.39 0.38 0.4 7 days 0.42
0.4 0.45 0.41 14/18 days 0.44 0.4 0.46 0.43 0.005 Pre-dose 0.42
0.42 0.48 0.45 24 hours.sup. 0.4 0.42 0.42 0.43 3 days 0.4 0.41
0.44 0.42 7 days 0.39 0.42 0.41 0.42 14/18 days 0.41 0.42 0.42
0.42
TABLE-US-00049 TABLE 49 Pharmacologic Effect of EPO mRNA on Red
Blood Cells Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO)
Female NHP (EPO) Dose (mg/kg) Time RBC (10.sup.12/L) RBC
(10.sup.12/L) RBC (10.sup.12/L) RBC (10.sup.12/L) 0.5 Pre-dose 5.57
5.57 5.43 5.26 24 hours.sup. 4.66 4.96 5.12 4.69 3 days 4.91 4.97
5.13 5.15 7 days 4.8 5.04 5.55 5.68 14/18 days 4.21 4.92 5.83 5.72
0.05 Pre-dose 5.68 5.64 5.57 5.84 24 hours.sup. 4.96 5.08 5.25 5.18
3 days 5.13 5.04 4.81 5.16 7 days 5.17 5.05 5.37 5.31 14/18 days
5.43 5.26 5.57 5.57 0.005 Pre-dose 5.67 5.36 6.15 5.72 24
hours.sup. 5.34 5.35 5.63 5.35 3 days 5.32 5.24 5.77 5.42 7 days
5.25 5.34 5.49 5.35 14/18 days 5.37 5.34 5.67 5.36
[1249] As shown in Tables 50 and 51, the administration of modified
RNA had an effect on serum chemistry parameters including alanine
transaminase (ALT) and aspartate transaminase (AST).
TABLE-US-00050 TABLE 50 Pharmacologic Effect of EPO mRNA on Alanine
Transaminase Male NHP (G-CSF) Female NHP (G-CSF) Male NHP (EPO)
Female NHP (EPO) Dose (mg/kg) Time ALT (U/L) ALT (U/L) ALT (U/L)
ALT (U/L) 0.5 Pre-dose 29 216 50 31 2 days 63 209 98 77 4 days 70
98 94 87 7 days 41 149 60 59 14 days 43 145 88 44 0.05 Pre-dose 58
53 56 160 2 days 82 39 95 254 4 days 88 56 70 200 7 days 73 73 64
187 14 days 50 31 29 216 0.005 Pre-dose 43 51 45 45 2 days 39 32 62
48 4 days 48 58 48 50 7 days 29 55 21 48 14 days 44 46 43 51
TABLE-US-00051 TABLE 51 Pharmacologic Effect of EPO mRNA on
Aspartate Transaminase Male NHP (G-CSF) Female NHP (G-CSF) Male NHP
(EPO) Female NHP (EPO) Dose (mg/kg) Time AST (U/L) AST (U/L) AST
(U/L) AST (U/L) 0.5 Pre-dose 32 47 59 20 2 days 196 294 125 141 4
days 67 63 71 60 7 days 53 68 56 47 14 days 47 67 82 44 0.05
Pre-dose 99 33 74 58 2 days 95 34 61 80 4 days 69 42 48 94 7 days
62 52 53 78 14 days 59 20 32 47 0.005 Pre-dose 35 54 39 40 2 days
70 34 29 25 4 days 39 36 43 55 7 days 28 31 55 31 14 days 39 20 35
54
[1250] As shown in Table 52, the administration of lipid
nanoparticle-formulated modified RNA at high doses (0.5 mg/kg)
caused an increase in cytokines, interferon-alpha (IFN-alpha) after
administration of modified mRNA.
TABLE-US-00052 TABLE 52 Pharmacologic Effect of EPO mRNA on Alanine
Transaminase Male NHP Female NHP Male NHP Female NHP (G-CSF)
(G-CSF) (EPO) (EPO) Dose IFN-alpha IFN-alpha IFN-alpha IFN-alpha
(mg/kg) Time (pg/mL) (pg/mL) (pg/mL) (pg/mL) 0.5 Pre-dose 0 0 0 0
Day 1 + 503.8 529.2 16.79 217.5 8 hr 4 days 0 0 0 0 0.05 Pre-dose 0
0 0 0 Day 1 + 0 0 0 0 8 hr 4 days 0 0 0 0 0.005 Pre-dose 0 0 0 0
Day 1 + 0 0 0 0 8 hr 4 days 0 0 0 0
Example 24
Study of Intramuscular and/or Subcutaneous Administration in
Non-Human Primates
[1251] Formulations containing modified EPO mRNA (mRNA sequence
shown in SEQ ID NO: 251436; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1; fully modified
with 5-methylcytosine and pseudouridine) or G-CSF mRNA (mRNA
sequence shown in SEQ ID NO: 251433; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1; fully modified
with 5-methylcytosine and pseudouridine) in saline were
administered to non-human primates (Cynomolgus monkey) (NHP)
intramuscularly (IM) or subcutaneously (SC). The single modified
mRNA dose of 0.05 mg/kg or 0.005 mg/kg was in a dose volume of 0.5
mL/kg. The non-human primates are bled 5-6 days prior to dosing to
determine serum protein concentration and a baseline complete blood
count. After administration with the modified mRNA formulation the
NHP are bled at 8 hours, 24 hours, 48 hours, 72 hours, 7 days and
14 days to determined protein expression. Protein expression of
G-CSF and EPO is determined by ELISA. At 24 hours, 72 hours, 7 days
and 14 days after administration the complete blood count of the
NHP is also determined. Urine from the NHPs is collected over the
course of the entire experiment and analyzed to evaluate clinical
safety. Tissue near the injection site is also collected and
analyzed to determine protein expression.
Example 25
Modified mRNA Trafficking
[1252] In order to determine localization and/or trafficking of the
modified mRNA, studies may be performed as follows.
[1253] LNP formulations of siRNA and modified mRNA are formulated
according to methods known in the art and/or described herein. The
LNP formulations may include at least one modified mRNA which may
encode a protein such as G-CSF, EPO, Factor VII, and/or any protein
described herein. The formulations may be administered locally into
muscle of mammals using intramuscular or subcutaneous injection.
The dose of modified mRNA and the size of the LNP may be varied to
determine the effect on trafficking in the body of the mammal
and/or to assess the impact on a biologic reaction such as, but not
limited to, inflammation. The mammal may be bled at different time
points to determine the expression of protein encoded by the
modified mRNA administered present in the serum and/or to determine
the complete blood count in the mammal.
[1254] For example, modified mRNA encoding Factor VII, expressed in
the liver and secreted into the serum, may be administered
intramuscularly and/or subcutaneously. Coincident or prior to
modified mRNA administration, siRNA is administered to knock out
endogenous Factor VII. Factor VII arising from the intramuscular
and/or subcutaneous injection of modified mRNA is administered is
measured in the blood. Also, the levels of Factor VII is measured
in the tissues near the injection site. If Factor VII is expressed
in blood then there is trafficking of the modified mRNA. If Factor
VII is expressed in tissue and not in the blood than there is only
local expression of Factor VII.
Example 26
Formulations of Multiple Modified mRNA
[1255] LNP formulations of modified mRNA are formulated according
to methods known in the art and/or described herein or known in the
art. The LNP formulations may include at least one modified mRNA
which may encode a protein such as G-CSF, EPO, thrombopoietin
and/or any protein described herein. The at least one modified mRNA
may include 1, 2, 3, 4 or 5 modified mRNA molecules. The
formulations containing at least one modified mRNA may be
administered intravenously, intramuscularly or subcutaneously in a
single or multiple dosing regimens. Biological samples such as, but
not limited to, blood and/or serum may be collected and analyzed at
different time points before and/or after administration of the at
least one modified mRNA formulation. An expression of a protein in
a biological sample of 50-200 pg/ml after the mammal has been
administered a formulation containing at least one modified mRNA
encoding said protein would be considered biologically
effective.
Example 27
Polyethylene Glycol Ratio Studies
[1256] A. Formulation and Characterization of PEG LNPs
[1257] Lipid nanoparticles (LNPs) were formulated using the syringe
pump method.
[1258] The LNPs were formulated at a 20:1 weight ratio of total
lipid to modified G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine). The molar ratio ranges of the formulations are
shown in Table 53.
TABLE-US-00053 TABLE 53 Molar Ratios DLin- PEG-c- KC2-DMA DSPC
Cholesterol DOMG Mole Percent 50.0 10.0 37-38.5 1.5-3 (mol %)
[1259] Two types of PEG lipid, 1,2-Dimyristoyl-sn-glycerol,
methoxypolyethylene Glycol (PEG-DMG, NOF Cat #SUNBRIGHT.RTM.
GM-020) and 1,2-Distearoyl-sn-glycerol, methoxypolyethylene Glycol
(PEG-DSG, NOF Cat #SUNBRIGHT.RTM. GS-020), were tested at 1.5 or
3.0 mol %. After the formation of the LNPs and the encapsulation of
the modified G-CSF mRNA, the LNP formulations were characterized by
particle size, zeta potential and encapsulation percentage and the
results are shown in Table 54.
TABLE-US-00054 TABLE 54 Characterization of LNP Formulations
Formulation No. NPA-071-1 NPA-072-1 NPA-073-1 NPA-074-1 Lipid
PEG-DMG PEG-DMG PEG-DSA PEG-DSA 1.5% 3% 1.5% 3% Mean Size 95 nm 85
nm 95 nm 75 nm PDI: 0.01 PDI: 0.06 PDI: 0.08 PDI: 0.08 Zeta at pH
7.4 -1.1 mV -2.6 mV 1.7 mV 0.7 mV Encapsulation 88% 89% 98% 95%
(RiboGreen)
[1260] B. In Vivo Screening of PEG LNPs
[1261] Formulations of the PEG LNPs described in Table 55 were
administered to mice (n=5) intravenously at a dose of 0.5 mg/kg.
Serum was collected from the mice at 2 hours, 8 hours, 24 hours, 48
hours, 72 hours and 8 days after administration of the formulation.
The serum was analyzed by ELISA to determine the protein expression
of G-CSF and the expression levels are shown in Table 55. LNP
formulations using PEG-DMG gave substantially higher levels of
protein expression than LNP formulations with PEG-DSA.
TABLE-US-00055 TABLE 55 Protein Expression Formulation Protein
Expression Lipid No. Time (pg/ml) PEG-DMG, 1.5% NPA-071-1 2 hours
114,102 8 hours 357,944 24 hours 104,832 48 hours 6,697 72 hours
980 .sup. 8 days 0 PEG-DMG, 3% NPA-072-1 2 hours 154,079 8 hours
354,994 24 hours 164,311 48 hours 13,048 72 hours 1,182 .sup. 8
days 13 PEG-DSA, 1.5% NPA-073-1 2 hours 3,193 8 hours 6,162 24
hours 446 48 hours 197 72 hours 124 .sup. 8 days 5 PEG-DSA, 3%
NPA-074-1 2 hours 259 8 hours 567 24 hours 258 48 hours 160 72
hours 328 .sup. 8 days 33
Example 28
Cationic Lipid Formulation Studies
[1262] A. Formulation and Characterization of Cationic Lipid
Nanoparticles
[1263] Lipid nanoparticles (LNPs) were formulated using the syringe
pump method.
[1264] The LNPs were formulated at a 20:1 weight ratio of total
lipid to modified mRNA. The final lipid molar ratio ranges of
cationic lipid, DSPC, cholesterol and PEG-c-DOMG are outlined in
Table 56.
TABLE-US-00056 TABLE 56 Molar Ratios Cationic Lipid DSPC
Cholesterol PEG-c-DOMG Mole Percent 50.0 10.0 38.5 1.5 (mol %)
[1265] A 25 mM lipid solution in ethanol and modified RNA in 50 mM
citrate at a pH of 3 were mixed to create spontaneous vesicle
formation. The vesicles were stabilized in ethanol before the
ethanol was removed and there was a buffer exchange by dialysis.
The LNPs were then characterized by particle size, zeta potential,
and encapsulation percentage. Table 57 describes the
characterization of LNPs encapsulating EPO modified mRNA (mRNA
sequence shown in SEQ ID NO: 251436 polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1; fully modified
with 5-methylcytosine and pseudouridine) or G-CSF modified mRNA
(mRNA sequence shown in SEQ ID NO: 251433; polyA tail of
approximately 160 nucleotidies not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) using
DLin-MC3-DMA, DLin-DMA or C12-200 as the cationic lipid.
TABLE-US-00057 TABLE 57 Characterization of Cationic Lipid
Formulations Formulation No. NPA- NPA- NPA- NPA- NPA- NPA- 071-1
072-1 073-1 074-1 075-1 076-1 Lipid DLin- DLin- DLin- DLin- C12-
C12- MC3- MC3- DMA DMA 200 200 DMA DMA Modified EPO G-CSF EPO G-CSF
EPO G-CSF RNA Mean Size 89 nm 96 nm 70 nm 73 nm 97 nm 103 nm PDI:
PDI: PDI: PDI: PDI: PDI: 0.07 0.08 0.04 0.06 0.05 0.09 Zeta at -1.1
mV -1.4 mV -1.6 mV -0.4 mV 1.4 mV 0.9 mV pH 7.4 Encap- 100% 100%
99% 100% 88% 98% sulation (RiboGreen)
[1266] B. In Vivo Screening of Cationic LNP Formulations
[1267] Formulations of the cationic lipid formulations described in
Table 57 were administered to mice (n=5) intravenously at a dose of
0.5 mg/kg. Serum was collected from the mice at 2 hours, 24 hours,
72 hours and/or 7 days after administration of the formulation. The
serum was analyzed by ELISA to determine the protein expression of
EPO or G-CSF and the expression levels are shown in Table 58.
TABLE-US-00058 TABLE 58 Protein Expression Protein Modified
Expression mRNA Formulation No. Time (pg/ml) EPO NPA-071-1 2 hours
304,190.0 24 hours 166,811.5 72 hours 1,356.1 7 days 20.3 EPO
NPA-073-1 2 hours 73,852.0 24 hours 75,559.7 72 hours 130.8 EPO
NPA-075-1 2 hours 413,010.2 24 hours 56,463.8 G-CSF NPA-072-1 2
hours 62,113.1 24 hours 53,206.6 G-CSF NPA-074-1 24 hours 25,059.3
G-CSF NPA-076-1 2 hours 219,198.1 24 hours 8,470.0
[1268] Toxcity was seen in the mice administered the LNPs
formulations with the cationic lipid C12-200 (NPA-075-1 and
NPA-076-1) and they were sacrificed at 24 hours because they showed
symptoms such as scrubby fur, cowering behavior and weight loss of
greater than 10%. C12-200 was expected to be more toxic but also
had a high level of expression over a short period. The cationic
lipid DLin-DMA (NPA-073-1 and NPA-074-1) had the lowest expression
out of the three cationic lipids tested. DLin-MC3-DMA (NPA-071-1
and NPA-072-1) showed good expression up to day three and was above
the background sample out to day 7 for EPO formulations.
Example 29
Method of Screening for Protein Expression
[1269] A. Electrospray Ionization
[1270] A biological sample which may contain proteins encoded by
modified RNA administered to the subject is prepared and analyzed
according to the manufacturer protocol for electrospray ionization
(ESI) using 1, 2, 3 or 4 mass analyzers. A biologic sample may also
be analyzed using a tandem ESI mass spectrometry system.
[1271] Patterns of protein fragments, or whole proteins, are
compared to known controls for a given protein and identity is
determined by comparison.
[1272] B. Matrix-Assisted Laser Desorption/Ionization
[1273] A biological sample which may contain proteins encoded by
modified RNA administered to the subject is prepared and analyzed
according to the manufacturer protocol for matrix-assisted laser
desorption/ionization (MALDI).
[1274] Patterns of protein fragments, or whole proteins, are
compared to known controls for a given protein and identity is
determined by comparison.
[1275] C. Liquid Chromatography-Mass Spectrometry-Mass
Spectrometry
[1276] A biological sample, which may contain proteins encoded by
modified RNA, may be treated with a trypsin enzyme to digest the
proteins contained within. The resulting peptides are analyzed by
liquid chromatography-mass spectrometry-mass spectrometry
(LC/MS/MS). The peptides are fragmented in the mass spectrometer to
yield diagnostic patterns that can be matched to protein sequence
databases via computer algorithms. The digested sample may be
diluted to achieve 1 ng or less starting material for a given
protein. Biological samples containing a simple buffer background
(e.g. water or volatile salts) are amenable to direct in-solution
digest; more complex backgrounds (e.g. detergent, non-volatile
salts, glycerol) require an additional clean-up step to facilitate
the sample analysis.
[1277] Patterns of protein fragments, or whole proteins, are
compared to known controls for a given protein and identity is
determined by comparison.
Example 30
Lipid Nanoparticle In Vivo Studies
[1278] mCherry mRNA (mRNA sequence shown in SEQ ID NO: 251441;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was formulated as a lipid nanoparticle (LNP) using
the syringe pump method. The LNP was formulated at a 20:1 weight
ratio of total lipid to modified mRNA with a final lipid molar
ratio of 50:10:38.5:1.5 (DLin-KC2-DMA: DSPC: Cholesterol:
PEG-c-DOMG). The mCherry formulation, listed in Table 59, was
characterized by particle size, zeta potential, and
encapsulation.
TABLE-US-00059 TABLE 59 mCherry Formulation Formulation # NPA-003-5
Modified mRNA mCherry Mean size 105 nm PDI: 0.09 Zeta at pH 7.4 1.8
mV Encaps. 100% (RiboGr)
[1279] The LNP formulation was administered to mice (n=5)
intravenously at a modified mRNA dose of 100 ug. Mice were
sacrificed at 24 hrs after dosing. The liver and spleen from the
mice administered with mCherry modified mRNA formulations were
analyzed by immunohistochemistry (IHC), western blot, or
fluorescence-activated cell sorting (FACS).
[1280] Histology of the liver showed uniform mCherry expression
throughout the section, while untreated animals did not express
mCherry. Western blots were also used to confirm mCherry expression
in the treated animals, whereas mCherry was not detected in the
untreated animals. Tubulin was used as a control marker and was
detected in both treated and untreated mice, indicating that normal
protein expression in hepatocytes was unaffected.
[1281] FACS and IHC were also performed on the spleens of mCherry
and untreated mice. All leukocyte cell populations were negative
for mCherry expression by FACS analysis. By IHC, there were also no
observable differences in the spleen in the spleen between mCherry
treated and untreated mice.
Example 31
Syringe Pump In Vivo Studies
[1282] mCherry modified mRNA (mRNA sequence shown in SEQ ID NO:
251434; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) is formulated as a lipid nanoparticle (LNP)
using the syringe pump method. The LNP is formulated at a 20:1
weight ratio of total lipid to modified mRNA with a final lipid
molar ratio of 50:10:38.5:1.5 (DLin-KC2-DMA: DSPC: Cholesterol:
PEG-c-DOMG). The mCherry formulation is characterized by particle
size, zeta potential, and encapsulation.
[1283] The LNP formulation is administered to mice (n=5)
intravenously at a modified mRNA dose of 10 or 100 ug. Mice are
sacrificed at 24 hrs after dosing. The liver and spleen from the
mice administered with mCherry modified mRNA formulations are
analyzed by immunohistochemistry (IHC), western blot, and/or
fluorescence-activated cell sorting (FACS).
Example 32
In vitro and in vivo Expression
[1284] A. In vitro Expression in Human Cells Using Lipidoid
Formulations
[1285] The ratio of mmRNA to lipidoid used to test for in vitro
transfection is tested empirically at different lipidoid:mmRNA
ratios. Previous work using siRNA and lipidoids have utilized
2.5:1, 5:1, 10:1, and 15:1 lipidoid:siRNA wt:wt ratios. Given the
longer length of mmRNA relative to siRNA, a lower wt:wt ratio of
lipidoid to mmRNA may be effective. In addition, for comparison
mmRNA were also formulated using RNAIMAX.TM. (Invitrogen, Carlsbad,
Calif.) or TRANSIT-mRNA (Mims Bio, Madison, Wis.) cationic lipid
delivery vehicles.
[1286] The ability of lipidoid-formulated Luciferase (IVT cDNA
sequence as shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ
ID NO: 251443, polyA tail of approximately 160 nucleotides not
shown in sequence, 5' cap, Cap1, fully modified with
5-methylcytosine at each cytosine and pseudouridine replacement at
each uridine site), green fluorescent protein (GFP) (IVT cDNA
sequence as shown in SEQ ID NO: 251444; mRNA sequence shown in SEQ
ID NO: 251445, polyA tail of approximately 160 nucleotides not
shown in sequence, 5' cap, Cap1, fully modified with
5-methylcytosine at each cytosine and pseudouridine replacement at
each uridine site), G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251434; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1), and EPO mRNA (mRNA sequence shown in SEQ
ID NO: 251436; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1) to express the desired protein
product can be confirmed by luminescence for luciferase expression,
flow cytometry for GFP expression, and by ELISA for G-CSF and
Erythropoietin (EPO) secretion.
[1287] B. In Vivo Expression Following Intravenous Injection
[1288] Systemic intravenous administration of the formulations are
created using various different lipidoids including, but not
limited to, 98N12-5, C12-200, and MD1.
[1289] Lipidoid formulations containing mmRNA are injected
intravenously into animals. The expression of the modified mRNA
(mmRNA)-encoded proteins are assessed in blood and/or other organs
samples such as, but not limited to, the liver and spleen collected
from the animal. Conducting single dose intravenous studies will
also allow an assessment of the magnitude, dose responsiveness, and
longevity of expression of the desired product.
[1290] In one embodiment, lipidoid based formulations of 98N12-5,
C12-200, MD1 and other lipidoids, are used to deliver luciferase,
green fluorescent protein (GFP), mCherry fluorescent protein,
secreted alkaline phosphatase (sAP), human G-CSF, human Factor IX,
or human Erythropoietin (EPO) mmRNA into the animal. After
formulating mmRNA with a lipid, as described previously, animals
are divided into groups to receive either a saline formulation, or
a lipidoid-formulation which contains one of a different mmRNA
selected from luciferase, GFP, mCherry, sAP, human G-CSF, human
Factor IX, and human EPO. Prior to injection into the animal,
mmRNA-containing lipidoid formulations are diluted in PBS. Animals
are then administered a single dose of formulated mmRNA ranging
from a dose of 10 mg/kg to doses as low as 1 ng/kg, with a
preferred range to be 10 mg/kg to 100 ng/kg, where the dose of
mmRNA depends on the animal body weight such as a 20 gram mouse
receiving a maximum formulation of 0.2 ml (dosing is based no mmRNA
per kg body weight). After the administration of the mmRNA-lipidoid
formulation, serum, tissues, and/or tissue lysates are obtained and
the level of the mmRNA-encoded product is determined at a single
and/or a range of time intervals. The ability of
lipidoid-formulated Luciferase, GFP, mCherry, sAP, G-CSF, Factor
IX, and EPO mmRNA to express the desired protein product is
confirmed by luminescence for the expression of Luciferase, flow
cytometry for the expression of GFP and mCherry expression, by
enzymatic activity for sAP, or by ELISA for the section of G-CSF,
Factor 1.times. and/or EPO.
[1291] Further studies for a multi-dose regimen are also performed
to determine the maximal expression of mmRNA, to evaluate the
saturability of the mmRNA-driven expression (by giving a control
and active mmRNA formulation in parallel or in sequence), and to
determine the feasibility of repeat drug administration (by giving
mmRNA in doses separated by weeks or months and then determining
whether expression level is affected by factors such as
immunogenicity). An assessment of the physiological function of
proteins such as G-CSF and EPO are also determined through
analyzing samples from the animal tested and detecting increases in
granulocyte and red blood cell counts, respectively. Activity of an
expressed protein product such as Factor IX, in animals can also be
assessed through analysis of Factor 1.times. enzymatic activity
(such as an activated partial thromboplastin time assay) and effect
of clotting times.
[1292] C. In Vitro Expression Following Intramuscular and/or
Subcutaneous Injection
[1293] The use of lipidoid formulations to deliver
oligonucleotides, including mRNA, via an intramuscular route or a
subcutaneous route of injection needs to be evaluated as it has not
been previously reported. Intramuscular and/or subcutaneous
injection of mmRNA are evaluated to determine if mmRNA-containing
lipidoid formulations are capabable to produce both localized and
systemic expression of a desired portiens.
[1294] Lipidoid formulations of 98N12-5, C12-200, and MDlcontaining
mmRNA selected from luciferase, green fluorescent protein (GFP),
mCherry fluorescent protein, secreted alkaline phosphatase (sAP),
human G-CSF, human factor IX, or human Erythropoietin (EPO) mmRNA
are injected intramuscularly and/or subcutaneously into animals.
The expression of mmRNA-encoded proteins are assessed both within
the muscle or subcutaneous tissue and systemically in blood and
other organs such as the liver and spleen. Single dose studies
allow an assessment of the magnitude, dose responsiveness, and
longevity of expression of the desired product.
[1295] Animals are divided into groups to receive either a saline
formulation or a formulation containing modified mRNA. Prior to
injection mmRNA-containing lipidoid formulations are diluted in
PBS. Animals are administered a single intramuscular dose of
formulated mmRNA ranging from 50 mg/kg to doses as low as 1 ng/kg
with a preferred range to be 10 mg/kg to 100 ng/kg. A maximum dose
for intramuscular administration, for a mouse, is roughly 1 mg
mmRNA or as low as 0.02 ng mmRNA for an intramuscular injection
into the hind limb of the mouse. For subcutaneous administration,
the animals are administered a single subcutaneous dose of
formulated mmRNA ranging from 400 mg/kg to doses as low as 1 ng/kg
with a preferred range to be 80 mg/kg to 100 ng/kg. A maximum dose
for subcutaneous administration, for a mouse, is roughly 8 mg mmRNA
or as low as 0.02 ng mmRNA.
[1296] For a 20 gram mouse the volume of a single intramuscular
injection is maximally 0.025 ml and a single subcutaneous injection
is maximally 0.2 ml. The optimal dose of mmRNA administered is
calculated from the body weight of the animal. At various points in
time points following the administration of the mmRNA-lipidoid,
serum, tissues, and tissue lysates is obtained and the level of the
mmRNA-encoded product is determined. The ability of
lipidoid-formulated luciferase, green fluorescent protein (GFP),
mCherry fluorescent protein, secreted alkaline phosphatase (sAP),
human G-CSF, human factor IX, or human Erythropoietin (EPO) mmRNA
to express the desired protein product is confirmed by luminescence
for luciferase expression, flow cytometry for GFP and mCherry
expression, by enzymatic activity for sAP, and by ELISA for G-CSF,
Factor 1.times. and Erythropoietin (EPO) secretion.
[1297] Additional studies for a multi-dose regimen are also
performed to determine the maximal expression using mmRNA, to
evaluate the saturability of the mmRNA-driven expression (achieved
by giving a control and active mmRNA formulation in parallel or in
sequence), and to determine the feasibility of repeat drug
administration (by giving mmRNA in doses separated by weeks or
months and then determining whether expression level is affected by
factors such as immunogenicity). Studies utilizing multiple
subcutaneous or intramuscular injection sites at one time point,
are also utilized to further increase mmRNA drug exposure and
improve protein production. An assessment of the physiological
function of proteins, such as GFP, mCherry, sAP, human G-CSF, human
factor IX, and human EPO, are determined through analyzing samples
from the tested animals and detecting a change in granulocyte
and/or red blood cell counts. Activity of an expressed protein
product such as Factor IX, in animals can also be assessed through
analysis of Factor 1.times. enzymatic activity (such as an
activated partial thromboplastin time assay) and effect of clotting
times.
Example 33
Bifunctional mmRNA
[1298] Using the teachings and synthesis methods described herein,
modified RNAs are designed and synthesized to be bifunctional,
thereby encoding one or more cytotoxic protein molecules as well as
be synthesized using cytotoxic nucleosides.
[1299] Administration of the bifunctional modified mRNAs is
effected using either saline or a lipid carrier. Once administered,
the bifunctional modified mRNA is translated to produce the encoded
cytotoxic peptide. Upon degradation of the delivered modified mRNA,
the cytotoxic nucleosides are released which also effect
therapeutic benefit to the subject.
Example 34
Modified mRNA Transfection
[1300] A. Reverse Transfection
[1301] For experiments performed in a 24-well collagen-coated
tissue culture plate, Keratinocytes are seeded at a cell density of
1.times.10.sup.5. For experiments performed in a 96-well
collagen-coated tissue culture plate, Keratinocytes are seeded at a
cell density of 0.5.times.10.sup.5. For each modified mRNA (mmRNA)
to be transfected, modified mRNA: RNAIMAX.TM. is prepared as
described and mixed with the cells in the multi-well plate within a
period of time, e.g., 6 hours, of cell seeding before cells had
adhered to the tissue culture plate.
[1302] B. Forward Transfection
[1303] In a 24-well collagen-coated tissue culture plate,
Keratinocytes are seeded at a cell density of 0.7.times.10.sup.5.
For experiments performed in a 96-well collagen-coated tissue
culture plate, Keratinocytes are seeded at a cell density of
0.3.times.10.sup.5. Keratinocytes are grown to a confluency of
>70% for over 24 hours. For each modified mRNA (mmRNA) to be
transfected, modified mRNA: RNAIMAX.TM. is prepared as described
and transfected onto the cells in the multi-well plate over 24
hours after cell seeding and adherence to the tissue culture
plate.
[1304] C. Modified mRNA Translation Screen: G-CSF ELISA
[1305] Keratinocytes are grown in EPILIFE medium with Supplement S7
from Invitrogen (Carlsbad, Calif.) at a confluence of >70%. One
set of keratinocytes were reverse transfected with 300 ng of the
chemically modified mRNA (mmRNA) complexed with RNAIMAX.TM. from
Invitrogen. Another set of keratinocytes are forward transfected
with 300 ng modified mRNA complexed with RNAIMAX.TM. from
Invitrogen. The modified mRNA: RNAIMAX.TM. complex is formed by
first incubating the RNA with Supplement-free EPILIFE.RTM. media in
a 5.times. volumetric dilution for 10 minutes at room
temperature.
[1306] In a second vial, RNAIMAX.TM. reagent was incubated with
Supplement-free EPILIFE.RTM. Media in 10.times. volumetric dilution
for 10 minutes at room temperature. The RNA vial was then mixed
with the RNAIMAX.TM. vial and incubated for 20-30 minutes at room
temperature before being added to the cells in a drop-wise fashion.
Secreted human Granulocyte-Colony Stimulating Factor (G-CSF)
concentration in the culture medium is measured at 18 hours
post-transfection for each of the chemically modified mRNA in
triplicate.
[1307] Secretion of Human G-CSF from transfected human
keratinocytes is quantified using an ELISA kit from Invitrogen or
R&D Systems (Minneapolis, Minn.) following the manufacturers
recommended instructions.
[1308] D. Modified mRNA Dose and Duration: G-CSF ELISA
[1309] Keratinocytes are grown in EPILIFE.RTM. medium with
Supplement S7 from Invitrogen at a confluence of >70%.
Keratinocytes are reverse transfected with either Ong, 46.875 ng,
93.75 ng, 187.5 ng, 375 ng, 750 ng, or 1500 ng modified mRNA
complexed with the RNAIMAX.TM. from Invitrogen (Carlsbad, Calif.).
The modified mRNA:RNAIMAX.TM. complex is formed as described.
Secreted human G-CSF concentration in the culture medium is
measured at 0, 6, 12, 24, and 48 hours post-transfection for each
concentration of each modified mRNA in triplicate. Secretion of
human G-CSF from transfected human keratinocytes is quantified
using an ELISA kit from Invitrogen or R&D Systems following the
manufacturers recommended instructions.
Example 35
Split Dose Studies
[1310] Studies utilizing multiple subcutaneous or intramuscular
injection sites at one time point were designed and performed to
investigate ways to increase mmRNA drug exposure and improve
protein production. In addition to detection of the expressed
protein product, an assessment of the physiological function of
proteins was also determined through analyzing samples from the
animal tested.
[1311] Surprisingly, it has been determined that split dosing of
mmRNA produces greater protein production and phenotypic responses
than those produced by single unit dosing or multi-dosing
schemes.
[1312] The design of a single unit dose, multi-dose and split dose
experiment involved using human erythropoietin (EPO) mmRNA (mRNA
shown in SEQ ID NO: 251436; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1) administered in
buffer alone. The dosing vehicle (F. buffer) consisted of 150 mM
NaCl, 2 mM CaCl.sub.2, 2 mM Na.sup.+-phosphate (1.4 mM monobasic
sodium phosphate; 0.6 mM dibasic sodium phosphate), and 0.5 mM
EDTA, pH 6.5. The pH was adjusted using sodium hydroxide and the
final solution was filter sterilized. The mmRNA was modified with
5meC at each cytosine and pseudouridine replacement at each uridine
site.
[1313] Animals (n=5) were injected IM (intramuscular) for the
single unit dose of 100 ug. For multi-dosing, two schedules were
used, 3 doses of 100 ug and 6 doses of 100 ug. For the split dosing
scheme, two schedules were used, 3 doses at 33.3 ug and 6 doses of
16.5 ug mmRNA. Control dosing involved use of buffer only at 6
doses. Control mmRNA involved the use of luciferase mmRNA (IVT cDNA
sequence shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ ID
NO: 251443, polyA tail of approximately 160 nucleotides not shown
in sequence, 5' cap, Cap1, fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site)
dosed 6 times at 100 ug. Blood and muscle tissue were evaluated 13
hrs post injection.
[1314] Human EPO protein was measured in mouse serum 13 h post I.M.
single, multi- or split dosing of the EPO mmRNA in buffer. Seven
groups of mice (n=5 mice per group) were treated and evaluated. The
results are shown in Table 60.
TABLE-US-00060 TABLE 60 Split dose study Avg. Polypeptide Dose Dose
of Total pmol/mL per unit drug Splitting Group Treatment mmRNA Dose
human EPO (pmol/ug) Factor 1 Human EPO mmRNA 1 .times. 100 ug 100
ug 14.3 .14 1 2 Human EPO mmRNA 3 .times. 100 ug 300 ug 82.5 .28 2
3 Human EPO mmRNA 6 .times. 100 ug 600 ug 273.0 .46 3.3 4 Human EPO
mmRNA 3 .times. 33.3 ug 100 ug 104.7 1.1 7.9 5 Human EPO mmRNA 6
.times. 16.5 ug 100 ug 127.9 1.3 9.3 6 Luciferase mmRNA 6 .times.
100 ug 600 ug 0 -- -- 7 Buffer Alone -- -- 0 -- --
[1315] The splitting factor is defined as the product per unit drug
divided by the single dose product per unit drug (PUD). For example
for treatment group 2 the value 0.28 or product (EPO) per unit drug
(mmRNA) is divided by the single dose product per unit drug of
0.14. The result is 2. Likewise, for treatment group 4, the value
1.1 or product (EPO) per unit drug (mmRNA) is divided by the single
dose product per unit drug of 0.14. The result is 7.9.
Consequently, the dose splitting factor (DSF) may be used as an
indicator of the efficacy of a split dose regimen. For any single
administration of a total daily dose, the DSF should be equal to 1.
Therefore any DSF greater than this value in a split dose regimen
is an indication of increased efficacy.
[1316] To determine the dose response trends, impact of injection
site and impact of injection timing, studies are performed. In
these studies, varied doses of 1 ug, 5 ug, 10 ug, 25 ug, 50 ug, and
values in between are used to determine dose response outcomes.
Split dosing for a 100 ug total dose includes three or six doses of
1.6 ug, 4.2 ug, 8.3 ug, 16.6 ug, or values and total doses equal to
administration of the total dose selected.
[1317] Injection sites are chosen from the limbs or any body
surface presenting enough area suitable for injection. This may
also include a selection of injection depth to target the dermis
(Intradermal), epidermis (Epidermal), subcutaneous tissue (SC) or
muscle (IM). Injection angle will vary based on targeted delivery
site with injections targeting the intradermal site to be 10-15
degree angles from the plane of the surface of the skin, between
20-45 degrees from the plane of the surface of the skin for
subcutaneous injections and angles of between 60-90 degrees for
injections substantially into the muscle.
Example 36
Quantification in Exosomes
[1318] The quantity and localization of the mmRNA of the present
invention can be determined by measuring the amounts (initial,
timecourse, or residual basis) in isolated exosomes. In this study,
since the mmRNA are typically codon-optimized and distinct in
sequence from endogenous mRNA, the levels of mmRNA are quantitated
as compared to endogenous levels of native or wild type mRNA by
using the methods of Gibbings, PCT/IB2009/005878, the contents of
which are incorporated herein by reference in their entirety.
[1319] In these studies, the method is performed by first isolating
exosomes or vesicles preferably from a bodily fluid of a patient
previously treated with a polynucleotide, primary construct or
mmRNA of the invention, then measuring, in said exosomes, the
polynucleotide, primary construct or mmRNA levels by one of mRNA
microarray, qRT-PCR, or other means for measuring RNA in the art
including by suitable antibody or immunohistochemical methods.
Example 37
Effect of Modified mRNA on Cellular Viability, Cytotoxicity and
Apoptosis
[1320] This experiment demonstrates cellular viability,
cytotoxicity and apoptosis for distinct modified mRNA in-vitro
transfected Human Keratinocyte cells. Keratinocytes are grown in
EPILIFE.RTM. medium with Human Keratinocyte Growth Supplement in
the absence of hydrocortisone from Invitrogen (Carlsbad, Calif.) at
a confluence of >70%. Keratinocytes are reverse transfected with
Ong, 46.875 ng, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng, 3000
ng, or 6000 ng of modified mRNA complexed with RNAIMAX.TM. from
Invitrogen. The modified mRNA:RNAIMAX.TM. complex is formed.
Secreted human G-CSF concentration in the culture medium is
measured at 0, 6, 12, 24, and 48 hours post-transfection for each
concentration of each modified m RNA in triplicate. Secretion of
human G-CSF from transfected human keratinocytes is quantified
using an ELISA kit from Invitrogen or R&D Systems following the
manufacturers recommended instructions.
[1321] Cellular viability, cytotoxicity and apoptosis is measured
at 0, 12, 48, 96, and 192 hours post-transfection using the
APOTOX-GLO.TM. kit from Promega (Madison, Wis.) according to
manufacturer instructions.
Example 38
Detection of a Cellular Innate Immune Response to Modified mRNA
Using an ELISA Assay
[1322] An enzyme-linked immunosorbent assay (ELISA) for Human Tumor
Necrosis Factor-.alpha. (TNF-.alpha.), Human Interferon-.beta.
(IFN-.beta.) and Human Granulocyte-Colony Stimulating Factor
(G-CSF) secreted from in vitro-transfected Human Keratinocyte cells
is tested for the detection of a cellular innate immune response.
Keratinocytes are grown in EPILIFE.RTM. medium with Human
Keratinocyte Growth Supplement in the absence of hydrocortisone
from Invitrogen (Carlsbad, Calif.) at a confluence of >70%.
