U.S. patent application number 14/177551 was filed with the patent office on 2014-07-17 for polynucleotides and polypeptides in plants.
This patent application is currently assigned to MENDEL BIOTECHNOLOGY, INC.. The applicant listed for this patent is Mendel Biotechnology, Inc.. Invention is credited to Luc J. Adam, Roger Canales, Karen S. Century, Jennifer M. Costa, Robert A. Creelman, Neal I. Gutterson, Jacqueline E. Heard, Frederick D. Hempel, Cai-Zhong Jiang, Katherine Krolikowski, Roderick W. Kumimoto, Omaira Pineda, Emily L. Queen Kumimoto, Oliver J. Ratcliffe, Peter P. Repetti, T. Lynne Reuber, Jose Luis Riechmann, James Z. Zhang.
Application Number | 20140201864 14/177551 |
Document ID | / |
Family ID | 46299154 |
Filed Date | 2014-07-17 |
United States Patent
Application |
20140201864 |
Kind Code |
A1 |
Kumimoto; Roderick W. ; et
al. |
July 17, 2014 |
Polynucleotides and Polypeptides in Plants
Abstract
The invention relates to plant transcription factor
polypeptides, polynucleotides that encode them, homologs from a
variety of plant species, and methods of using the polynucleotides
and polypeptides to produce transgenic plants having advantageous
properties compared to a reference plant. Sequence information
related to these polynucleotides and polypeptides can also be used
in bioinformatic search methods and is also disclosed.
Inventors: |
Kumimoto; Roderick W.;
(Sacramento, CA) ; Adam; Luc J.; (Hayward, CA)
; Canales; Roger; (San Diego, CA) ; Century; Karen
S.; (Chapel Hill, NC) ; Creelman; Robert A.;
(Castro Valley, CA) ; Costa; Jennifer M.; (Union
City, CA) ; Gutterson; Neal I.; (Oakland, CA)
; Hempel; Frederick D.; (Sunol, CA) ; Heard;
Jacqueline E.; (Wenham, MA) ; Jiang; Cai-Zhong;
(Davis, CA) ; Krolikowski; Katherine; (Richmond,
CA) ; Pineda; Omaira; (Vero Beach, FL) ; Queen
Kumimoto; Emily L.; (Sacramento, CA) ; Ratcliffe;
Oliver J.; (Oakland, CA) ; Repetti; Peter P.;
(Emeryville, CA) ; Reuber; T. Lynne; (San Mateo,
CA) ; Riechmann; Jose Luis; (Barcelona, ES) ;
Zhang; James Z.; (Palo Alto, CA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Mendel Biotechnology, Inc. |
Hayward |
CA |
US |
|
|
Assignee: |
MENDEL BIOTECHNOLOGY, INC.
Hayward
CA
|
Family ID: |
46299154 |
Appl. No.: |
14/177551 |
Filed: |
February 11, 2014 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
11986992 |
Nov 26, 2007 |
|
|
|
14177551 |
|
|
|
|
10412699 |
Apr 10, 2003 |
7345217 |
|
|
11986992 |
|
|
|
|
10295403 |
Nov 15, 2002 |
|
|
|
10412699 |
|
|
|
|
09394519 |
Sep 13, 1999 |
|
|
|
10295403 |
|
|
|
|
09489376 |
Jan 21, 2000 |
|
|
|
11986992 |
|
|
|
|
10302267 |
Nov 22, 2002 |
7223904 |
|
|
11986992 |
|
|
|
|
09506720 |
Feb 17, 2000 |
|
|
|
10302267 |
|
|
|
|
10286264 |
Nov 1, 2002 |
|
|
|
11986992 |
|
|
|
|
09533030 |
Mar 22, 2000 |
|
|
|
10286264 |
|
|
|
|
10278173 |
Oct 21, 2002 |
|
|
|
11986992 |
|
|
|
|
09533392 |
Mar 22, 2000 |
|
|
|
10278173 |
|
|
|
|
09533029 |
Mar 22, 2000 |
6664446 |
|
|
11986992 |
|
|
|
|
10278536 |
Oct 22, 2002 |
|
|
|
11986992 |
|
|
|
|
09532591 |
Mar 22, 2000 |
|
|
|
10278536 |
|
|
|
|
10290627 |
Nov 7, 2002 |
|
|
|
11986992 |
|
|
|
|
09533648 |
Mar 22, 2000 |
|
|
|
10290627 |
|
|
|
|
09958131 |
Jan 30, 2002 |
6946586 |
|
|
PCT/US00/09448 |
Apr 6, 2000 |
|
|
|
11986992 |
|
|
|
|
09713994 |
Nov 16, 2000 |
|
|
|
11986992 |
|
|
|
|
09819142 |
Mar 27, 2001 |
|
|
|
11986992 |
|
|
|
|
09934455 |
Aug 22, 2001 |
|
|
|
09819142 |
|
|
|
|
09713994 |
Nov 16, 2000 |
|
|
|
09934455 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
09713994 |
|
|
|
|
10225068 |
Aug 9, 2002 |
7193129 |
|
|
11986992 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225068 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
10225066 |
Aug 9, 2002 |
7238860 |
|
|
11986992 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225066 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
10225067 |
Aug 9, 2002 |
7135616 |
|
|
11986992 |
|
|
|
|
09837944 |
Apr 18, 2001 |
|
|
|
10225067 |
|
|
|
|
10171468 |
Jun 14, 2002 |
|
|
|
09837944 |
|
|
|
|
10374780 |
Feb 25, 2003 |
7511190 |
|
|
11986992 |
|
|
|
|
60101349 |
Sep 22, 1998 |
|
|
|
60103312 |
Oct 6, 1998 |
|
|
|
60108734 |
Nov 17, 1998 |
|
|
|
60113409 |
Dec 22, 1998 |
|
|
|
60116841 |
Jan 22, 1999 |
|
|
|
60120880 |
Feb 18, 1999 |
|
|
|
60121037 |
Feb 22, 1999 |
|
|
|
60124278 |
Mar 11, 1999 |
|
|
|
60129450 |
Apr 15, 1999 |
|
|
|
60135134 |
May 20, 1999 |
|
|
|
60144153 |
Jul 15, 1999 |
|
|
|
60161143 |
Oct 22, 1999 |
|
|
|
60162656 |
Nov 1, 1999 |
|
|
|
60125814 |
Mar 23, 1999 |
|
|
|
60125814 |
Mar 23, 1999 |
|
|
|
60125814 |
Mar 23, 1999 |
|
|
|
60125814 |
Mar 23, 1999 |
|
|
|
60125814 |
Mar 23, 1999 |
|
|
|
60128153 |
Apr 7, 1999 |
|
|
|
60166228 |
Nov 17, 1999 |
|
|
|
60197899 |
Apr 17, 2000 |
|
|
|
60227439 |
Aug 22, 2000 |
|
|
|
60227439 |
Aug 22, 2000 |
|
|
|
60310847 |
Aug 9, 2001 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60310847 |
Aug 9, 2001 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60310847 |
Aug 9, 2001 |
|
|
|
60336049 |
Nov 19, 2001 |
|
|
|
60338692 |
Dec 11, 2001 |
|
|
|
60434166 |
Dec 17, 2002 |
|
|
|
Current U.S.