Secreted TNF-.alpha. keratinocytes are reverse transfected with
Ong, 93.75 ng, 187.5 ng, 375 ng, 750 ng, 1500 ng or 3000 ng of the
chemically modified mRNA (mmRNA) complexed with RNAIMAX.TM. from
Invitrogen as described in triplicate. Secreted TNF-.alpha. in the
culture medium is measured 24 hours post-transfection for each of
the chemically modified mRNA using an ELISA kit from Invitrogen
according to the manufacturer protocols.
[1323] Secreted IFN-.beta. in the same culture medium is measured
24 hours post-transfection for each of the chemically modified mRNA
using an ELISA kit from Invitrogen according to the manufacturer
protocols. Secreted human G-CSF concentration in the same culture
medium is measured at 24 hours post-transfection for each of the
chemically modified mRNA. Secretion of human G-CSF from transfected
human keratinocytes is quantified using an ELISA kit from
Invitrogen or R&D Systems (Minneapolis, Minn.) following the
manufacturers recommended instructions. These data indicate which
modified mRNA (mmRNA) are capable eliciting a reduced cellular
innate immune response in comparison to natural and other
chemically modified polynucleotides or reference compounds by
measuring exemplary type 1 cytokines TNF-.alpha. and
IFN-.beta..
Example 39
Human Granulocyte-Colony Stimulating Factor (G-CSF) Modified
mRNA-Induced Cell Proliferation Assay
[1324] Human keratinocytes are grown in EPILIFE.RTM. medium with
Supplement S7 from Invitrogen at a confluence of >70% in a
24-well collagen-coated TRANSWELL.RTM. (Corning, Lowell, Mass.)
co-culture tissue culture plate. Keratinocytes are reverse
transfected with 750 ng of the indicated chemically modified mRNA
(mmRNA) complexed with RNAIMAX from Invitrogen as described in
triplicate. The modified mRNA:RNAIMAX complex is formed as
described. Keratinocyte media is exchanged 6-8 hours
post-transfection. 42-hours post-transfection, the 24-well
TRANSWELL.RTM. plate insert with a 0.4 .mu.m-pore semi-permeable
polyester membrane is placed into the human G-CSF modified
mRNA-transfected keratinocyte containing culture plate
[1325] Human myeloblast cells, Kasumi-1 cells or KG-1
(0.2.times.10.sup.5 cells), are seeded into the insert well and
cell proliferation is quantified 42 hours post-co-culture
initiation using the CyQuant Direct Cell Proliferation Assay
(Invitrogen, Carlsbad, Calif.) in a 100-120 .mu.l volume in a
96-well plate. Modified mRNA-encoding human G-CSF-induced
myeloblast cell proliferation is expressed as a percent cell
proliferation normalized to untransfected keratinocyte/myeloblast
co-culture control wells. Secreted human G-CSF concentration in
both the keratinocyte and myeloblast insert co-culture wells is
measured at 42 hours post-co-culture initiation for each modified
mRNA in duplicate. Secretion of human G-CSF is quantified using an
ELISA kit from Invitrogen following the manufacturer recommended
instructions.
[1326] Transfected human G-CSF modified mRNA in human keratinocyte
feeder cells and untransfected human myeloblast cells are detected
by RT-PCR. Total RNA from sample cells is extracted and lysed using
RNEASY.RTM. kit (Qiagen, Valencia, Calif.) according to the
manufacturer instructions. Extracted total RNA is submitted to
RT-PCR for specific amplification of modified mRNA-G-CSF using
PROTOSCRIPT.RTM. M-MuLV Taq RT-PCR kit (New England BioLabs,
Ipswich, Mass.) according to the manufacturer instructions with
human G-CSF-specific primers. RT-PCR products are visualized by
1.2% agarose gel electrophoresis.
Example 40
Co-Culture Assay
[1327] Modified mRNA comprised of chemically-distinct modified
nucleotides encoding human Granulocyte-Colony Stimulating Factor
(G-CSF) may stimulate the cellular proliferation of a transfection
incompetent cell in a co-culture environment. The co-culture
includes a highly transfectable cell type such as a human
keratinocyte and a transfection incompetent cell type such as a
white blood cell (WBC). The modified mRNA encoding G-CSF are
transfected into the highly transfectable cell allowing for the
production and secretion of G-CSF protein into the extracellular
environment where G-CSF acts in a paracrine-like manner to
stimulate the white blood cell expressing the G-CSF receptor to
proliferate. The expanded WBC population may be used to treat
immune-compromised patients or partially reconstitute the WBC
population of an immunosuppressed patient and thus reduce the risk
of opportunistic infections. In another example, a highly
transfectable cell such as a fibroblast are transfected with
certain growth factors support and simulate the growth,
maintenance, or differentiation of poorly transfectable embryonic
stem cells or induced pluripotent stem cells.
Example 41
Detection Assays of Human IgG Antibodies
[1328] A. ELISA Detection of Human IgG Antibodies
[1329] This example describes an ELISA for Human IgG from Chinese
Hamster
[1330] Ovary's (CHO) and Human Embryonic Kidney (HEK, HER-2
Negative) 293 cells transfected with human IgG modified mRNA
(mmRNA). The Human Embryonic Embryonic Kidney (HEK) 293 are grown
in CD 293 Medium with Supplement of L-Glutamine from Invitrogen
until they reach a confluence of 80-90%. The CHO cells are grown in
CD CHO Medium with Supplement of L-Glutamine, Hypoxanthine and
Thymidine. In one aspect, 2.times.10.sup.6 cells are transfected
with 24 .mu.g modified mRNA complexed with RNAIMAX.TM. from
Invitrogen in a 75 cm2 culture flask from Corning in 7 ml of
medium. In another aspect, 80,000 cells are transfected with 1
.mu.g modified mRNA complexed with RNAIMAX.TM. from Invitrogen in a
24-well plate. The modified mRNA:RNAIMAX.TM. complex is formed by
incubating in a vial the mmRNA with either the CD 293 or CD CHO
medium in a 5.times. volumetric dilution for 10 minutes at room
temperature. In a second vial, RNAIMAX.TM. reagent is incubated
with CD 293 medium or CD CHO medium in a 10.times. volumetric
dilution for 10 minutes at room temperature. The mmRNA vial is then
mixed with the RNAIMAX.TM. vial and incubated for 20-30 minutes at
room temperature before it isadded to the CHO or HEK cells in a
drop-wise fashion. The culture supernatants are stored at 4 degrees
celsius. The concentration of the secreted human IgG in the culture
medium in the 24 .mu.g mmRNA transfections is measured at 12, 24,
36 hours post-transfection and the 1 .mu.g mmRNA transfection is
measured at 36 hours. Secretion of Trastuzumab from transfected HEK
293 cells is quantified using an ELISA kit from Abcam (Cambridge,
Mass.) following the manufacturers recommended instructions. The
data shows that a Humanized IgG antibody (such as Trastuzumab)
mmRNA is capable of being translated in HEK Cells and that
Trastuzumab is secreted out of the cells and released into the
extracellular environment. Furthermore, the data demonstrate that
transfection of cells with mmRNA encoding Trastuzumab for the
production of secreted protein can be scaled up to a bioreactor or
large cell culture conditions.
[1331] B. Western Detection of Modified mRNA Produced Human IgG
Antibody
[1332] A Western Blot of CHO-K1 cells is co-transfected with 1
.mu.g each of Heavy and Light Chain of Trastuzumab modified mRNA
(mmRNA). CHO cells are grown using standard protocols in 24-well
plates. The cell supernatants or cell lysates are collected 24
hours post-transfection, separated on a 12% SDS-Page gel and
transferred onto a nitrocellulose membrane using the IBOT.RTM. by
Invitrogen (Carlsbad, Calif.). The cells are incubated with a first
conjugation of a rabbit polyclonal antibody to Human IgG conjugated
to DYLIGHT594 (ab96904, abcam, Cambridge, Mass.) and a second
conjugation of a goat polyclonal antibody to Rb IgG which is
conjugated to alkaline phosphatase. After incubation, the antibody
is detected using Novex.RTM. alkaline phosphatase chromogenic
substrate by Invitrogen (Carlsbad, Calif.).
[1333] C. Cell Immuno Staining of Modified mRNA Produced
Trastuzumab and Rituximab
[1334] CHO-K1 cells are co-transfected with 500 ng each of Heavy
and Light Chain of either Trastuzumab or Rituximab. Cells are grown
in F-12K Medium from GIBCO.RTM. (Grand Island, N.Y.) and 10% FBS.
Cells are fixed with 4% paraformaldehyde in PBS, permeabilized with
0.1% Triton X-100 in PBS for 5-10 minutes at room temperature and
cells are washed 3 times with room temperature PBS. Trastuzumab and
Rituximab staining is performed using rabbit polyclonal antibody to
Human IgG conjugated to DYLIGHT.RTM.594 (ab96904, abcam, Cambridge,
Mass.) according to the manufacture's recommended dilutions.
Nuclear DNA staining is performed with DAPI dye from Invitrogen
(Carlsbad, Calif.). The protein for Trastuzumab and Rituximab is
translated and localized to the cytoplasm upon modified mRNA
transfections. Pictures are taken 13 hours post-transfection.
[1335] D. Binding Immunoblot Assay for Modified mRNA Produced
Trastuzumab and Rituximab
[1336] Trastuzumab and Rituximab are detected using a binding
immunoblot detection assay. Varying concentrations (100 ng/ul to 0
ng/ul) of the ErB2 peptide (ab40048, abeam, Cambridge, Mass.),
antigen for Trastuzumab and the CD20 peptide (ab97360, abeam,
Cambridge, Mass.), antigen for Rituximab are run on a 12% SDS-Page
gel and transferred onto a membrane using the iBlot from
Invitrogen. The membranes are incubated for 1 hour with their
respective cell supernatants from CHO-K1 cells which are
co-transfected with 500 ng each of Heavy and Light Chain of either
Trastuzumab or Rituximab. The membranes are blocked with 1% BSA and
a secondary anti-human IgG antibody conjugated to alkaline
phosphatase (abcam, Cambridge, Mass.) is added. Antibody detection
is conducted using the NOVEX alkaline phosphatase chromogenic
substrate by Invitrogen (Carlsbad, Calif.). The data shows that a
humanized IgG antibodies generated from modified mRNA is capable of
recognizing and binding to their respective antigens.
[1337] E. Cell Proliferation Assay
[1338] The SK-BR-3 cell line, an adherent cell line derived from a
human breast adenocarcinoma, which overexpresses the HER2/neu
receptor can be used to compare the anti-proliferative properties
of modified mRNA (mmRNA) generated Trastuzumab. Varying
concentrations of purified Trastuzumab generated from modified mRNA
and trastuzumab are be added to cell cultures, and their effects on
cell growth are be assessed in triplicate cytotoxicity and
viability assays.
Example 42
Bulk Transfection of Modified mRNA into Cell Culture
[1339] A. Cationic Lipid Delivery Vehicles
[1340] RNA transfections are carried out using RNAIMAX.TM.
(Invitrogen, Carlsbad, Calif.) or TRANSIT-mRNA (Mims Bio, Madison,
Wis.) cationic lipid delivery vehicles. RNA and reagent are first
diluted in Opti-MEM basal media (Invitrogen, Carlsbad, Calif.). 100
ng/uL RNA is diluted 5.times. and 5 .mu.L, of RNAIMax per .mu.g of
RNA is diluted 10.times.. The diluted components are pooled and
incubated 15 minutes at room temperature before they are dispensed
to culture media. For TRANSIT-mRNA transfections, 100 ng/uL RNA is
diluted 10.times. in Opti-MEM and BOOST reagent is added (at a
concentration of 2 .mu.L per .mu.g of RNA), TRANSIT-mRNA is added
(at a concentration of 2 .mu.L per .mu.g of RNA), and then the
RNA-lipid complexes are delivered to the culture media after a
2-minute incubation at room temperature. RNA transfections are
performed in Nutristem xenofree hES media (Stemgent, Cambridge,
Mass.) for RiPS derivations, Dermal Cell Basal Medium plus
Keratinocyte Growth Kit (ATCC) for keratinocyte experiments, and
Opti-MEM plus 2% FBS for all other experiments. Successful
introduction of a modified mRNA (mmRNA) into host cells can be
monitored using various known methods, such as a fluorescent
marker, such as Green Fluorescent Protein (GFP). Successful
transfection of a modified mRNA can also be determined by measuring
the protein expression level of the target polypeptide by e.g.,
Western Blotting or immunocytochemistry. Similar methods may be
followed for large volume scale-up to multi-liter (5-10,000 L)
culture format following similar RNA-lipid complex ratios.
[1341] B. Electroporation Delivery of Exogenous Synthetic mRNA
Transcripts
[1342] Electroporation parameters are optimized by transfecting
MRC-5 fibroblasts with in vitro synthetic modified mRNA (mmRNA)
transcripts and measuring transfection efficiency by quantitative
RT-PCR with primers designed to specifically detect the exogenous
transcripts. Discharging a 150 uF capacitor charged to F into
2.5.times.10.sup.6 cells suspended in 50 .mu.l of Opti-MEM
(Invitrogen, Carlsbad, Calif.) in a standard electroporation
cuvette with a 2 mm gap is sufficient for repeated delivery in
excess of 10,000 copies of modified mRNA transcripts per cell, as
determined using the standard curve method, while maintaining high
viability (>70%). Further experiments may reveal that the
voltage required to efficiently transfect cells with mmRNA
transcripts can depend on the cell density during electroporation.
Cell density may vary from 1.times.10.sup.6 cell/50 .mu.l to a
density of 2.5.times.10.sup.6 cells/50 .mu.l and require from 110V
to 145V to transfect cells with similar efficiencies measured in
transcript copies per cell. Large multi-liter (5-10,000 L)
electroporation may be performed similar to large volume flow
electroporation strategies similar to methods described with the
above described constraints (Li et al., 2002; Geng et al.,
2010).
Example 43
In Vivo Delivery Using Lipoplexes
[1343] A. Human EPO Modified RNA Lipoplex
[1344] A formulation containing 100 .mu.g of modified human
erythropoietin mRNA (mRNA shown in SEQ ID NO: 251436; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1)
(EPO; fully modified 5-methylcytosine;
N.sup.1-methyl-pseudouridine) was lipoplexed with 30% by volume of
RNAIMAX.TM. (Lipoplex-h-Epo-46; Generation 2 or Gen2) in 50-70 uL
delivered intramuscularly to four C57/BL6 mice. Other groups
consisted of mice receiving an injection of the lipoplexed modified
luciferase mRNA (Lipoplex-luc) (IVT cDNA sequence shown in SEQ ID
NO: 251442; mRNA sequence shown in SEQ ID NO: 251443, polyA tail of
approximately 160 nucleotides not shown in sequence, 5' cap, Cap1,
fully modified with 5-methylcytosine at each cytosine and
pseudouridine replacement at each uridine site) which served as a
control containing 100 .mu.g of modified luciferase mRNA was
lipoplexed with 30% by volume of RNAiMAX.TM. or mice receiving an
injection of the formulation buffer as negative control at a dose
volume of 65 ul. 13 hours after the intramuscular injection, serum
was collected from each mouse to measure the amount of human EPO
protein in the mouse serum by human EPO ELISA and the results are
shown in Table 61.
TABLE-US-00061 TABLE 61 Human EPO Production (IM Injection Route)
Formualtion Average Lipoplex-h-Epo-46 251.95 Lipoplex-Luc 0
Formulation Buffer 0
[1345] B. Human G-CSF Modified RNA Lipoplex
[1346] A formulation containing 100 .mu.g of one of two versions of
modified human G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) (G-CSF fully modified with 5-methylcytosine
and pseudouridine (G-CSF) or G-CSF fully modified with
5-methylcytosine and N1-methyl-pseudouridine (G-CSF-N1) lipoplexed
with 30% by volume of RNAIMAX.TM. and delivered in 150 uL
intramuscularly (I.M), in 150 uL subcutaneously (S.C) and in 225 uL
intravenously (I.V) to C57/BL6 mice.
[1347] Three control groups were administered either 100 .mu.g of
modified luciferase mRNA (IVT cDNA sequence shown in SEQ ID NO:
251442; mRNA sequence shown in SEQ ID NO: 251443, polyA tail of
approximately 160 nucleotides not shown in sequence, 5' cap, Cap1,
fully modified with 5-methylcytosine at each cytosine and
pseudouridine replacement at each uridine site) intramuscularly
(Luc-unsp I.M.) or 150 .mu.g of modified luciferase mRNA
intravenously (Luc-unsp I.V.) or 150 uL of the formulation buffer
intramuscularly (Buffer I.M.). 6 hours after administration of a
formulation, serum was collected from each mouse to measure the
amount of human G-CSF protein in the mouse serum by human G-CSF
ELISA and the results are shown in Table 62.
[1348] These results demonstrate that both
5-methylcytosine/pseudouridine and
5-methylcytosine/N1-methyl-pseudouridine modified human G-CSF mRNA
can result in specific human G-CSF protein expression in serum when
delivered via I.V. or I.M. route of administration in a lipoplex
formulation.
TABLE-US-00062 TABLE 62 Human G-CSF in Serum (I.M., I.V., S.C.
Injection Route) Formulation Route G-CSF (pg/ml) G-CSF I.M. 85.6
G-CSF N1 I.M. 40.1 G-CSF S.C. 3.9 G-CSF N1 S.C. 0.0 G-CSF I.V. 31.0
G-CSF N1 I.V. 6.1 Luc-unsp I.M. 0.0 Luc-unsp I.V. 0.0 Buffer I.M.
0.0
[1349] C. Human G-CSF Modified RNA Lipoplex Comparison
[1350] A formulation containing 100 .mu.g of either modified human
G-CSF mRNA lipoplexed with 30% by volume of RNAIMAX.TM. with a
5-methylcytosine (5mc) and a pseudouridine (.psi.) modification
(G-CSF-Gen1-Lipoplex), modified human G-CSF mRNA with a 5mc and
.psi. modification in saline (G-CSF-Genl-Saline), modified human
G-CSF mRNA with a N1-5-methylcytosine (N-1-5mc) and a .psi.
modification lipoplexed with 30% by volume of RNAIMAX.TM.
(G-CSF-Gen2-Lipoplex), modified human G-CSF mRNA with a N1-5mc and
.psi. modification in saline (G-CSF-Gen2-Saline), modified
luciferase with a 5mc and .psi. modification lipoplexed with 30% by
volume of RNAIMAX.TM. (Luc-Lipoplex), or modified luciferase mRNA
with a a 5mc and .psi. modification in saline (Luc-Saline) was
delivered intramuscularly (I.M.) or subcutaneously (S.C.) and a
control group for each method of administration was giving a dose
of 80 uL of the formulation buffer (F. Buffer) to C57/BL6 mice. 13
hours post injection serum and tissue from the site of injection
were collected from each mouse and analyzed by G-CSF ELISA to
compare human G-CSF protein levels. The results of the human G-CSF
protein in mouse serum from the intramuscular administration, and
the subcutaneous administration results are shown in Table 63.
[1351] These results demonstrate that
5-methylcytosine/pseudouridine and
5-methylcytosine/N1-methyl-pseudouridine modified human G-CSF mRNA
can result in specific human G-CSF protein expression in serum when
delivered via I.M. or S.C. route of administration whether in a
saline formulation or in a lipoplex formulation. As shown in Table
63, 5-methylcytosine/N1-methyl-pseudouridine modified human G-CSF
mRNA generally demonstrates increased human G-CSF protein
production relative to 5-methylcytosine/pseudouridine modified
human G-CSF mRNA.
TABLE-US-00063 TABLE 63 Human G-CSF Protein in Mouse Serum G-CSF
(pg/ml) I.M. Injection S.C. Formulation Route Injenction Route
G-CSF-Gen1-Lipoplex 13.988 42.855 G-CSF-Gen1-saline 9.375 4.614
G-CSF-Gen2-lipoplex 75.572 32.107 G-CSF-Gen2-saline 20.190 45.024
Luc lipoplex 0 3.754 Luc saline 0.0748 0 F. Buffer 4.977 2.156
[1352] D. mCherry Modified RNA Lipoplex Comparison
[1353] Intramuscular and Subcutaneous Administration
[1354] A formulation containing 100 .mu.g of either modified
mCherry mRNA (mRNA sequence shown in SEQ ID NO: 251434; polyA tail
of approximately 160 nucleotides not shown in sequence; 5' cap,
Cap1) lipoplexed with 30% by volume of RNAIMAX.TM. or modified
mCherry mRNA in saline is delivered intramuscularly and
subcutaneously to mice. A formulation buffer is also administered
to a control group of mice either intramuscularly or
subcutaneously. The site of injection on the mice may be collected
17 hours post injection for sectioning to determine the cell
type(s) responsible for producing protein.
[1355] Intravitreal Administration
[1356] A formulation containing 10 .mu.g of either modified mCherry
mRNA lipoplexed with RNAIMAX.TM., modified mCherry mRNA in a
formulation buffer, modified luciferase mRNA lipoplexed with
RNAMAX.TM., modified luciferase mRNA in a formulation buffer can be
administered by intravitreal injection (IVT) in rats in a dose
volume of 5 .mu.l/eye. A formulation buffer is also administrered
by IVT to a control group of rats in a dose volume of 5 .mu.l/eye.
Eyes from treated rats can be collected after 18 hours post
injection for sectioning and lysating to determine whether mmRNA
can be effectively delivered in vivo to the eye and result in
protein production, and to also determine the cell type(s)
responsible for producing protein in vivo.
[1357] Intranasal Administration
[1358] A formulation containing 100 .mu.g of either modified
mCherry mRNA lipoplexed with 30% by volume of RNAIMAX.TM., modified
mCherry mRNA in saline, modified luciferase mRNA lipoplexed with
30% by volume of RNAIMAX.TM. or modified luciferase mRNA in saline
is delivered intranasally. A formulation buffer is also
administered to a control group intranasally. Lungs may be
collected about 13 hours post instillation for sectioning (for
those receiving mCherry mRNA) or homogenization (for those
receiving luciferase mRNA). These samples will be used to determine
whether mmRNA can be effectively delivered in vivo to the lungs and
result in protein production, and to also determine the cell
type(s) responsible for producing protein in vivo.
Example 44
In Vivo Delivery Using Varying Lipid Ratios
[1359] Modified mRNA was delivered to C57/BL6 mice to evaluate
varying lipid ratios and the resulting protein expression.
Formulations of 100 .mu.g modified human EPO mRNA (mRNA shown in
SEQ ID NO: 251436; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine) lipoplexed with 10%, 30% or 50%
RNAIMAX.TM., 100 .mu.g modified luciferase mRNA (IVT cDNA sequence
shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ ID NO:
251443, polyA tail of approximately 160 nucleotides not shown in
sequence, 5' cap, Cap1, fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site)
lipoplexed with 10%, 30% or 50% RNAIMAX.TM. or a formulation buffer
were administered intramuscularly to mice in a single 70 .mu.l
dose. Serum was collected 13 hours post injection to undergo a
human EPO ELISA to determine the human EPO protein level in each
mouse. The results of the human EPO ELISA, shown in Table 64, show
that modified human EPO expressed in the muscle is secreted into
the serum for each of the different percentage of RNAIMAX.TM..
TABLE-US-00064 TABLE 64 Human EPO Protein in Mouse Serum (IM
Injection Route) Formulation EPO (pg/ml) Epo + 10% RNAiMAX 11.4 Luc
+ 10% RNAiMAX 0 Epo + 30% RNAiMAX 27.1 Luc + 30% RNAiMAX 0 Epo +
50% RNAiMAX 19.7 Luc + 50% RNAiMAX 0 F. Buffer 0
Example 45
Intramuscular and Subcutaneous In Vivo Delivery in Mammals
[1360] Modified human EPO mRNA (mRNA sequence shown in SEQ ID NO:
251436; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) formulated in formulation buffer was delivered to
either C57/BL6 mice or Sprague-Dawley rats to evaluate the dose
dependency on human EPO production. Rats were intramuscularlly
injected with 50 .mu.l of the modified human EPO mRNA (h-EPO),
modified luciferase mRNA (Luc) (IVT cDNA sequence shown in SEQ ID
NO: 251442; mRNA sequence shown in SEQ ID NO: 251443, polyA tail of
approximately 160 nucleotides not shown in sequence, 5' cap, Cap1,
fully modified with 5-methylcytosine at each cytosine and
pseudouridine replacement at each uridine site) or the formulation
buffer (F. Buffer) as described in the dosing chart Table 65.
[1361] Mice were intramuscularly or subcutaneously injected with 50
.mu.l of the modified human EPO mRNA (h-EPO), modified luciferase
mRNA (Luc) or the formulation buffer (F. Buffer) as described in
the dosing chart Table 66. 13 hours post injection blood was
collected and serum was analyzed to determine the amount human EPO
for each mouse or rat. The average and geometric mean in pg/ml for
the rat study are also shown in Table 65.
TABLE-US-00065 TABLE 65 Rat Study Geometric- Group Dose (ug) Avg.
pg/ml mean pg/ml h-EPO G#1 150 67.7 67.1 h-EPO G#2 100 79.4 66.9
h-EPO G#3 50 101.5 85.4 h-EPO G#4 10 46.3 31.2 h-EPO G#5 1 28.7
25.4 Luc G#6 100 24.5 22.4 F. Buffer G#7 -- 18.7 18.5
TABLE-US-00066 TABLE 66 Mouse Study Average Level in serum Route
Treatment Group Dose pg/ml IM h-EPO 1 100 .mu.g 96.2 IM h-EPO 2 50
.mu.g 63.5 IM h-EPO 3 25 .mu.g 18.7 IM h-EPO 4 10 .mu.g 25.9 IM
h-EPO 5 1 .mu.g 2.6 IM Luc 6 100 .mu.g 0 IM F. Buffer 7 -- 1.0 SC
h-EPO 1 100 .mu.g 72.0 SC Luc 2 100 .mu.g 26.7 SC F. Buffer 3 --
17.4
Example 46
Duration of Activity after Intramuscular In Vivo Delivery
[1362] Modified human EPO mRNA (mRNA sequence shown in SEQ ID NO:
251436; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) formulated in formulation buffer was delivered to
Sprague-Dawley rats to determine the duration of the dose response.
Rats were intramuscularly injected with 50 .mu.l of the modified
human EPO mRNA (h-EPO), modified luciferase mRNA (IVT cDNA sequence
shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ ID NO:
251443, polyA tail of approximately 160 nucleotides not shown in
sequence, 5' cap, Cap1, fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site)
(Luc) or the formulation buffer (F. Buffer) as described in the
dosing chart Table 67. The rats were bled 2, 6, 12, 24, 48 and 72
hours after the intramuscular injection to determine the
concentration of human EPO in serum at a given time. The average
and geometric mean in pg/ml for this study are also shown in Table
67.
TABLE-US-00067 TABLE 67 Dosing Chart Geometric- Dose mean Group
(ug) Avg. pg/ml (pg/ml) h-EPO 2 hour 100 59.6 58.2 h-EPO 6 hour 100
68.6 55.8 h-EPO 12 hour 100 87.4 84.5 h-EPO 24 hour 100 108.6 95.3
h-EPO 48 hour 100 77.9 77.0 h-EPO 72 hour 100 80.1 75.8 Luc 24, 48
and 72 hour 100 37.2 29.2 F. Buffer 24, 48 and 72 hour -- 48.9
10.4
Example 47
Routes of Administration
[1363] Further studies were performed to investigate dosing using
different routes of administration. Following the protocol outlined
in Example 35, 4 mice per group were dosed intramuscularly (I.M.),
intravenously (IV) or subcutaneously (S.C.) by the dosing chart
outlined in Table 68. Serum was collected 13 hours post injection
from all mice, tissue was collected from the site of injection from
the intramuscular and subcutaneous group and the spleen, liver and
kidneys were collected from the intravenous group. The results from
the intramuscular group and the subcutaneous group results are
shown in Table 69.
TABLE-US-00068 TABLE 68 Dosing Chart Total Dosing Group Treatment
Route Dose of mmRNA Dose Vehicle 1 Lipoplex-human EPO I.M. 4
.times. 100 ug + 30% 4 .times. 70 ul Lipoplex mmRNA Lipoplex 2
Lipoplex-human EPO I.M. 4 .times. 100 ug 4 .times. 70 ul Buffer
mmRNA 3 Lipoplex-human EPO S.C. 4 .times. 100 ug + 30% 4 .times. 70
ul Lipoplex mmRNA Lipoplex 4 Lipoplex-human EPO S.C. 4 .times. 100
ug 4 .times. 70 ul Buffer mmRNA 5 Lipoplex-human EPO I.V. 200 ug +
30% 140 ul Lipoplex mmRNA Lipoplex 6 Lipoplexed-Luciferase I.M. 100
ug + 30% 4 .times. 70 ul Lipoplex mmRNA Lipoplex 7
Lipoplexed-Luciferase I.M. 100 ug 4 .times. 70 ul Buffer mmRNA 8
Lipoplexed-Luciferase S.C. 100 ug + 30% 4 .times. 70 ul Lipoplex
mmRNA Lipoplex 9 Lipoplexed-Luciferase S.C. 100 ug 4 .times. 70 ul
Buffer mmRNA 10 Lipoplexed-human EPO I.V. 200 ug + 30% 140 ul
Lipoplex mmRNA Lipoplex 11 Formulation Buffer I.M. 4x multi dosing
4 .times. 70 ul Buffer
TABLE-US-00069 TABLE 69 Human EPO Protein in Mouse Serum (I.M.
Injection Route) EPO (pg/ml) I.M. S.C. Formulation Injection Route
Injection Route Epo-Lipoplex 67.115 2.154 Luc-Lipoplex 0 0
Epo-Saline 100.891 11.37 Luc-Saline 0 0 Formulation Buffer 0 0
Example 48
Rapidly Eliminated Lipid Nanoparticle (reLNP) Studies
[1364] A. Formulation of Modified RNA reLNPs
[1365] Solutions of synthesized lipid,
1,2-distearoyl-3-phosphatidylcholine (DSPC) (Avanti Polar Lipids,
Alabaster, Ala.), cholesterol (Sigma-Aldrich, Taufkirchen,
Germany), and
.alpha.-[3'-(1,2-dimyristoyl-3-propanoxy)-carboxamide-propyl]-w-methoxy-p-
olyoxyethylene (PEG-c-DOMG) (NOF, Bouwelven, Belgium) are prepared
and stored at -20.degree. C. The synthesized lipid is selected from
DLin-DMA with an internal ester, DLin-DMA with a terminal ester,
DLin-MC3-DMA-internal ester, and DLin-MC3-DMA with a terminal
ester. The reLNPs are combined to yield a molar ratio of
50:10:38.5:1.5 (reLNP: DSPC: Cholesterol: PEG-c-DOMG). Formulations
of the reLNPs and modified mRNA are prepared by combining the lipid
solution with the modified mRNA solution at total lipid to modified
mRNA weight ratio of 10:1, 15:1, 20:1 and 30:1.
[1366] B. Characterization of Formulations
[1367] A Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern,
Worcestershire, UK) is used to determine the particle size, the
polydispersity index (PDI) and the zeta potential of the modified
mRNA nanoparticles in 1.times.PBS in determining particle size and
15 mM PBS in determining zeta potential.
[1368] Ultraviolet-visible spectroscopy is used to determine the
concentration of modified mRNA nanoparticle formulation. After
mixing, the absorbance spectrum of the solution is recorded between
230 nm and 330 nm on a DU 800 spectrophotometer (Beckman Coulter,
Beckman Coulter, Inc., Brea, Calif.). The modified RNA
concentration in the nanoparicle formulation is calculated based on
the extinction coefficient of the modified RNA used in the
formulation and on the difference between the absorbance at a
wavelength of 260 nm and the baseline value at a wavelength of 330
nm.
[1369] QUANT-IT.TM. RIBOGREEN.RTM. RNA assay (Invitrogen
Corporation Carlsbad, Calif.) is used to evaluate the encapsulation
of modified RNA by the nanoparticle. The samples are diluted,
transferred to a polystyrene 96 well plate, then either a TE buffer
or a 2% Triton X-100 solution is added. The plate is incubated and
the RIBOGREEN.RTM. reagent is diluted in TE buffer, and of this
solution is added to each well. The fluorescence intensity is
measured using a fluorescence plate reader (Wallac Victor 1420
Multilablel Counter; Perkin Elmer, Waltham, Mass.) The fluorescence
values of the reagent blank are subtracted from each of the samples
and the percentage of free modified RNA is determined by dividing
the fluorescence intensity of the intact sample by the fluorescence
value of the disrupted sample.
[1370] C. In Vitro Incubation
[1371] Human embryonic kidney epithelial (HEK293) and
hepatocellular carcinoma epithelial (HepG2) cells (LGC standards
GmbH, Wesel, Germany) are seeded on 96-well plates (Greiner Bio-one
GmbH, Frickenhausen, Germany) and plates for HEK293 cells are
precoated with collagen typel. HEK293 are seeded at a density of
about 30,000 and HepG2 are seeded at a density of about 35,000
cells per well in 100 .mu.l cell culture medium. Formulations
containing mCherry mRNA (mRNA sequence shown in SEQ ID NO: 251434;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) are added directly after seeding the cells and
incubated. The mCherry cDNA with the T7 promoter, 5' untranslated
region (UTR) and 3' UTR used in in vitro transcription (IVT) is
given in SEQ ID NO: 251435.
[1372] Cells are harvested by transferring the culture media
supernatants to a 96-well Pro-Bind U-bottom plate (Beckton
Dickinson GmbH, Heidelberg, Germany). Cells are trypsinized with
1/2 volume Trypsin/EDTA (Biochrom AG, Berlin, Germany), pooled with
respective supernatants and fixed by adding one volume PBS/2% FCS
(both Biochrom AG, Berlin, Germany)/0.5% formaldehyde (Merck,
Darmstadt, Germany). Samples are then submitted to a flow cytometer
measurement with an excitation laser and a filter for PE-Texas Red
in a LSRII cytometer (Beckton Dickinson GmbH, Heidelberg, Germany).
The mean fluorescence intensity (MFI) of all events and the
standard deviation of four independent wells are presented in for
samples analyzed.
[1373] D. In Vivo Formulation Studies
[1374] Mice are administered intravenously a single dose of a
formulation containing a modified mRNA and a reLNP. The modified
mRNA administered to the mice is selected from G-CSF (mRNA sequence
shown in SEQ ID NO: 251433; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1), Factor IX (mRNA
shown in SEQ ID NO: 251437; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1) or mCherry (mRNA
sequence shown in SEQ ID NO: 251434; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1).
[1375] The mice are injected with 100 ug, 10 ug or 1 ug of the
formulated modified mRNA and are sacrificed 8 hours after they are
administered the formulation. Serum from the mice administered
formulations containing human G-CSF modified mRNA are measured by
specific G-CSF ELISA and serum from mice administered human Factor
IX modified RNA is analyzed by specific factor IX ELISA or
chromogenic assay. The liver and spleen from the mice administered
with mCherry modified mRNA are analyzed by immunohistochemistry
(IHC) or fluorescence-activated cell sorting (FACS). As a control,
a group of mice are not injected with any formulation and their
serum and tissue are collected analyzed by ELISA, FACS and/or
IHC.
Example 49
In Vitro Transfection of VEGF-A
[1376] Human vascular endothelial growth factor-isoform A (VEGF-A)
modified mRNA (mRNA sequence shown in SEQ ID NO: 251446; polyA tail
of approximately 160 nucleotides not shown in sequence; 5' cap,
Cap1) was transfected via reverse transfection in Human
Keratinocyte cells in 24 multi-well plates. Human Keratinocytes
cells were grown in EPILIFE.RTM. medium with Supplement S7 from
Invitrogen (Carlsbad, Calif.) until they reached a confluence of
50-70%. The cells were transfected with 0, 46.875, 93.75, 187.5,
375, 750, and 1500 ng of modified mRNA (mmRNA) encoding VEGF-A
which had been complexed with RNAIMAX.TM. from Invitrogen
(Carlsbad, Calif.). The RNA:RNAIMAX.TM. complex was formed by first
incubating the RNA with Supplement-free EPILIFE.RTM. media in a
5.times. volumetric dilution for 10 minutes at room temperature. In
a second vial, RNAIMAX.TM. reagent was incubated with
Supplement-free EPILIFE.RTM. Media in a 10.times. volumetric
dilution for 10 minutes at room temperature. The RNA vial was then
mixed with the RNAIMAX.TM. vial and incubated for 20-30 minutes at
room temperature before being added to the cells in a drop-wise
fashion.
[1377] The fully optimized mRNA encoding VEGF-A (mRNA sequence
shown in SEQ ID NO: 251446; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1) transfected with
the Human Keratinocyte cells included modifications during
translation such as natural nucleoside triphosphates (NTP),
pseudouridine at each uridine site and 5-methylcytosine at each
cytosine site (pseudo-U/5mC), and N1-methyl-pseudouridine at each
uridine site and 5-methylcytosine at each cytosine site
(N1-methyl-Pseudo-U/5mC). Cells were transfected with the mmRNA
encoding VEGF-A and secreted VEGF-A concentration (.rho.g/ml) in
the culture medium was measured at 6, 12, 24, and 48 hours
post-transfection for each of the concentrations using an ELISA kit
from Invitrogen (Carlsbad, Calif.) following the manufacturers
recommended instructions. These data, shown in Table 70 and FIGS.
6A, 6B and 6C, show that modified mRNA encoding VEGF-A is capable
of being translated in Human Keratinocyte cells and that VEGF-A is
transported out of the cells and released into the extracellular
environment.
TABLE-US-00070 TABLE 70 VEGF-A Dosing and Protein Secretion 6 hours
12 hours 24 hours 48 hours Dose (ng) (pg/ml) (pg/ml) (pg/ml)
(pg/ml) VEGF-A Dose Containing Natural NTPs 46.875 10.37 18.07
33.90 67.02 93.75 9.79 20.54 41.95 65.75 187.5 14.07 24.56 45.25
64.39 375 19.16 37.53 53.61 88.28 750 21.51 38.90 51.44 61.79 1500
36.11 61.90 76.70 86.54 VEGF-A Dose Containing Pseudo-U/5mC 46.875
10.13 16.67 33.99 72.88 93.75 11.00 20.00 46.47 145.61 187.5 16.04
34.07 83.00 120.77 375 69.15 188.10 448.50 392.44 750 133.95 304.30
524.02 526.58 1500 198.96 345.65 426.97 505.41 VEGF-A Dose
Containing N1-methyl-Pseudo-U/5mC 46.875 0.03 6.02 27.65 100.42
93.75 12.37 46.38 121.23 167.56 187.5 104.55 365.71 1025.41 1056.91
375 605.89 1201.23 1653.63 1889.23 750 445.41 1036.45 1522.86
1954.81 1500 261.61 714.68 1053.12 1513.39
Example 50
In Vivo Studies of Factor IX
[1378] Human Factor IX mmRNA (Genl; fully modified 5-methycytosine
and pseudouridine) formulated in formulation buffer was delivered
to mice via intramuscular injection. The results demonstrate that
Factor 1.times. protein was elevated in serum as measured 13 hours
after administration.
[1379] In this study, mice (N=5 for Factor IX, N=3 for Luciferase
or Buffer controls) were intramuscularly injected with 50 .mu.l of
the Factor IX mmRNA (mRNA sequence shown in SEQ ID NO: 251437;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1), Luciferase (IVT cDNA sequence shown in SEQ ID NO:
251442; mRNA sequence shown in SEQ ID NO: 251443, polyA tail of
approximately 160 nucleotides not shown in sequence, 5' cap, Cap1,
fully modified with 5-methylcytosine at each cytosine and
pseudouridine replacement at each uridine site) or the formulation
buffer (F. Buffer) at 2.times.100 ug/mouse. The mice were bled at
13 hours after the intramuscular injection to determine the
concentration of human the polypeptide in serum in pg/mL. The
results revealed that administration of Factor IX mmRNA resulted in
levels of 1600 pg/mL at 13 hours as compared to less than 100 pg/mL
of Factor IX for either Luciferase or buffer control
administration.
Example 51
Multi-Site Administration: Intramuscular and Subcutaneous
[1380] Human G-CSF modified mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) modified as either Genl or Gen2
(5-methylcytosine (5mc) and a pseudouridine (.psi.) modification,
G-CSF-Gen1; or N1-5-methylcytosine (N-1-5mc) and a .psi.
modification, G-CSF-Gen2) and formulated in formulation buffer were
delivered to mice via intramuscular (IM) or subcutaneous (SC)
injection. Injection of four doses or 2.times.50 ug (two sites)
daily for three days (24 hrs interval) was performed. The fourth
dose was administered 6 hrs before blood collection and CBC
analysis. Controls included Luciferase (IVT cDNA sequence shown in
SEQ ID NO: 251442; mRNA sequence shown in SEQ ID NO: 251443, polyA
tail of approximately 160 nucleotides not shown in sequence, 5'
cap, Cap1, fully modified with 5-methylcytosine at each cytosine
and pseudouridine replacement at each uridine site) or the
formulation buffer (F. Buffer). The mice were bled at 72 hours
after the first mRNA injection (6 hours after the last modified
mRNA dose) to determine the effect of mRNA-encoded human G-CSF on
the neutrophil count. The dosing regimen is shown in Table 71 as
are the resulting neutrophil counts (thousands/uL). In Table 71, an
asterisk (*) indicates statistical significance at p<0.05.
[1381] For intramuscular administration, the data reveal a four
fold increase in neutrophil count above control at day 3 for the
Genl G-CSF mRNA and a two fold increase for the Gen2 G-CSF mmRNA.
For subcutaneous administration, the data reveal a two fold
increase in neutrophil count above control at day 3 for the Gen2
G-CSF mRNA.
[1382] These data demonstrate that both
5-methylcytidine/pseudouridine and
5-methylcytidine/Nl-methyl-pseudouridine-modified mRNA can be
biologically active, as evidenced by specific increases in blood
neutrophil counts.
TABLE-US-00071 TABLE 71 Dosing Regimen Dose Vol. Dosing Neutrophil
Gr. Treatment Route N= Dose (.mu.g/mouse) (.mu.l/mouse) Vehicle
Thous/uL 1 G-CSF (Gen1) I.M 5 2 .times. 50 ug (four doses) 50 F.
buffer 840* 2 G-CSF (Gen1) S.C 5 2 .times. 50 ug (four doses) 50 F.
buffer 430 3 G-CSF (Gen2) I.M 5 2 .times. 50 ug (four doses) 50 F.
buffer 746* 4 G-CSF (Gen2) S.C 5 2 .times. 50 ug (four doses) 50 F.
buffer 683 5 Luc (Gen1) I.M. 5 2 .times. 50 ug (four doses) 50 F.
buffer 201 6 Luc (Gen1) S.C. 5 2 .times. 50 ug (four doses) 50 F.
buffer 307 7 Luc (Gen2) I.M 5 2 .times. 50 ug (four doses) 50 F.
buffer 336 8 Luc (Gen2) S.C 5 2 .times. 50 ug (four doses) 50 F.
buffer 357 9 F. Buffer I.M 4 0 (four doses) 50 F. buffer 245 10 F.
Buffer S.C. 4 0 (four doses) 50 F. buffer 509 11 Untreated -- 4 --
312
Example 52
Intravenous Administration
[1383] Human G-CSF modified mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) modified with 5-methylcytosine (5mc) and a
pseudouridine (.psi.) modification (Gen 1); or having no
modifications and formulated in 10% lipoplex (RNAiMax) were
delivered to mice at a dose of 50 ug RNA and in a volume of 100 ul
via intravenous (IV) injection at days 0, 2 and 4. Neutrophils were
measured at days 1, 5 and 8. Controls included non-specific
mammalian RNA or the formulation buffer alone (F. Buffer). The mice
were bled at days 1, 5 and 8 to determine the effect of modified
mRNA-encoded human G-CSF to increase neutrophil count. The dosing
regimen is shown in Table 72 as are the resulting neutrophil counts
(thousands/uL; K/uL).
[1384] For intravenous administration, the data reveal a four to
five fold increase in neutrophil count above control at day 5 with
G-CSF modified mRNA but not with unmodified G-CSF mRNA or
non-specific controls. Blood count returned to baseline four days
after the final injection. No other changes in leukocyte
populations were observed.
[1385] In Table 72, an asterisk (*) indicates statistical
significance at p<0.001 compared to buffer.
[1386] These data demonstrate that lipoplex-formulated
5-methylcytidine/pseudouridine-modified mRNA can be biologically
active, when delivered through an I.V. route of administration as
evidenced by specific increases in blood neutrophil counts. No
other cell subsets were significantly altered. Unmodified G-CSF
mRNA similarly administered showed no pharmacologic effect on
neutrophil counts.
TABLE-US-00072 TABLE 72 Dosing Regimen Dose Vol. Dosing Neutrophil
Gr. Day Treatment N= (.mu.l/mouse) Vehicle K/uL 1 1 G-CSF (Gen1) 5
100 10% lipoplex 2.91 2 5 G-CSF (Gen1) 5 100 10% lipoplex 5.32* 3 8
G-CSF (Gen1) 5 100 10% lipoplex 2.06 4 1 G-CSF (no 5 100 10%
lipoplex 1.88 modification) 5 5 G-CSF (no 5 100 10% lipoplex 1.95
modification) 6 8 G-CSF (no 5 100 10% lipoplex 2.09 modification) 7
1 RNA control 5 100 10% lipoplex 2.90 8 5 RNA control 5 100 10%
lipoplex 1.68 9 8 RNA control 4 100 10% lipoplex 1.72 10 1 F.
Buffer 4 100 10% lipoplex 2.51 11 5 F. Buffer 4 100 10% lipoplex
1.31 12 8 F. Buffer 4 100 10% lipoplex 1.92
Example 53
Saline Formulation: Intramuscular Administration
[1387] A. Protein Expression
[1388] Human G-CSF modified mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) and human EPO mmRNA (mRNA sequence shown in
SEQ ID NO: 251436; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1); G-CSF modified mRNA (modified
with 5-methylcytosine (5mc) and pseudouridine (.psi.)) and EPO
modified mRNA (modified with N.sup.1-5-methylcytosine (N-1-5mc) and
.psi. modification), were formulated in formulation buffer (150 mM
sodium chloride, 2 mM calcium chloride, 2 mM phosphate, 0.5 mM EDTA
at a pH of 6.5) and delivered to mice via intramuscular (IM)
injection at a dose of 100 ug.
[1389] Controls included Luciferase (IVT cDNA sequence shown in SEQ
ID NO: 251442; mRNA sequence shown in SEQ ID NO: 251443, polyA tail
of approximately 160 nucleotides not shown in sequence, 5' cap,
Cap1, fully modified with 5-methylcytosine at each cytosine and
pseudouridine replacement at each uridine site) or the formulation
buffer (F. Buffer). The mice were bled at 13 hours after the
injection to determine the concentration of the human polypeptide
in serum in pg/mL. (G-CSF groups measured human G-CSF in mouse
serum and EPO groups measured human EPO in mouse serum). The data
are shown in Table 73.
TABLE-US-00073 TABLE 73 Dosing Regimen Average Protein Product Dose
Vol. Dosing pg/mL, Group Treatment N = (.mu.l/mouse) Vehicle serum
G-CSF G-CSF 5 50 Saline 19.8 G-CSF Luciferase 5 50 Saline 0.5 G-CSF
F. buffer 5 50 F. buffer 0.5 EPO EPO 5 50 Saline 191.5 EPO
Luciferase 5 50 Saline 15.0 EPO F. buffer F. buffer 4.8
[1390] B. Dose Response
[1391] Human EPO modified mRNA (mRNA sequence shown in SEQ ID NO:
251436; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) were formulated in formulation buffer and delivered
to mice via intramuscular (IM) injection.
[1392] Controls included Luciferase (mRNA sequence shown in SEQ ID
NO: 251443, polyA tail of approximately 160 nucleotides not shown
in sequence, 5' cap, Cap1, fully modified with 5-methylcytosine and
pseudouridine) or the formulation buffer (F. Buffer). The mice were
bled at 13 hours after the injection to determine the concentration
of the human polypeptide in serum in pg/mL. The dose and expression
are shown in Table 74.
TABLE-US-00074 TABLE 74 Dosing Regimen and Expression Average
Protein Dose Product Vol. pg/mL, Treatment (.mu.l/mouse) serum EPO
100 96.2 EPO 50 63.5 EPO 25 18.7 EPO 10 25.9 EPO 1 2.6 Luciferase
100 0.0 F. buffer 100 1.0
Example 54
EPO Muti-Dose/Multi-Administration
[1393] Studies utilizing multiple intramuscular injection sites at
one time point were designed and performed.
[1394] The design of a single multi-dose experiment involved using
human erythropoietin (EPO) mmRNA (mRNA sequence shown in SEQ ID NO:
251436; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) or G-CSF mmRNA (mRNA sequence shown in SEQ
ID NO: 251433; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1) administered in formulation
buffer. The dosing vehicle (F. buffer) was used as a control. The
EPO and G-CSF modified mRNA were modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine
site.
[1395] Animals (n=5), Sprague-Dawley rats, were injected IM
(intramuscular) for the single unit dose of 100 ug (delivered to
one thigh). For multi-dosing 6 doses of 100 ug (delivered to two
thighs) were used for both EPO and G-CSF mmRNA. Control dosing
involved use of buffer at a single dose. Human EPO blood levels
were evaluated 13 hrs post injection.
[1396] Human EPO protein was measured in rat serum 13 hrs post
intramuscular injection. Five groups of rats were treated and
evaluated. The results are shown in Table 75.
TABLE-US-00075 TABLE 75 Multi-dose study Avg. Pg/mL human Dose of
Total EPO, Group Treatment mmRNA Dose serum 1 Human EPO mmRNA 1
.times. 100 ug 100 ug 143 2 Human EPO mmRNA 6 .times. 100 ug 600 ug
256 3 G-CSF mmRNA 1 .times. 100 ug 100 ug 43 4 G-CSF mmRNA 6
.times. 100 ug 600 ug 58 5 Buffer Alone -- -- 20
Example 55
Signal Sequence Exchange Study
[1397] Several variants of mmRNAs encoding human Granulocyte colony
stimulating factor (G-CSF) (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) were synthesized using modified nucleotides
pseudouridine and 5-methylcytosine (pseudo-U/5mC). These variants
included the G-CSF constructs encoding either the wild-type N
terminal secretory signal peptide sequence
(MAGPATQSPMKLMALQLLLWHSALWTVQEA; SEQ ID NO: 95), no secretory
signal peptide sequence, or secretory signal peptide sequences
taken from other mRNAs. These included sequences where the wild
type G-CSF signal peptide sequence was replaced with the signal
peptide sequence of either: human .alpha.-1-anti trypsin (AAT)
(MMPSSVSWGILLLAGLCCLVPVSLA; SEQ ID NO: 94), human Factor IX (FIX)
(MQRVNMIMAESPSLITICLLGYLLSAECTVFLDHENANKILNRPKR; SEQ ID NO: 96),
human Prolactin (Prolac) (MKGSLLLLLVSNLLLCQSVAP; SEQ ID NO: 97), or
human Albumin (Alb) (MKWVTFISLLFLFSSAYSRGVFRR; SEQ ID NO: 98).
[1398] 250 ng of modified mRNA encoding each G-CSF variant was
transfected into HEK293A (293A in the table), mouse myoblast (MM in
the table) (C2C12, CRL-1772, ATCC) and rat myoblast (RM in the
table) (L6 line, CRL-1458, ATCC) cell lines in a 24 well plate
using 1 ul of Lipofectamine 2000 (Life Technologies), each well
containing 300,000 cells. The supernatants were harvested after 24
hrs and the secreted G-CSF protein was analyzed by ELISA using the
Human G-CSF ELISA kit (Life Technologies). The data shown in Table
76 reveal that cells transfected with G-CSF mmRNA encoding the
Albumin signal peptide secrete at least 12 fold more G-CSF protein
than its wild type counterpart.
TABLE-US-00076 TABLE 76 Signal Peptide Exchange 293A MM RM Signal
peptides (pg/ml) (pg/ml) (pg/ml) G-CSF Natural 9650 3450 6050
.alpha.-1-anti trypsin 9950 5000 8475 Factor IX 11675 6175 11675
Prolactin 7875 1525 9800 Albumin 122050 81050 173300 No Signal
peptide 0 0 0
Example 56
Cytokine Study: PBMC
[1399] A. PBMC Isolation and Culture
[1400] 50 mL of human blood from two donors was received from
Research Blood Components (lots KP30928 and KP30931) in sodium
heparin tubes. For each donor, the blood was pooled and diluted to
70 mL with DPBS (SAFC Bioscience 59331C, lot 071M8408) and split
evenly between two 50 mL conical tubes. 10 mL of Ficoll Paque (GE
Healthcare 17-5442-03, lot 10074400) was gently dispensed below the
blood layer. The tubes were centrifuged at 2000 rpm for 30 minutes
with low acceleration and braking The tubes were removed and the
buffy coat PBMC layers were gently transferred to a fresh 50 mL
conical and washed with DPBS. The tubes were centrifuged at 1450
rpm for 10 minutes.
[1401] The supernatant was aspirated and the PBMC pellets were
resuspended and washed in 50 mL of DPBS. The tubes were centrifuged
at 1250 rpm for 10 minutes. This wash step was repeated, and the
PBMC pellets were resuspended in 19 mL of Optimem I (Gibco 11058,
lot 1072088) and counted. The cell suspensions were adjusted to a
concentration of 3.0.times.10 6 cells/mL live cells.
[1402] These cells were then plated on five 96 well tissue culture
treated round bottom plates (Costar 3799) per donor at 50 uL per
well. Within 30 minutes, transfection mixtures were added to each
well at a volume of 50 uL per well. After 4 hours post
transfection, the media was supplemented with 10 uL of Fetal Bovine
Serum (Gibco 10082, lot 1012368)
[1403] B. Transfection Preparation
[1404] mmRNA encoding human G-CSF (mRNA sequence shown in SEQ ID
NO: 251433; polyA tail of approximately 160 nucleotides not shown
in sequence; 5' cap, Cap1) (containing either (1) natural NTPs, (2)
100% substitution with 5-methyl cytidine and pseudouridine, or (3)
100% substitution with 5-methyl cytidine and
N1-methyl-pseudouridine; mmRNA encoding luciferase (IVT cDNA
sequence shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ ID
NO: 251443, polyA tail of approximately 160 nucleotides not shown
in sequence, 5' cap, Cap1, fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site)
(containing either (1) natural NTPs or (2) 100% substitution with
5-methyl cytidine and pseudouridine) and TLR agonist R848
(Invivogen tlrl-r848) were diluted to 38.4 ng/uL in a final volume
of 2500 uL Optimem I.
[1405] Separately, 432 uL of Lipofectamine 2000 (Invitrogen
11668-027, lot 1070962) was diluted with 13.1 mL Optimem I. In a 96
well plate nine aliquots of 135 uL of each mmRNA, positive control
(R-848) or negative control (Optimem I) was added to 135 uL of the
diluted Lipofectamine 2000. The plate containing the material to be
transfected was incubated for 20 minutes. The transfection mixtures
were then transferred to each of the human PBMC plates at 50 uL per
well. The plates were then incubated at 37 C. At 2, 4, 8, 20, and
44 hours each plate was removed from the incubator, and the
supernatants were frozen.
[1406] After the last plate was removed, the supernatants were
assayed using a human G-CSF ELISA kit (Invitrogen KHC2032) and
human IFN-alpha ELISA kit (Thermo Scientific 41105-2). Each
condition was done in duplicate.
[1407] C. Results
[1408] The ability of unmodified and modified mRNA (mmRNAs) to
produce the encoded protein was assessed (G-CSF production) over
time as was the ability of the mRNA to trigger innate immune
recognition as measured by interferon-alpha production. Use of in
vitro PBMC cultures is an accepted way to measure the
immunostimulatory potential of oligonucleotides (Robbins et al.,
Oligonucleotides 2009 19:89-102; herein incorporated by reference
in its entirety).
[1409] Results were interpolated against the standard curve of each
ELISA plate using a four parameter logistic curve fit. Shown in
Tables 77 and 78 are the average from 2 separate PBMC donors of the
G-CSF and IFN-alpha production over time as measured by specific
ELISA.
[1410] In the G-CSF ELISA, background signal from the Lipofectamine
2000 untreated condition was subtracted at each timepoint. The data
demonstrated specific production of human G-CSF protein by human
peripheral blood mononuclear is seen with G-CSF mRNA containing
natural NTPs, 100% substitution with 5-methyl cytidine and
pseudouridine, or 100% substitution with 5-methyl cytidine and
N1-methyl-pseudouridine. Production of G-CSF was significantly
increased through the use of modified mRNA relative to unmodified
mRNA, with the 5-methyl cytidine and N1-methyl-pseudouridine
containing G-CSF mmRNA showing the highest level of G-CSF
production. With regards to innate immune recognition, unmodified
mRNA resulted in substantial IFN-alpha production, while the
modified mRNA largely prevented interferon-alpha production. G-CSF
mRNA fully modified with 5-methyl cytidine and
N1-methyl-pseudouridine did not significantly increase cytokines
whereas G-CSF mRNA fully modified with 5-methyl cytidine and
pseudouridine induced IFN-alpha, TNF-alpha and IP10. Many other
cytokines were not affected by either modification.
TABLE-US-00077 TABLE 77 G-CSF Signal G-CSF signal - 2 Donor Average
pg/mL 2 Hr 4 Hr 8 Hr 20 Hr 44 Hr G-CSF (5mC/pseudouridine) 120.3
136.8 421.0 346.1 431.8 G-CSF (5mC/N1-methyl- 256.3 273.7 919.3
1603.3 1843.3 pseudouridine) G-CSF(Natural-no 63.5 92.6 129.6 258.3
242.4 modification) Luciferase 4.5 153.7 33.0 186.5 58.0
(5mC/pseudouridine)
TABLE-US-00078 TABLE 78 IFN-alpha signal IFN-alpha signal - 2 donor
average pg/mL 2 Hr 4 Hr 8 Hr 20 Hr 44 Hr G-CSF (5mC/pseudouridine)
21.1 2.9 3.7 22.7 4.3 G-CSF (5mC/N1-methyl- 0.5 0.4 3.0 2.3 2.1
pseudouridine) G-CSF(Natural) 0.0 2.1 23.3 74.9 119.7 Luciferase
(5mC/pseudouridine) 0.4 0.4 4.7 1.0 2.4 R-848 39.1 151.3 278.4
362.2 208.1 Lpf. 2000 control 0.8 17.2 16.5 0.7 3.1
Example 57
Chemical Modification Ranges of Modified mRNA
[1411] Modified nucleotides such as, but not limited to, the
chemical modifications 5-methylcytosine and pseudouridine have been
shown to lower the innate immune response and increase expression
of RNA in mammalian cells. Surprisingly, and not previously known,
the effects manifested by the chemical modifications can be
titrated when the amount of chemical modification is less than
100%. Previously, it was believed that full modification was
necessary and sufficient to elicit the beneficial effects of the
chemical modifications and that less than 100% modification of an
mRNA had little effect. However, it has now been shown that the
benefits of chemical modification can be derived using less than
complete modification and that the effects are target,
concentration and modification dependent.
[1412] A. Modified RNA Transfected in PBMC
[1413] 960 ng of G-CSF mRNA modified with 5-methylcytosine (5mC)
and pseudouridine (pseudoU) or unmodified G-CSF mRNA was
transfected with 0.8 uL of Lipofectamine 2000 into peripheral blood
mononuclear cells (PBMC) from three normal blood donors (D1, D2,
D3). The G-CSF mRNA (mRNA sequence shown in SEQ ID NO: 251433;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) was completely modified with 5mC and pseudoU (100%
modification), not modified with 5mC and pseudoU (0% modification)
or was partially modified with 5mC and pseudoU so the mRNA would
contain 50% modification, 25% modification, 10% modification, %5
modification, 1% modification or 0.1% modification. A control
sample of Luciferase (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified 5meC and pseudoU) was also analyzed
for G-CSF expression. For TNF-alpha and IFN-alpha control samples
of Lipofectamine-2000, LPS, R-848, Luciferase (mRNA sequence shown
in SEQ ID NO: 251443; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1; fully modified 5mC and
pseudo), and P(I)P(C) were also analyzed. The supernatant was
harvested and run by ELISA 22 hours after transfection to determine
the protein expression. The expression of G-CSF is shown in Table
79 and the expression of IFN-alpha and TNF-alpha is shown in Table
80. The expression of IFN-alpha and TNF-alpha may be a secondary
effect from the transfection of the G-CSF mRNA. Tables 79 and 80
show that the amount of chemical modification of G-CSF, IFN-alpha
and TNF-alpha is titratable when the mRNA is not fully modified and
the titratable trend is not the same for each target.
TABLE-US-00079 TABLE 79 G-CSF Expression G-CSF Expression (pg/ml)
D1 D2 D3 100% modification 270.3 151.6 162.2 50% modification 45.6
19.8 26.3 25% modification 23.6 10.8 8.9 10% modification 39.4 12.9
12.9 5% modification 70.9 26.8 26.3 1% modification 70.3 26.9 66.9
0.1% modification 67.5 25.2 28.7 Luciferase 14.5 3.1 10.0
TABLE-US-00080 TABLE 80 IFN-alpha and TNF-alpha Expression
IFN-alpha Expression TNF-alpha Expression (pg/ml) (pg/ml) D1 D2 D3
D1 D2 D3 100% modification 76.8 6.8 15.1 5.6 1.4 21.4 50%
modification 22.0 5.5 257.3 4.7 1.7 12.1 25% modification 64.1 14.9
549.7 3.9 0.7 10.1 10% modification 150.2 18.8 787.8 6.6 0.9 13.4
5% modification 143.9 41.3 1009.6 2.5 1.8 12.0 1% modification
189.1 40.5 375.2 9.1 1.2 25.7 0.1% modification 261.2 37.8 392.8
9.0 2. 13.7 0% modification 230.3 45.1 558.3 10.9 1.4 10.9 LF 200 0
0 1.5 45.8 2.8 53.6 LPS 0 0 1.0 114.5 70.0 227.0 R-848 39.5 11.9
183.5 389.3 256.6 410.6 Luciferase 9.1 0 3.9 4.5 2.7 13.6 P(I)P(C)
1498.1 216.8 238.8 61.2 4.4 69.1
[1414] B. Modified RNA Transfected in HEK293
[1415] Human embryonic kidney epithelial (HEK293) cells were seeded
on 96-well plates at a density of 30,000 cells per well in 100 ul
cell culture medium. 250 ng of modified G-CSF mRNA (mRNA sequence
shown in SEQ ID NO: 251433; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1) formulated with
RNAiMAX.TM. (Invitrogen, Carlsbad, Calif.) was added to a well. The
G-CSF was completely modified with 5mC and pseudoU (100%
modification), not modified with 5mC and pseudoU (0% modification)
or was partially modified with 5mC and pseudoU so the mRNA would
contain 75% modification, 50% modification or 25% modification.
Control samples (AK 5/2, mCherry mRNA (mRNA sequence shown in SEQ
ID NO: 251434; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified 5mC and pseudoU)
and untreated) were also analyzed. The half-life of G-CSF mRNA
fully modified with 5-methylcytosine and pseudouridine is
approximately 8-10 hours. The supernatants were harvested after 16
hours and the secreted G-CSF protein was analyzed by ELISA. Table
81 shows that the amount of chemical modification of G-CSF is
titratable when the mRNA is not fully modified.
TABLE-US-00081 TABLE 81 G-CSF Expression G-CSF Expression (ng/ml)
100% modification 118.4 75% modification 101.9 50% modification
105.7 25% modification 231.1 0% modification 270.9 AK 5/2 166.8
mCherry 0 Untreated 0
Example 58
In Vivo Delivery of Modified mRNA (mmRNA)
[1416] Modified RNA was delivered to C57/BL6 mice intramuscularly,
subcutaneously, or intravenously to evaluate the bio-distribution
of modified RNA using luciferase. A formulation buffer used with
all delivery methods contained 150 mM sodium chloride, 2 mM calcium
chloride, 2 mM Na+-phosphate which included 1.4 mM monobasic sodium
phosphate and 0.6 mM of dibasic sodium phosphate, and 0.5 mM
ethylenediaminetetraacetic acid (EDTA) was adjusted using sodium
hydroxide to reach a final pH of 6.5 before being filtered and
sterilized. A 1.times. concentration was used as the delivery
buffer. To create the lipoplexed solution delivered to the mice, in
one vial 50 .mu.g of RNA was equilibrated for 10 minutes at room
temperature in the delivery buffer and in a second vial 10 .mu.l
RNAiMAX.TM. was equilibrated for 10 minutes at room temperature in
the delivery buffer. After equilibrium, the vials were combined and
delivery buffer was added to reach a final volume of 100 .mu.l
which was then incubated for 20 minutes at room temperature.
Luciferin was administered by intraperitoneal injection (IP) at 150
mg/kg to each mouse prior to imaging during the plateau phase of
the luciferin exposure curve which was between 15 and 30 minutes.
To create luciferin, 1 g of D-luciferin potassium or sodium salt
was dissolved in 66.6 ml of distilled phosphate buffer solution
(DPBS), not containing Mg2+ or Ca2+, to make a 15 mg/ml solution.
The solution was gently mixed and passed through a 0.2 .mu.m
syringe filter, before being purged with nitrogen, aliquoted and
frozen at -80.degree. C. while being protected from light as much
as possible. The solution was thawed using a waterbath if luciferin
was not dissolved, gently mixed and kept on ice on the day of
dosing.
[1417] Whole body images were taken of each mouse 2, 8 and 24 hours
after dosing. Tissue images and serum was collected from each mouse
24 hours after dosing. Mice administered doses intravenously had
their liver, spleen, kidneys, lungs, heart, peri-renal adipose
tissue and thymus imaged. Mice administered doses intramuscularly
or subcutaneously had their liver, spleen, kidneys, lungs,
peri-renal adipose tissue, and muscle at the injection site. From
the whole body images the bioluminescence was measured in photon
per second for each route of administration and dosing regimen.
[1418] A. Intramuscular Administration
[1419] Mice were intramuscularly (I.M.) administered either
modified luciferase mRNA fully modified with 5-methylcytosine and
pseudouridine (Naked-Luc), lipoplexed modified luciferase mRNA
fully modified with 5-methylcytosine and pseudouridine
(Lipoplex-luc) (IVT cDNA sequence shown in SEQ ID NO: 251442; mRNA
sequence shown in SEQ ID NO: 251443, polyA tail of approximately
160 nucleotides not shown in sequence, 5' cap, Cap1, fully modified
with 5-methylcytosine at each cytosine and pseudouridine
replacement at each uridine site), lipoplexed modified granulocyte
colony-stimulating factor (G-CSF) mRNA (mRNA sequence shown in SEQ
ID NO: 251433; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine) (Lipoplex-Cytokine) or the
formation buffer at a single dose of 50 .mu.g of modified RNA in an
injection volume of 50 .mu.l for each formulation in the right hind
limb and a single dose of 5 .mu.g of modified RNA in an injection
volume of 50 .mu.l in the left hind limb. The bioluminescence
average for the luciferase expression signals for each group at 2,
8 and 24 hours after dosing are shown in Table 82. The
bioluminescence showed a positive signal at the injection site of
the 5 .mu.g and 50 .mu.g modified RNA formulations containing and
not containing lipoplex.
TABLE-US-00082 TABLE 82 In vivo Biophotoic Imaging (I.M. Injection
Route) Dose Bioluminescence (photon/sec) Formulation (ug) 2 hours 8
hours 24 hours Naked-Luc 5 224,000 683,000 927,000 Lipolplex-Luc 5
579,000 639,000 186,000 Lipoplex-G-CSF 5 64,600 85,600 75,100
Formulation Buffer 5 102,000 86,000 90,700 Naked-Luc 50 446,000
766,000 509,000 Lipolplex-Luc 50 374,000 501,000 332,000
Lipoplex-G-CSF 50 49,400 74,800 74,200 Formulation Buffer 50 59,300
69,200 63,600
[1420] B. Subcutaneous Administration
[1421] Mice were subcutaneously (S.C.) administered either modified
luciferase mRNA (Naked-Luc), lipoplexed modified luciferase mRNA
(Lipoplex-luc), lipoplexed modified G-CSF mRNA (Lipoplex-G-CSF) or
the formation buffer at a single dose of 50 .mu.g of modified mRNA
in an injection volume of 100 .mu.l for each formulation. The
bioluminescence average for the luciferase expression signals for
each group at 2, 8 and 24 hours after dosing are shown in Table 83.
The bioluminescence showed a positive signal at the injection site
of the 50 .mu.g modified mRNA formulations containing and not
containing lipoplex.
TABLE-US-00083 TABLE 83 In vivo Biophotoic Imaging (S.C. Injection
Route) Bioluminescence (photon/sec) Formulation 2 hours 8 hours 24
hours Naked-Luc 3,700,000 8,060,000 2,080,000 Lipolplex-Luc
3,960,000 1,700,000 1,290,000 Lipoplex-G-CSF 123,000 121,000
117,000 Formulation Buffer 116,000 127,000 123,000
[1422] C. Intravenous Administration
[1423] Mice were intravenously (I.V.) administered either modified
luciferase mRNA (Naked-Luc), lipoplexed modified luciferase mRNA
(Lipoplex-luc), lipoplexed modified G-CSF mRNA (Lipoplex-G-CSF) or
the formation buffer at a single dose of 50 .mu.g of modified mRNA
in an injection volume of 100 .mu.l for each formulation. The
bioluminescence average for the luciferase expression signal in the
spleen from each group at 2 hours after dosing is shown in Table
84. The bioluminescence showed a positive signal in the spleen of
the 50 .mu.g modified mRNA formulations containing lipoplex.
TABLE-US-00084 TABLE 84 In vivo Biophotoic Imaging (I.V. Injection
Route) Bioluminescence (photon/sec) Formulation of the Spleen
Naked-Luc 58,400 Lipolplex-Luc 65,000 Lipoplex-G-CSF 57,100
Formulation Buffer 58,300
Example 59
Buffer Formulation Studies
[1424] G-CSF modified mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with N1-pseudouridine and
5-methylcytosine) or Factor IX modified mRNA (mRNA sequence shown
in SEQ ID NO: 251437; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1; fully modified with
N1-pseudouridine and 5-methylcytosine) in a buffer solution is
administered intramuscularly to rats in an injection volume of 50
.mu.l (n=5) at a modified mRNA dose of 200 ug per rat as described
in Table 85. The modified mRNA is lyophilized in water for 1-2
days. It is then reconstituted in the buffers listed below to a
target concentration of 6 mg/ml. Concentration is determined by OD
260. Samples are diluted to 4 mg/ml in the appropriate buffer
before dosing.
[1425] To precipitate the modified mRNA, 3M sodium acetate, pH 5.5
and pure ethanol are added at 1/10.sup.th the total volume and 4
times the total volume of modified mRNA, respectively. The material
is placed at -80 C for a minimum of 1 hour. The material is then
centrifuged for 30 minutes at 4000 rpm, 4 C. The supernatant is
removed and the pellet is centrifuged and washed 3.times. with 75%
ethanol. Finally, the pellet is reconstituted with buffer to a
target concentration of 6 mg/ml. Concentration is determined by OD
260. Samples are diluted to 4 mg/ml in the appropriate buffer
before dosing. All samples are prepared by lyophilization unless
noted below.
TABLE-US-00085 TABLE 85 Buffer Dosing Groups Group Treatment Buffer
Dose (ug/rat) 1 G-CSF 0.9% Saline 200 Factor IX 0.9% Saline 200 2
G-CSF 0.9% Saline + 2 mM 200 Calcium Factor IX 0.9% Saline + 2 mM
200 Calcium 3 G-CSF Lactated Ringer's 200 Factor IX Lactated
Ringer's 200 4 G-CSF 5% Sucrose 200 Factor IX 5% Sucrose 200 5
G-CSF 5% Sucrose + 2 mM 200 Calcium Factor IX 5% Sucrose + 2 mM 200
Calcium 6 G-CSF 5% Mannitol 200 Factor IX 5% Mannitol 200 7 G-CSF
5% Mannitol + 2 mM 200 Calcium Factor IX 5% Mannitol + 2 mM 200
Calcium 8 G-CSF 0.9% saline (precipitation) 200 Factor IX 0.9%
saline (precipitation) 200
[1426] Serum samples are collected from the rats at various time
intervals and analyzed for G-CSF or Factor IX protein expression
using G-CSF or Factor IX ELISA.
Example 60
Multi-Dose Study
[1427] Sprague-Dawley rats (n=8) are injected intravenously eight
times (twice a week) over 28 days. The rats are injected with 0.5
mg/kg, 0.05 mg/kg, 0.005 mg/kg or 0.0005 mg/kg of human G-CSF
modified mRNA of luciferase modified mRNA formulated in a lipid
nanoparticle, 0.5 mg/kg of human G-CSF modified mRNA in saline, 0.2
mg/kg of the human G-CSF protein Neupogen or non-translatable human
G-CSF modified mRNA formulated in a lipid nanoparticle. Serum is
collected during pre-determined time intervals to evaluate G-CSF
protein expression (8, 24 and 72 hours after the first dose of the
week), complete blood count and white blood count (24 and 72 hours
after the first dose of the week) and clinical chemistry (24 and 72
hours after the first dose of the week). The rats are sacrificed at
day 29, 4 days after the final dosing, to determine the complete
blood count, white blood count, clinical chemistry, protein
expression and to evaluate the effect on the major organs by
histopathology and necropsy. Further, an antibody assay is
performed on the rats on day 29.
Example 61
LNP In Vivo Study
[1428] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 160 nucleotides not shown in
sequence, 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine was formulated as a lipid nanoparticle (LNP) using
the syringe pump method. The LNP was formulated at a 20:1 weight
ratio of total lipid to modified mRNA with a final lipid molar
ratio of 50:10:38.5:1.5 (DLin-KC2-DMA: DSPC: Cholesterol: PEG-DMG).
As shown in Table 86, the luciferase LNP formulation was
characterized by particle size, zeta potential, and
encapsulation.
TABLE-US-00086 TABLE 86 Luciferase Formulation Formulation
NPA-098-1 Modified mRNA Luciferase Mean size 135 nm PDI: 0.08 Zeta
at pH 7.4 -0.6 mV Encaps. 91% (RiboGr)
[1429] As outlined in Table 87, the luciferase LNP formulation was
administered to Balb-C mice (n=3) intramuscularly, intravenously
and subcutaneously and a luciferase modified RNA formulated in PBS
was administered to mice intravenously.
TABLE-US-00087 TABLE 87 Luciferase Formulations Injec- Concentra-
tion Amount of Formula- tion Volume modified Dose tion Vehicle
Route (mg/ml) (ul) RNA (ug) (mg/kg) Luc-LNP PBS IV 0.20 50 10 0.50
Luc-LNP PBS IM 0.20 50 10 0.50 Luc-LNP PBS SC 0.20 50 10 0.50
Luc-PBS PBS IV 0.20 50 10 0.50
[1430] The mice administered the luciferase LNP formulation
intravenously and intramuscularly were imaged at 2, 8, 24, 48, 120
and 192 hours and the mice administered the luciferase LNP
formulation subcutaneously were imaged at 2, 8, 24, 48 and 120
hours to determine the luciferase expression as shown in Table 88.
In Table 88, "NT" means not tested. Twenty minutes prior to
imaging, mice were injected intraperitoneally with a D-luciferin
solution at 150 mg/kg. Animals were then anesthetized and images
were acquired with an IVIS Lumina II imaging system (Perkin Elmer).
Bioluminescence was measured as total flux (photons/second) of the
entire mouse.
TABLE-US-00088 TABLE 88 Luciferase Expression Route of Average
Expression (photon/second) Form. Administration 2 hours 8 hours 24
hours 48 hours 120 hours 192 hours Luc-LNP IV 1.62E+08 3.00E+09
7.77E+08 4.98E+08 1.89E+08 6.08E+07 Luc-LNP IM 4.85E+07 4.92E+08
9.02E+07 3.17E+07 1.22E+07 2.38E+06 Luc-LNP SC 1.85E+07 9.79E+08
3.09E+08 4.94E+07 1.98E+06 NT Luc-PBS IV 3.61E+05 5.64E+05 3.19E+05
NT NT NT
[1431] One mouse administered the LNP formulation intravenously was
sacrificed at 8 hours to determine the luciferase expression in the
liver and spleen. Also, one mouse administered the LNP formulation
intramuscular was sacrificed at 8 hours to determine the luciferase
expression of the muscle around the injection site and in the liver
and spleen. As shown in Table 89, expression was seen in the both
the liver and spleen after intravenous and intramuscular
administration and in the muscle around the intramuscular injection
site.
TABLE-US-00089 TABLE 89 Luciferase Expression in Tissue Expression
(photon/second) Luciferase LNP: IV Administration Liver 7.984E+08
Spleen 3.951E+08 Luciferase LNP: IM Administration Muscle around
the 3.688E+07 injection site Liver 1.507E+08 Spleen 1.096E+07
Example 62
Cytokine Study: PBMC
[1432] A. PBMC Isolation and Culture
[1433] 50 mL of human blood from two donors was received from
Research Blood Components (lots KP30928 and KP30931) in sodium
heparin tubes. For each donor, the blood was pooled and diluted to
70 mL with DPBS (SAFC Bioscience 59331C, lot 071M8408) and split
evenly between two 50 mL conical tubes. 10 mL of Ficoll Paque (GE
Healthcare 17-5442-03, lot 10074400) was gently dispensed below the
blood layer. The tubes were centrifuged at 2000 rpm for 30 minutes
with low acceleration and braking The tubes were removed and the
buffy coat PBMC layers were gently transferred to a fresh 50 mL
conical and washed with DPBS. The tubes were centrifuged at 1450
rpm for 10 minutes.
[1434] The supernatant was aspirated and the PBMC pellets were
resuspended and washed in 50 mL of DPBS. The tubes were centrifuged
at 1250 rpm for 10 minutes. This wash step was repeated, and the
PBMC pellets were resuspended in 19 mL of Optimem I (Gibco 11058,
lot 1072088) and counted. The cell suspensions were adjusted to a
concentration of 3.0.times.10 6 cells/mL live cells.
[1435] These cells were then plated on five 96 well tissue culture
treated round bottom plates (Costar 3799) per donor at 50 uL per
well. Within 30 minutes, transfection mixtures were added to each
well at a volume of 50 uL per well. After 4 hours post
transfection, the media was supplemented with 10 uL of Fetal Bovine
Serum (Gibco 10082, lot 1012368).