Class: |
800/279 ;
800/278; 800/281; 800/284; 800/287; 800/289; 800/290; 800/298;
800/301 |
Current CPC
Class: |
C12N 15/827 20130101;
C12N 15/8245 20130101; C12N 15/8273 20130101; C12N 15/8267
20130101; C12N 15/8249 20130101; C12N 15/8287 20130101; C12N
15/8251 20130101; C12N 15/8261 20130101; C12N 15/8279 20130101;
Y02A 40/146 20180101; C12N 15/8293 20130101; C12N 15/8266 20130101;
C12N 15/8271 20130101; C12N 15/8214 20130101; C12N 15/8275
20130101; C12N 15/8281 20130101; C12N 15/8262 20130101; C12N
15/8282 20130101; C12N 15/8291 20130101; C12N 15/8247 20130101;
C07K 14/415 20130101; C12N 15/825 20130101 |
Class at
Publication: |
800/279 ;
800/278; 800/281; 800/284; 800/287; 800/289; 800/290; 800/298;
800/301 |
International
Class: |
C12N 15/82 20060101
C12N015/82 |
Claims
1. A transgenic plant transformed with a DNA construct encoding a
polypeptide having an amino acid sequence identity with a sequence
selected from the group consisting of SEQ ID NO: 2N, wherein
N=1-480, SEQ ID NO: 2N-1, where N=857-970, or SEQ ID NO: 989, 990,
991, 1001, 1002, 1012, 1018, 1021, 1022, 1025, 1027, 1028, 1029,
1034, 1050, 1051, 1072, 1073, 1074, 1075, 1076, 1091, 1092, 1093,
1094, 1095, 1109, 1110, 1111, 1112, 1150, 1165, 1166, 1167, 1168,
1169, 1189, 1190, 1191, 1197, 1198, 1199, 1213, 1214, 1215, 1216,
1226, 1227, 1233, 1239, 1246, 1247, 1258, 1259, 1269, 1307, 1308,
1309, 1310, 1323, 1329, 1330, 1331, 1332, 1338, 1339, 1340, 1361,
1362, 1373, 1374, 1375, 1384, 1389, 1390, 1391, 1396, 1411, 1412,
1413, 1414, 1424, 1435, 1436, 1437, 1448, 1456, 1457, 1458, 1459,
1460, 1472, 1483, 1484, 1500, 1508, 1510, 1511, 1520, 1538, 1539,
1540, 1541, 1542, 1543, 1563, 1564, 1565, 1566, 1567, 1568, 1569,
1582, 1583, 1594, 1611, 1612, 1618, 1619, 1620, 1626, 1627, 1635,
1636, 1640, 1641, 1655, 1656, 1657, 1658, 1672, 1673, 1680, 1682,
1686, 1687, 1688, 1689, 1696, 1702, 1703, 1945, 1947, 1949, 1951,
1953, 1955, 1957, 1959, 1961, 1963, 1965, 1967, 1969, 1971, and
1973; wherein the amino acid identity is selected from the group
consisting of at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, or at least 86%, at least 87%, at least 88%, at
least 90%, at least 95%, at least 98%, or 100% amino acid sequence
identity; wherein when the polypeptide is expressed in the
transgenic plant, the polypeptide confers to the trangenic plant an
enhanced trait, as compared to a control plant, selected from the
group consisting of: smaller size, smaller petals, smaller sepals,
increased tolerance to Erysiphe, increased resistance to Erysiphe,
increased tolerance to Botrytis, increased tolerance to
Sclerotinia, increased tolerance to Pseudomonas, increased
tolerance to salt, increased tolerance to sucrose, increased
tolerance to glucose, increased tolerance to cold, increased
tolerance in heat, increased tolerance to osmotic stress, increased
tolerance to drought, increased tolerance to nutrient-limiting
conditions, increased tolerance to nitrogen-limiting conditions,
increased tolerance to phosphate-free medium, increased tolerance
to potassium-free medium, increased tolerance to freezing, altered
C:N sensing, reduced sensitivity to ABA, insensitive to ABA,
decreased seed oil content, increased seed protein content,
increased seed protein content, decreased seed protein, late
flowering, early flowering, sterile, less pollen production, embryo
lethal, delayed senescence, premature senescence, fewer trichomes
at seedling stage, altered leaf shape, curled leaves, serrated
leaves, shiny leaves, dark green leaves, dark green plant, light
green coloration, reduced seed color, greater size, increased
seedling size, large leaves, larger seeds, greater biomass,
increased root hairs, homeotic transformation, terminal flowers,
short stamen filaments, abnormal anther development, reduced
fertility, glabrous, altered trichome distribution, increased
trichome size, increased trichome density, reduced branching, more
vascular bundles in stem, loss of apical dominance, long petioles,
upturned leaves, smaller petals, smaller sepals, reduced or absent
petals, sepals and stamens, reduced petal abscission, leaf cell
expansion, slow growth, photomorphogenesis in dark conditions,
lethal when overexpressed, increased leaf unsaturated fatty acids,
increased leaf chlorophyll, increased leaf carotenoids, increased
anthocyanins in leaf, increased anthocyanins in root, increased
anthocyanins in seed, reduced lignin, increased lutein content,
increased seed lutein, decreased seed lutein, decreased leaf
lutein, increased xanthophyll, increased leaf xanthophyll,
increased arabinose, increased leaf arabinose, increased mannose,
increased .delta.- and .gamma.-tocopherol, increased leaf insoluble
sugars, decreased insoluble sugars, increase in xylose, increased
leaf rhamnose, increased fucose, decreased rhamnose, increased leaf
fatty acids, increase in glucosinolate M39480, increased
glucosinolate M39481, increase in 18:1 fatty acids, increased seed
16:0 fatty acid, increased seed 16:1 fatty acid, increased seed
18:0 fatty acid, increased seed 18:1 fatty acid, increased seed
18:3 fatty acid, increased seed 20:0 fatty acid, reduction in 16:3
fatty acid, reduction in 18:2 fatty acids, reduction in 20:1 fatty
acids, reduction in 22:1 fatty acids, increased wax in leaves, and,
decreased seed fatty acid composition.