[1436] B. Transfection Preparation
[1437] Modified mRNA encoding human G-CSF (mRNA sequence shown in
SEQ ID NO: 251433; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1) (containing either (1) natural
NTPs, (2) 100% substitution with 5-methyl cytidine and
pseudouridine, or (3) 100% substitution with 5-methyl cytidine and
N1-methyl-pseudouridine; mRNA encoding luciferase (IVT cDNA
sequence shown in SEQ ID NO: 251442; mRNA sequence shown in SEQ ID
NO: 251443, polyA tail of approximately 160 nucleotides not shown
in sequence, 5' cap, Cap1, fully modified with 5-methylcytosine at
each cytosine and pseudouridine replacement at each uridine site)
(containing either (1) natural NTPs or (2) 100% substitution with
5-methyl cytidine and pseudouridine) and TLR agonist R848
(Invivogen tlrl-r848) were diluted to 38.4 ng/uL in a final volume
of 2500 uL Optimem I.
[1438] Separately, 110 uL of Lipofectamine 2000 (Invitrogen
11668-027, lot 1070962) was diluted with 6.76 mL Optimem I. In a 96
well plate nine aliquots of 135 uL of each mRNA, positive control
(R-848) or negative control (Optimem I) was added to 135 uL of the
diluted Lipofectamine 2000. The plate containing the material to be
transfected was incubated for 20 minutes. The transfection mixtures
were then transferred to each of the human PBMC plates at 50 uL per
well. The plates were then incubated at 37.degree. C. At 2, 4, 8,
20, and 44 hours each plate was removed from the incubator, and the
supernatants were frozen.
[1439] After the last plate was removed, the supernatants were
assayed using a human G-CSF ELISA kit (Invitrogen KHC2032) and
human IFN-alpha ELISA kit (Thermo Scientific 41105-2). Each
condition was done in duplicate.
[1440] C. Protein and Innate Immune Response Analysis
[1441] The ability of unmodified and modified mRNA to produce the
encoded protein was assessed (G-CSF production) over time as was
the ability of the mRNA to trigger innate immune recognition as
measured by interferon-alpha production. Use of in vitro PBMC
cultures is an accepted way to measure the immunostimulatory
potential of oligonucleotides (Robbins et al., Oligonucleotides
2009 19:89-102).
[1442] Results were interpolated against the standard curve of each
ELISA plate using a four parameter logistic curve fit. Shown in
Tables 90 and 91 are the average from 3 separate PBMC donors of the
G-CSF, interferon-alpha (IFN-alpha) and tumor necrosis factor alpha
(TNF-alpha) production over time as measured by specific ELISA.
[1443] In the G-CSF ELISA, background signal from the Lipofectamine
2000 (LF2000) untreated condition was subtracted at each time
point. The data demonstrated specific production of human G-CSF
protein by human peripheral blood mononuclear is seen with G-CSF
mRNA containing natural NTPs, 100% substitution with 5-methyl
cytidine and pseudouridine, or 100% substitution with 5-methyl
cytidine and N1-methyl-pseudouridine. Production of G-CSF was
significantly increased through the use of 5-methyl cytidine and
N1-methyl-pseudouridine modified mRNA relative to 5-methyl cytidine
and pseudouridine modified mRNA.
[1444] With regards to innate immune recognition, while both
modified mRNA chemistries largely prevented IFN-alpha and TNF-alpha
production relative to positive controls (R848, p(I)p(C)),
significant differences did exist between the chemistries. 5-methyl
cytidine and pseudouridine modified mRNA resulted in low but
detectable levels of IFN-alpha and TNF-alpha production, while
5-methyl cytidine and N.sup.1-methyl-pseudouridine modified mRNA
resulted in no detectable IFN-alpha and TNF-alpha production.
[1445] Consequently, it has been determined that, in addition to
the need to review more than one cytokine marker of the activation
of the innate immune response, it has surprisingly been found that
combinations of modifications provide differing levels of cellular
response (protein production and immune activation). The
modification, N1-methyl-pseudouridine, in this study has been shown
to convey added protection over the standard combination of
5-methylcytidine/pseudouridine explored by others resulting in
twice as much protein and almost 150 fold reduction in immune
activation (TNF-alpha).
[1446] Given that PBMC contain a large array of innate immune RNA
recognition sensors and are also capable of protein translation, it
offers a useful system to test the interdependency of these two
pathways. It is known that mRNA translation can be negatively
affected by activation of such innate immune pathways (Kariko et
al. Immunity (2005) 23:165-175; Warren et al. Cell Stem Cell (2010)
7:618-630). Using PBMC as an in vitro assay system it is possible
to establish a correlation between translation (in this case G-CSF
protein production) and cytokine production (in this case
exemplified by IFN-alpha and TNF-alpha protein production). Better
protein production is correlated with lower induction of innate
immune activation pathway, and new chemistries can be judged
favorably based on this ratio (Table 92).
[1447] In this study, the PC Ratio for the two chemical
modifications, pseudouridine and N1-methyl-pseudouridine, both with
5-methy cytosine was 4742/141=34 as compared to 9944/1=9944 for the
cytokine IFN-alpha. For the cytokine, TNF-alpha, the two
chemistries had PC Ratios of 153 and 1243, respectively suggesting
that for either cytokine, the Nl-methyl-pseudouridine is the
superior modification. In Tables 90 and 91, "NT" means not
tested.
TABLE-US-00090 TABLE 90 G-CSF G-CSF: 3 Donor Average (pg/ml) G-CSF
4742 5-methylcytosine/ pseudouridine G-CSF 9944 5-methylcytosine/
N1-methyl-pseudouridine Luciferase 18 LF2000 16
TABLE-US-00091 TABLE 91 IFN-alpha and TNF-alpha IFN-alpha: 3
TNF-alpha: Donor Average 3 Donor (pg/ml) Average (pg/ml) G-CSF 141
31 5-methylcytosine/pseudouridine G-CSF 1 8 5-methylcytosine/
N1-methyl-pseudouridine P(I)P(C) 1104 NT R-848 NT 1477 LF2000 17
25
TABLE-US-00092 TABLE 92 G-CSF to Cytokine Ratios G-CSF/IFN-alpha
(ratio) G-CSF/TNF-alpha (ratio) 5-methyl- 5-methyl- 5- cytosine/ 5-
cytosine/ methylcytosine/ N1-methyl- methylcytosine/ N1-methyl-
pseudouridine pseudouridine pseudouridine pseudouridine PC 34 9944
153 1243 Ratio
Example 63
In Vitro PBMC Studies: Percent Modification
[1448] 480 ng of G-CSF mRNA modified with 5-methylcytosine (5mC)
and pseudouridine (pseudoU) or unmodified G-CSF mRNA was
transfected with 0.4 uL of Lipofectamine 2000 into peripheral blood
mononuclear cells (PBMC) from three normal blood donors (D1, D2,
and D3). The G-CSF mRNA (mRNA sequence shown in SEQ ID NO: 251433;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) was completely modified with 5mC and pseudoU (100%
modification), not modified with 5mC and pseudoU (0% modification)
or was partially modified with 5mC and pseudoU so the mRNA would
contain 75% modification, 50% modification or 25% modification. A
control sample of Luciferase (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified 5meC and pseudoU) was also
analyzed for G-CSF expression. For TNF-alpha and IFN-alpha control
samples of Lipofectamine-2000, LPS, R-848, Luciferase (mRNA
sequence shown in SEQ ID NO: 251443; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1; fully modified
5mC and pseudo), and P(I)P(C) were also analyzed. The supernatant
was harvested and run by ELISA 22 hours after transfection to
determine the protein expression. The expression of G-CSF is shown
in Table 93 and the expression of IFN-alpha and TNF-alpha is shown
in Table 94. The expression of IFN-alpha and TNF-alpha may be a
secondary effect from the transfection of the G-CSF mRNA. Tables 93
and 94 show that the amount of chemical modification of G-CSF,
interferon alpha (IFN-alpha) and tumor necrosis factor-alpha
(TNF-alpha) is titratable when the mRNA is not fully modified and
the titratable trend is not the same for each target.
[1449] By using PBMC as an in vitro assay system it is possible to
establish a correlation between translation (in this case G-CSF
protein production) and cytokine production (in this case
exemplified by IFN-alpha protein production). Better protein
production is correlated with lower induction of innate immune
activation pathway, and the percentage modification of a chemistry
can be judged favorably based on this ratio (Table 95). As
calculated from Tables 93 and 94 and shown in Table 95, full
modification with 5-methylcytidine and pseudouridine shows a much
better ratio of protein cytokine production than without any
modification (natural G-CSF mRNA) (100-fold for IFN-alpha and
27-fold for TNF-alpha). Partial modification shows a linear
relationship with increasingly less modification resulting in a
lower protein cytokine ratio.
TABLE-US-00093 TABLE 93 G-CSF Expression G-CSF Expression (pg/ml)
D1 D2 D3 100% modification 1968.9 2595.6 2835.7 75% modification
566.7 631.4 659.5 50% modification 188.9 187.2 191.9 25%
modification 139.3 126.9 102.0 0% modification 194.8 182.0 183.3
Luciferase 90.2 0.0 22.1
TABLE-US-00094 TABLE 94 IFN-alpha and TNF-alpha Expression
IFN-alpha Expression TNF-alpha Expression (pg/ml) (pg/ml) D1 D2 D3
D1 D2 D3 100% modification 336.5 78.0 46.4 115.0 15.0 11.1 75%
modification 339.6 107.6 160.9 107.4 21.7 11.8 50% modification
478.9 261.1 389.7 49.6 24.1 10.4 25% modification 564.3 400.4 670.7
85.6 26.6 19.8 0% modification 1421.6 810.5 1260.5 154.6 96.8 45.9
LPS 0.0 0.6 0.0 0.0 12.6 4.3 R-848 0.5 3.0 14.1 655.2 989.9 420.4
P(I)P(C) 130.8 297.1 585.2 765.8 2362.7 1874.4 Lipid only 1952.2
866.6 855.8 248.5 82.0 60.7
TABLE-US-00095 TABLE 95 PC Ratio and Effect of Percentage of
Modification Average Average Average G-CSF/IFN- G-CSF/TNF- % G-CSF
IFN-a TNF-a alpha alpha Modification (pg/ml) (pg/ml) (pg/ml) (PC
ratio) (PC ratio) 100 2466 153 47 16 52 75 619 202 47 3.1 13 50 189
376 28 0.5 6.8 25 122 545 44 0.2 2.8 0 186 1164 99 0.16 1.9
Example 64
Modified RNA Transfected in PBMC
[1450] 500 ng of G-CSF mRNA modified with 5-methylcytosine (5mC)
and pseudouridine (pseudoU) or unmodified G-CSF mRNA was
transfected with 0.4 uL of Lipofectamine 2000 into peripheral blood
mononuclear cells (PBMC) from three normal blood donors (D1, D2,
and D3). The G-CSF mRNA (mRNA sequence shown in SEQ ID NO: 251433;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) was completely modified with 5mC and pseudoU (100%
modification), not modified with 5mC and pseudoU (0% modification)
or was partially modified with 5mC and pseudoU so the mRNA would
contain 50% modification, 25% modification, 10% modification, %5
modification, 1% modification or 0.1% modification. A control
sample of mCherry (mRNA sequence shown in SEQ ID NO: 251434; polyA
tail of approximately 160 nucleotides not shown in sequence; 5'
cap, Cap1; fully modified 5meC and pseudouridine), G-CSF fully
modified with 5-methylcytosine and pseudouridine (Control G-CSF)
and an untreated control was also analyzed for expression of G-CSF,
tumor necrosis factor-alpha (TNF-alpha) and interferon-alpha
(IFN-alpha). The supernatant was harvested 6 hours and 18 hours
after transfection and run by ELISA to determine the protein
expression. The expression of G-CSF, IFN-alpha, and TNF-alpha for
Donor 1 is shown in Table 96, Donor 2 is shown in Table 97 and
Donor 3 is shown in Table 98.
[1451] Full 100% modification with 5-methylcytidine and
pseudouridine resulted in the most protein translation (G-CSF) and
the least amount of cytokine produced across all three human PBMC
donors. Decreasing amounts of modification results in more cytokine
production (IFN-alpha and TNF-alpha), thus further highlighting the
importance of fully modification to reduce cytokines and to improve
protein translation (as evidenced here by G-CSF production).
TABLE-US-00096 TABLE 96 Donor 1 G-CSF IFN-alpha TNF-alpha (pg/mL)
(pg/mL) (pg/mL) 6 18 6 18 6 18 hours hours hours hours hours hours
100% Mod 1815 2224 1 13 0 0 75% Mod 591 614 0 89 0 0 50% Mod 172
147 0 193 0 0 25% Mod 111 92 2 219 0 0 10% Mod 138 138 7 536 18 0
1% Mod 199 214 9 660 18 3 0.1% Mod 222 208 10 597 0 6 0% Mod 273
299 10 501 10 0 Control G-CSF 957 1274 3 123 18633 1620 mCherry 0 0
0 10 0 0 Untreated N/A N/A 0 0 1 1
TABLE-US-00097 TABLE 97 Donor 2 G-CSF IFN-alpha TNF-alpha (pg/mL)
(pg/mL) (pg/mL) 6 18 6 18 6 18 hours hours hours hours hours hours
100% Mod 2184 2432 0 7 0 11 75% Mod 935 958 3 130 0 0 50% Mod 192
253 2 625 7 23 25% Mod 153 158 7 464 6 6 10% Mod 203 223 25 700 22
39 1% Mod 288 275 27 962 51 66 0.1% Mod 318 288 33 635 28 5 0% Mod
389 413 26 748 1 253 Control G-CSF 1461 1634 1 59 481 814 mCherry 0
7 0 1 0 0 Untreated N/A N/A 1 0 0 0
TABLE-US-00098 TABLE 98 Donor 3 G-CSF IFN-alpha TNF-alpha (pg/mL)
(pg/mL) (pg/mL) 6 18 6 18 6 18 hours hours hours hours hours hours
100% Mod 6086 7549 7 658 11 11 75% Mod 2479 2378 23 752 4 35 50%
Mod 667 774 24 896 22 18 25% Mod 480 541 57 1557 43 115 10% Mod 838
956 159 2755 144 123 1% Mod 1108 1197 235 3415 88 270 0.1% Mod 1338
1177 191 2873 37 363 0% Mod 1463 1666 215 3793 74 429 Control G-CSF
3272 3603 16 1557 731 9066 mCherry 0 0 2 645 0 0 Untreated N/A N/A
1 1 0 8
Example 65
Innate Immune Response Study in BJ Fibroblasts
[1452] A. Single Transfection
[1453] Human primary foreskin fibroblasts (BJ fibroblasts) were
obtained from American Type Culture Collection (ATCC) (catalog
#CRL-2522) and grown in Eagle's Minimum Essential Medium (ATCC,
catalog #30-2003) supplemented with 10% fetal bovine serum at
37.degree. C., under 5% CO.sub.2. BJ fibroblasts were seeded on a
24-well plate at a density of 300,000 cells per well in 0.5 ml of
culture medium. 250 ng of modified G-CSF mRNA (mRNA sequence shown
in SEQ ID NO: 251433; polyA tail of approximately 140 nucleotides
not shown in sequence; 5' cap, Cap1) fully modified with
5-methylcytosine and pseudouridine (Genl) or fully modified with
5-methylcytosine and N1-methyl-pseudouridine (Gen2) having CapO,
Cap1or no cap was transfected using Lipofectamine 2000 (Invitrogen,
catalog #11668-019), following manufacturer's protocol. Control
samples of poly I:C (PIC), Lipofectamine 2000 (Lipo), natural
luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443; polyA
tail of approximately 160 nucleotides not shown in sequence; 5'
cap, Cap1) and natural G-CSF mRNA were also transfected. The cells
were harvested after 18 hours, the total RNA was isolated and
DNASE.RTM. treated using the RNeasy micro kit (catalog #74004)
following the manufacturer's protocol. 100 ng of total RNA was used
for cDNA synthesis using High Capacity cDNA Reverse Transcription
kit (catalog #4368814) following the manufacturer's protocol. The
cDNA was then analyzed for the expression of innate immune response
genes by quantitative real time PCR using SybrGreen in a Biorad CFX
384 instrument following manufacturer's protocol. Table 99 shows
the expression level of innate immune response transcripts relative
to house-keeping gene HPRT (hypoxanthine phosphoribosytransferase)
and is expressed as fold-induction relative to HPRT. In the table,
the panel of standard metrics includes: RIG-I is retinoic acid
inducible gene 1, IL6 is interleukin-6, OAS-1 is oligoadenylate
synthetase 1, IFNb is interferon-beta, AIM2 is absent in
melanoma-2, IFIT-1 is interferon-induced protein with
tetratricopeptide repeats 1, PKR is protein kinase R, TNFa is tumor
necrosis factor alpha and IFNa is interferon alpha.
TABLE-US-00099 TABLE 99 Innate Immune Response Transcript Levels
Formulation RIG-I IL6 OAS-1 IFNb AIM2 IFIT-1 PKR TNFa IFNa Natural
71.5 20.6 20.778 11.404 0.251 151.218 16.001 0.526 0.067 Luciferase
Natural G-CSF 73.3 47.1 19.359 13.615 0.264 142.011 11.667 1.185
0.153 PIC 30.0 2.8 8.628 1.523 0.100 71.914 10.326 0.264 0.063
G-CSF Gen1-UC 0.81 0.22 0.080 0.009 0.008 2.220 1.592 0.090 0.027
G-CSF Gen1-Cap0 0.54 0.26 0.042 0.005 0.008 1.314 1.568 0.088 0.038
G-CSF Gen1-Cap1 0.58 0.30 0.035 0.007 0.006 1.510 1.371 0.090 0.040
G-CSF Gen2-UC 0.21 0.20 0.002 0.007 0.007 0.603 0.969 0.129 0.005
G-CSF Gen2-Cap0 0.23 0.21 0.002 0.0014 0.007 0.648 1.547 0.121
0.035 G-CSF Gen2-Cap1 0.27 0.26 0.011 0.004 0.005 0.678 1.557 0.099
0.037 Lipo 0.27 0.53 0.001 0 0.007 0.954 1.536 0.158 0.064
[1454] B. Repeat Transfection
[1455] Human primary foreskin fibroblasts (BJ fibroblasts) were
obtained from American Type Culture Collection (ATCC) (catalog
#CRL-2522) and grown in Eagle's Minimum Essential Medium (ATCC,
catalog #30-2003) supplemented with 10% fetal bovine serum at
37.degree. C., under 5% CO.sub.2. BJ fibroblasts were seeded on a
24-well plate at a density of 300,000 cells per well in 0.5 ml of
culture medium. 250 ng of modified G-CSF mRNA (mRNA sequence shown
in SEQ ID NO: 251433; polyA tail of approximately 140 nucleotides
not shown in sequence; 5' cap, Cap1) unmodified, fully modified
with 5-methylcytosine and pseudouridine (Genl) or fully modified
with 5-methylcytosine and Nl-methyl-pseudouridine (Gen2) was
transfected daily for 5 days following manufacturer's protocol.
Control samples of Lipofectamine 2000 (L2000) and mCherry mRNA
(mRNA sequence shown in SEQ ID NO: 251434; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytidine and pseudouridine) were also
transfected daily for 5 days. The results are shown in Table
100.
[1456] Unmodified mRNA showed a cytokine response in
interferon-beta (IFN-beta) and interleukin-6 (IL-6) after one day.
mRNA modified with at least pseudouridine showed a cytokine
response after 2-3 days whereas mRNA modified with 5-methylcytosine
and N1-methyl-pseudouridine showed a reduced response after 3-5
days.
TABLE-US-00100 TABLE 100 Cytokine Response Formulation Transfection
IFN-beta (pg/ml) IL-6 (pg/ml) G-CSF unmodified 6 hours 0 3596 Day 1
1363 15207 Day 2 238 12415 Day 3 225 5017 Day 4 363 4267 Day 5 225
3094 G-CSF Gen 1 6 hours 0 3396 Day 1 38 3870 Day 2 1125 16341 Day
3 100 25983 Day 4 75 18922 Day 5 213 15928 G-CSF Gen 2 6 hours 0
3337 Day 1 0 3733 Day 2 150 974 Day 3 213 4972 Day 4 1400 4122 Day
5 350 2906 mCherry 6 hours 0 3278 Day 1 238 3893 Day 2 113 1833 Day
3 413 25539 Day 4 413 29233 Day 5 213 20178 L2000 6 hours 0 3270
Day 1 13 3933 Day 2 388 567 Day 3 338 1517 Day 4 475 1594 Day 5 263
1561
Example 66
In Vivo Detection of Innate Immune Response
[1457] In an effort to distringuish the importance of different
chemical modification of mRNA on in vivo protein production and
cytokine response in vivo, female BALB/C mice (n=5) are injected
intramuscularly with G-CSF mRNA (G-CSF mRNA unmod) (mRNA sequence
shown in SEQ ID NO: 251433; polyA tail of approximately 160
nucleotides not shown in sequence;) with a 5' cap of Cap1, G-CSF
mRNA fully modified with 5-methylcytosine and pseudouridine (G-CSF
mRNA 5mc/pU), G-CSF mRNA fully modified with 5-methylcytosine and
N.sup.1-methyl-pseudouridine with (G-CSF mRNA 5mc/N1pU) or without
a 5' cap (G-CSF mRNA 5mc/N1 pU no cap) or a control of either R848
or 5% sucrose as described in Table 101.
TABLE-US-00101 TABLE 101 Dosing Chart Formulation Route Dose
(ug/mouse) Dose (ul) G-CSF mRNA I.M. 200 50 unmod G-CSF mRNA I.M.
200 50 5mc/pU G-CSF mRNA I.M. 200 50 5mc/N1pU G-CSF mRNA I.M. 200
50 5mc/N1pU no cap R848 I.M. 75 50 5% sucrose I.M. -- 50 Untreated
I.M. -- --
[1458] Blood is collected at 8 hours after dosing. Using ELISA the
protein levels of G-CSF, TNF-alpha and IFN-alpha is determined by
ELISA. 8 hours after dosing, muscle is collected from the injection
site and quantitative real time polymerase chain reaction (QPCR) is
used to determine the mRNA levels of RIG-I, PKR, AIM-2, IFIT-1,
OAS-2, MDA-5, IFN-beta, TNF-alpha, IL-6, G-CSF, CD45 in the
muscle.
Example 67
In Vivo Detection of Innate Immune Response Study
[1459] Female BALB/C mice (n=5) were injected intramuscularly with
G-CSF mRNA (G-CSF mRNA unmod) (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence;) with a 5' cap of Cap1, G-CSF mRNA fully modified with
5-methylcytosine and pseudouridine (G-CSF mRNA 5mc/pU), G-CSF mRNA
fully modified with 5-methylcytosine and N1-methyl-pseudouridine
with (G-CSF mRNA 5mc/N1pU) or without a 5' cap (G-CSF mRNA 5mc/N1
pU no cap) or a control of either R848 or 5% sucrose as described
in Table 102. Blood is collected at 8 hours after dosing and using
ELISA the protein levels of G-CSF and interferon-alpha (IFN-alpha)
is determined by ELISA and are shown in Table 102.
[1460] As shown in Table 102, unmodified, 5mc/pU, and 5mc/N1pU
modified G-CSF mRNA resulted in human G-CSF expression in mouse
serum. The uncapped 5mC/N1pU modified G-CSF mRNA showed no human
G-CSF expression in serum, highlighting the importance of having a
5' cap structure for protein translation.
[1461] As expected, no human G-CSF protein was expressed in the
R848, 5% sucrose only, and untreated groups. Importantly,
significant differences were seen in cytokine production as
measured by mouse IFN-alpha in the serum. As expected, unmodified
G-CSF mRNA demonstrated a robust cytokine response in vivo (greater
than the R848 positive control). The 5mc/pU modified G-CSF mRNA did
show a low but detectable cytokine response in vivo, while the
5mc/N1pU modified mRNA showed no detectable IFN-alpha in the serum
(and same as vehicle or untreated animals).
[1462] Also, the response of 5mc/N1pU modified mRNA was the same
regardless of whether it was capped or not. These in vivo results
reinforce the conclusion that 1) that unmodified mRNA produce a
robust innate immune response, 2) that this is reduced, but not
abolished, through 100% incorporation of 5mc/pU modification, and
3) that incorporation of 5mc/N1pU modifications results in no
detectable cytokine response.
[1463] Lastly, given that these injections are in 5% sucrose (which
has no effect by itself), these result should accurately reflect
the immunostimulatory potential of these modifications.
[1464] From the data it is evident that N1pU modified molecules
produce more protein while concomitantly having little or no effect
on IFN-alpha expression. It is also evident that capping is
required for protein production for this chemical modification. The
Protein Cytokine Ratio of 748 as compared to the PC Ratio for the
unmodified mRNA (PC=9) means that this chemical modification is far
superior as related to the effects or biological implications
associated with IFN-alpha.
TABLE-US-00102 TABLE 102 Human G-CSF and Mouse IFN-alpha in serum
G-CSF IFN-alpha Dose Dose protein expression PC Formulation Route
(ug/mouse) (ul) (pg/ml) (pg/ml) Ratio GCSF mRNA unmod I.M. 200 50
605.6 67.01 9 GCSF mRNA 5mc/pU I.M. 200 50 356.5 8.87 40 GCSF
mRNA5mc/N1pU I.M. 200 50 748.1 0 748 GCSF mRNA5mc/N1pU no cap I.M.
200 50 6.5 0 6.5 R848 I.M. 75 50 3.4 40.97 .08 5% sucrose I.M. --
50 0 1.49 0 Untreated I.M. -- -- 0 0 0
Example 68
In Vivo Delivery of Modified RNA
[1465] Protein production of modified mRNA was evaluated by
delivering modified G-CSF mRNA or modified Factor IX mRNA to female
Sprague Dawley rats (n=6). Rats were injected with 400 ug in 100 ul
of G-CSF mRNA (mRNA sequence shown in SEQ ID NO: 251433; polyA tail
of approximately 160 nucleotides not shown in sequence; 5' cap,
Cap1) fully modified with 5-methylcytosine and pseudouridine (G-CSF
Genl), G-CSF mRNA fully modified with 5-methylcytosine and
N1-methyl-pseudouridine (G-CSF Gen2) or Factor IX mRNA (mRNA
sequence shown in SEQ ID NO: 251437; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and pseudouridine (Factor IX Genl)
reconstituted from the lyophilized form in 5% sucrose. Blood was
collected 8 hours after injection and the G-CSF protein level in
serum was measured by ELISA. Table 103 shows the G-CSF protein
levels in serum after 8 hours.
[1466] These results demonstrate that both G-CSF Gen 1 and G-CSF
Gen 2 modified mRNA can produce human G-CSF protein in a rat
following a single intramuscular injection, and that human G-CSF
protein production is improved when using Gen 2 chemistry over Gen
1 chemistry.
TABLE-US-00103 TABLE 103 G-CSF Protein in Rat Serum (I.M. Injection
Route) Formulation G-CSF protein (pg/ml) G-CSF Gen1 19.37 G-CSF
Gen2 64.72 Factor IX Gen 1 2.25
Example 69
Chemical Modification: In Vitro Studies
[1467] A. In Vitro Screening in PBMC
[1468] 500 ng of G-CSF (mRNA sequence shown in SEQ ID NO: 251433;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) mRNA fully modified with the chemical modification
outlined Tables 104 and 105 was transfected with 0.4 uL
Lipofectamine 2000 into peripheral blood mononuclear cells (PBMC)
from three normal blood donors. Control samples of LPS, R848,
P(I)P(C) and mCherry (mRNA sequence shown in SEQ ID NO: 251434;
polyA tail of approximately 160 nucleotides not shown in sequence,
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) were also analyzed. The supernatant was harvested
and stored frozen until analyzed by ELISA to determine the G-CSF
protein expression, and the induction of the cytokines
interferon-alpha (IFN-.alpha.) and tumor necrosis factor alpha
(TNF-.alpha.). The protein expression of G-CSF is shown in Table
104, the expression of IFN-.alpha. and TNF-.alpha. is shown in
Table 105.
[1469] The data in Table 104 demonstrates that many, but not all,
chemical modifications can be used to productively produce human
G-CSF in PBMC. Of note, 100% N1-methyl-pseudouridine substitution
demonstrates the highest level of human G-CSF production (almost
10-fold higher than pseudouridine itself). When
N.sup.1-methyl-pseudouridine is used in combination with
5-methylcytidine a high level of human G-CSF protein is also
produced (this is also higher than when pseudouridine is used in
combination with 5 methylcytidine).
[1470] Given the inverse relationship between protein production
and cytokine production in PBMC, a similar trend is also seen in
Table 105, where 100% substitution with Nl-methyl-pseudouridine
results no cytokine induction (similar to transfection only
controls) and pseudouridine shows detectable cytokine induction
which is above background.
[1471] Other modifications such as N6-methyladenosine and
alpha-thiocytidine appear to increase cytokine stimulation.
TABLE-US-00104 TABLE 104 Chemical Modifications and G-CSF Protein
Expression G-CSF Protein Expression (pg/ml) Donor Donor Donor
Chemical Modifications 1 2 3 Pseudouridine 2477 1,909 1,498
5-methyluridine 318 359 345 N1-methyl-pseudouridine 21,495 16,550
12,441 2-thiouridine 932 1,000 600 4-thiouridine 5 391 218
5-methoxyuridine 2,964 1,832 1,800 5-methylcytosine and
pseudouridine (1.sup.st set) 2,632 1,955 1,373 5-methylcytosine and
N1-methyl- 10,232 7,245 6,214 pseudouridine (1.sup.st set)
2'Fluoroguanosine 59 186 177 2'Fluorouridine 118 209 191
5-methylcytosine and pseudouridine (2.sup.nd set) 1,682 1,382 1,036
5-methylcytosine and N1-methyl- 9,564 8,509 7,141 pseudouridine
(2.sup.nd set) 5-bromouridine 314 482 291
5-(2-carbomethoxyvinyl)uridine 77 286 177
5-[3(1-E-propenylamino)uridine 541 491 550 .alpha.-thiocytidine 105
264 245 5-methylcytosine and pseudouridine (3.sup.rd set) 1,595
1,432 955 N1-methyladenosine 182 177 191 N6-methyladenosine 100 168
200 5-methylcytidine 291 277 359 N4-acetylcytidine 50 136 36
5-formylcytidine 18 205 23 5-methylcytosine and pseudouridine
(4.sup.th set) 264 350 182 5-methylcytosine and N1-methyl- 9,505
6,927 5,405 pseudouridine (4.sup.th set) LPS 1,209 786 636 mCherry
5 168 164 R848 709 732 636 P(I)P(C) 5 186 182
TABLE-US-00105 TABLE 105 Chemical Modifications and Cytokine
Expression Chemical IFN-.alpha. Expression (pg/ml) TNF-.alpha.
Expression (pg/ml) Modifications Donor 1 Donor 2 Donor 3 Donor 1
Donor 2 Donor 3 Pseudouridine 120 77 171 36 81 126 5-methyluridine
245 135 334 94 100 157 N1-methyl- 26 75 138 101 106 134
pseudouridine 2-thiouridine 100 108 154 133 133 141 4-thiouridine
463 258 659 169 126 254 5-methoxyuridine 0 64 133 39 74 111
5-methylcytosine 88 94 148 64 89 121 and pseudouridine (1.sup.st
set) 5-methylcytosine 0 60 136 54 79 126 and N1-methyl-
pseudouridine (1.sup.st set) 2'Fluoroguanosine 107 97 194 91 94 141
2'Fluorouridine 158 103 178 164 121 156 5-methylcytosine 133 92 167
99 111 150 and pseudouridine (2.sup.nd set) 5-methylcytosine 0 66
140 54 97 149 and N1-methyl- pseudouridine (2.sup.nd set)
5-bromouridine 95 86 181 87 106 157 5-(2- 0 61 130 40 81 116
carbomethoxyvinyl) uridine 5-[3(1-E- 0 58 132 71 90 119
propenylamino)uridine .alpha.-thiocytidine 1,138 565 695 300 273
277 5-methylcytosine 88 75 150 84 89 130 and pseudouridine
(3.sup.rd set) N1-methyladenosine 322 255 377 256 157 294
N6-methyladenosine 1,935 1,065 1,492 1,080 630 857 5-methylcytidine
643 359 529 176 136 193 N4-acetylcytidine 789 593 431 263 67 207
5-formylcytidine 180 93 88 136 30 40 5-methylcytosine 131 28 18 53
24 29 and pseudouridine (4.sup.th set) 5-methylcytosine 0 0 0 36 14
13 and N1-methyl- pseudouridine (4.sup.th set) LPS 0 67 146 7,004
3,974 4,020 mCherry 100 75 143 67 100 133 R848 674 619 562 11,179
8,546 9,907 P(I)P(C) 470 117 362 249 177 197
[1472] B. In Vitro Screening in HeLa Cells
[1473] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas,
VA) were harvested by treatment with Trypsin-EDTA solution
(LifeTechnologies, Grand
[1474] Island, N.Y.) and seeded in a total volume of 100 ul EMEM
medium (supplemented with 10% FCS and 1.times. Glutamax) per well
in a 96-well cell culture plate (Corning, Manassas, Va.). The cells
were grown at 37oG in 5% CO.sub.2 atmosphere overnight. Next day,
83 ng of Luciferase modified RNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) with the chemical modification described in
Table 106, were diluted in 10 ul final volume of OPTI-MEM
(LifeTechnologies, Grand Island, N.Y.).
[1475] Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.)
was used as transfection reagent and 0.2 ul were diluted in 10 ul
final volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minute at room temperature. Then the 20 ul combined
solution was added to the 100 ul cell culture medium containing the
HeLa cells and incubated at room temperature.
[1476] After 18 to 22 hours of incubation cells expressing
luciferase were lysed with 100 ul of Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The lysate
volumes were adjusted or diluted until no more than 2 mio relative
light units (RLU) per well were detected for the strongest signal
producing samples and the RLUs for each chemistry tested are shown
in Table 106. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.). The background signal of the plates without reagent
was about 200 relative light units per well.
[1477] These results demonstrate that many, but not all, chemical
modifications can be used to productively produce human G-CSF in
HeLa cells. Of note, 100% N1-methyl-pseudouridine substitution
demonstrates the highest level of human G-CSF production.
TABLE-US-00106 TABLE 106 Relative Light Units of Luciferase
Chemical Modification RLU N6-methyladenosine (m6a) 534
5-methylcytidine (m5c) 138,428 N4-acetylcytidine (ac4c) 235,412
5-formylcytidine (f5c) 436 5-methylcytosine/pseudouridine, test A1
48,659 5-methylcytosine/N1-methyl-pseudouridine, test A1 190,924
Pseudouridine 655,632 1-methylpseudouridine (m1u) 1,517,998
2-thiouridine (s2u) 3387 5-methoxyuridine (mo5u) 253,719
5-methylcytosine/pseudouridine, test B1 317,744
5-methylcytosine/N1-methyl-pseudouridine, test B1 265,871
5-Bromo-uridine 43,276 5 (2 carbovinyl) uridine 531 5 (3-1E
propenyl Amino) uridine 446 5-methylcytosine/pseudouridine, test A2
295,824 5-methylcytosine/N1-methyl-pseudouridine, test A2 233,921
5-methyluridine 50,932 .alpha.-Thio-cytidine 26,358
5-methylcytosine/pseudouridine, test B2 481,477
5-methylcytosine/N1-methyl-pseudouridine, test B2 271,989
5-methylcytosine/pseudouridine, test A3 438,831
5-methylcytosine/N1-methyl-pseudouridine, test A3 277,499
Unmodified Luciferase 234,802
[1478] C. In Vitro Screening in Rabbit Reticulocyte Lysates
[1479] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) was modified with the chemical modification listed in
Table 107 and were diluted in sterile nuclease-free water to a
final amount of 250 ng in 10 ul. The diluted luciferase was added
to 40 ul of freshly prepared Rabbit Reticulocyte Lysate and the in
vitro translation reaction was done in a standard 1.5 mL
polypropylene reaction tube (Thermo Fisher Scientific, Waltham,
Mass.) at 30.degree. C. in a dry heating block. The translation
assay was done with the Rabbit Reticulocyte Lysate
(nuclease-treated) kit (Promega, Madison, Wis.) according to the
manufacturer's instructions. The reaction buffer was supplemented
with a one-to-one blend of provided amino acid stock solutions
devoid of either Leucine or Methionine resulting in a reaction mix
containing sufficient amounts of both amino acids to allow
effective in vitro translation.
[1480] After 60 minutes of incubation, the reaction was stopped by
placing the reaction tubes on ice. Aliquots of the in vitro
translation reaction containing luciferase modified RNA were
transferred to white opaque polystyrene 96-well plates (Corning,
Manassas, Va.) and combined with 100 ul complete luciferase assay
solution (Promega, Madison, Wis.). The volumes of the in vitro
translation reactions were adjusted or diluted until no more than 2
mio relative light units (RLUs) per well were detected for the
strongest signal producing samples and the RLUs for each chemistry
tested are shown in Table 107. The plate reader was a BioTek
Synergy H1 (BioTek, Winooski, Vt.). The background signal of the
plates without reagent was about 200 relative light units per
well.
[1481] These cell-free translation results very nicely correlate
with the protein production results in HeLa, with the same
modifications generally working or not working in both systems. One
notable exception is 5-formylcytidine modified luciferase mRNA
which worked in the cell-free translation system, but not in the
HeLa cell-based transfection system. A similar difference between
the two assays was also seen with 5-formylcytidine modified G-CSF
mRNA.
TABLE-US-00107 TABLE 107 Relative Light Units of Luciferase
Chemical Modification RLU N6-methyladenosine (m6a) 398
5-methylcytidine (m5c) 152,989 N4-acetylcytidine (ac4c) 60,879
5-formylcytidine (f5c) 55,208 5-methylcytosine/pseudouridine, test
A1 349,398 5-methylcytosine/N1-methyl-pseudouridine, test A1
205,465 Pseudouridine 587,795 1-methylpseudouridine (m1u) 589,758
2-thiouridine (s2u) 708 5-methoxyuridine (mo5u) 288,647
5-methylcytosine/pseudouridine, test B1 454,662
5-methylcytosine/N1-methyl-pseudouridine, test B1 223,732
5-Bromo-uridine 221,879 5 (2 carbovinyl) uridine 225 5 (3-1E
propenyl Amino) uridine 211 5-methylcytosine/pseudouridine, test A2
558,779 5-methylcytosine/N1-methyl-pseudouridine, test A2 333,082
5-methyluridine 214,680 .alpha.-Thio-cytidine 123,878
5-methylcytosine/pseudouridine, test B2 487,805
5-methylcytosine/N1-methyl-pseudouridine, test B2 154,096
5-methylcytosine/pseudouridine, test A3 413,535
5-methylcytosine/N1-methyl-pseudouridine, test A3 292,954
Unmodified Luciferase 225,986
Example 70
Chemical Modification: In Vivo Studies
[1482] A. In vivo Screening of G-CSF Modified mRNA
[1483] Balb-C mice (n=4) are intramuscularly injected in each leg
with modified G-CSF mRNA (mRNA sequence shown in SEQ ID NO: 251433;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1), fully modified with the chemical modifications
outlined in Table 108, is formulated in 1.times.PBS. A control of
luciferase modified mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with pseudouridine and
5-methylcytosine) and a control of PBS are also tested. After 8
hours serum is collected to determine G-CSF protein levels cytokine
levels by ELISA.
TABLE-US-00108 TABLE 108 G-CSF mRNA Chemical Modifications G-CSF
Pseudouridine G-CSF 5-methyluridine G-CSF 2-thiouridine G-CSF
4-thiouridine G-CSF 5-methoxyuridine G-CSF 2'-fluorouridine G-CSF
5-bromouridine G-CSF 5-[3(1-E-propenylamino)uridine) G-CSF
alpha-thio-cytidine G-CSF 5-methylcytidine G-CSF N4-acetylcytidine
G-CSF Pseudouridine and 5-methylcytosine G-CSF
N1-methyl-pseudouridine and 5-methylcytosine Luciferase
Pseudouridine and 5-methylcytosine PBS None
[1484] B. In vivo Screening of Luciferase Modified mRNA
[1485] Balb-C mice (n=4) were subcutaneously injected with 200 ul
containing 42 to 103 ug of modified luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1), fully modified
with the chemical modifications outlined in Table 109, was
formulated in 1.times.PBS. A control of PBS was also tested. The
dosages of the modified luciferase mRNA is also outlined in Table
109. 8 hours after dosing the mice were imaged to determine
luciferase expression. Twenty minutes prior to imaging, mice were
injected intraperitoneally with a D-luciferin solution at 150
mg/kg. Animals were then anesthetized and images were acquired with
an IVIS Lumina II imaging system (Perkin Elmer). Bioluminescence
was measured as total flux (photons/second) of the entire
mouse.
[1486] As demonstrated in Table 109, all luciferase mRNA modified
chemistries demonstrated in vivo activity, with the exception of
2'-fluorouridine. In addition 1-methylpseudouridine modified mRNA
demonstrated very high expression of luciferase (5-fold greater
expression than pseudouridine containing mRNA).
TABLE-US-00109 TABLE 109 Luciferase Screening Dose Dose Luciferase
Chemical (ug) of volume expression mRNA Modifications mRNA (ml)
(photon/second) Luciferase 5-methylcytidine 83 0.72 1.94E+07
Luciferase N4-acetylcytidine 76 0.72 1.11E07 Luciferase
Pseudouridine 95 1.20 1.36E+07 Luciferase 1- 103 0.72 7.40E+07
methylpseudouridine Luciferase 5-methoxyuridine 95 1.22 3.32+07
Luciferase 5-methyluridine 94 0.86 7.42E+06 Luciferase
5-bromouridine 89 1.49 3.75E+07 Luciferase 2'-fluoroguanosine 42
0.72 5.88E+05 Luciferase 2'-fluorocytidine 47 0.72 4.21E+05
Luciferase 2'-flurorouridine 59 0.72 3.47E+05 PBS None -- 0.72
3.16E+05
Example 71
In Vivo Screening of Combination Luciferase Modified mRNA
[1487] Balb-C mice (n=4) were subcutaneously injected with 200 ul
of 100 ug of modified luciferase mRNA (mRNA sequence shown in SEQ
ID NO: 251443; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1), fully modified with the chemical
modifications outlined in Table 110, was formulated in 1.times.PBS.
A control of PBS was also tested. 8 hours after dosing the mice
were imaged to determine luciferase expression. Twenty minutes
prior to imaging, mice were injected intraperitoneally with a
D-luciferin solution at 150 mg/kg. Animals were then anesthetized
and images were acquired with an IVIS Lumina II imaging system
(Perkin Elmer). Bioluminescence was measured as total flux
(photons/second) of the entire mouse.
[1488] As demonstrated in Table 110, all luciferase mRNA modified
chemistries (in combination) demonstrated in vivo activity. In
addition the presence of N1-methyl-pseudouridine in the modified
mRNA (with N4-acetylcytidine or 5 methylcytidine) demonstrated
higher expression than when the same combinations where tested
using with pseudouridine. Taken together, these data demonstrate
that N1-methyl-pseudouridine containing luciferase mRNA results in
improved protein expression in vivo whether used alone (Table 109)
or when used in combination with other modified nulceotides (Table
110).
TABLE-US-00110 TABLE 110 Luciferase Screening Combinations
Luciferase expression (photon/ mRNA Chemical Modifications second)
Luciferase N4-acetylcytidine/pseudouridine 4.18E+06 Luciferase
N4-acetylcytidine/N1-methyl-pseudouridine 2.88E+07 Luciferase
5-methylcytidine/5-methoxyuridine 3.48E+07 Luciferase
5-methylcytidine/5-methyluridine 1.44E+07 Luciferase
5-methylcytidine/where 50% of the uridine 2.39E+06 is replaced with
2-thiouridine Luciferase 5-methylcytidine/pseudouridine 2.36E+07
Luciferase 5-methylcytidine/N1-methyl-pseudouridine 4.15E+07 PBS
None 3.59E+05
Example 72
Innate Immune Response in BJ Fibroblasts
[1489] Human primary foreskin fibroblasts (BJ fibroblasts) are
obtained from American Type Culture Collection (ATCC) (catalog
#CRL-2522) and grown in Eagle's Minimum Essential Medium (ATCC, cat
#30-2003) supplemented with 10% fetal bovine serum at 37.degree.
C., under 5% CO.sub.2. BJ fibroblasts are seeded on a 24-well plate
at a density of 130,000 cells per well in 0.5 ml of culture medium.
250 ng of modified G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 5-methylcytosine and
pseudouridine (Genl) or fully modified with 5-methylcytosine and
Nl-methyl-pseudouridine (Gen2) is transfected using Lipofectamine
2000 (Invitrogen, cat #11668-019), following manufacturer's
protocol. Control samples of Lipofectamine 2000 and unmodified
G-CSF mRNA (natural G-CSF) are also transfected. The cells are
transfected for five consecutive days. The transfection complexes
are removed four hours after each round of transfection.
[1490] The culture supernatant is assayed for secreted G-CSF
(R&D Systems, catalog #DCS50), tumor necrosis factor-alpha
(TNF-alpha) and interferon alpha (IFN-alpha by ELISA every day
after transfection following manufacturer's protocols. The cells
are analyzed for viability using CELL TITER GLO.RTM. (Promega,
catalog #G7570) 6 hrs and 18 hrs after the first round of
transfection and every alternate day following that. At the same
time from the harvested cells, total RNA is isolated and treated
with DNASE.RTM. using the RNAEASY micro kit (catalog #74004)
following the manufacturer's protocol. 100 ng of total RNA is used
for cDNA synthesis using the High Capacity cDNA Reverse
Transcription kit (Applied Biosystems, cat #4368814) following the
manufacturer's protocol. The cDNA is then analyzed for the
expression of innate immune response genes by quantitative real
time PCR using SybrGreen in a Biorad CFX 384 instrument following
the manufacturer's protocol.
Example 73
In Vitro Transcription with Wild-Type T7 Polymerase
[1491] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) and G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) were fully modified with different
chemistries and chemistry combinations listed in Tables 111-114
using wild-type T7 polymerase as previously described.
[1492] The yield of the translation reactions was determined by
spectrophometric measurement (OD.sub.260) and the yield for
Luciferase is shown in Table 111 and G-CSF is shown in Table
113.
[1493] The luciferase and G-CSF modified mRNA were also subjected
to an enzymatic capping reaction and each modified mRNA capping
reaction was evaluated for yield by spectrophometic measurement
(OD.sub.260) and correct size assessed using bioanalyzer. The yield
from the capping reaction for luciferase is shown in Table 112 and
G-CSF is shown in Table 114.
TABLE-US-00111 TABLE 111 In vitro transcription chemistry for
Luciferase Chemical Modification Yield (mg) N6-methyladenosine 0.99
5-methylcytidine 1.29 N4-acetylcytidine 1.0 5-formylcytidine 0.55
Pseudouridine 2.0 N1-methyl-pseudouridine 1.43 2-thiouridine 1.56
5-methoxyuridine 2.35 5-methyluridine 1.01 .alpha.-Thio-cytidine
0.83 5-Br-uridine (5Bru) 1.96 5 (2 carbomethoxyvinyl) uridine 0.89
5 (3-1E propenyl Amino) uridine 2.01
N4-acetylcytidine/pseudouridine 1.34
N4-acetylcytidine/N1-methyl-pseudouridine 1.26
5-methylcytidine/5-methoxyuridine 1.38
5-methylcytidine/5-bromouridine 0.12 5-methylcytidine/5-methy
luridine 2.97 5-methylcytidine/half of the uridines 1.59 are
modified with 2-thiouridine 5-methylcytidine/2-thiouridine 0.90
5-methylcytidine/pseudouridine 1.83
5-methylcytidine/N1-methyl-pseudouridine 1.33
TABLE-US-00112 TABLE 112 Capping chemistry and yield for Luciferase
modified mRNA Chemical Modification Yield (mg) 5-methylcytidine
1.02 N4-acetylcytidine 0.93 5-formylcytidine 0.55 Pseudouridine
2.07 N1-methyl-pseudouridine 1.27 2-thiouridine 1.44
5-methoxyuridine 2 5-methyluridine 0.8 .alpha.-Thio-cytidine 0.74
5-Br-uridine (5Bru) 1.29 5 (2 carbomethoxyvinyl) uridine 0.54 5
(3-1E propenyl Amino) uridine 1.39 N4-acetylcytidine/pseudouridine
0.99 N4-acetylcytidine/N1-methyl-pseudouridine 1.08
5-methylcytidine/5-methoxyuridine 1.13
5-methylcytidine/5-methyluridine 1.08 5-methylcytidine/half of the
uridines 1.2 are modified with 2-thiouridine
5-methylcytidine/2-thiouridine 1.27 5-methylcytidine/pseudouridine
1.19 5-methylcytidine/N1-methyl-pseudouridine 1.04
TABLE-US-00113 TABLE 113 In vitro transcription chemistry and yield
for G-CSF modified mRNA Chemical Modification Yield (mg)
N6-methyladenosine 1.57 5-methylcytidine 2.05 N4-acetylcytidine
3.13 5-formylcytidine 1.41 Pseudouridine 4.1
N1-methyl-pseudouridine 3.24 2-thiouridine 3.46 5-methoxyuridine
2.57 5-methyluridine 4.27 4-thiouridine 1.45 2'-F-uridine 0.96
.alpha.-Thio-cytidine 2.29 2'-F-guanosine 0.6 N-1-methyladenosine
0.63 5-Br-uridine (5Bru) 1.08 5 (2 carbomethoxyvinyl) uridine 1.8 5
(3-1E propenyl Amino) uridine 2.09 N4-acetylcytidine/pseudouridine
1.72 N4-acetylcytidine/N1-methyl-pseudouridine 1.37
5-methylcytidine/5-methoxyuridine 1.85
5-methylcytidine/5-methyluridine 1.56 5-methylcytidine/half of the
uridines 1.84 are modified with 2-thiouridine
5-methylcytidine/2-thiouridine 2.53 5-methylcytidine/pseudouridine
0.63 N4-acetylcytidine/2-thiouridine 1.3
N4-acetylcytidine/5-bromouridine 1.37
5-methylcytidine/N1-methyl-pseudouridine 1.25
N4-acetylcytidine/pseudouridine 2.24
TABLE-US-00114 TABLE 114 Capping chemistry and yield for G-CSF
modified mRNA Chemical Modification Yield (mg) N6-methyladenosine
1.04 5-methylcytidine 1.08 N4-acetylcytidine 2.73 5-formylcytidine
0.95 Pseudouridine 3.88 N1-methyl-pseudouridine 2.58 2-thiouridine
2.57 5-methoxyuridine 2.05 5-methyluridine 3.56 4-thiouridine 0.91
2'-F-uridine 0.54 .alpha.-Thio-cytidine 1.79 2'-F-guanosine 0.14
5-Br-uridine (5Bru) 0.79 5 (2 carbomethoxyvinyl) uridine 1.28 5
(3-1E propenyl Amino) uridine 1.78 N4-acetylcytidine/pseudouridine
0.29 N4-acetylcytidine/N1-methyl-pseudouridine 0.33
5-methylcytidine/5-methoxyuridine 0.91
5-methylcytidine/5-methyluridine 0.61 5-methylcytidine/half of the
uridines are modified with 1.24 2-thiouridine
5-methylcytidine/pseudouridine 1.08 N4-acetylcytidine/2-thiouridine
1.34 N4-acetylcytidine/5-bromouridine 1.22
5-methylcytidine/N1-methyl-pseudouridine 1.56
Example 74
In vitro Transcription with mutant T7 polymerase
[1494] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) and G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) were fully modified with different
chemistries and chemistry combinations listed in Tables 115-118
using a mutant T7 polymerase (Durascribe.RTM. T7 Transcription kit
(Cat. No. DS010925) (Epicentre.RTM., Madison, Wis.).
[1495] The yield of the translation reactions was determined by
spectrophometric measurement (OD.sub.260) and the yield for
Luciferase is shown in Tables 115 and G-CSF is shown in Tables
117.
[1496] The luciferase and G-CSF modified mRNA were also subjected
to an enzymatic capping reaction and each modified mRNA capping
reaction was evaluated for yield by spectrophometic measurement
(OD260) and correct size assessed using bioanalyzer. The yield from
the capping reaction for luciferase is shown in Table 116 and G-CSF
is shown in Table 118.
TABLE-US-00115 TABLE 115 In vitro transcription chemistry and yield
for Luciferase modified mRNA Chemical Modification Yield (ug)
2'Fluorocytosine 71.4 2'Fluorouridine 57.5
5-methylcytosine/pseudouridine, test A 26.4
5-methylcytosine/N1-methyl-pseudouridine, test A 73.3
N1-acetylcytidine/2-fluorouridine 202.2
5-methylcytidine/2-fluorouridine 131.9
2-fluorocytosine/pseudouridine 119.3
2-fluorocytosine/N1-methyl-pseudouridine 107.0
2-fluorocytosine/2-thiouridine 34.7 2-fluorocytosine/5-bromouridine
81.0 2-fluorocytosine/2-fluorouridine 80.4
2-fluoroguanine/5-methylcytosine 61.2
2-fluoroguanine/5-methylcytosine/pseudouridine 65.0
2-fluoroguanine/5-methylcytidine/N1-methyl-pseudouridine 41.2
2-fluoroguanine/pseudouridine 79.1
2-fluoroguanine/N1-methyl-pseudouridine 74.6
5-methylcytidine/pseudouridine, test B 91.8
5-methylcytidine/N1-methyl-pseudouridine, test B 72.4
2'fluoroadenosine 190.98
TABLE-US-00116 TABLE 116 Capping chemistry and yield for Luciferase
modified mRNA Chemical Modification Yield (ug) 2'Fluorocytosine
19.2 2'Fluorouridine 16.7 5-methylcytosine/pseudouridine, test A
7.0 5-methylcytosine/N1-methyl-pseudouridine, test A 21.5
N1-acetylcytidine/2-fluorouridine 47.5
5-methylcytidine/2-fluorouridine 53.2
2-fluorocytosine/pseudouridine 58.4
2-fluorocytosine/N1-methyl-pseudouridine 26.2
2-fluorocytosine/2-thiouridine 12.9 2-fluorocytosine/5-bromouridine
26.5 2-fluorocytosine/2-fluorouridine 35.7
2-fluoroguanine/5-methylcytosine 24.7
2-fluoroguanine/5-methylcytosine/pseudouridine 32.3
2-fluoroguanine/5-methylcytidine/N1-methyl-pseudouridine 31.3
2-fluoroguanine/pseudouridine 20.9
2-fluoroguanine/N1-methyl-pseudouridine 29.8
5-methylcytidine/pseudouridine, test B 58.2
5-methylcytidine/N1-methyl-pseudouridine, test B 44.4
TABLE-US-00117 TABLE 117 In vitro transcription chemistry and yield
for G-CSF modified mRNA Chemical Modification Yield (ug)
2'Fluorocytosine 56.5 2'Fluorouridine 79.4
5-methylcytosine/pseudouridine, test A 21.2
5-methylcytosine/N1-methyl-pseudouridine, test A 77.1
N1-acetylcytidine/2-fluorouridine 168.6
5-methylcytidine/2-fluorouridine 134.7
2-fluorocytosine/pseudouridine 97.8
2-fluorocytosine/N1-methyl-pseudouridine 103.1
2-fluorocytosine/2-thiouridine 58.8 2-fluorocytosine/5-bromouridine
88.8 2-fluorocytosine/2-fluorouridine 93.9
2-fluoroguanine/5-methylcytosine 97.3
2-fluoroguanine/5-methylcytosine/pseudouridine 96.0
2-fluoroguanine/5-methylcytidine/N1-methyl-pseudouridine 82.0
2-fluoroguanine/pseudouridine 68.0
2-fluoroguanine/N1-methyl-pseudouridine 59.3
5-methylcytidine/pseudouridine, test B 58.7
5-methylcytidine/N1-methyl-pseudouridine, test B 78.0
TABLE-US-00118 TABLE 118 Capping chemistry and yield for G-CSF
modified mRNA Chemical Modification Yield (ug) 2'Fluorocytosine
16.9 2'Fluorouridine 17.0 5-methylcytosine/pseudouridine, test A
10.6 5-methylcytosine/N1-methyl-pseudouridine, test A 22.7
N1-acetylcytidine/2-fluorouridine 19.9
5-methylcytidine/2-fluorouridine 21.3
2-fluorocytosine/pseudouridine 65.2
2-fluorocytosine/N1-methyl-pseudouridine 58.9
2-fluorocytosine/2-thiouridine 41.2 2-fluorocytosine/5-bromouridine
35.8 2-fluorocytosine/2-fluorouridine 36.7
2-fluoroguanine/5-methylcytosine 36.6
2-fluoroguanine/5-methylcytosine/pseudouridine 37.3
2-fluoroguanine/5-methylcytidine/N1-methyl-pseudouridine 30.7
2-fluoroguanine/pseudouridine 29.0
2-fluoroguanine/N1-methyl-pseudouridine 22.7
5-methylcytidine/pseudouridine, test B 60.4
5-methylcytidine/N1-methyl-pseudouridine, test B 33.0
Example 75
2'O-methyl and 2'Fluoro Compounds
[1497] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) were produced as fully modified versions with the
chemistries in Table 119 and transcribed using mutant T7 polymerase
(Durascribe.RTM. T7 Transcription kit (Cat. No. DS010925)
(Epicentre.RTM., Madison, Wis.). 2' fluoro-containing mRNA were
made using Durascribe T7, however, 2'Omethyl-containing mRNA could
not be transcribed using Durascribe T7.
[1498] Incorporation of 2'Omethyl modified mRNA might possibly be
accomplished using other mutant T7 polymerases (Nat. Biotechnol.
(2004) 22:1155-1160; Nucleic Acids Res. (2002) 30:e138) or U.S.
Pat. No. 7,309,570, the contents of each of which are incorporated
herein by reference in their entirety. Alternatively, 2'OMe
modifications could be introduced post-transcriptionally using
enzymatic means.
[1499] Introduction of modifications on the 2' group of the sugar
has many potential advantages. 2'OMe substitutions, like 2' fluoro
substitutions are known to protect against nucleases and also have
been shown to abolish innate immune recognition when incorporated
into other nucleic acids such as siRNA and anti-sense (incorporated
in its entirety, Crooke, ed. Antisense Drug Technology, 2.sup.nd
edition; Boca Raton: CRC press).
[1500] The 2'Fluoro-modified mRNA were then transfected into HeLa
cells to assess protein production in a cell context and the same
mRNA were also assessed in a cell-free rabbit reticulocyte system.
A control of unmodified luciferase (natural luciferase) was used
for both transcription experiments, a control of untreated and mock
transfected (Lipofectamine 2000 alone) were also analyzed for the
HeLa transfection and a control of no RNA was analyzed for the
rabbit reticulysates.
[1501] For the HeLa transfection experiments, the day before
transfection, 20,000 HeLa cells (ATCC no. CCL-2; Manassas, Va.)
were harvested by treatment with Trypsin-EDTA solution
(LifeTechnologies, Grand Island, N.Y.) and seeded in a total volume
of 100 ul EMEM medium (supplemented with 10% FCS and 1.times.
Glutamax) per well in a 96-well cell culture plate (Corning,
Manassas, Va.). The cells were grown at 37oG in 5% CO.sub.2
atmosphere overnight. Next day, 83 ng of the 2' fluoro-containing
luciferase modified RNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) with the chemical modification described in Table
119, were diluted in 10 ul final volume of OPTI-MEM
(LifeTechnologies, Grand Island, N.Y.). Lipofectamine 2000
(LifeTechnologies, Grand Island, N.Y.) was used as transfection
reagent and 0.2 ul were diluted in 10 ul final volume of OPTI-MEM.
After 5 minutes of incubation at room temperature, both solutions
were combined and incubated an additional 15 minute at room
temperature. Then the 20 ul combined solution was added to the 100
ul cell culture medium containing the HeLa cells and incubated at
room temperature. After 18 to 22 hours of incubation cells
expressing luciferase were lysed with 100 ul of Passive Lysis
Buffer (Promega, Madison, Wis.) according to manufacturer
instructions. Aliquots of the lysates were transferred to white
opaque polystyrene 96-well plates (Corning, Manassas, Va.) and
combined with 100 ul complete luciferase assay solution (Promega,
Madison, Wis.). The lysate volumes were adjusted or diluted until
no more than 2 mio relative light units (RLU) per well were
detected for the strongest signal producing samples and the RLUs
for each chemistry tested are shown in Table 119. The plate reader
was a BioTek Synergy H1 (BioTek, Winooski, Vt.). The background
signal of the plates without reagent was about 200 relative light
units per well.
[1502] For the rabbit reticulocyte lysate assay,
2'-fluoro-containing luciferase mRNA were diluted in sterile
nuclease-free water to a final amount of 250 ng in 10 ul and added
to 40 ul of freshly prepared Rabbit Reticulocyte Lysate and the in
vitro translation reaction was done in a standard 1.5 mL
polypropylene reaction tube (Thermo Fisher Scientific, Waltham,
Mass.) at 30.degree. C. in a dry heating block. The translation
assay was done with the Rabbit Reticulocyte Lysate
(nuclease-treated) kit (Promega, Madison, Wis.) according to the
manufacturer's instructions. The reaction buffer was supplemented
with a one-to-one blend of provided amino acid stock solutions
devoid of either Leucine or Methionine resulting in a reaction mix
containing sufficient amounts of both amino acids to allow
effective in vitro translation. After 60 minutes of incubation, the
reaction was stopped by placing the reaction tubes on ice.
[1503] Aliquots of the in vitro translation reaction containing
luciferase modified RNA were transferred to white opaque
polystyrene 96-well plates (Corning, Manassas, Va.) and combined
with 100 ul complete luciferase assay solution (Promega, Madison,
Wis.). The volumes of the in vitro translation reactions were
adjusted or diluted until no more than 2 mio relative light units
(RLUs) per well were detected for the strongest signal producing
samples and the RLUs for each chemistry tested are shown in Table
120. The plate reader was a BioTek Synergy H1 (BioTek, Winooski,
Vt.). The background signal of the plates without reagent was about
160 relative light units per well.
[1504] As can be seen in Table 119 and 120, multiple
2'Fluoro-containing compounds are active in vitro and produce
luciferase protein.
TABLE-US-00119 TABLE 119 HeLa Cells Concentration Volume Yield
Chemical Modification (ug/ml) (ul) (ug) RLU 2'Fluoroadenosine
381.96 500 190.98 388.5 2'Fluorocytosine 654.56 500 327.28 2420
2'Fluoroguanine 541,795 500 270.90 11,705.5 2'Flurorouridine
944.005 500 472.00 6767.5 Natural luciferase N/A N/A N/A 133,853.5
Mock N/A N/A N/A 340 Untreated N/A N/A N/A 238
TABLE-US-00120 TABLE 120 Rabbit Reticulysates Chemical Modification
RLU 2'Fluoroadenosine 162 2'Fluorocytosine 208 2'Fluoroguanine
371,509 2'Flurorouridine 258 Natural luciferase 2,159,968 No RNA
156
Example 76
Luciferase in HeLa Cells Using a Combination of Modifications
[1505] To evaluate using of 2' fluoro-modified mRNA in combination
with other modification a series of mRNA were transcribed using
either wild-type T7 polymerase (non-fluoro-containing compounds) or
using mutant T7 polymerases (fluyoro-containing compounds) as
described in Example 75. All modified mRNA were tested by in vitro
transfection in HeLa cells.
[1506] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37oG in 5%
CO.sub.2 atmosphere overnight. Next day, 83 ng of Luciferase
modified RNA (mRNA sequence shown in SEQ ID NO: 251443; polyA tail
of approximately 160 nucleotides not shown in sequence; 5' cap,
Cap1) with the chemical modification described in Table 121, were
diluted in 10 ul final volume of OPTI-MEM (LifeTechnologies, Grand
Island, N.Y.). Lipofectamine 2000 (LifeTechnologies, Grand Island,
N.Y.) was used as transfection reagent and 0.2 ul were diluted in
10 ul final volume of OPTI-MEM. After 5 minutes of incubation at
room temperature, both solutions were combined and incubated an
additional 15 minute at room temperature. Then the 20 ul combined
solution was added to the 100 ul cell culture medium containing the
HeLa cells and incubated at room temperature.
[1507] After 18 to 22 hours of incubation cells expressing
luciferase were lysed with 100 ul of Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The lysate
volumes were adjusted or diluted until no more than 2 mio relative
light units (RLU) per well were detected for the strongest signal
producing samples and the RLUs for each chemistry tested are shown
in Table 121. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.). The background signal of the plates without reagent
was about 200 relative light units per well.
[1508] As evidenced in Table 121, most combinations of
modifications resulted in mRNA which produced functional luciferase
protein, including all the non-fluoro containing compounds and many
of the combinations containing 2' fluoro modifications.
TABLE-US-00121 TABLE 121 Luciferase Chemical Modification RLU
N4-acetylcytidine/pseudouridine 113,796
N4-acetylcytidine/N1-methyl-pseudouridine 316,326
5-methylcytidine/5-methoxyuridine 24,948
5-methylcytidine/5-methyluridine 43,675 5-methylcytidine/half of
the uridines modified with 50% 41,601 2-thiouridine
5-methylcytidine/2-thiouridine 1,102 5-methylcytidine/pseudouridine
51,035 5-methylcytidine/N1-methyl-pseudouridine 152,151
N4-acetylcytidine/2'Fluorouridine triphosphate 288
5-methylcytidine/2'Fluorouridine triphosphate 269 2'Fluorocytosine
triphosphate/pseudouridine 260 2'Fluorocytosine
triphosphate/N1-methyl-pseudouridine 412 2'Fluorocytosine
triphosphate/2-thiouridine 427 2'Fluorocytosine
triphosphate/5-bromouridine 253 2'Fluorocytosine
triphosphate/2'Fluorouridine triphosphate 184 2'Fluoroguanine
triphosphate/5-methylcytidine 321 2'Fluoroguanine
triphosphate/5-methylcytidine/Pseudouridine 207
2'Fluoroguanine/5-methylcytidine/N1-methyl-psuedouridine 235
2'Fluoroguanine/pseudouridine 218
2'Fluoroguanine/N1-methyl-psuedouridine 247
5-methylcytidine/pseudouridine, test A 13,833
5-methylcytidine/N1-methyl-pseudouridine, test A 598
2'Fluorocytosine triphosphate 201 2'Fluorouridine triphosphate 305
5-methylcytidine/pseudouridine, test B 115,401
5-methylcytidine/N1-methyl-pseudouridine, test B 21,034 Natural
luciferase 30,801 Untreated 344 Mock 262
Example 77
G-CSF In Vitro Transcription
[1509] To assess the activity of all our different chemical
modifications in the context of a second open reading frame, we
replicated experiments previously conducted using luciferase mRNA,
with human G-CSF mRNA. G-CSF mRNA (mRNA sequence shown in SEQ ID
NO: 251433; polyA tail of approximately 160 nucleotides not shown
in sequence; 5' cap, Cap1) were fully modified with the chemistries
in Tables 122 and 123 using wild-type T7 polymerase (for all
non-fluoro-containing compounds) or mutant T7 polymerase (for all
fluoro-containing compounds). The mutant T7 polymerase was obtained
commercially (Durascribe.RTM. T7 Transcription kit (Cat. No.
DS010925) (Epicentre.RTM., Madison, Wis.).
[1510] The modified RNA in Tables 122 and 123 were transfected in
vitro in HeLa cells or added to rabbit reticulysates (250 ng of
modified mRNA) as indicated. A control of untreated, mock
transfected (transfection reagent alone), G-CSF fully modified with
5-methylcytosine and N1-methyl-pseudouridine or luciferase control
(mRNA sequence shown in SEQ ID NO: 251443; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1)
fully modified with 5-methylcytosine and N1-methyl-pseudouridine
were also analyzed. The expression of G-CSF protein was determined
by ELISA and the values are shown in Tables 122 and 123. In Table
122, "NT" means not tested.
[1511] As shown in Table 123, many, but not all, chemical
modifications resulted in human G-CSF protein production. These
results from cell-based and cell-free translation systems correlate
very nicely with the same modifications generally working or not
working in both systems. One notable exception is 5-formylcytidine
modified G-CSF mRNA which worked in the cell-free translation
system, but not in the HeLa cell-based transfection system. A
similar difference between the two assays was also seen with
5-formylcytidine modified luciferase mRNA.
[1512] As demonstrated in Table 123, many, but not all, G-CSF mRNA
modified chemistries (when used in combination) demonstrated in
vivo activity. In addition the presence of N1-methyl-pseudouridine
in the modified mRNA (with N4-acetylcytidine or 5 methylcytidine)
demonstrated higher expression than when the same combinations
where tested using with pseudouridine. Taken together, these data
demonstrate that N1-methyl-pseudouridine containing G-CSF mRNA
results in improved protein expression in vitro.
TABLE-US-00122 TABLE 122 G-CSF Expression G-CSF protein G-CSF
(pg/ml) protein Rabbit (pg/ml) reticulysates Chemical Modification
HeLa cells cells Pseudouridine 1,150,909 147,875 5-methyluridine
347,045 147,250 2-thiouridine 417,273 18,375
N1-methyl-pseudouridine NT 230,000 4-thiouridine 107,273 52,375
5-methoxyuridine 1,715,909 201,750 5-methylcytosine/pseudouridine,
Test A 609,545 119,750 5-methylcytosine/N1-methyl-pseudouridine,
1,534,318 110,500 Test A 2'-Fluoro-guanosine 11,818 0
2'-Fluoro-uridine 60,455 0 5-methylcytosine/pseudouridine, Test B
358,182 57,875 5-methylcytosine/N1-methyl-pseudouridine, 1,568,636
76,750 Test B 5-Bromo-uridine 186,591 72,000 5-(2carbomethoxyvinyl)
uridine 1,364 0 5-[3(1-E-propenylamino) uridine 27,955 32,625
.alpha.-thio-cytidine 120,455 42,625
5-methylcytosine/pseudouridine, Test C 882,500 49,250
N1-methyl-adenosine 4,773 0 N6-methyl-adenosine 1,591 0
5-methyl-cytidine 646,591 79,375 N4-acetylcytidine 39,545 8,000
5-formyl-cytidine 0 24,000 5-methylcytosine/pseudouridine, Test D
87,045 47,750 5-methylcytosine/N1-methyl-pseudouridine, 1,168,864
97,125 Test D Mock 909 682 Untreated 0 0
5-methylcytosine/N1-methyl-pseudouridine, 1,106,591 NT Control
Luciferase control NT 0
TABLE-US-00123 TABLE 123 Combination Chemistries in HeLa cells
G-CSF protein (pg/ml) Chemical Modification HeLa cells
N4-acetylcytidine/pseudouridine 537,273
N4-acetylcytidine/N1-methyl-pseudouridine 1,091,818
5-methylcytidine/5-methoxyuridine 516,136
5-methylcytidine/5-bromouridine 48,864
5-methylcytidine/5-methyluridine 207,500
5-methylcytidine/2-thiouridine 33,409
N4-acetylcytidine/5-bromouridine 211,591
N4-acetylcytidine/2-thiouridine 46,136
5-methylcytosine/pseudouridine 301,364
5-methylcytosine/N1-methyl-pseudouridine 1,017,727
N4-acetylcytidine/2'Fluorouridine triphosphate 62,273
5-methylcytidine/2'Fluorouridine triphosphate 49,318
2'Fluorocytosine triphosphate/pseudouridine 7,955 2'Fluorocytosine
triphosphate/N1-methyl-pseudouridine 1,364 2'Fluorocytosine
triphosphate/2-thiouridine 0 2'Fluorocytosine
triphosphate/5-bromouridine 1,818 2'Fluorocytosine
triphosphate/2'Fluorouridine triphosphate 909 2'Fluoroguanine
triphosphate/5-methylcytidine 0 2'Fluoroguanine
triphosphate/5-methylcytidine/pseudouridine 0 2'Fluoroguanine
triphosphate/5-methylcytidine/N1 1,818 methylpseudouridine
2'Fluoroguanine triphosphate/pseudouridine 1,136 2'Fluoroguanine
triphosphate/2'Fluorocytosine 0
triphosphate/N1-methyl-pseudouridine 5-methylcytidine/pseudouridine
617,727 5-methylcytidine/N1-methyl-pseudouridine 747,045
5-methylcytidine/pseudouridine 475,455
5-methylcytidine/N1-methyl-pseudouridine 689,091
5-methylcytosine/N1-methyl-pseudouridine, Control 1 848,409
5-methylcytosine/N1-methyl-pseudouridine, Control 2 581,818 Mock
682 Untreated 0 Luciferase 2'Fluorocytosine triphosphate 0
Luciferase 2'Fluorouridine triphosphate 0
Example 78
Screening of Chemistries
[1513] The tables listed in below (Tables 124-126) summarize much
of the in vitro and in vitro screening data with the different
compounds presented in the previous examples. A good correlation
exists between cell-based and cell-free translation assays. The
same chemistry substitutions generally show good concordance
whether tested in the context of luciferase or G-CSF mRNA. Lastly,
N1-methyl-pseudouridine containing mRNA show a very high level of
protein expression with little to no detectable cytokine
stimulation in vitro and in vivo, and is superior to mRNA
containing pseudouridine both in vitro and in vivo.
[1514] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1) and G-CSF mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) were modified with naturally and
non-naturally occurring chemistries described in Tables 124 and 125
or combination chemistries described in Table 126 and tested using
methods described herein.
[1515] In Tables 125 and 126, "*" refers to in vitro transcription
reaction using a mutant T7 polymerase (Durascribe.RTM. T7
Transcription kit (Cat. No. DS010925) (Epicentre.RTM., Madison,
Wis.); "**" refers to the second result in vitro transcription
reaction using a mutant T7 polymerase (Durascribe.RTM. T7
Transcription kit (Cat. No. DS010925) (Epicentre.RTM., Madison,
Wis.); "***" refers to production seen in cell free translations
(rabbit reticulocyte lysates); the protein production of HeLa is
judged by "+," "+/-" and "-"; when referring to G-CSF PBMC "++++"
means greater than 6,000 pg/ml G-CSF, "+++" means greater than
3,000 pg/ml G-CSF, "++" means greater than 1,500 pg/ml G-CSF, "+"
means greater than 300 pg/ml G-CSF, "+/-" means 150-300 pg/ml G-CSF
and the background was about 110 pg/ml; when referring to cytokine
PBMC "++++" means greater than 1,000 pg/ml interferon-alpha
(IFN-alpha), "+++" means greater than 600 pg/ml IFN-alpha, "++"
means greater than 300 pg/ml IFN-alpha, "+" means greater than 100
pg/ml IFN-alpha, "-" means less than 100 pg/ml and the background
was about 70 pg/ml; and "NT" means not tested. In Table 125, the
protein production was evaluated using a mutant T7 polymerase
(Durascribe.RTM. T7 Transcription kit (Cat. No. DS010925)
(Epicentre.RTM., Madison, Wis.).
TABLE-US-00124 TABLE 124 Naturally Occurring Protein Protein
Protein Cytokines In Vivo In Vivo Common Name IVT IVT (Luc; (G-CSF;
(G-CSF; (G-CSF; Protein Protein (symbol) (Luc) (G-CSF) HeLa) HeLa)
PBMC) PBMC) (Luc) (G-CSF) 1-methyladenosine Fail Pass NT - +/- ++
NT NT (m.sup.1A) N.sup.6- Pass Pass - - +/- ++++ NT NT
methyladenosine (m.sup.6A) 2'-O- Fail* Not NT NT NT NT NT NT
methyladenosine Done (Am) 5-methylcytidine Pass Pass + + + ++ + NT
(m.sup.5C) 2'-O- Fail* Not NT NT NT NT NT NT methylcytidine Done
(Cm) 2-thiocytidine Fail Fail NT NT NT NT NT NT (s.sup.2C)
N.sup.4-acetylcytidine Pass Pass + + +/- +++ + NT (ac.sup.4C)
5-formylcytidine Pass Pass -*** -*** - + NT NT (f.sup.5C) 2'-O-
Fail* Not NT NT NT NT NT NT methylguanosine Done (Gm) inosine (I)
Fail Fail NT NT NT NT NT NT pseudouridine (Y) Pass Pass + + ++ + +
NT 5-methyluridine Pass Pass + + +/- + NT NT (m.sup.5U)
2'-O-methyluridine Fail* Not NT NT NT NT NT NT (Um) Done 1- Pass
Pass + Not ++++ - + NT methylpseudouridine Done (m.sup.1Y)
2-thiouridine (s.sup.2U) Pass Pass - + + + NT NT 4-thiouridine
(s.sup.4U) Fail Pass + +/- ++ NT NT 5-methoxyuridine Pass Pass + +
++ - + NT (mo.sup.5U) 3-methyluridine Fail Fail NT NT NT NT NT NT
(m.sup.3U)
TABLE-US-00125 TABLE 125 Non-Naturally Occurring Protein Protein
Protein Cytokines In Vivo In Vivo Common IVT IVT (Luc; (G-CSF;
(G-CSF; (G-CSF; Protein Protein Name (Luc) (G-CSF) HeLa) HeLa)
PBMC) PBMC) (Luc) (G-CSF) 2'-F-ara- Fail Fail NT NT NT NT NT NT
guanosine 2'-F-ara- Fail Fail NT NT NT NT NT NT adenosine 2'-F-ara-
Fail Fail NT NT NT NT NT NT cytidine 2'-F-ara- Fail Fail NT NT NT
NT NT NT uridine 2'-F- Fail/ Pass/ +** +/- - + + NT guanosine
Pass** Fail** 2'-F- Fail/ Fail/ -** NT NT NT NT NT adenosine Pass**
Fail** 2'-F-cytidine Fail/ Fail/ +** NT NT NT + NT Pass** Pass**
2'-F-uridine Fail/ Pass/ +** + +/- + - NT Pass** Pass** 2'-OH-ara-
Fail Fail NT NT NT NT NT NT guanosine 2'-OH-ara- Not Not NT NT NT
NT NT NT adenosine Done Done 2'-OH-ara- Fail Fail NT NT NT NT NT NT
cytidine 2'-OH-ara- Fail Fail NT NT NT NT NT NT uridine
5-Br-Uridine Pass Pass + + + + + 5-(2-carbo- Pass Pass - - +/- -
methoxyvinyl) Uridine 5-[3-(1-E- Pass Pass - + + - Propenylamino)
Uridine (aka Chem 5) N6-(19- Fail Fail NT NT NT NT NT NT
Amino-penta- oxanonadecyl) A 2- Fail Fail NT NT NT NT NT NT
Dimethylamino guanosine 6-Aza- Fail Fail NT NT NT NT NT NT cytidine
a-Thio- Pass Pass + + +/- +++ NT NT cytidine Pseudo- NT NT NT NT NT
NT NT NT isocytidine 5-Iodo- NT NT NT NT NT NT NT NT uridine
a-Thio- NT NT NT NT NT NT NT NT uridine 6-Aza-uridine NT NT NT NT
NT NT NT NT Deoxy- NT NT NT NT NT NT NT NT thymidine a-Thio NT NT
NT NT NT NT NT NT guanosine 8-Oxo- NT NT NT NT NT NT NT NT
guanosine O6-Methyl- NT NT NT NT NT NT NT NT guanosine 7-Deaza- NT
NT NT NT NT NT NT NT guanosine 6-Chloro- NT NT NT NT NT NT NT NT
purine a-Thio- NT NT NT NT NT NT NT NT adenosine 7-Deaza- NT NT NT
NT NT NT NT NT adenosine 5-iodo- NT NT NT NT NT NT NT NT
cytidine
[1516] In Table 126, the protein production of HeLa is judged by
"+," "+/-" and "-"; when referring to G-CSF PBMC "++++" means
greater than 6,000 pg/ml G-CSF, "+++" means greater than 3,000
pg/ml G-CSF, "++" means greater than 1,500 pg/ml G-CSF, "+" means
greater than 300 pg/ml G-CSF, "+/-" means 150-300 pg/ml G-CSF and
the background was about 110 pg/ml; when referring to cytokine PBMC
"++++" means greater than 1,000 pg/ml interferon-alpha (IFN-alpha),
"+++" means greater than 600 pg/ml IFN-alpha, "++" means greater
than 300 pg/ml IFN-alpha, "+" means greater than 100 pg/ml
IFN-alpha, "-" means less than 100 pg/ml and the background was
about 70 pg/ml; "WT" refers to the wild type T7 polymerase, "MT"
refers to mutant T7 polymerase (Durascribe.RTM. T7 Transcription
kit (Cat. No. DS010925) (Epicentre.RTM., Madison, Wis.) and "NT"
means not tested.