2. The transgenic plant of claim 1, wherein the transgenic plant is
dicotyledenous.
3. The transgenic plant of claim 1, wherein the transgenic plant is
monocotyledenous.
4. The transgenic plant of claim 1, wherein expression of the
polypeptide is regulated by a constitutive, inducible, or
tissue-specific promoter.
5. A method for producing a transgenic plant having an enhanced
trait as compared to a control plant, the method steps comprising:
(a) transforming a target plant with a DNA construct encoding a
polypeptide having an amino acid sequence identity with a sequence
selected from the group consisting of SEQ ID NO: 2N, wherein
N=1-480, SEQ ID NO: 2N-1, where N=857-970, or SEQ ID NO: 989, 990,
991, 1001, 1002, 1012, 1018, 1021, 1022, 1025, 1027, 1028, 1029,
1034, 1050, 1051, 1072, 1073, 1074, 1075, 1076, 1091, 1092, 1093,
1094, 1095, 1109, 1110, 1111, 1112, 1150, 1165, 1166, 1167, 1168,
1169, 1189, 1190, 1191, 1197, 1198, 1199, 1213, 1214, 1215, 1216,
1226, 1227, 1233, 1239, 1246, 1247, 1258, 1259, 1269, 1307, 1308,
1309, 1310, 1323, 1329, 1330, 1331, 1332, 1338, 1339, 1340, 1361,
1362, 1373, 1374, 1375, 1384, 1389, 1390, 1391, 1396, 1411, 1412,
1413, 1414, 1424, 1435, 1436, 1437, 1448, 1456, 1457, 1458, 1459,
1460, 1472, 1483, 1484, 1500, 1508, 1510, 1511, 1520, 1538, 1539,
1540, 1541, 1542, 1543, 1563, 1564, 1565, 1566, 1567, 1568, 1569,
1582, 1583, 1594, 1611, 1612, 1618, 1619, 1620, 1626, 1627, 1635,
1636, 1640, 1641, 1655, 1656, 1657, 1658, 1672, 1673, 1680, 1682,
1686, 1687, 1688, 1689, 1696, 1702, 1703, 1945, 1947, 1949, 1951,
1953, 1955, 1957, 1959, 1961, 1963, 1965, 1967, 1969, 1971, and
1973; wherein the amino acid identity is selected from the group
consisting of at least 65%, at least 70%, at least 75%, at least
80%, at least 85%, or at least 86%, at least 87%, at least 88%, at
least 90%, at least 95%, at least 98%, or 100% amino acid sequence
identity; and the enhanced trait is selected from the group
consisting of smaller size, smaller petals, smaller sepals,
increased tolerance to Erysiphe, increased resistance to Erysiphe,
increased tolerance to Botrytis, increased tolerance to
Sclerotinia, increased tolerance to Pseudomonas, increased
tolerance to salt, increased tolerance to sucrose, increased
tolerance to glucose, increased tolerance to cold, increased
tolerance in heat, increased tolerance to osmotic stress, increased
tolerance to drought, increased tolerance to nutrient-limiting
conditions, increased tolerance to nitrogen-limiting conditions,
increased tolerance to phosphate-free medium, increased tolerance
to potassium-free medium, increased tolerance to freezing, altered
C:N sensing, reduced sensitivity to ABA, insensitive to ABA,
decreased seed oil content, increased seed protein content,
increased seed protein content, decreased seed protein, late
flowering, early flowering, sterile, less pollen production, embryo
lethal, delayed senescence, premature senescence, fewer trichomes
at seedling stage, altered leaf shape, curled leaves, serrated
leaves, shiny leaves, dark green leaves, dark green plant, light
green coloration, reduced seed color, greater size, increased
seedling size, large leaves, larger seeds, greater biomass,
increased root hairs, homeotic transformation, terminal flowers,
short stamen filaments, abnormal anther development, reduced
fertility, glabrous, altered trichome distribution, increased
trichome size, increased trichome density, reduced branching, more
vascular bundles in stem, loss of apical dominance, long petioles,
upturned leaves, smaller petals, smaller sepals, reduced or absent
petals, sepals and stamens, reduced petal abscission, leaf cell
expansion, slow growth, photomorphogenesis in dark conditions,
lethal when overexpressed, increased leaf unsaturated fatty acids,
increased leaf chlorophyll, increased leaf carotenoids, increased
anthocyanins in leaf, increased anthocyanins in root, increased
anthocyanins in seed, reduced lignin, increased lutein content,
increased seed lutein, decreased seed lutein, decreased leaf
lutein, increased xanthophyll, increased leaf xanthophyll,
increased arabinose, increased leaf arabinose, increased mannose,
increased .delta.- and .gamma.-tocopherol, increased leaf insoluble
sugars, decreased insoluble sugars, increase in xylose, increased
leaf rhamnose, increased fucose, decreased rhamnose, increased leaf
fatty acids, increase in glucosinolate M39480, increased
glucosinolate M39481, increase in 18:1 fatty acids, increased seed
16:0 fatty acid, increased seed 16:1 fatty acid, increased seed
18:0 fatty acid, increased seed 18:1 fatty acid, increased seed
18:3 fatty acid, increased seed 20:0 fatty acid, reduction in 16:3
fatty acid, reduction in 18:2 fatty acids, reduction in 20:1 fatty
acids, reduction in 22:1 fatty acids, increased wax in leaves, and,
decreased seed fatty acid composition; wherein when the polypeptide
is expressed in the transgenic plant, the polypeptide confers to
the trangenic plant the enhanced trait, as compared to the control
plant.
6. The method of claim 5, wherein the transgenic plant is
dicotyledenous.
7. The method of claim 5, wherein the transgenic plant is
monocotyledenous.
8. The method of claim 5, wherein expression of the polypeptide is
regulated by a constitutive, inducible, or tissue-specific
promoter.
9. The method of claim 5, wherein the method further comprises the
step of: (b) selfing or crossing the transformed plant with itself
or another plant, respectively, to produce a transgenic seed.
10. The method of claim 5, wherein the method further comprises the
step of: (b) selecting the transgenic plant by its ectopic
expression of the polypeptide or the presence of the enhanced
trait, as compared to the control plant.
Description
RELATIONSHIP TO COPENDING APPLICATIONS
[0001] This application is a divisional application of U.S. patent
application Ser. No. 11/986,992, filed Nov. 26, 2007 (pending),
which is a divisional of U.S. patent application Ser. No.
10/412,699, filed Apr. 10, 2003 (issued as U.S. Pat. No.
7,345,217). U.S. patent application Ser. No. 10/412,699 is a
continuation-in-part of application Ser. No. 10/295,403, filed Nov.
15, 2002 (abandoned), which is a divisional of application Ser. No.
09/394,519, filed Sep. 13, 1999 (abandoned), which claims the
benefit of Application No. 60/101,349, filed Sep. 22, 1998
(expired), which also claims the benefit of Application No.
60/103,312, filed Oct. 6, 1998 (expired), which also claims the
benefit of Application No. 60/108,734, filed Nov. 17, 1998
(expired), which also claims the benefit of Application No.