TABLE-US-00126 TABLE 126 Combination Chemistry Protein Protein
Protein Cytokines In Vivo Cytidine Uridine IVT IVT (Luc; (G-CSF;
(G-CSF; (G-CSF; Protein analog analog Purine Luc (G-CSF) HeLa)
HeLa) PBMC) PBMC) (Luc) N4- pseudouridine A, G Pass Pass + + NT NT
+ acetylcytidine WT WT N4- N1-methyl- A, G Pass Pass + + NT NT +
acetylcytidine pseudouridine WT WT 5- 5- A, G Pass Pass + + NT NT +
methylcytidine methoxyuridine WT WT 5- 5- A, G Pass Pass Not + NT
NT methylcytidine bromouridine WT WT Done 5- 5- A, G Pass Pass + +
NT NT + methylcytidine methyluridine WT WT 5- 50% 2- A, G Pass Pass
+ NT NT NT + methylcytidine thiouridine; WT WT 50% uridine 5- 100%
2- A, G Pass Pass - + NT NT methylcytidine thiouridine WT WT 5-
pseudouridine A, G Pass Pass + + ++ + + methylcytidine WT WT 5-
N1-methyl- A, G Pass Pass + + ++++ - + methylcytidine pseudouridine
WT WT N4- 2- A, G Not Pass Not + NT NT NT acetylcytidine
thiouridine Done WT Done N4- 5- A, G Not Pass Not + NT NT NT
acetylcytidine bromouridine Done WT Done N4- 2 A, G Pass Pass - +
NT NT NT acetylcytidine Fluorouridine triphosphate 5- 2 A, G Pass
Pass - + NT NT NT methylcytidine Fluorouridine triphosphate 2
pseudouridine A, G Pass Pass - + NT NT NT Fluorocytosine
triphosphate 2 N1-methyl- A, G Pass Pass - +/- NT NT NT
Fluorocytosine pseudouridine triphosphate 2 2- A, G Pass Pass - -
NT NT NT Fluorocytosine thiouridine triphosphate 2 5- A, G Pass
Pass - +/- NT NT NT Fluorocytosine bromouridine triphosphate 2 2 A,
G Pass Pass - +/- NT NT NT Fluorocytosine Fluorouridine
triphosphate triphosphate 5- uridine A, 2 Pass Pass - - NT NT NT
methylcytidine Fluoro GTP 5- pseudouridine A, 2 Pass Pass - - NT NT
NT methylcytidine Fluoro GTP 5- N1-methyl- A, 2 Pass Pass - +/- NT
NT NT methylcytidine pseudouridine Fluoro GTP 2 pseudouridine A, 2
Pass Pass - +/- NT NT NT Fluorocytosine Fluoro triphosphate GTP 2
N1-methyl- A, 2 Pass Pass - - NT NT NT Fluorocytosine pseudouridine
Fluoro triphosphate GTP
Example 79
2'Fluoro Chemistries in PBMC
[1517] The ability of G-CSF modified mRNA (mRNA sequence shown in
SEQ ID NO: 251433; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1) to trigger innate an immune
response was determined by measuring interferon-alpha (IFN-alpha)
and tumor necrosis factor-alpha (TNF-alpha) production. Use of in
vitro PBMC cultures is an accepted way to measure the
immunostimulatory potential of oligonucleotides (Robbins et al.,
Oligonucleotides 2009 19:89-102) and transfection methods are
described herein. Shown in Table 127 are the average from 2 or 3
separate PBMC donors of the interferon-alpha (IFN-alpha) and tumor
necrosis factor alpha (TNF-alpha) production over time as measured
by specific ELISA. Controls of R848, P(I)P(C), LPS and
Lipofectamine 2000 (L2000) were also analyzed.
[1518] With regards to innate immune recognition, while both
modified mRNA chemistries largely prevented IFN-alpha and TNF-alpha
production relative to positive controls (R848, P(I)P(C)), 2'
fluoro compounds reduce IFN-alpha and TNF-alpha production even
lower than other combinations and N4-acetylcytidine combinations
raised the cytokine profile.
TABLE-US-00127 TABLE 127 IFN-alpha and TNF-alpha IFN-alpha:
TNF-alpha: 3 Donor 2 Donor Average Average (pg/ml) (pg/ml) L2000 1
361 P(I)P(C) 482 544 R848 45 8,235 LPS 0 6,889
N4-acetylcytidine/pseudouridine 694 528
N4-acetylcytidine/N1-methyl-pseudouridine 307 283
5-methylcytidine/5-methoxyuridine 0 411
5-methylcytidine/5-bromouridine 0 270
5-methylcytidine/5-methyluridine 456 428
5-methylcytidine/2-thiouridine 274 277
N4-acetylcytidine/2-thiouridine 0 285
N4-acetylcytidine/5-bromouridine 44 403
5-methylcytidine/pseudouridine 73 332
5-methylcytidine/N1-methyl-pseudouridine 31 280
N4-acetylcytidine/2'fluorouridine triphosphate 35 32
5-methylcytodine/2'fluorouridine triphosphate 24 0 2'fluorocytidine
triphosphate/N1-methyl- 0 11 pseudouridine 2'fluorocytidine
triphosphate/2-thiouridine 0 0
2'fluorocytidine/triphosphate5-bromouridine 12 2 2'fluorocytidine
triphosphate/2'fluorouridine 11 0 triphosphate 2'fluorocytidine
triphosphate/5-methylcytidine 14 23 2'fluorocytidine
triphosphate/5- 6 21 methylcytidine/pseudouridine 2'fluorocytidine
triphosphate/5- 3 15 methylcytidine/N1-methyl-pseudouridine
2'fluorocytidine triphosphate/pseudouridine 0 4 2'fluorocytidine
triphosphate/N1-methyl- 6 20 pseudouridine
5-methylcytidine/pseudouridine 82 18
5-methylcytidine/N1-methyl-pseudouridine 35 3
Example 80
Modified mRNA with a Tobacco Etch Virus 5'UTR
[1519] A 5' untranslated region (UTR) may be provided as a flanking
region. Multiple 5' UTRs may be included in the flanking region and
may be the same or of different sequences. Any portion of the
flanking regions, including none, may be codon optimized and any
may independently contain one or more different structural or
chemical modifications, before and/or after codon optimization.
[1520] The 5' UTR may comprise the 5'UTR from the tobacco etch
virus (TEV). Variants of 5' UTRs may be utilized wherein one or
more nucleotides are added or removed to the termini, including A,
T, C or G.
Example 81
Expression of PLGA Formulated mRNA
[1521] A. Synthesis and Characterization of Luciferase PLGA
Microspheres
[1522] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) fully modified with 5-methylcytosine and
N1-methyl-pseudouridine, modified with 25% of uridine replaced with
2-thiouridine and 25% of cytosine replaced with 5-methylcytosine,
fully modified with N1-methyl-pseudouridine, or fully modified with
pseudouridine was reconstituted in 1.times.TE buffer and then
formulated in PLGA microspheres. PLGA microspheres were synthesized
using the water/oil/water double emulsification methods known in
the art using PLGA-ester cap (Lactel, Cat#B6010-2, inherent
viscosity 0.55-0.75, 50:50 LA:GA), polyvinylalcohol (PVA) (Sigma,
Cat#348406-25G, MW 13-23 k) dichloromethane and water. Briefly, 0.4
ml of mRNA in TE buffer at 4 mg/ml (W1) was added to 2 ml of PLGA
dissolved in dichloromethane (DCM) (O1) at a concentration of 200
mg/ml of PLGA. The W1/O1 emulsion was homogenized (IKA Ultra-Turrax
Homogenizer, T18) for 30 seconds at speed 5 (19,000 rpm). The W1/O1
emulsion was then added to 250 ml 1% PVA (W2) and homogenized for 1
minute at speed 5 (19,000 rpm). Formulations were left to stir for
3 hours, then passed through a 100 .mu.m nylon mesh strainer
(Fisherbrand Cell Strainer, Cat #22-363-549) to remove larger
aggregates, and finally washed by centrifugation (10 min, 9,250
rpm, 4.degree. C.). The supernatant was discarded and the PLGA
pellets were resuspended in 5-10 ml of water, which was repeated
2.times.. After washing and resuspension with water, 100-200 .mu.l
of a PLGA microspheres sample was used to measure particle size of
the formulations by laser diffraction (Malvern Mastersizer2000).
The washed formulations were frozen in liquid nitrogen and then
lyophilized for 2-3 days.
[1523] After lyophilization, .about.10 mg of PLGA MS were weighed
out in 2 ml eppendorf tubes and deformulated by adding 1 ml of DCM
and letting the samples shake for 2-6 hrs. The mRNA was extracted
from the deformulated PLGA micropsheres by adding 0.5 ml of water
and shaking the sample overnight. Unformulated luciferase mRNA in
TE buffer (unformulated control) was spiked into DCM and went
through the deformulation process (deformulation control) to be
used as controls in the transfection assay. The encapsulation
efficiency, weight percent loading and particle size are shown in
Table 128. Encapsulation efficiency was calculated as mg of mRNA
from deformulation of PLGA microspheres divided by the initial
amount of mRNA added to the formulation. Weight percent loading in
the formulation was calculated as mg of mRNA from deformulation of
PLGA microspheres divided by the initial amount of PLGA added to
the formulation.
TABLE-US-00128 TABLE 128 PLGA Characteristics Theoretical Actual
Particle Encapsulation mRNA mRNA Size Efficiency Loading (wt
Loading (D50, Chemical Modifications Sample ID (%) %) (wt %) um)
Fully modified with 5- 43-66A 45.8 0.4 0.18 33.4 methylcytosine and
N1- 43-66B 29.6 0.12 27.7 methyl-pseudouridine 43-66C 25.5 0.10
27.1 25% of uridine replaced 43-67A 34.6 0.4 0.14 29.9 with
2-thiouridine and 43-67B 22.8 0.09 30.2 25% of cytosine replaced
43-67C 23.9 0.10 25.1 with 5-methylcytosine Fully modified with N1-
43-69A 55.8 0.4 0.22 40.5 methyl-pseudouridine 43-69B 31.2 0.12
41.1 43-69C 24.9 0.10 46.1 Fully modified with 43-68-1 49.3 0.4
0.20 34.8 pseudouridine 43-68-2 37.4 0.15 35.9 43-68-3 45.0 0.18
36.5
[1524] B. Protein Expression of Modified mRNA Encapsulated in PLGA
Microspheres
[1525] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
a 5% CO.sub.2 atmosphere overnight. The next day, 83 ng of the
deformulated luciferase mRNA PLGA microsphere samples, deformulated
luciferase mRNA control (Deform control), or unformulated
luciferase mRNA control (Unfomul control) was diluted in a 10 ul
final volume of OPTI-MEM (LifeTechnologies, Grand Island, N.Y.).
Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.) was used
as a transfection reagent and 0.2 ul was diluted in a 10 ul final
volume of OPTI-MEM. After 5 min of incubation at room temperature,
both solutions were combined and incubated an additional 15 min at
room temperature. Then 20 ul of the combined solution was added to
100 ul of cell culture medium containing the HeLa cells. The plates
were then incubated as described before.
[1526] After an 18 to 22 hour incubation, cells expressing
luciferase were lysed with 100 ul Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The background
signal of the plates without reagent was about 200 relative light
units per well. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.).
[1527] Cells were harvested and the bioluminescence (in relative
light units, RLU) for each sample is shown in Table 129.
Transfection of these samples confirmed that the varied chemistries
of luciferase mRNA is still able to express luciferase protein
after PLGA microsphere formulation.
TABLE-US-00129 TABLE 129 Chemical Modifications Chemical Biolum.
Modifications Sample ID (RLU) Fully modified with Deform contol
164266.5 5-methylcytosine Unformul control 113714 and N1-methyl-
43-66A 25174 pseudouridine 43-66B 25359 43-66C 20060 25% of uridine
Deform contol 90816.5 replaced with 2- Unformul control 129806
thiouridine and 25% 43-67A 38329.5 of cytosine replaced 43-67B
8471.5 with 5- 43-67C 10991.5 methylcytosine Fully modified with
Deform contol 928093.5 N1-methyl- Unformul control 1512273.5
pseudouridine 43-69A 1240299.5 43-69B 748667.5 43-69C 1193314 Fully
modified with Deform contol 154168 pseudouridine Unformul control
151581 43-68-1 120974.5 43-68-2 107669 43-68-3 97226
Example 82
In Vitro Studies of Factor IX
[1528] A. Serum-Free Media
[1529] Human Factor IX mRNA (mRNA sequence shown in SEQ ID NO:
251437; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was transfected in serum-free media. The cell
culture supernatant was collected and subjected to trypsin
digestion before undergoing 2-dimensional HPLC separation of the
peptides. Matrix-assisted laser desorption/ionization was used to
detect the peptides. 8 peptides were detected and 7 of the detected
peptides are unique to Factor IX. These results indicate that the
mRNA transfected in the serum-free media was able to express
full-length Factor 1.times. protein.
[1530] B. Human Embryonic Kidney (HEK) 293A Cells
[1531] ng of codon optimized Human Factor IX mRNA (mRNA sequence
shown in SEQ ID NO: 251437; fully modified with 5-methylcytosine
and pseudouridine; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1) was transfected into HEK 293A
cells (150,000 cells/well) using Lipofectamine 2000 in DMEM in
presence of 10% FBS. The transfection complexes were removed 3
hours after transfection. Cells were harvested at 3, 6, 9, 12, 24,
48 and 72 hours after transfection. Total RNA was isolated and used
for cDNA synthesis. The cDNA was subjected to analysis by
quantitative Real-Time PCR using codon optimized Factor IXspecific
primer set. Human hypoxanthine phosphoribosyltransfersase 1 (HPRT)
level was used for normalization. The data is plotted as a percent
of detectable mRNA considering the mRNA level as 100% at the 3 hour
time point. The half-life of Factor IX modified mRNA fully modified
with 5-methylcytosine and pseudouridine in human embryonic kidney
293 (HEK293) cells is about 8-10 hours.
Example 83
Saline Formulation: Subcutaneous Administration
[1532] Human G-CSF modified mRNA (mRNA sequence shown in SEQ ID NO:
251433; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) and human EPO modified mRNA (mRNA sequence shown in
SEQ ID NO: 251436; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine), were formulated in saline and
delivered to mice via intramuscular (IM) injection at a dose of 100
ug.
[1533] Controls included Luciferase (mRNA sequence shown in SEQ ID
NO: 251443; polyA tail of approximately 160 nucleotides not shown
in sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine)) or the formulation buffer (F. Buffer). The mice
were bled at 13 hours after the injection to determine the
concentration of the human polypeptide in serum in pg/mL. (G-CSF
groups measured human G-CSF in mouse serum and EPO groups measured
human EPO in mouse serum). The data are shown in Table 130.
[1534] mRNA degrades rapidly in serum in the absence of formulation
suggesting the best method to deliver mRNA to last longer in the
system is by formulating the mRNA. As shown in Table 130, mRNA can
be delivered subcutaneously using only a buffer formulation.
TABLE-US-00130 TABLE 130 Dosing Regimen Average Protein Dose
Product Vol. Dosing pg/mL, Group Treatment (.mu.l/mouse) Vehicle
serum G-CSF G-CSF 100 F. buffer 45 G-CSF Luciferase 100 F. buffer 0
G-CSF F. buffer 100 F. buffer 2.2 EPO EPO 100 F. buffer 72.03 EPO
Luciferase 100 F. buffer 26.7 EPO F. buffer 100 F. buffer 13.05
Example 84
Intravitreal Delivery
[1535] mCherry modified mRNA (mRNA sequence shown in SEQ ID NO:
251434; polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) and luciferase modified mRNA (mRNA sequence shown in
SEQ ID NO: 251443; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine) formulated in saline was
delivered intravitreally in rats as described in Table 131. The
sample was compared against a control of saline only delivered
intravitreally.
TABLE-US-00131 TABLE 131 Dosing Chart Dose Level Dose Treatment
(.mu.g modified volume Right Eye Left Eye Group No. RNA/eye)
(.mu.L/eye) (OD) (OS) Control 0 5 Delivery Delivery buffer only
buffer only Modified RNA in 10 5 mCherry Luciferase delivery
buffer
[1536] The formulation will be administered to the left or right
eye of each animal on day 1 while the animal is anesthetized. On
the day prior to administration gentamicin ophthalmic ointment or
solution was applied to both eyes twice. The gentamicin ophthalmic
ointment or solution was also applied immediately following the
injection and on the day following the injection. Prior to dosing,
mydriatic drops (1% tropicamide and/or 2.5% phenylephrine) are
applied to each eye.
[1537] 18 hours post dosing the eyes receiving the dose of mCherry
and delivery buffer are enucleated and each eye was separately
placed in a tube containing 10 mL 4% paraformaldehyde at room
temperature for overnight tissue fixation. The following day, eyes
will be separately transferred to tubes containing 10 mL of 30%
sucurose and stored at 21.degree. C. until they were processed and
sectioned. The slides prepared from different sections were
evaluated under F-microscopy. Postive expression was seen in the
slides prepared with the eyes administered mCherry modified mRNA
and the control showed no expression.
Example 85
In Vivo Cytokine Expression Study
[1538] Mice were injected intramuscularly with 200 ug of G-CSF
modified mRNA (mRNA sequence shown in SEQ ID NO: 251433; polyA tail
of approximately 160 nucleotides not shown in sequence) which was
unmodified with a 5' cap, Cap1 (unmodified), fully modified with
5-methylcytosine and pseudouridine and a 5' cap, Cap1 (Gen1) or
fully modified with 5-methylcytosine and
N.sup.1-methyl-pseudouridine and a 5' cap, Cap1 (Gen2 cap) or no
cap (Gen2 uncapped). Controls of R-848, 5% sucrose and untreated
mice were also analyzed. After 8 hours serum was collected from the
mice and analyzed for interferon-alpha (IFN-alpha) expression. The
results are shown in Table 132.
TABLE-US-00132 TABLE 132 IFN-alpha Expression Formulation IFN-alpha
(pg/ml) G-CSF unmodified 67.012 G-CSF Gen1 8.867 G-CSF Gen2 cap 0
G-CSF Gen2 uncapped 0 R-848 40.971 5% sucrose 1.493 Untreated 0
Example 86
In Vitro Expression of VEGF Modified mRNA
[1539] HEK293 cells were transfected with modified mRNA (mmRNA)
VEGF-A (mRNA sequence shown in SEQ ID NO: 251446; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) which had
been complexed with Lipofectamine-2000 from Invitrogen (Carlsbad,
Calif.) at the concentration shown in Table 133. The protein
expression was detected by ELISA and the protein (pg/ml) is shown
in Table 133 and FIG. 7.
TABLE-US-00133 TABLE 134 Protein Expression Amount Transfected 10
2.5 625 156 39 10 2 610 ng ng pg pg pg pg pg fg Protein 10495 10038
2321.23 189.6 0 0 0 0 (pg/ml)
Example 87
In Vitro Screening in HeLa Cells of GFP
[1540] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
5% CO.sub.2 atmosphere overnight. Next day, 37.5 ng or 75 ng of
Green Fluorescent protein (GFP) modified RNA (mRNA sequence shown
in SEQ ID NO: 251445; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1) with the chemical modification
described in Table 134, were diluted in 10 ul final volume of
OPTI-MEM (LifeTechnologies, Grand Island, N.Y.). Lipofectamine 2000
(LifeTechnologies, Grand Island, N.Y.) was used as transfection
reagent and 0.2 ul were diluted in 10 ul final volume of OPTI-MEM.
After 5 minutes of incubation at room temperature, both solutions
were combined and incubated an additional 15 minute at room
temperature. Then the 20 ul combined solution was added to the 100
ul cell culture medium containing the HeLa cells and incubated at
room temperature.
[1541] After an 18 to 22 hour incubation cells expressing
luciferase were lysed with 100 ul of Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The median
fluorescence intensity (MFI) was determined for each chemistry and
is shown in Table 134.
[1542] These results demonstrate that GFP fully modified with
N1-methyl-pseudouridine and 5-methylcytosine produces more protein
in HeLa cells compared to the other chemistry. Additionally the
higher dose of GFP administered to the cells resulted in the
highest MFI value.
TABLE-US-00134 TABLE 134 Mean Fluorescence Intensity 37.5 ng 75 ng
Chemistry MFI MFI No modifications 97400 89500
5-methylcytosine/pseudouridine 324000 715000
5-methylcytosine/N1-methyl-pseudouridine 643000 1990000
Example 88
Homogenization
[1543] Different luciferase mRNA solutions (as described in Table
135 where "X" refers to the solution containing that component)
(mRNA sequence shown in SEQ ID NO: 251443; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) were
evaluated to test the percent yield of the different solutions, the
integrity of the mRNA by bioanalyzer, and the protein expression of
the mRNA by in vitro transfection. The mRNA solutions were prepared
in water, 1.times.TE buffer at 4 mg/ml as indicated in Table 135,
and added to either dichloromethane (DCM) or DCM containing 200
mg/ml of poly(lactic-co-glycolic acid) (PLGA) (Lactel, Cat#B6010-2,
inherent viscosity 0.55-0.75, 50:50 LA:GA) to achieve a final mRNA
concentration of 0.8 mg/ml. The solutions requiring homogenization
were homogenized for 30 seconds at speed 5 (approximately 19,000
rpm) (IKA Ultra-Turrax Homogenizer, T18). The mRNA samples in
water, dichloromethane and poly(lactic-co-glycolic acid) (PLGA)
were not recoverable (NR). All samples, except the NR samples,
maintained integrity of the mRNA as determined by bioanalyzer
(Bio-rad Experion).
[1544] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
a 5% CO2 atmosphere overnight. The next day, 250 ng of luciferase
mRNA from the recoverable samples was diluted in a 10 ul final
volume of OPTI-MEM (LifeTechnologies, Grand Island, N.Y.).
Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.) was used
as a transfection reagent and 0.2 ul was diluted in a 10 ul final
volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minutes at room temperature. Then 20 ul of the
combined solution was added to 100 ul of cell culture medium
containing the HeLa cells. The plates were then incubated as
described before. Controls luciferase mRNA (luciferase mRNA
formulated in saline) (Control) and untreated cells (Untreat.) were
also evaluated. Cells were harvested and the bioluminescence
average (in photons/second) (biolum. (p/s)) for each signal is also
shown in Table 135. The recoverable samples all showed activity of
luciferase mRNA when analyzed.
[1545] After an 18 to 22 hour incubation, cells expressing
luciferase were lysed with 100 ul Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The background
signal of the plates without reagent was about 200 relative light
units per well. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.).
[1546] Cells were harvested and the bioluminescence average (in
relative light units, RLU) (biolum. (RLU)) for each signal is also
shown in Table 135. The recoverable samples all showed activity of
luciferase mRNA when analyzed.
TABLE-US-00135 TABLE 135 Solutions Solution 1x TE DCM/ Homog- Yield
Biolum. No. Water Buffer DCM PLGA enizer (%) (RLU) 1 X 96 5423780 2
X X 95 4911950 3 X X 92 2367230 4 X X 90 4349410 5 X X X 66 4145340
6 X X X 71 3834440 7 X X X NR n/a 8 X X X 24 3182080 9 X X NR n/a
10 X X 79 3276800 11 X X 79 5563550 12 X X 79 4919100 Control
2158060 Untreat. 3530
Example 89
TE Buffer and Water Evaluation
[1547] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was reconstituted in water or TE buffer as outlined
in Table 136 and then formulated in PLGA microspheres. PLGA
microspheres were synthesized using the water/oil/water double
emulsification methods known in the art using PLGA (Lactel,
Cat#B6010-2, inherent viscosity 0.55-0.75, 50:50 LA:GA),
polyvinylalcohol (PVA) (Sigma, Cat#348406-25G, MW 13-23 k)
dichloromethane and water. Briefly, 0.2 to 0.6 ml of mRNA in water
or TE buffer at a concentration of 2 to 6 mg/ml (W1) was added to 2
ml of PLGA dissolved in dichloromethane (DCM) (O1) at a
concentration of 100 mg/ml of PLGA. The W1/O1 emulsion was
homogenized (IKA Ultra-Turrax Homogenizer, T18) for 30 seconds at
speed 5 (.about.19,000 rpm). The W1/O1 emulsion was then added to
250 ml 1% PVA (W2) and homogenized for 1 minute at speed 5
(.about.19,000 rpm).
[1548] Formulations were left to stir for 3 hours, then passed
through a 100 .mu.m nylon mesh strainer (Fisherbrand Cell Strainer,
Cat #22-363-549) to remove larger aggregates, and finally washed by
centrifugation (10 min, 9,250 rpm, 4.degree. C.). The supernatant
was discarded and the PLGA pellets were resuspended in 5-10 ml of
water, which was repeated 2.times.. The washed formulations were
frozen in liquid nitrogen and then lyophilized for 2-3 days. After
lyophilization, .about.10 mg of PLGA MS were weighed out in 2 ml
eppendorf tubes and deformulated by adding 1 ml of DCM and letting
the samples shake for 2-6 hrs. mRNA was extracted from the
deformulated PLGA micropsheres by adding 0.5 ml of water and
shaking the sample overnight. Unformulated luciferase mRNA in water
or TE buffer (deformulation controls) was spiked into DCM and went
through the deformulation process to be used as controls in the
transfection assay.
[1549] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
a 5% CO2 atmosphere overnight. The next day, 100 ng of the
deformulated luciferase mRNA samples was diluted in a 10 ul final
volume of OPTI-MEM (LifeTechnologies, Grand Island, N.Y.).
Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.) was used
as a transfection reagent and 0.2 ul was diluted in a 10 ul final
volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minutes at room temperature. Then 20 ul of the
combined solution was added to 100 ul of cell culture medium
containing the HeLa cells. The plates were then incubated as
described before.
[1550] After 18 to 22 hour incubation, cells expressing luciferase
were lysed with 100 ul Passive Lysis Buffer (Promega, Madison,
Wis.) according to manufacturer instructions. Aliquots of the
lysates were transferred to white opaque polystyrene 96-well plates
(Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The background
signal of the plates without reagent was about 200 relative light
units per well. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.). To determine the activity of the luciferase mRNA
from each formulation, the relative light units (RLU) for each
formulation was divided by the RLU of the appropriate mRNA
deformulation control (mRNA in water or TE buffer). Table 136 shows
the activity of the luciferase mRNA. The activity of the luciferase
mRNA in the PLGA microsphere formulations (Form.) was
substantitally improved by formulating in TE buffer versus
water.
TABLE-US-00136 TABLE 136 Formulations W1 Theoretical Actual mRNA
Solvent Total mRNA mRNA Activity conc. volume mRNA Loading Loading
W1 (% of deform. Form. (mg/ml) (ul) (ug) (wt %) (wt %) Solvent
control) PLGA A 4 400 1600 0.80 0.14 Water 12.5% PLGA B 4 200 800
0.40 0.13 Water 1.3% PLGA C 4 600 2400 1.20 0.13 Water 12.1% PLGA D
2 400 800 0.40 0.07 Water 1.3% PLGA E 6 400 2400 1.20 0.18 TE
Buffer 38.9% PLGA F 4 400 1600 0.80 0.16 TE Buffer 39.7% PLGA G 4
400 1600 0.80 0.10 TE Buffer 26.6%
Example 90
Chemical Modifications on mRNA
[1551] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (Life Technologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
5% CO.sub.2 atmosphere overnight. The next day, 83 ng of Luciferase
modified RNA (mRNA sequence shown SEQ ID NO: 251443; polyA tail of
approximately 140 nucleotides not shown in sequence; 5' cap, Cap1)
with the chemical modification described in Table 137, were diluted
in 10 ul final volume of OPTI-MEM (LifeTechnologies, Grand Island,
N.Y.). Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.)
was used as transfection reagent and 0.2 ul were diluted in 10 ul
final volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minute at room temperature. Then the 20 ul combined
solution was added to the 100 ul cell culture medium containing the
HeLa cells and incubated at room temperature.
[1552] After 18 to 22 hours of incubation cells expressing
luciferase were lysed with 100 ul of Passive Lysis Buffer (Promega,
Madison, Wis.) according to manufacturer instructions. Aliquots of
the lysates were transferred to white opaque polystyrene 96-well
plates (Corning, Manassas, Va.) and combined with 100 ul complete
luciferase assay solution (Promega, Madison, Wis.). The lysate
volumes were adjusted or diluted until no more than 2 mio relative
light units (RLU) per well were detected for the strongest signal
producing samples and the RLUs for each chemistry tested are shown
in Table 137. The plate reader was a BioTek Synergy H1 (BioTek,
Winooski, Vt.). The background signal of the plates without reagent
was about 200 relative light units per well.
TABLE-US-00137 TABLE 137 Chemical Modifications Sample RLU
Untreated 336 Unmodified Luciferase 33980 5-methylcytosine and
pseudouridine 1601234 5-methylcytosine and N1-methyl-pseudouridine
421189 25% cytosines replaced with 5-methylcytosine 222114 and 25%
of uridines replaced with 2-thiouridine N1-methyl-pseudouridine
3068261 Pseudouridine 140234 N4-Acetylcytidine 1073251
5-methoxyuridine 219657 5-Bromouridine 6787 N4-Acetylcytidineand
N1-methyl-pseudouridine 976219 5-methylcytosine and
5-methoxyuridine 66621 5-methylcytosine and 2'fluorouridine
11333
Example 91
Intramuscular and Subcutaneous Administration of Modified mRNA
[1553] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 140 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 5-methylcytosine and
pseudouridine (5mC/pU), fully modified with 5-methylcytosine and
Nl-methyl-pseudouridine (5mC/NlmpU), fully modified with
pseudouridine (pU), fully modified with N1-methyl-pseudouridine
(NlmpU) or modified where 25% of the cytosines replaced with
5-methylcytosine and 25% of the uridines replaced with
2-thiouridine (5mC/s2U) formulated in PBS (pH 7.4) was administered
to Balb-C mice intramuscularly or subcutaneously at a dose of 2.5
mg/kg. The mice were imaged at 2 hours, 8 hours, 24 hours, 48
hours, 72 hours, 96 hours, 120 hours and 144 hours for
intramuscular delivery and 2 hours, 8 hours, 24 hours, 48 hours, 72
hours, 96 hours and 120 hours for subcutaneous delivery. Twenty
minutes prior to imaging, mice were injected intraperitoneally with
a D-luciferin solution at 150 mg/kg. Animals were then anesthetized
and images were acquired with an IVIS Lumina II imaging system
(Perkin Elmer). Bioluminescence was measured as total flux
(photons/second) of the entire mouse. The average total flux
(photons/second) for intramuscular administration is shown in Table
138 and the average total flux (photons/second) for subcutaneous
administration is shown in Table 139. The background signal was
3.79E+05 (p/s). The peak expression for intramuscular
administration was seen between 24 and 48 hours for all chemistry
and expression was still detected at 144 hours. For subcutaneous
delivery the peak expression was seen at 2-8 hours and expression
was detected at 72 hours.
TABLE-US-00138 TABLE 138 Intramuscular Administration 5mC/ 5mC/
5mC/ pU N1mpU s2U pU N1mpU Flux Flux Flux Flux Flux (p/s) (p/s)
(p/s) (p/s) (p/s) 2 hours 1.98E+07 4.65E+06 4.68E+06 2.33E+06
3.66E+07 8 hours 1.42E+07 3.64E+06 3.78E+06 8.07E+06 7.21E+07 24
hours 2.92E+07 1.22E+07 3.35E+07 1.01E+07 1.75E+08 48 hours
2.64E+07 1.01E+07 5.06E+07 7.46E+06 3.42E+08 72 hours 2.18E+07
8.59E+06 3.42E+07 4.08E+06 5.83E+07 96 hours 2.75E+07 2.70E+06
2.38E+07 4.35E+06 7.15E+07 120 hours 2.19E+07 1.60E+06 1.54E+07
1.25E+06 3.87E+07 144 hours 9.17E+06 2.19E+06 1.14E+07 1.86E+06
5.04E+07
TABLE-US-00139 TABLE 139 Subcutaneous Administration 5mC/ 5mC/ 5mC/
pU N1mpU s2U pU N1mpU Flux Flux Flux Flux Flux (p/s) (p/s) (p/s)
(p/s) (p/s) 2 hours 5.26E+06 4.54E+06 9.34E+06 2.43E+06 2.80E+07 8
hours 2.32E+06 8.75E+05 8.15E+06 2.12E+06 3.09E+07 24 hours
2.67E+06 5.49E+06 3.80E+06 2.24E+06 1.48E+07 48 hours 1.22E+06
1.77E+06 3.07E+06 1.58E+06 1.24E+07 72 hours 1.12E+06 8.00E+05
8.53E+05 4.80E+05 2.29E+06 96 hours 5.16E+05 5.33E+05 4.30E+05
4.30E+05 6.62E+05 120 hours 3.80E+05 4.09E+05 3.21E+05 6.82E+05
5.05E+05
Example 92
Osmotic Pump Study
[1554] Prior to implantation, an osmotic pump (ALZET.RTM. Osmotic
Pump 2001D, DURECT Corp. Cupertino, Calif.) is loaded with the 0.2
ml of 1.times.PBS (pH 7.4) (PBS loaded pump) or 0.2 ml of
luciferase modified mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
N1-methyl-pseudouridine) at 1 mg/ml in 1.times.PBS (pH 7.4)
(Luciferase loaded pump) and incubated overnight in 1.times.PBS (pH
7.4) at 37.degree. C.
[1555] Balb-C mice (n=3) are implanted subcutaneously with either
the PBS loaded pump or the luciferase loaded pump and imaged at 2
hours, 8 hours and 24 hours. As a control a PBS loaded pump is
implanted subcutaneously and the mice are injected subcutaneously
with luciferase modified mRNA in 1.times.PBS (PBS loaded pump; SC
Luciferase) or an osmotic pump is not implanted and the mice are
injected subcutaneously with luciferase modified mRNA in
1.times.PBS (SC Luciferase). The luciferase formulations are
outlined in Table 140.
TABLE-US-00140 TABLE 140 Luciferase Formulations Conc Inj. Vol. Amt
Dose Group Vehicle (mg/ml) (ul) (ug) (mg/kg) PBS loaded pump; PBS
1.00 50 50 2.5 SC Luciferase Luciferase loaded PBS 1.00 -- 200 10.0
pump PBS loaded pump PBS -- -- -- -- SC Luciferase PBS 1.00 50 50
2.5
Example 93
External Osmotic Pump Study
[1556] An external osmotic pump (ALZET.RTM. Osmotic Pump 2001D,
DURECT Corp. Cupertino, Calif.) is loaded with the 0.2 ml of
1.times.PBS (pH 7.4) (PBS loaded pump) or 0.2 ml of luciferase
modified mRNA (mRNA sequence shown in SEQ ID NO: 251443; polyA tail
of approximately 140 nucleotides not shown in sequence; 5' cap,
Cap1; fully modified with 5-methylcytosine and
N1-methyl-pseudouridine) at 1 mg/ml in 1.times.PBS (pH 7.4)
(luciferase loaded pump) and incubated overnight in 1.times.PBS (pH
7.4) at 37.degree. C.
[1557] Using a catheter connected to the external PBS loaded pump
or the luciferase loaded pump Balb-C mice (n=3) are administered
the formulation. The mice are imaged at 2 hours, 8 hours and 24
hours. As a control an external PBS loaded pump is used and the
mice are injected subcutaneously with luciferase modified mRNA in
1.times.PBS (PBS loaded pump; SC Luciferase) or the external pump
is not used and the mice are only injected subcutaneously with
luciferase modified mRNA in 1.times.PBS (SC Luciferase). Twenty
minutes prior to imaging, mice are injected intraperitoneally with
a D-luciferin solution at 150 mg/kg. Animals are then anesthetized
and images are acquired with an IVIS Lumina II imaging system
(Perkin Elmer). Bioluminescence is measured as total flux
(photons/second) of the entire mouse. The luciferase formulations
are outlined in Table 141 and the average total flux
(photons/second).
TABLE-US-00141 TABLE 141 Luciferase Formulations Conc Inj. Vol. Amt
Dose Group Vehicle (mg/ml) (ul) (ug) (mg/kg) PBS loaded pump; PBS
1.00 50 50 2.5 SC Luciferase Luciferase loaded PBS 1.00 -- 200 10.0
pump PBS loaded pump PBS -- -- -- -- SC Luciferase PBS 1.00 50 50
2.5
Example 94
Fibrin Sealant Study
[1558] Fibrin sealant, such as Tisseel (Baxter Healthcare Corp.,
Deerfield, Ill.), is composed of fibrinogen and thrombin in a
dual-barreled syringe. Upon mixing, fibrinogen is converted to
fibrin to form a fibrin clot in about 10 to 30 seconds. This clot
can mimic the natural clotting mechanism of the body. Additionally
a fibrin hydrogel is a three dimensional structure that can
potentially be used in sustained release delivery. Currently,
fibrin sealant is approved for application in hemostasis and
sealing to replace conventional surgical techniques such as suture,
ligature and cautery.
[1559] The thrombin and fibrinogen components were loaded
separately into a dual barreled syringe. Balb-C mice (n=3) were
injected subcutaneously with 50 ul of fibrinogen, 50 ul of thrombin
and they were also injected at the same site with modified
luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443; polyA
tail of approximately 140 nucleotides not shown in sequence; 5'
cap, Cap1; fully modified with 5-methylcytosine and
Nl-methyl-pseudouridine) (Tisseel+Luciferase), 50 ul of fibrinogen
and 50 ul thrombin (Tisseel) or modified luciferase mRNA
(Luciferase). The injection of fibrinogen and thrombin was done
simultaneously using the dual-barreled syringe. The SC injection of
luciferase was done 15 minutes after the fibrinogen/thrombin
injection to allow the fibrin hydrogel to polymerize
(Tisseel+Luciferase group). A control group of untreated mice were
also evaluated. The mice were imaged at 5 hours and 24 hours.
Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The luciferase
formulations are outlined in Table 142 and the average total flux
(photons/second) is shown in Table 143. The fibrin sealant was
found to not interfere with imaging and the injection of luciferase
and Tisseel showed expression of luciferase.
TABLE-US-00142 TABLE 142 Luciferase Formulations Conc Inj. Vol. Amt
Dose Group Vehicle (mg/ml) (ul) (ug) (mg/kg) Tisseel + PBS 1.00 50
50 2.5 Luciferase Tisseel -- -- -- -- -- Luciferase PBS 1.00 50 50
2.5 Untreated -- -- -- -- --
TABLE-US-00143 TABLE 143 Total Flux 5 Hours 24 Hours Group Flux
(p/s) Flux (p/s) Tisseel + Luciferase 4.59E+05 3.39E+05 Tisseel
1.99E+06 1.06E+06 Luciferase 9.94E+05 7.44E+05 Untreated 3.90E+05
3.79E+05
Example 95
Fibrin Containing mRNA Sealant Study
[1560] A. Modified mRNA and Calcium Chloride
[1561] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with N1-methyl-pseudouridine is added to calcium chloride. The
calcium chloride is then used to reconstitute thrombin. Fibrinogen
is reconstituted with fibrinolysis inhibitor solution per the
manufacturer's instructions. The reconstituted thrombin containing
modified mRNA and fibrinogen is loaded into a dual barreled
syringe. Mice are injected subcutaneously with 50 ul of fibrinogen
and 50 ul of thrombin containing modified mRNA or they were
injected with 50 ul of PBS containing an equivalent dose of
modified luciferase mRNA. A control group of untreated mice is also
evaluated. The mice are imaged at predetermined intervals to
determine the average total flux (photons/second).
[1562] B. Lipid Nanoparticle Formulated Modified mRNA and Calcium
Chloride
[1563] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with N1-methyl-pseudouridine is formulated in a lipid nanoparticle
is added to calcium chloride. The calcium chloride is then used to
reconstitute thrombin. Fibrinogen is reconstituted with
fibrinolysis inhibitor solution per the manufacturer's
instructions. The reconstituted thrombin containing modified mRNA
and fibrinogen is loaded into a dual barreled syringe. Mice are
injected subcutaneously with 50 ul of fibrinogen and50 ul of
thrombin containing modified mRNA or they were injected with 50 ul
of PBS containing an equivalent dose of modified luciferase mRNA. A
control group of untreated mice is also evaluated. The mice are
imaged at predetermined intervals to determine the average total
flux (photons/second).
[1564] C. Modified mRNA and Fibrinogen
[1565] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with Nl-methyl-pseudouridine is added to the fibrinolysis inhibitor
solution. The fibrinolysis inhibitor solution is then used to
reconstitute fibrinogen. Thrombin is reconstituted with the calcium
chloride solution per the manufacturer's instructions. The
reconstituted fibrinogen containing modified mRNA and thrombin is
loaded into a dual barreled syringe. Mice are injected
subcutaneously with 50 ul of thrombin and 50 ul of fibrinogen
containing modified mRNA or they were injected with 50 ul of PBS
containing an equivalent dose of modified luciferase mRNA. A
control group of untreated mice is also evaluated. The mice are
imaged at predetermined intervals to determine the average total
flux (photons/second).
[1566] D. Lipid Nanoparticle Formulated Modified mRNA and
Fibrinogen
[1567] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with N1-methyl-pseudouridine is formulated in a lipid nanoparticle
is added to the fibrinolysis inhibitor solution. The fibrinolysis
inhibitor solution is then used to reconstitute fibrinogen.
Thrombin is reconstituted with the calcium chloride solution per
the manufacturer's instructions. The reconstituted fibrinogen
containing modified mRNA and thrombin is loaded into a dual
barreled syringe. Mice are injected subcutaneously with 50 ul of
thrombin and 50 ul of fibrinogen containing modified mRNA or they
were injected with 50 ul of PBS containing an equivalent dose of
modified luciferase mRNA. A control group of untreated mice is also
evaluated. The mice are imaged at predetermined intervals to
determine the average total flux (photons/second).
[1568] E. Modified mRNA and Thrombin
[1569] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with N1-methyl-pseudouridine is added to the reconstituted thrombin
after it is reconstituted with the calcium chloride per the
manufactuer's instructions. The fibrinolysis inhibitor solution is
then used to reconstitute fibrinogen per the manufacturer's
instructions. The reconstituted fibrinogen and thrombin containing
modified mRNA is loaded into a dual barreled syringe. Mice are
injected subcutaneously with 50 ul of thrombin containing modified
mRNA and 50 ul of fibrinogen or they were injected with 50 ul of
PBS containing an equivalent dose of modified luciferase mRNA. A
control group of untreated mice is also evaluated. The mice are
imaged at predetermined intervals to determine the average total
flux (photons/second).
[1570] F. Lipid Nanoparticle Formulated Modified mRNA and
Thrombin
[1571] Prior to reconstitution, luciferase mRNA (mRNA sequence
shown in SEQ ID NO: 251443; polyA tail of approximately 140
nucleotides not shown in sequence; 5' cap, Cap1) fully modified
with 5-methylcytosine and N1-methyl-pseudouridine or fully modified
with N1-methyl-pseudouridine is formulated in a lipid nanoparticle
is added to the reconstituted thrombin after it is reconstituted
with the calcium chloride per the manufactuer's instructions. The
fibrinolysis inhibitor solution is then used to reconstitute
fibrinogen per the manufacturer's instructions. The reconstituted
fibrinogen and thrombin containing modified mRNA is loaded into a
dual barreled syringe. Mice are injected subcutaneously with 50 ul
of thrombin containing modified mRNA and 50 ul of fibrinogen or
they were injected with 50 ul of PBS containing an equivalent dose
of modified luciferase mRNA. A control group of untreated mice is
also evaluated. The mice are imaged at predetermined intervals to
determine the average total flux (photons/second).
Example 96
Cationic Lipid Formulation of 5-Methylcytosine and
N1-Methyl-Pseudouridine Modified mRNA
[1572] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) fully modified with 5-methylcytosine and
N1-methyl-pseudouridine was formulated in the cationic lipids
described in Table 144. The formulations were administered
intravenously (I.V.), intramuscularly (I.M.) or subcutaneously
(S.C.) to Balb-C mice at a dose of 0.05 mg/kg.
TABLE-US-00144 TABLE 144 Cationic Lipid Formulations Formulation
NPA-126-1 NPA-127-1 NPA-128-1 NPA-129-1 111612-B Lipid DLin-MC3-DMA
DLin-KC2-DMA C12-200 DLinDMA DODMA Lipid/mRNA 20:1 20:1 20:1 20:1
20:1 ratio (wt/wt) Mean Size 122 nm 114 nm 153 nm 137 nm 223.2 nm
PDI: 0.13 PDI: 0.10 PDI: 0.17 PDI: 0.09 PDI: 0.142 Zeta at pH 7.4
-1.4 mV -0.5 mV -1.4 mV 2.0 mV -3.09 mV Encaps. (RiboGr) 95% 77%
69% 80% 64%
[1573] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours and 24 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 4.17E+05 p/s. The results of the imaging are shown in
Table 145. In Table 145, "NT" means not tested.
TABLE-US-00145 TABLE 145 Flux DLin- DLin- MC3-DMA KC2-DMA C12-200
DLinDMA DODMA Route Time Point Flux (p/s) Flux (p/s) Flux (p/s)
Flux (p/s) Flux (p/s) I.V. 2 hrs 1.92E+08 2.91E+08 1.08E+08
2.53E+07 8.40E+06 I.V. 8 hrs 1.47E+08 2.13E+08 3.72E+07 3.82E+07
5.62E+06 I.V. 24 hrs 1.32E+07 2.41E+07 5.35E+06 4.20E+06 8.97E+05
I.M. 2 hrs 8.29E+06 2.37E+07 1.80E+07 1.51E+06 NT I.M. 8 hrs
5.83E+07 2.12E+08 2.60E+07 1.99E+07 NT I.M. 24 hrs 4.30E+06
2.64E+07 3.01E+06 9.46E+05 NT S.C. 2 hrs 1.90E+07 5.16E+07 8.91E+07
4.66E+06 9.61E+06 S.C. 8 hrs 7.74E+07 2.00E+08 4.58E+07 9.67E+07
1.90E+07 S.C. 24 hrs 7.49E+07 2.47E+07 6.96E+06 6.50E+06
1.28E+06
Example 97
Lipid Nanoparticle Intravenous Study
[1574] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was formulated in a lipid nanoparticle containing
50% DLin-MC3-DMA OR DLin-KC2-DMA as described in Table 146, 38.5%
cholesterol, 10% DSPC and 1.5% PEG. The formulation was
administered intravenously (I.V.) to Balb-C mice at a dose of 0.5
mg/kg, 0.05 mg/kg, 0.005 mg/kg or 0.0005 mg/kg. Twenty minutes
prior to imaging, mice were injected intraperitoneally with a
D-luciferin solution at 150 mg/kg. Animals were then anesthetized
and images were acquired with an IVIS Lumina II imaging system
(Perkin Elmer). Bioluminescence was measured as total flux
(photons/second) of the entire mouse.
TABLE-US-00146 TABLE 146 Formulations Formulation NPA-098-1
NPA-100-1 Lipid DLin-KC2-DMA DLin-MC3-DMA Lipid/mRNA ratio (wt/wt)
20:1 20:1 Mean Size 135 nm 152 nm PDI: 0.08 PDI: 0.08 Zeta at pH
7.4 -0.6 mV -1.2 mV Encaps. (RiboGr) 91% 94%
[1575] For DLin-KC2-DMA the mice were imaged at 2 hours, 8 hours,
24 hours, 72 hours, 96 hours and 168 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 3.66E+05 p/s. The results of the imaging are shown in
Table 147. Organs were imaged at 8 hours and the average total flux
(photons/second) was measured for the liver, spleen, lung and
kidney. A control for each organ was also analyzed. The results are
shown in Table 149. The peak signal for all dose levels was at 8
hours after administration. Also, distribution to the various
organs (liver, spleen, lung, and kidney) may be able to be
controlled by increasing or decreasing the LNP dose.
TABLE-US-00147 TABLE 147 Flux Time 0.5 mg/kg 0.05 mg/kg 0.005 mg/kg
0.0005 mg/kg Point Flux (p/s) Flux (p/s) Flux (p/s) Flux (p/s) 2
hrs 3.54E+08 1.75E+07 2.30E+06 4.09E+05 8 hrs 1.67E+09 1.71E+08
9.81E+06 7.84E+05 24 hrs 2.05E+08 2.67E+07 2.49E+06 5.51E+05 72 hrs
8.17E+07 1.43E+07 1.01E+06 3.75E+05 96 hrs 4.10E+07 9.15E+06
9.58E+05 4.29E+05 168 hrs 3.42E+07 9.15E+06 1.47E+06 5.29E+05
TABLE-US-00148 TABLE 148 Organ Flux Liver Spleen Lung Kidney Flux
(p/s) Flux (p/s) Flux (p/s) Flux (p/s) 0.5 mg/kg 1.42E+08 4.86E+07
1.90E+05 3.20E+05 0.05 mg/kg 7.45E+06 4.62E+05 6.86E+04 9.11E+04
0.005 mg/kg 3.32E+05 2.97E+04 1.42E+04 1.15E+04 0.0005 mg/kg
2.34E+04 1.08E+04 1.87E+04 9.78E+03 Untreated 1.88E+04 1.02E+04
1.41E+04 9.20E+03
[1576] For DLin-MC3-DMA the mice were imaged at 2 hours, 8 hours,
24 hours, 48 hours, 72 hours and 144 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 4.51E+05 p/s. The results of the imaging are shown in
Table 149. Organs were imaged at 8 hours and the average total flux
(photons/second) was measured for the liver, spleen, lung and
kidney. A control for each organ was also analyzed. The results are
shown in Table 150. The peak signal for all dose levels was at 8
hours after administration. Also, distribution to the various
organs (liver, spleen, lung, and kidney) may be able to be
controlled by increasing or decreasing the LNP dose.
TABLE-US-00149 TABLE 149 Flux Time 0.5 mg/kg 0.05 mg/kg 0.005 mg/kg
0.0005 mg/kg Point Flux (p/s) Flux (p/s) Flux (p/s) Flux (p/s) 2
hrs 1.23E+08 7.76E+06 7.66E+05 4.88E+05 8 hrs 1.05E+09 6.79E+07
2.75E+06 5.61E+05 24 hrs 4.44E+07 1.00E+07 1.06E+06 5.71E+05 48 hrs
2.12E+07 4.27E+06 7.42E+05 4.84E+05 72 hrs 1.34E+07 5.84E+06
6.90E+05 4.38E+05 144 hrs 4.26E+06 2.25E+06 4.58E+05 3.99E+05
TABLE-US-00150 TABLE 150 Organ Flux Liver Spleen Lung Kidney Flux
(p/s) Flux (p/s) Flux (p/s) Flux (p/s) 0.5 mg/kg 1.19E+08 9.66E+07
1.19E+06 1.85E+05 0.05 mg/kg 1.10E+07 1.79E+06 7.23E+04 5.82E+04
0.005 mg/kg 3.58E+05 6.04E+04 1.33E+04 1.33E+04 0.0005 mg/kg
2.25E+04 1.88E+04 2.05E+04 1.65E+04 Untreated 1.91E+04 1.66E+04
2.63E+04 2.14E+04
Example 98
Lipid Nanoparticle Subcutaneous Study
[1577] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) was formulated in a lipid nanoparticle containing
50% DLin-KC2-DMA as described in Table 151, 385% cholesterol, 10%
DSPC and 1.5% PEG. The formulation was administered subcutaneously
(S.C.) to Balb-C mice at a dose of 0.5 mg/kg, 0.05 mg/kg or 0.005
mg/kg.
TABLE-US-00151 TABLE 151 DLin-KC2-DMA Formulation Formulation
NPA-098-1 Lipid DLin-KC2-DMA Lipid/mRNA ratio (wt/wt) 20:1 Mean
Size 135 nm PDI: 0.08 Zeta at pH 7.4 -0.6 mV Encaps. (RiboGr)
91%
[1578] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours, 24 hours, 48 hours, 72 hours and 144
hours after dosing and the average total flux (photons/second) was
measured for each route of administration and cationic lipid
formulation. The lower limit of detection was about 3E+05 p/s. The
results of the imaging are shown in Table 152. Organs were imaged
at 8 hours and the average total flux (photons/second) was measured
for the liver, spleen, lung and kidney. A control for each organ
was also analyzed. The results are shown in Table 153. The peak
signal for all dose levels was at 8 hours after administration.
Also, distribution to the various organs (liver, spleen, lung, and
kidney) may be able to be controlled by increasing or decreasing
the LNP dose. At high doses, the LNP formulations migrates outside
of the subcutaneous injection site, as high levels of luciferase
expression are detected in the liver, spleen, lung, and kidney.
TABLE-US-00152 TABLE 152 Flux Time 0.5 mg/kg 0.05 mg/kg 0.005 mg/kg
Point Flux (p/s) Flux (p/s) Flux (p/s) 2 hrs 3.18E+07 7.46E+06
8.94E+05 8 hrs 5.15E+08 2.18E+08 1.34E+07 24 hrs 1.56E+08 5.30E+07
7.16E+06 48 hrs 5.22E+07 8.75E+06 9.06E+05 72 hrs 8.87E+06 1.50E+06
2.98E+05 144 hrs 4.55E+05 3.51E+05 2.87E+05
TABLE-US-00153 TABLE 153 Organ Flux Liver Spleen Lung Kidney Flux
(p/s) Flux (p/s) Flux (p/s) Flux (p/s) 0.5 mg/kg 1.01E+07 7.43E+05
9.75E+04 1.75E+05 0.05 mg/kg 1.61E+05 3.94E+04 4.04E+04 3.29E+04
0.005 mg/kg 2.84E+04 2.94E+04 2.42E+04 9.79E+04 Untreated 1.88E+04
1.02E+04 1.41E+04 9.20E+03
Example 99
Cationic Lipid Nanoparticle Subcutaneous Study
[1579] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) is formulated in a lipid nanoparticle containing 50%
DLin-MC3-DMA, 38.5% cholesterol, 10% DSPC and 1.5% PEG. The
formulation is administered subcutaneously (S.C.) to Balb-C mice at
a dose of 0.5 mg/kg, 0.05 mg/kg or 0.005 mg/kg.
[1580] The mice are imaged at 2 hours, 8 hours, 24 hours, 48 hours,
72 hours and 144 hours after dosing and the average total flux
(photons/second) was measured for each route of administration and
cationic lipid formulation. Organs are imaged at 8 hours and the
average total flux (photons/second) is measured for the liver,
spleen, lung and kidney. A control for each organ is also
analyzed.
Example 100
Luciferase Lipoplex Study
[1581] Lipoplexed luciferase mRNA (mRNA sequence shown in SEQ ID
NO: 251443; polyA tail of approximately 140 nucleotides not shown
in sequence; 5' cap, Cap1) fully modified with 5-methylcytosine and
pseudouridine (5mC/pU), fully modified with 5-methylcytosine and
N1-methyl-pseudouridine (5mC/NlmpU) or modified where 25% of the
cytosines replaced with 5-methylcytosine and 25% of the uridines
replaced with 2-thiouridine (5mC/s2U). The formulation was
administered intravenously (I.V.), intramuscularly (I.M.) or
subcutaneously (S.C.) to Balb-C mice at a dose of 0.10 mg/kg.
[1582] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 8 hours, 24 hours and 48 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and chemical modification. The background signal was
about 3.91E+05 p/s. The results of the imaging are shown in Table
154. Organs were imaged at 6 hours and the average total flux
(photons/second) was measured for the liver, spleen, lung and
kidney. A control for each organ was also analyzed. The results are
shown in Table 155.
TABLE-US-00154 TABLE 154 Flux Time 5mC/pU 5mC/N1mpU 5mC/s2U Route
Point Flux (p/s) Flux (p/s) Flux (p/s) I.V. 8 hrs 5.76E+06 1.78E+06
1.88E+06 I.V. 24 hrs 1.02E+06 7.13E+05 5.28E+05 I.V. 48 hrs
4.53E+05 3.76E+05 4.14E+05 I.M. 8 hrs 1.90E+06 2.53E+06 1.29E+06
I.M. 24 hrs 9.33E+05 7.84E+05 6.48E+05 I.M. 48 hrs 8.51E+05
6.59E+05 5.49E+05 S.C. 8 hrs 2.85E+06 6.48E+06 1.14E+06 S.C. 24 hrs
6.66E+05 7.15E+06 3.93E+05 S.C. 48 hrs 3.24E+05 3.20E+06
5.45E+05
TABLE-US-00155 TABLE 155 Organ Flux Liver Spleen Lung Kidney Inj.
Site Route Chemistry Flux (p/s) Flux (p/s) Flux (p/s) Flux (p/s)
Flux (p/s) I.V. 5mC/pU 5.26E+05 2.04E+07 4.28E+06 1.77E+04 n/a I.V.
5mC/N1mpU 1.48E+05 5.00E+06 1.93E+06 1.77E+04 n/a I.V. 5mC/s2U
2.14E+04 3.29E+06 5.48E+05 2.16E+04 n/a I.M. 5mC/pU 2.46E+04
1.38E+04 1.50E+04 1.44E+04 1.15E+06 I.M. 5mC/N1mpU 1.72E+04
1.76E+04 1.99E+04 1.56E+04 1.20E+06 I.M. 5mC/s2U 1.28E+04 1.36E+04
1.33E+04 1.07E+04 7.60E+05 S.C. 5mC/pU 1.55E+04 1.67E+04 1.45E+04
1.69E+04 4.46E+04 S.C. 5mC/N1mpU 1.20E+04 1.46E+04 1.38E+04
1.14E+04 8.29E+04 S.C. 5mC/s2U 1.22E+04 1.31E+04 1.45E+04 1.08E+04
5.62E+04 Untreated 2.59E+04 1.34E+04 1.26E+04 1.22E+04 n/a
Example 101
Cationic Lipid Formulation of Modified mRNA
[1583] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) modified where 25% of the cytosines replaced with
5-methylcytosine and 25% of the uridines replaced with
2-thiouridine (5mC/s2U) was formulated in the cationic lipids
described in Table 156. The formulations were administered
intravenously (I.V.), intramuscularly (I.M.) or subcutaneously
(S.C.) to Balb-C mice at a dose of 0.05 mg/kg.
TABLE-US-00156 TABLE 156 Cationic Lipid Formulations Formulation
NPA-130-1 NPA-131-1 NPA-132-1 NPA-133-1 111612-C Lipid DLin-MC3-DMA
DLin-KC2-DMA C12-200 DLinDMA DODMA Lipid/mRNA 20:1 20:1 20:1 20:1
20:1 ratio (wt/wt) Mean Size 120 nm 105 nm 122 nm 105 nm 221.3 nm
PDI: 0.10 PDI: 0.11 PDI: 0.13 PDI: 0.14 PDI: 0.063 Zeta at pH 7.4
0.2 mV -0.6 mV -0.5 mV -0.3 mV -3.10 mV Encaps. (RiboGr) 100% 100%
93% 93% 60%
[1584] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours and 24 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 3.31E+05 p/s. The results of the imaging are shown in
Table 157. In Table 157, "NT" means not tested. Untreated mice
showed an average flux of 3.14E+05 at 2 hours, 3.33E+05 at 8 hours
and 3.46E+05 at 24 hours. Peak expression was seen for all three
routes tested at 8 hours. DLin-KC2-DMA has better expression than
DLin-MC3-DMA and DODMA showed expression for all routes
evaluated.
TABLE-US-00157 TABLE 157 Flux DLin-MC3- DLin-KC2- DMA DMA C12-200
DLinDMA DODMA Route Time Point Flux (p/s) Flux (p/s) Flux (p/s)
Flux (p/s) Flux (p/s) I.V. 2 hrs 9.88E+06 6.98E+07 9.18E+06
3.98E+06 5.79E+06 I.V. 8 hrs 1.21E+07 1.23E+08 1.02E+07 5.98E+06
6.14E+06 I.V. 24 hrs 2.02E+06 1.05E+07 1.25E+06 1.35E+06 5.72E+05
I.M. 2 hrs 6.72E+05 3.66E+06 3.25E+06 7.34E+05 4.42E+05 I.M. 8 hrs
7.78E+06 2.85E+07 4.29E+06 2.22E+06 1.38E+05 I.M. 24 hrs 4.22E+05
8.79E+05 5.95E+05 8.48E+05 4.80E+05 S.C. 2 hrs 2.37E+06 4.77E+06
4.44E+06 1.07E+06 1.05E+06 S.C. 8 hrs 3.65E+07 1.17E+08 3.71E+06
9.33E+06 2.57E+06 S.C. 24 hrs 4.47E+06 1.28E+07 6.39E+05 8.89E+05
4.27E+05
Example 102
Formulation of 5-Methylcytosine and N1-Methyl-Pseudouridine
Modified mRNA
[1585] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) fully modified with 5-methylcytosine and
N1-methyl-pseudouridine was formulated in PBS (pH of 7.4). The
formulations were administered intramuscularly (I.M.) or
subcutaneously (S.C.) to Balb-C mice at a dose of 2.5 mg/kg.
[1586] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 5 minutes, 30 minutes, 60 minutes and 120 minutes after
dosing and the average total flux (photons/second) was measured for
each route of administration and cationic lipid formulation. The
background flux was about 3.78E+05 p/s. The results of the imaging
are shown in Table 158. Expression of luciferase was already seen
at 30 minutes with both routes of delivery. Peak expression from
subcutaneous administration appears between 30 to 60 minutes.
Intramuscular expression was still increasing at 120 minutes.
TABLE-US-00158 TABLE 158 Flux PBS (pH 7.4) Route Time Point Flux
(p/s) I.M. 5 min 4.38E+05 I.M. 30 min 1.09E+06 I.M. 60 min 1.18E+06
I.M. 120 min 2.86E+06 S.C. 5 min 4.19E+05 S.C. 30 min 6.38E+06 S.C.
60 min 5.61E+06 S.C. 120 min 2.66E+06
Example 103
Intramuscular and Subcutaneous Administration of Chemically
Modified mRNA
[1587] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 140 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with N4-acetylcytidine,
fully modified with 5-methoxyuridine, fully modified with
N4-acetylcytidine and N1-methyl-pseudouridine or fully modified
5-methylcytosine and 5-methoxyuridine formulated in PBS (pH 7.4)
was administered to Balb-C mice intramuscularly or subcutaneously
at a dose of 2.5 mg/kg. Twenty minutes prior to imaging, mice were
injected intraperitoneally with a D-luciferin solution at 150
mg/kg. Animals were then anesthetized and images were acquired with
an IVIS Lumina II imaging system (Perkin Elmer). Bioluminescence
was measured as total flux (photons/second) of the entire mouse.
The mice were imaged at 2 hours, 8 hours and 24 hours. The average
total flux (photons/second) for intramuscular administration is
shown in Table 159 and the average total flux (photons/second) for
subcutaneous administration is shown in Table 160. The background
signal was 3.84E+05 (p/s). The peak expression for intramuscular
administration was seen between 24 and 48 hours for all chemistry
and expression was still detected at 120 hours. For subcutaneous
delivery the peak expression was seen at 2-8 hours and expression
was detected at 72 hours.
TABLE-US-00159 TABLE 159 Intramuscular Administration 2 hours 8
hours 24 hours Flux (p/s) Flux (p/s) Flux (p/s) N4-acetylcytidine
1.32E+07 2.15E+07 4.01E+07 5-methoxyuridine 4.93E+06 1.80E+07
4.53E+07 N4-acetylcytidine/ 2.02E+07 1.93E+07 1.63E+08
N1-methyl-pseudouridine 5-methylcytosine/5- 6.79E+06 4.55E+07
3.44E+07 methoxyuridine
TABLE-US-00160 TABLE 160 Subcutaneous Administration 2 hours 8
hours 24 hours Flux (p/s) Flux (p/s) Flux (p/s) N4-acetylcytidine
3.07E+07 1.23E+07 1.28E+07 5-methoxyuridine 7.10E+06 9.38E+06
1.32E+07 N4-acetylcytidine/ 7.12E+06 3.07E+06 1.03E+07
N1-methyl-pseudouridine 5-methylcytosine/5- 7.15E+06 1.25E+07
1.11E+07 methoxyuridine
Example 104
In Vivo Study
[1588] Luciferase modified mRNA containing at least one chemical
modification is formulated as a lipid nanoparticle (LNP) using the
syringe pump method and characterized by particle size, zeta
potential, and encapsulation.
[1589] As outlined in Table 161, the luciferase LNP formulation is
administered to Balb-C mice intramuscularly (I.M.), intravenously
(I.V.) and subcutaneously (S.C.). As a control luciferase modified
RNA formulated in PBS is administered intravenously to mice.
TABLE-US-00161 TABLE 161 Luciferase Formulations Concen- Injection
Amount of Formula- tration Volume modified Dose tion Vehicle Route
(mg/ml) (ul) RNA (ug) (mg/kg) Luc-LNP PBS S.C. 0.2000 50 10 0.5000
Luc-LNP PBS S.C. 0.0200 50 1 0.0500 Luc-LNP PBS S.C. 0.0020 50 0.1
0.0050 Luc-LNP PBS S.C. 0.0002 50 0.01 0.0005 Luc-LNP PBS I.V.
0.2000 50 10 0.5000 Luc-LNP PBS I.V. 0.0200 50 1 0.0500 Luc-LNP PBS
I.V. 0.0020 50 0.1 0.0050 Luc-LNP PBS I.V. 0.0002 50 0.01 0.0005
Luc-LNP PBS I.M. 0.2000 50 10 0.5000 Luc-LNP PBS I.M. 0.0200 50 1
0.0500 Luc-LNP PBS I.M. 0.0020 50 0.1 0.0050 Luc-LNP PBS I.M.
0.0002 50 0.01 0.0005 Luc-PBS PBS I.V. 0.20 50 10 0.50
[1590] The mice are imaged at 2, 8, 24, 48, 120 and 192 hours to
determine the bioluminescence (measured as total flux
(photons/second) of the entire mouse). At 8 hours or 192 hours the
liver, spleen, kidney and injection site for subcutaneous and
intramuscular administration are imaged to determine the
bioluminescence.
Example 105
Cationic Lipid Formulation Studies of Chemically Modified mRNA
[1591] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) fully modified with 5-methylcytosine and
pseudouridine (5mC/pU), pseudouridine (pU) or
N1-methyl-pseudouridine (NlmpU) was formulated in the cationic
lipids described in Table 162. The formulations were administered
intravenously (I.V.), intramuscularly (I.M.) or subcutaneously
(S.C.) to Balb-C mice at a dose of 0.05 mg/kg.
TABLE-US-00162 TABLE 162 Cationic Lipid Formulations Formulation
NPA-137-1 NPA-134-1 NPA-135-1 NPA-136-1 111612-A Lipid DLin-MC3-DMA
DLin-MC3-DMA DLin-KC2-DMA C12-200 DODMA Lipid/mRNA 20:1 20:1 20:1
20:1 20:1 ratio (wt/wt) Mean Size 111 nm 104 nm 95 nm 143 nm 223.2
nm PDI: 0.15 PDI: 0.13 PDI: 0.11 PDI: 0.12 PDI: 0.142 Zeta at pH
7.4 -4.1 mV -1.9 mV -1.0 mV 0.2 mV -3.09 mV Encaps. (RiboGr) 97%
100% 100% 78% 64% Chemistry pU N1mpU N1mpU N1mpU 5mC/pU
[1592] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours and 24 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 4.11E+05 p/s. The results of the imaging are shown in
Table 163. Peak expression was seen for all three routes tested at
8 hours.
TABLE-US-00163 TABLE 163 Flux DLin-MC3- DLin-MC3- DLin-KC2- C12-200
DODMA DMA (pU) DMA (N1mpU) DMA (N1mpU) (N1mpU) (5mC/pU) Route Time
Point Flux (p/s) Flux (p/s) Flux (p/s) Flux (p/s) Flux (p/s) I.V. 2
hrs 3.21E+08 1.24E+09 1.01E+09 9.00E+08 3.90E+07 I.V. 8 hrs
1.60E+09 3.22E+09 2.38E+09 1.11E+09 1.17E+07 I.V. 24 hrs 1.41E+08
3.68E+08 3.93E+08 8.06E+07 1.11E+07 I.M. 2 hrs 2.09E+07 3.29E+07
8.32E+07 9.43E+07 4.66E+06 I.M. 8 hrs 2.16E+08 6.14E+08 1.00E+09
8.77E+07 7.05E+06 I.M. 24 hrs 1.23E+07 1.40E+08 5.09E+08 1.36E+07
1.14E+06 S.C. 2 hrs 2.32E+07 3.60E+07 2.14E+08 1.01E+08 3.11E+07
S.C. 8 hrs 5.55E+08 9.80E+08 4.93E+09 1.01E+09 8.04E+07 S.C. 24 hrs
1.81E+08 2.74E+08 2.12E+09 4.74E+07 1.34E+07
Example 106
Studies of Chemical Modified mRNA
[1593] Luciferase mRNA (mRNA sequence shown in SEQ ID NO: 251443;
polyA tail of approximately 140 nucleotides not shown in sequence;
5' cap, Cap1) fully modified with N4-acetylcytidine (N-4-acetyl),
fully modified with 5-methoxyuridine (5-meth), fully modified with
N4-acetylcytidine and Nl-methyl-pseudouridine (N-4-acetyl/NlmpU) or
fully modified with 5-methylcytosine and 5-methoxyuridine
(5mC/5-meth) was formulated in DLin-MC3-DMA as described in Table
164.
[1594] The formulations were administered intravenously (I.V.),
intramuscularly (I.M.) or subcutaneously (S.C.) to Balb-C mice at a
dose of 0.05 mg/kg.
TABLE-US-00164 TABLE 164 Cationic Lipid Formulations Formulation
NPA-141-1 NPA-142-1 NPA-143-1 NPA-144-1 Lipid DLin-MC3-DMA
DLin-MC3-DMA DLin-MC3-DMA DLin-MC3-DMA Lipid/mRNA 20:1 20:1 20:1
20:1 ratio (wt/wt) Mean Size 138 nm 116 nm 144 nm 131 nm PDI: 0.16
PDI: 0.15 PDI: 0.15 PDI: 0.15 Zeta at pH 7.4 -2.8 mV -2.8 mV -4.3
mV -5.0 mV Encaps. (RiboGr) 97% 100% 75% 72% Chemistry N4-acetyl
5meth N4-acetyl/N1mpU 5mC/5-meth
[1595] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 6 hours and 24 hours after dosing and the
average total flux (photons/second) was measured for each route of
administration and cationic lipid formulation. The background flux
was about 2.70E+05 p/s. The results of the imaging are shown in
Table 165.
TABLE-US-00165 TABLE 165 Flux N4- N4-acetyl/ 5mC/5- Time acetyl
5meth N1mpU meth Route Point Flux (p/s) Flux (p/s) Flux (p/s) Flux
(p/s) I.V. 2 hrs 9.17E+07 3.19E+06 4.21E+07 1.88E+06 I.V. 6 hrs
7.70E+08 9.28E+06 2.34E+08 7.75E+06 I.V. 24 hrs 6.84E+07 1.04E+06
3.55E+07 3.21E+06 I.M. 2 hrs 8.59E+06 7.86E+05 5.30E+06 5.11E+05
I.M. 6 hrs 1.27E+08 8.88E+06 3.82E+07 3.17E+06 I.M. 24 hrs 4.46E+07
1.38E+06 2.00E+07 1.39E+06 S.C. 2 hrs 1.83E+07 9.67E+05 4.45E+06
1.01E+06 S.C. 6 hrs 2.89E+08 1.78E+07 8.91E+07 1.29E+07 S.C. 24 hrs
6.09E+07 6.40E+06 2.08E+08 6.63E+06
Example 107
Lipid Nanoparticle Containing A Plurality of Modified mRNAs
[1596] EPO mRNA (mRNA sequence shown in SEQ ID NO: 251436; polyA
tail of approximately 140 nucleotides not shown in sequence; 5'
cap, Cap1; fully modified with 5-methylcytosine and
N1-methyl-pseudouridine), G-CSF mRNA (mRNA sequence shown in SEQ ID
NO: 251433; polyA tail of approximately 140 nucleotides not shown
in sequence; 5' cap, Cap1; fully modified with 5-methylcytosine and
N1-methyl-pseudouridine) and Factor IX mRNA (mRNA sequence shown in
SEQ ID NO: 251437; polyA tail of approximately 140 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and N1-methyl-pseudouridine), is formulated in
DLin-MC3-DMA as described in Table 166. The formulations are
administered intravenously (I.V.), intramuscularly (I.M.) or
subcutaneously (S.C.) to Balb-C mice at a dose of 0.05 mg/kg.
Control LNP formulations containing only one mRNA are also
admininistered at an equivalent dose.
TABLE-US-00166 TABLE 166 DLin-MC3-DMA Formulation Formulation
NPA-157-1 Lipid DLin-MC3- DMA Lipid/mRNA ratio (wt/wt) 20:1 Mean
Size 89 nm PDI: 0.08 Zeta at pH 7.4 1.1 mV Encaps. (RiboGr) 97%
[1597] Serum is collected from the mice at 8 hours, 24 hours, 72
hours and/or 7 days after administration of the formulation. The
serum is analyzed by ELISA to determine the protein expression of
EPO, G-CSF, and Factor IX.
Example 108
Cationic Lipid Formulation Studies of 5-Methylcytosine and
N1-Methyl-Pseudouridine Modified mRNA
[1598] EPO mRNA (mRNA sequence shown in SEQ ID NO: 251436; polyA
tail of approximately 140 nucleotides not shown in sequence; 5'
cap, Cap1; fully modified with 5-methylcytosine and
N1-methyl-pseudouridine) or G-CSF mRNA (mRNA sequence shown in SEQ
ID NO: 251433; polyA tail of approximately 140 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and N1-methyl-pseudouridine) is formulated in
DLin-MC3-DMA and DLin-KC2-DMA as described in Table 167. The
formulations are administered intravenously (I.V), intramuscularly
(I.M.) or subcutaneously (S.C.) to Balb-C mice at a dose of 0.05
mg/kg.
TABLE-US-00167 TABLE 167 DLin-MC3-DMA and DLin-KC2-DMA Formulations
Formulation NPA-147-1 NPA-148-1 NPA-150-1 NPA-151-1 mRNA EPO EPO
G-CSF G-CSF Lipid DLin-MC3-DMA DLin-KC2-DMA DLin-MC3-DMA
DLin-KC2-DMA Lipid/mRNA 20:1 20:1 20:1 20:1 ratio (wt/wt) Mean Size
117 nm 82 nm 119 nm 88 nm PDI: 0.14 PDI: 0.08 PDI: 0.13 PDI: 0.08
Zeta at pH 7.4 -1.7 mV 0.6 mV 3.6 mV 2.2 mV Encaps. (RiboGr) 100%
96% 100% 100%
[1599] Serum is collected from the mice at 8 hours, 24 hours, 72
hours and/or 7 days after administration of the formulation. The
serum is analyzed by ELISA to determine the protein expression of
EPO and G-CSF.
Example 109
In Vitro VEGF PBMC Study
[1600] 500 ng of VEGF mRNA (mRNA sequence shown in SEQ ID NO:
251446 polyA tail of approximately 160 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 5-methylcytosine and
pseudouridine (VEGF 5mC/pU), fully modified with 5-methylcytosine
and Nl-methyl-pseudouridine (VEGF 5mC/NlmpU) or unmodified (VEGF
unmod) was transfected with 0.4 uL of Lipofectamine 2000 into
peripheral blood mononuclear cells (PBMC) from three normal blood
donors (D1, D2, and D3). Cells were also untreated for each donor
as a control. The supernatant was harvested and run by ELISA 22
hours after transfection to determine the protein expression and
cytokine induction. The expression of VEGF and IFN-alpha induction
is shown in Table 168 and FIGS. 8A and 8B.
TABLE-US-00168 TABLE 168 Protein and Cytokine levels VEGF
Expression IFN-alpha Induction (pg/ml) (pg/ml) D1 D2 D3 D1 D2 D3
VEGF unmod 2 0 0 5400 3537 4946 VEGF 5mC/pU 424 871 429 145 294 106
VEGF 5mC/N1mpU 5088 10331 6183 205 165 6
Example 110
In Vitro Expression of Modified mRNA
[1601] HEK293 cells were transfected EPO modified mRNA (mRNA
sequence shown in SEQ ID NO:251436; polyA tail of approximately 160
nucleotides not shown in sequence; 5' cap, Cap1; fully modified
with 5-methylcytosine and pseudouridine), HeLa cells were forward
transfected with Transforming growth factor beta (TGF-beta)
modified mRNA (mRNA sequence shown in SEQ ID NO: 251447; poly A
tail of approximately 160 nucleotides not shown in sequence; 5'
cap, Cap1; fully modified with 5-methylcytosine and pseudouridine)
and HepG2 cells were transfected with
bactericidal/permeability-increasing protein (rBPI-21) modified
mRNA (mRNA sequence shown in SEQ ID NO: 251448; poly A tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and pseudouridine) which had
been complexed with Lipofectamine-2000 from Invitrogen (Carlsbad,
Calif.) at the concentrations shown in Table 169, 170 and 171 using
the procedures described herein. The protein expression was
detected by ELISA and the protein (pg/ml) is also shown in Table
169, 170 and 171. In Table 169, ">" means greater than. For
TGF-beta a control of untreated cells and a mock transfection of
Lipofectamine-2000 was also tested.
TABLE-US-00169 TABLE 169 EPO Protein Expression Amount Transfected
5 1 200 40 8 1.6 320 64 ng ng pg pg pg pg fg fg Protein >2000
609.486 114.676 0 0 0 0 0 (pg/ml)
TABLE-US-00170 TABLE 170 TGF-beta Protein Expression Amount
Transfected 750 ng 250 ng 83 ng Mock Untreated Protein 5058 4325
3210 2 0 (pg/ml)
TABLE-US-00171 TABLE 171 rBPI-21 Protein Expression Amount
Transfected 2 400 80 16 3.2 640 128 26 ug ng ng ng ng pg pg pg
Protein 20.683 9.269 4.768 0 0 0 0 0 (pg/ml)
Example 111
Bicistronic Modified mRNA
[1602] Human embryonic kidney epithelial (HEK293) were seeded on
96-well plates (Greiner Bio-one GmbH, Frickenhausen, Germany)
HEK293 were seeded at a density of 30,000 in 100 .mu.l cell culture
medium (DMEM, 10% FCS, adding 2 mM L-Glutamine, 1 mM Sodiumpyruvate
and 1.times. non-essential amino acids (Biochrom AG, Berlin,
Germany) and 1.2 mg/ml Sodiumbicarbonate (Sigma-Aldrich, Munich,
Germany)) 75 ng of the bi-cistronic modified mRNA (mCherry-2A-GFP)
(SEQ ID NO: 251449; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine), mCherry modified mRNA (mRNA
SEQ ID NO: 251434; polyA tail of approximately 160 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and pseudouridine) or green fluorescent protein
(GFP) modified mRNA (mRNA sequence shown in SEQ ID NO: 251445;
polyA tail of approximately 160 nucleotides not shown in sequence;
5' cap, Cap1; fully modified with 5-methylcytosine and
pseudouridine) were added after seeding the cells and incubated. A
control of untreated cells was also evaluated. mCherry-2A-GFP
refers to a modified mRNA sequence comprising the coding region of
mCherry, the 2A peptide and the coding region of GFP.
[1603] Cells were harvested by transferring the culture media
supernatants to a 96-well Pro-Bind U-bottom plate (Beckton
Dickinson GmbH, Heidelberg, Germany). Cells were trypsinized with
1/2 volume Trypsin/EDTA (Biochrom AG, Berlin, Germany), pooled with
respective supernatants and fixed by adding one volume PBS/2% FCS
(both Biochrom AG, Berlin, Germany)/0.5% formaldehyde (Merck,
Darmstadt, Germany). Samples then were submitted to a flow
cytometer measurement with a 532 nm excitation laser and the 610/20
filter for PE-Texas Red in a LSRII cytometer (Beckton Dickinson
GmbH, Heidelberg, Germany). The mean fluorescence intensity (MFI)
of all events is shown in Table 172. Cells transfected with the
bi-cistronic modified mRNA were able to express both mCherry and
GFP.
TABLE-US-00172 TABLE 172 MFI of Modified mRNA Modified mRNA mCherry
MFI GFP MFI mCherry 17746 427 GFP 427 20019 mCherry-2A-GFP 5742
6783 Untreated 427 219
Example 112
Cationic Lipid Formulation Studies of 5-Methylcytosine and
N1-Methyl-Pseudouridine Modified mRNA to Produce an Antibody
[1604] Herceptin heavy chain (HC) mRNA (mRNA sequence shown in SEQ
ID NO: 251450; polyA tail of approximately 140 nucleotides not
shown in sequence; 5' cap, Cap1; fully modified with
5-methylcytosine and N1-methyl-pseudouridine) and Herceptin light
chain (LC) (mRNA sequence shown in SEQ ID NO: 251451; polyA tail of
approximately 140 nucleotides not shown in sequence; 5' cap, Cap1;
fully modified with 5-methylcytosine and N1-methyl-pseudouridine)
are formulated in DLin-MC3-DMA and DLin-KC2-DMA as described in
Table 173. The formulations are administered intravenously (I.V) to
Balb-C mice at a dose of 0.500, 0.050, and 0.005 mg/kg.
TABLE-US-00173 TABLE 173 DLin-MC3-DMA and DLin-KC2-DMA Formulations
Formulation NPA-158-1 NPA-159-1 Herceptin HC:LC 2:1 2:1 Ratio
(wt/wt) Lipid DLin-MC3-DMA DLin-KC2-DMA Lipid/Total mRNA 20:1 20:1
ratio (wt/wt) Mean Size 129 nm 100 nm PDI: 0.14 PDI: 0.10 Zeta at
pH 7.4 0.9 mV 1.9 mV Encaps. (RiboGr) 100% 100%
[1605] Serum was collected from the mice at 8 hours, 24 hours, 72
hours and/or 7 days after administration of the formulation. The
serum was analyzed by ELISA to determine the protein expression of
Herceptin.
Example 113
Directed SAR of Pseudouridine and N1-Methyl-Pseudouridine
[1606] With the recent focus on the pyrimidine nucleoside
pseudouridine, a series of structure-activity studies were designed
to investigate mRNA containing modifications to pseudouridine or
Nl-methyl-pseudourdine.
[1607] The study was designed to explore the effect of chain
length, increased lipophilicity, presence of ring structures, and
alteration of hydrophobic or hydrophilic interactions when
modifications were made at the N1 position, C6 position, the
2-position, the 4-position and on the phosphate backbone. Stability
is also investigated.
[1608] To this end, modifications involving alkylation,
cycloalkylation, alkyl-cycloalkylation, arylation, alkyl-arylation,
alkylation moieties with amino groups, alkylation moieties with
carboxylic acid groups, and alkylation moieties containing amino
acid charged moieties are investigated. The degree of alkylation is
generally C.sub.1-C.sub.6. Examples of the chemistry modifications
include those listed in Table 174 and Table 175.
TABLE-US-00174 TABLE 174 Pseudouridine and N1-methylPseudouridine
SAR Compound Naturally Chemistry Modification # occuring
N1-Modifications N1-Ethyl-pseudo-UTP 1 N N1-Propyl-pseudo-UTP 2 N
N1-iso-propyl-pseudo-UTP 3 N N1-(2,2,2-Trifluoroethyl)-pseudo-UTP 4
N N1-Cyclopropyl-pseudo-UTP 5 N N1-Cyclopropylmethyl-pseudo-UTP 6 N
N1-Phenyl-pseudo-UTP 7 N N1-Benzyl-pseudo-UTP 8 N
N1-Aminomethyl-pseudo-UTP 9 N Pseudo-UTP-N1-2-ethanoic acid 10 N
N1-(3-Amino-3-carboxypropyl)pseudo-UTP 11 N
N1-Methyl-3-(3-amino-3-carboxy- 12 Y propyl)pseudo-UTP C-6
Modifications 6-Methyl-pseudo-UTP 13 N 6-Trifluoromethyl-pseudo-UTP
14 N 6-Methoxy-pseudo-UTP 15 N 6-Phenyl-pseudo-UTP 16 N
6-Iodo-pseudo-UTP 17 N 6-Bromo-pseudo-UTP 18 N 6-Chloro-pseudo-UTP
19 N 6-Fluoro-pseudo-UTP 20 N 2- or 4-position Modifications
4-Thio-pseudo-UTP 21 N 2-Thio-pseudo-UTP 22 N Phosphate backbone
Modifications Alpha-thio-pseudo-UTP 23 N
N1-Me-alpha-thio-pseudo-UTP 24 N
TABLE-US-00175 TABLE 175 Pseudouridine and N1-methyl-Pseudouridine
SAR Compound Naturally Chemistry Modification # occurring
N1-Methyl-pseudo-UTP 1 Y N1-Butyl-pseudo-UTP 2 N
N1-tert-Butyl-pseudo-UTP 3 N N1-Pentyl-pseudo-UTP 4 N
N1-Hexyl-pseudo-UTP 5 N N1-Trifluoromethyl-pseudo-UTP 6 Y
N1-Cyclobutyl-pseudo-UTP 7 N N1-Cyclopentyl-pseudo-UTP 8 N
N1-Cyclohexyl-pseudo-UTP 9 N N1-Cycloheptyl-pseudo-UTP 10 N
N1-Cyclooctyl-pseudo-UTP 11 N N1-Cyclobutylmethyl-pseudo-UTP 12 N
N1-Cyclopentylmethyl-pseudo-UTP 13 N N1-Cyclohexylmethyl-pseudo-UTP
14 N N1-Cycloheptylmethyl-pseudo-UTP 15 N
N1-Cyclooctylmethyl-pseudo-UTP 16 N N1-p-tolyl-pseudo-UTP 17 N
N1-(2,4,6-Trimethyl-phenyl)pseudo-UTP 18 N
N1-(4-Methoxy-phenyl)pseudo-UTP 19 N N1-(4-Amino-phenyl)pseudo-UTP
20 N N1(4-Nitro-phenyl)pseudo-UTP 21 N Pseudo-UTP-N1-p-benzoic acid
22 N N1-(4-Methyl-benzyl)pseudo-UTP 24 N
N1-(2,4,6-Trimethyl-benzyl)pseudo-UTP 23 N
N1-(4-Methoxy-benzyl)pseudo-UTP 25 N N1-(4-Amino-benzyl)pseudo-UTP
26 N N1-(4-Nitro-benzyl)pseudo-UTP 27 N
Pseudo-UTP-N1-methyl-p-benzoic acid 28 N
N1-(2-Amino-ethyl)pseudo-UTP 29 N N1-(3-Amino-propyl)pseudo-UTP 30
N N1-(4-Amino-butyl)pseudo-UTP 31 N N1-(5-Amino-pentyl)pseudo-UTP
32 N N1-(6-Amino-hexyl)pseudo-UTP 33 N Pseudo-UTP-N1-3-propionic
acid 34 N Pseudo-UTP-N1-4-butanoic acid 35 N
Pseudo-UTP-N1-5-pentanoic acid 36 N Pseudo-UTP-N1-6-hexanoic acid
37 N Pseudo-UTP-N1-7-heptanoic acid 38 N
N1-(2-Amino-2-carboxyethyl)pseudo-UTP 39 N
N1-(4-Amino-4-carboxybutyl)pseudo-UTP 40 N N3-Alkyl-pseudo-UTP 41 N
6-Ethyl-pseudo-UTP 42 N 6-Propyl-pseudo-UTP 43 N
6-iso-Propyl-pseudo-UTP 44 N 6-Butyl-pseudo-UTP 45 N
6-tert-Butyl-pseudo-UTP 46 N 6-(2,2,2-Trifluoroethyl)-pseudo-UTP 47
N 6-Ethoxy-pseudo-UTP 48 N 6-Trifluoromethoxy-pseudo-UTP 49 N
6-Phenyl-pseudo-UTP 50 N 6-(Substituted-Phenyl)-pseudo-UTP 51 N
6-Cyano-pseudo-UTP 52 N 6-Azido-pseudo-UTP 53 N 6-Amino-pseudo-UTP
54 N 6-Ethylcarboxylate-pseudo-UTP 54b N 6-Hydroxy-pseudo-UTP 55 N
6-Methylamino-pseudo-UTP 55b N 6-Dimethylamino-pseudo-UTP 57 N
6-Hydroxyamino-pseudo-UTP 59 N 6-Formyl-pseudo-UTP 60 N
6-(4-Morpholino)-pseudo-UTP 61 N 6-(4-Thiomorpholino)-pseudo-UTP 62
N N1-Me-4-thio-pseudo-UTP 63 N N1-Me-2-thio-pseudo-UTP 64 N
1,6-Dimethyl-pseudo-UTP 65 N 1-Methyl-6-trifluoromethyl-pseudo-UTP
66 N 1-Methyl-6-ethyl-pseudo-UTP 67 N 1-Methyl-6-propyl-pseudo-UTP
68 N 1-Methyl-6-iso-propyl-pseudo-UTP 69 N
1-Methyl-6-butyl-pseudo-UTP 70 N 1-Methyl-6-tert-butyl-pseudo-UTP
71 N 1-Methyl-6-(2,2,2-Trifluoroethyl)pseudo-UTP 72 N
1-Methyl-6-iodo-pseudo-UTP 73 N 1-Methyl-6-bromo-pseudo-UTP 74 N
1-Methyl-6-chloro-pseudo-UTP 75 N 1-Methyl-6-fluoro-pseudo-UTP 76 N
1-Methyl-6-methoxy-pseudo-UTP 77 N 1-Methyl-6-ethoxy-pseudo-UTP 78
N 1-Methyl-6-trifluoromethoxy-pseudo-UTP 79 N
1-Methyl-6-phenyl-pseudo-UTP 80 N 1-Methyl-6-(substituted
phenyl)pseudo-UTP 81 N 1-Methyl-6-cyano-pseudo-UTP 82 N
1-Methyl-6-azido-pseudo-UTP 83 N 1-Methyl-6-amino-pseudo-UTP 84 N
1-Methyl-6-ethylcarboxylate-pseudo-UTP 85 N
1-Methyl-6-hydroxy-pseudo-UTP 86 N
1-Methyl-6-methylamino-pseudo-UTP 87 N
1-Methyl-6-dimethylamino-pseudo-UTP 88 N
1-Methyl-6-hydroxyamino-pseudo-UTP 89 N
1-Methyl-6-formyl-pseudo-UTP 90 N
1-Methyl-6-(4-morpholino)-pseudo-UTP 91 N
1-Methyl-6-(4-thiomorpholino)-pseudo-UTP 92 N
1-Alkyl-6-vinyl-pseudo-UTP 93 N 1-Alkyl-6-allyl-pseudo-UTP 94 N
1-Alkyl-6-homoallyl-pseudo-UTP 95 N 1-Alkyl-6-ethynyl-pseudo-UTP 96
N 1-Alkyl-6-(2-propynyl)-pseudo-UTP 97 N
1-Alkyl-6-(1-propynyl)-pseudo-UTP 98 N
Example 114
Incorporation of Naturally and Non-Naturally Occurring
Nucleosides
[1609] Naturally and non-naturally occurring nucleosides are
incorporated into mRNA encoding a polypeptide of interest. Examples
of these are given in Tables 176 and 177. Certain commercially
available nucleoside triphosphates (NTPs) are investigated in the
polynucleotides of the invention. A selection of these are given in
Table 176. The resultant mRNA are then examined for their ability
to produce protein, induce cytokines, and/or produce a therapeutic
outcome.
TABLE-US-00176 TABLE 176 Naturally and non-naturally occurring
nucleosides Compound Naturally Chemistry Modification # occuring
N4-Methyl-Cytosine 1 Y N4,N4-Dimethyl-2'-OMe-Cytosine 2 Y
5-Oxyacetic acid-methyl ester-Uridine 3 Y N3-Methyl-pseudo-Uridine
4 Y 5-Hydroxymethyl-Cytosine 5 Y 5-Trifluoromethyl-Cytosine 6 N
5-Trifluoromethyl-Uridine 7 N 5-Methyl-amino-methyl-Uridine 8 Y
5-Carboxy-methyl-amino-methyl-Uridine 9 Y
5-Carboxymethylaminomethyl-2'-OMe-Uridine 10 Y
5-Carboxymethylaminomethyl-2-thio-Uridine 11 Y
5-Methylaminomethyl-2-thio-Uridine 12 Y
5-Methoxy-carbonyl-methyl-Uridine 13 Y
5-Methoxy-carbonyl-methyl-2'-OMe-Uridine 14 Y 5-Oxyacetic
acid-Uridine 15 Y 3-(3-Amino-3-carboxypropyl)-Uridine 16 Y
5-(carboxyhydroxymethyl)uridine methyl ester 17 Y
5-(carboxyhydroxymethyl)uridine 18 Y
TABLE-US-00177 TABLE 177 Non-naturally occurring nucleoside
triphosphates Compound Naturally Chemistry Modification # occuring
N1-Me-GTP 1 N 2'-OMe-2-Amino-ATP 2 N 2'-OMe-pseudo-UTP 3 Y
2'-OMe-6-Me-UTP 4 N 2'-Azido-2'-deoxy-ATP 5 N 2'-Azido-2'-deoxy-GTP
6 N 2'-Azido-2'-deoxy-UTP 7 N 2'-Azido-2'-deoxy-CTP 8 N
2'-Amino-2'-deoxy-ATP 9 N 2'-Amino-2'-deoxy-GTP 10 N
2'-Amino-2'-deoxy-UTP 11 N 2'-Amino-2'-deoxy-CTP 12 N 2-Amino-ATP
13 N 8-Aza-ATP 14 N Xanthosine-5'-TP 15 N 5-Bromo-CTP 16 N
2'-F-5-Methyl-2'-deoxy-UTP 17 N 5-Aminoallyl-CTP 18 N
2-Amino-riboside-TP 19 N
Example 115
Incorporation of Modifications to the Nucleobase and Carbohydrate
(Sugar)
[1610] Naturally and non-naturally occurring nucleosides are
incorporated into mRNA encoding a polypeptide of interest.
Commercially available nucleosides and NTPs having modifications to
both the nucleobase and carbohydrate (sugar) are examined for their
ability to be incorporated into mRNA and to produce protein, induce
cytokines, and/or produce a therapeutic outcome. Examples of these
nucleosides are given in Tables 178 and 179.
TABLE-US-00178 TABLE 178 Combination modifications Chemistry
Modification Compound # 5-iodo-2'-fluoro-deoxyuridine 1
5-iodo-cytidine 6 2'-bromo-deoxyuridine 7 8-bromo-adenosine 8
8-bromo-guanosine 9 2,2'-anhydro-cytidine hydrochloride 10
2,2'-anhydro-uridine 11 2'-Azido-deoxyuridine 12 2-amino-adenosine
13 N4-Benzoyl-cytidine 14 N4-Amino-cytidine 15
2'-O-Methyl-N4-Acetyl-cytidine 16 2'Fluoro-N4-Acetyl-cytidine 17
2'Fluor-N4-Bz-cytidine 18 2'O-methyl-N4-Bz-cytidine 19
2'O-methyl-N6-Bz-deoxyadenosine 20 2'Fluoro-N6-Bz-deoxyadenosine 21
N2-isobutyl-guanosine 22 2'Fluro-N2-isobutyl-guanosine 23
2'O-methyl-N2-isobutyl-guanosine 24
TABLE-US-00179 TABLE 179 Naturally occuring combinations Compound
Naturally Name # occurring 5-Methoxycarbonylmethyl-2-thiouridine TP
1 Y 5-Methylaminomethyl-2-thiouridine TP 2 Y
5-Crbamoylmethyluridine TP 3 Y 5-Carbamoylmethyl-2'-O-methyluridine
TP 4 Y 1-Methyl-3-(3-amino-3-carboxypropyl) 5 Y pseudouridine TP
5-Methylaminomethyl-2-selenouridine TP 6 Y 5-Carboxymethyluridine
TP 7 Y 5-Methyldihydrouridine TP 8 Y lysidine TP 9 Y
5-Taurinomethyluridine TP 10 Y 5-Taurinomethyl-2-thiouridine TP 11
Y 5-(iso-Pentenylaminomethyl)uridine TP 12 Y
5-(iso-Pentenylaminomethyl)-2-thiouridine TP 13 Y
5-(iso-Pentenylaminomethyl)-2'-O- 14 Y methyluridine TP
N4-Acetyl-2'-O-methylcytidine TP 15 Y N4,2'-O-Dimethylcytidine TP
16 Y 5-Formyl-2'-O-methylcytidine TP 17 Y 2'-O-Methylpseudouridine
TP 18 Y 2-Thio-2'-O-methyluridine TP 19 Y 3,2'-O-Dimethyluridine TP
20 Y
[1611] In the tables "UTP" stands for uridine triphosphate, "GTP"
stands for guanosine triphosphate, "ATP" stands for adenosine
triphosphate, "CTP" stands for cytosine triphosphate, "TP" stands
for triphosphate and "Bz" stands for benzyl.
Example 116
Protein Production of Vascular Endothelial Growth Factor in HeLa
Cells
[1612] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
5% CO.sub.2 atmosphere overnight. The next day, 250 ng of vascular
endothelial growth factor (VEGF) modified RNA (mRNA sequence shown
in SEQ ID NO: 251446; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1) with the chemical modification
described in Table 180, was diluted in 10 ul final volume of
OPTI-MEM (LifeTechnologies, Grand Island, N.Y.). Lipofectamine 2000
(LifeTechnologies, Grand Island, N.Y.) was used as transfection
reagent and 0.2 ul of lipofectamine 2000 was diluted to 10 ul final
volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minute at room temperature. Then the 20 ul combined
solution was added to the 100 ul cell culture medium containing the
HeLa cells and incubated at room temperature. A second set of HeLa
cells was also evaluated with the VEGF mRNA according to the
procedure set out above. A control of untreated cells and cells
treated with just lipofecatamine 2000 was also analyzed for the
first set of HeLa cells.
[1613] After an 18 to 22 hour incubation cell culture supernatants
of cells expressing VEGF were collected and centrifuged at 10.000
rcf for 2 minutes. The cleared supernatants were then analyzed with
a VEGF-specific ELISA kit (R & D Systems, Minneapolis, Minn.)
according to the manufacturer instructions. All samples were
diluted until the determined values were within the linear range of
the ELISA standard curve. The amount of protein produced is shown
in Table 180.
[1614] These results demonstrate that VEGF fully modified with
1-methylpseudouridine produced more protein in HeLa cells compared
to the other chemistry.
TABLE-US-00180 TABLE 180 Protein Production VEGF set 1 VEGF set 2
Sample (pg/ml) (pg/ml) 5-methylcytosine and pseudouridine 25,455
50,341 (5mC and pU) 5-methylcytosine and 1-methylpsudouridine 5,795
8,523 (5mC and 1mpU) 25% of uridine modified with 2-thiouridine
27,045 27,045 and 25% of cytosine modified with 5- methylcytosine
(s2U and 5mC) Pseudouridine (pU) 216,023 345,114
1-methylpseudouridine (1mpU) 32,614 38,523 Unmodified 409,318
447,273 Lipofectamine 2000 (L2000) 0 N/A Untreated 0 N/A
Example 117
Comparison of Protein Production of Chemically Modified Vascular
Endothelial Growth Factor in HeLa Cells
[1615] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
5% CO.sub.2 atmosphere overnight. Next day, 250 ng of vascular
endothelial growth factor (VEGF) modified RNA (mRNA sequence shown
in SEQ ID NO: 251446; polyA tail of approximately 160 nucleotides
not shown in sequence; 5' cap, Cap1) with the chemical modification
described in Table 181, were diluted in 10 ul final volume of
OPTI-MEM (LifeTechnologies, Grand Island, N.Y.). Lipofectamine 2000
(LifeTechnologies, Grand Island, N.Y.) was used as transfection
reagent and 0.2 ul of lipofectamine 2000 was diluted to 10 ul final
volume of OPTI-MEM. After 5 minutes of incubation at room
temperature, both solutions were combined and incubated an
additional 15 minute at room temperature. Then the 20 ul combined
solution was added to the 100 ul cell culture medium containing the
HeLa cells and incubated at room temperature. A control of
untreated cells was also analyzed.
[1616] After an 18 to 22 hour incubation cell culture supernatants
of cells expressing VEGF were collected and centrifuged at 10.000
rcf for 2 minutes. The cleared supernatants were then analyzed with
a VEGF-specific ELISA kit (R & D Systems, Minneapolis, Minn.)
according to the manufacturer instructions. All samples were
diluted until the determined values were within the linear range of
the ELISA standard curve. The amount of protein produced is shown
in Table 181 and FIG. 9.
[1617] These results demonstrate that VEGF fully modified with
1-methylpseudouridine produced more protein in HeLa cells compared
to the other chemistry.
TABLE-US-00181 TABLE 181 Protein Production VEGF Sample (pg/ml)
Unmodified 121,176 5-methylcytosine and 1-methylpsudouridine
760,000 (5mC and 1mpU) 1-methylpseudouridine (1mpU) 1,393,824
Untreated 0
Example 118
Production of Vascular Endothelial Growth Factor Protein in
Mammals
[1618] Lipoplexed vascular endothelial growth factor (VEGF) mRNA
(mRNA sequence shown in SEQ ID NO: 251446; polyA tail of
approximately 160 nucleotides not shown in sequence; 5' cap, Cap1)
unmodified, fully modified with 5-methylcytosine and pseudouridine
(5mC/pU), fully modified with 5-methylcytosine and
1-methylpseudouridine (5mC/lmpU), modified where 25% of the
cytosines replaced with 5-methylcytosine and 25% of the uridines
replaced with 2-thiouridine (5mC/s2U), fully modified with
1-methylpseudouridine (1 mpU) or fully modified with pseudouridine
(pU). The formulation was administered intravenously to mice at a
dose of 2 ug of mRNA per mouse. As a control, a group of mice were
untreated. Serum from the mice is measured by specific VEGF ELISA 3
hours after administration for VEGF protein expression. The results
are shown in Table 182 and FIG. 10.
TABLE-US-00182 TABLE 182 Protein Production VEGF Sample (pg/ml)
Unmodified 34 5-methylcytosine and pseudouridine (5mC and pU) 40
5-methylcytosine and 1-methylpsudouridine 11 (5mC and 1mpU) 25% of
uridine modified with 2-thiouridine and 53 25% of cytosine modified
with 5-methylcytosine (s2U and 5mC) Pseudouridine (pU) 86
1-methyl-pseudouridine (1mpU) 51 Untreated 0
Example 119
Protein Production of Granulocyte Colony Stimulating Factor in HeLa
Cells
[1619] The day before transfection, 20,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with Trypsin-EDTA
solution (LifeTechnologies, Grand Island, N.Y.) and seeded in a
total volume of 100 ul EMEM medium (supplemented with 10% FCS and
1.times. Glutamax) per well in a 96-well cell culture plate
(Corning, Manassas, Va.). The cells were grown at 37.degree. C. in
5% CO.sub.2 atmosphere overnight. The next day, 250 ng of
granulocyte colony stimulating factor (G-CSF) modified RNA (mRNA
sequence shown in SEQ ID NO: 251433; polyA tail of approximately
160 nucleotides not shown in sequence; 5' cap, Cap1) with the
chemical modification described in Table 183, was diluted in 10 ul
final volume of OPTI-MEM (LifeTechnologies, Grand Island, N.Y.).
Lipofectamine 2000 (LifeTechnologies, Grand Island, N.Y.) was used
as transfection reagent and 0.2 ul of lipofectamine 2000 was
diluted to 10 ul final volume of OPTI-MEM. After 5 minutes of
incubation at room temperature, both solutions were combined and
incubated an additional 15 minute at room temperature. Then the 20
ul combined solution was added to the 100 ul cell culture medium
containing the HeLa cells and incubated at room temperature. A
control of untreated cells and cells treated with just
lipofecatamine 2000 was also analyzed.
[1620] After an 18 to 22 hour incubation cell culture supernatants
of cells expressing G-CSF were collected and centrifuged at 10.000
rcf for 2 minutes. The cleared supernatants were then analyzed with
a G-CSF-specific ELISA kit (R & D Systems, Minneapolis, Minn.)
according to the manufacturer instructions. All samples were
diluted until the determined values were within the linear range of
the ELISA standard curve. The amount of protein produced is shown
in Table 183 and FIG. 11.
TABLE-US-00183 TABLE 183 Protein Production G-CSF Sample (pg/ml)
5-methylcytosine and pseudouridine (5mC and pU) 704,250
5-methylcytosine and 1-methylpsudouridine 1,523,750 (5mC and 1mpU)
25% of uridine modified with 2-thiouridine and 89,000 25% of
cytosine modified with 5-methylcytosine (s2U and 5mC) Pseudouridine
(pU) 408,250 1-methylpseudouridine (1mpU) 1,391,250 Lipofectamine
2000 (L2000) 0 Untreated 0
Example 120
Protein Production of Chemically Modified Factor IX in HeLa Cell
Supernatant
[1621] The day before transfection, 15,000 HeLa cells (ATCC no.
CCL-2; Manassas, Va.) were harvested by treatment with
Trypsin-Ethylenediaminetetraacetic acid (EDTA) solution
(LifeTechnologies, Grand Island, N.Y.) and seeded in a total volume
of 100 ul Eagle's minimal essential medium (EMEM) (supplemented
with 10% fetal calf serum (FCS) and 1.times. Glutamax) per well in
a 24-well cell culture plate (Corning, Manassas, Va.). The cells
were grown at 37.degree. C. in 5% CO.sub.2 atmosphere overnight.
Next day, 250 ng of factor IX modified RNA (mRNA sequence shown in
SEQ ID NO: 251437; polyA tail of approximately 140 nucleotides not
shown in sequence; 5' cap, Cap1) fully modified with
5-methylcytosine and pseudouridine (5mC/pU), fully modified with
5-methylcytosine and 1-methylpseudouridine (5mC/lmpU), modified
where 25% of the cytosines replaced with 5-methylcytosine and 25%
of the uridines replaced with 2-thiouridine (s2U/5mC), fully
modified with 1-methylpseudouridine (1 mpU) or fully modified with
pseudouridine (pU) were diluted in 10 ul final volume of
OPTI-MEM.RTM. (LifeTechnologies, Grand Island, N.Y.). Lipofectamine
2000 (LifeTechnologies, Grand Island, N.Y.) was used as
transfection reagent and 0.2 ul of lipofectamine 2000 was diluted
to 10 ul final volume of OPTI-MEM.RTM.. After 5 minutes of
incubation at room temperature, both solutions were combined and
incubated an additional 15 minute at room temperature. Then the 20
ul combined solution was added to the 100 ul cell culture medium
containing the HeLa cells and incubated at room temperature. A
control of untreated was also analyzed.
[1622] After an 18 hour incubation cell culture supernatants of
cells expressing factor IX were collected by lysing cells with
immuno-precipitation (IP) buffer from Pierce Biotechnology (Thermo
Scientific, Rockford, Ill.) and centrifuged at 10.000 rcf for 2
minutes. The cleared supernatants were diluted 1:2 (1 ml lysate/2
wells/24 well plate) or 1:5 (1 ml lysate/5 wells/24 well plate)
then analyzed with a factor IX-specific ELISA kit according to the
manufacturer instructions. All samples were diluted until the
determined values were within the linear range of the ELISA
standard curve. The amount of protein produced in both studies is
shown in Table 184 and FIG. 12.
TABLE-US-00184 TABLE 184 Protein Production Factor IX Sample
(ng/ml) 5-methylcytosine and pseudouridine (5mC/pU) 45.8
5-methylcytosine and 1-methylpseudouridine 147.1 (5mC/1mpU) 25% of
the cytosines replaced with 5-methylcytosine 7.4 and 25% of the
uridines replaced with 2-thiouridine (s2U/5mC) Pseudouridine (pU)
17.0 1-methylpseudouridine (1mpU) 32.0 Untreated 0
Example 121
Intranasal Lung Delivery of 1-Methylpseudouridine or
5-Methylcytosine and 1-Methylpseudouridine Modified Luciferase mRNA
Formulated in Cationic Lipid Nanoparticle
[1623] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 140 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 1-methylpseudouridine
(Luc-G5-LNP-KC2) or fully modified with 1-methylpseudouridine and
5-methylcytosine (Luc-G2-LNP-KC2) were formulated in the cationic
Lipid Nanoparticle (LNP-KC2) as described in Table 185.
TABLE-US-00185 TABLE 185 Formulation Formulation NPA-127-1
NPA-135-1 Lipid DLin-KC2-DMA DLin-KC2-DMA Lipid/mRNA 20:1 20:1
ratio (wt/wt) Mean Size 114 nm 95 nm PDI: 0.10 PDI: 0.11 Zeta at pH
7.4 -0.5 mV -1.0 mV Encaps. (RiboGr) 77% 100%
[1624] The formulations were administered intranasally (I.N.) to
Balb-C mice at a dose of 0.3 mg/kg. Twenty minutes prior to
imaging, mice were injected intraperitoneally with a D-luciferin
solution at 150 mg/kg. Animals were then anesthetized and images
were acquired with an IVIS Lumina II imaging system (Perkin Elmer).
Bioluminescence was measured as total flux (photons/second) of the
entire mouse. The mice were imaged at 2 hours, 8 hours, 48, and 72
hours after dosing and the average total flux (photons/second) was
measured. The background flux was about 6.3+05 p/s. The results of
the imaging of Luc-G5-LNP-KC2 or Luc-G5-LNP-KC2 vs. Vehicle are
shown in the Table 186, "NT" means not tested.
TABLE-US-00186 TABLE 186 Luciferase expression after intranasal
dosing Luc-G5- Luc-G2- Vehicle Time LNP-KC2 LNP-KC2 (PBS) Route
Point Flux (p/s) Flux (p/s) Flux (p/s) I.N. 2 hrs 1.53E+06 5.81E+05
3.87E+05 I.N. 8 hrs 1.09E+07 9.35E+05 5.57E+05 I.N. 24 hrs 5.93E+06
5.33E+05 4.89E+05 I.N. 28 hrs 1.22E+06 7.63E+05 8.81E+05 I.N. 72
hrs 8.43E+05 NT 8.17E+05
Example 122
Intranasal Lung Delivery of 1-Methylpseudouridine or
5-Methylcytosine and 1-Methylpseudouridine Modified Luciferase mRNA
Lipoplexed in Lipofectamine 2000
[1625] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 140 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 1-methylpseudouridine
(Luc-G5-Lipoplex) or fully modified with 1-methylpseudouridine and
5-methylcytosine (Luc-G2-Lipoplex) were lipoplexed in two steps,
first step was the dilution of 16.6 ul from 3 mg/ml of
1-methylpseudouridine or 5-methylcytosine modified luciferase mRNA
in 108.5 ul DMEM and the second step was the dilution of 100 ul
LF2000 in 25 ul DMEM then both mixed together gently to make 250 ul
total mixer which incubated 5-10 min at RT to form a Lipid-mRNA
complex before injection. The lipoplex from both Luciferase mRNA
fully modified with 1-methylpseudouridine or 1-methylpseudouridine
and 5-methylcytosine were administered intranasally (I.N.) to
Balb-C mice at a dose of 0.5 mg/kg.
[1626] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours and 24 hours after dosing and the
average total flux (photons/second) was measured. The background
signal was about 4.8+05 p/s. The background flux was about 6.3+05
p/s. The results of the imaging of Luc-G5-Lipoplex or
Luc-G2-Lipoplex vs. Vehicle are shown in the Table 187.
TABLE-US-00187 TABLE 187 Luciferase expression after intranasal
dosing Luc-G5- Luc-G2- Vehicle Time Lipoplex Lipoplex (PBS) Route
Point Flux (p/s) Flux (p/s) Flux (p/s) I.N. 2 hrs 8.37E+05 9.58E+05
3.87E+05 I.N. 8 hrs 8.42E+05 7.11E+05 5.57E+05 I.N. 24 hrs 5.74E+05
5.53E+05 4.89E+05
Example 123
Intranasal Lung Delivery of 1-Methylpseudouridine or
5-Methylcytosine and 1-Methylpseudouridine Modified Luciferase mRNA
Formulated in PBS
[1627] Luciferase modified mRNA (mRNA sequence shown in SEQ ID NO:
251443; polyA tail of approximately 140 nucleotides not shown in
sequence; 5' cap, Cap1) fully modified with 1-methylpseudouridine
(Luc-G5-Buffer(PBS)) or fully modified with 1-methylpseudouridine
and 5-methylcytosine (Luc-G2-Buffer(PBS)) formulated in PBS (pH
7.4) were administered intranasally (I.N.) to Balb-C mice at a dose
of 7.5 mg/kg.
[1628] Twenty minutes prior to imaging, mice were injected
intraperitoneally with a D-luciferin solution at 150 mg/kg. Animals
were then anesthetized and images were acquired with an IVIS Lumina
II imaging system (Perkin Elmer). Bioluminescence was measured as
total flux (photons/second) of the entire mouse. The mice were
imaged at 2 hours, 8 hours and 24 hours after dosing and the
average total flux (photons/second) was measured. The background
flux was about 4.8+05 p/s. The background flux was about 6.3+05
p/s. The results of the imaging of Luc-G5-in Buffer vs. Vehicle are
shown in the Table 188.
TABLE-US-00188 TABLE 188 Luciferase expression after intranasal
dosing Luc-G5-in Luc-G2-in Vehicle Time Buffer (PBS) Buffer (PBS)
(PBS) Route Point Flux [p/s] Flux [p/s] Flux (p/s) I.N. 2 hrs
4.50E+05 9.58E+05 3.87E+05 I.N. 8 hrs 7.12E+05 7.11E+05 5.57E+05
I.N. 24 hrs 4.47E+05 5.53E+05 4.89E+05
[1629] It is to be understood that the words which have been used
are words of description rather than limitation, and that changes
may be made within the purview of the appended claims without
departing from the true scope and spirit of the invention in its
broader aspects.
[1630] While the present invention has been described at some
length and with some particularity with respect to the several
described embodiments, it is not intended that it should be limited
to any such particulars or embodiments or any particular
embodiment, but it is to be construed with references to the
appended claims so as to provide the broadest possible
interpretation of such claims in view of the prior art and,
therefore, to effectively encompass the intended scope of the
invention.
All publications, patent applications, patents, and other
references mentioned herein are incorporated by reference in their
entirety. In case of conflict, the present specification, including
definitions, will control. In addition, section headings, the
materials, methods, and examples are illustrative only and not
intended to be limiting.
Lengthy Table
[1631] The patent application contains a lengthy table section. A
copy of the table is available in electronic form from the USPTO
web site. An electronic copy of the table will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140206755A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140206755A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References