60/113,409, filed Dec. 22, 1998 (expired). U.S. patent application
Ser. No. 11/986,992 is also a continuation-in-part of application
Ser. No. 09/489,376, filed Jan. 21, 2000 (abandoned), which claims
the benefit of Application No. 60/116,841, filed Jan. 22, 1999
(expired). U.S. patent application Ser. No. 11/986,992 is also a
continuation-in-part of application Ser. No. 10/302,267, filed Nov.
22, 2002 (which issued as U.S. Pat. No. 7,223,904), which is a
divisional of application Ser. No. 09/506,720, filed Feb. 17, 2000
(abandoned), which claims the benefit of Application Nos.
60/120,880, filed Feb. 18, 1999 (expired), Application No.
60/121,037, filed Feb. 22, 1999 (expired), Application No.
60/124,278, filed Mar. 11, 1999 (expired), Application No.
60/129,450, filed Apr. 15, 1999 (expired), Application No.
60/135,134, filed May 20, 1999 (expired), Application No.
60/144,153, filed Jul. 15, 1999 (expired), Application No.
60/161,143, filed Oct. 22, 1999 (expired), and Application No.
60/162,656, filed Nov. 1, 1999 (expired). U.S. patent application
Ser. No. 11/986,992 is also a continuation-in-part of application
Ser. No. 10/286,264, filed Nov. 1, 2002 (abandoned), which is a
divisional of application Ser. No. 09/533,030, filed Mar. 22, 2000
(abandoned), which claims the benefit of Application No.
60/125,814, filed on Mar. 23, 1999 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 10/278,173, filed Oct. 21, 2002 (abandoned),
which is a divisional of application Ser. No. 09/533,392, filed
Mar. 22, 2000 (abandoned), which claims the benefit of Application
No. 60/125,814, filed on Mar. 23, 1999 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 09/533,029, filed on Mar. 22, 2000 (issued as
U.S. Pat. No. 6,664,446), which claims the benefit of Application
No. 60/125,814, filed Mar. 23, 1999 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 10/278,536, filed Oct. 22, 2002 (abandoned),
which is a divisional of application Ser. No. 09/532,591, filed
Mar. 22, 2000 (abandoned), which claims the benefit of Application
No. 60/125,814, filed on Mar. 23, 1999 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 10/290,627, filed Nov. 7, 2002 (abandoned),
which is a divisional of application Ser. No. 09/533,648, filed
Mar. 22, 2000 (abandoned), which claims the benefit of Application
No. 60/125,814, filed Mar. 23, 1999 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 09/958,131, filed Jan. 30, 2002 (issued as
U.S. Pat. No. 6,946,586), which is a 371 National Stage Application
of International Application No. PCT/US00/09448, filed Apr. 6,
2000, which claims the benefit of Application No. 60/128,153, filed
Apr. 7, 1999 (expired). U.S. patent application Ser. No. 11/986,992
is also a continuation-in-part of application Ser. No. 09/713,994,
filed Nov. 16, 2000 (abandoned), which claims the benefit of
Application No. 60/166,228, filed Nov. 17, 1999 (expired), which
also claims the benefit of Application No. 60/197,899, filed Apr.
17, 2000 (expired), which also claims the benefit of Application
No. 60/227,439, filed Aug. 22, 2000 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 09/819,142, filed Mar. 27, 2001 (abandoned).
U.S. patent application Ser. No. 11/986,992 is also a
continuation-in-part of application Ser. No. 09/934,455, filed Aug.
22, 2001 (abandoned); and, application Ser. No. 09/934,455 is a
continuation-in-part of application Ser. No. 09/713,994, filed Nov.
16, 2000 (abandoned), and a continuation-in-part of application
Ser. No. 09/837,944, filed Apr. 18, 2001 (abandoned); and,
application Ser. No. 09/934,455 claims the benefit of Application
No. 60/227,439, filed Aug. 22, 2000 (expired). U.S. patent
application Ser. No. 11/986,992 is also a continuation-in-part of
application Ser. No. 10/225,068, filed Aug. 9, 2002 (issued as U.S.
Pat. No. 7,193,129), which claims the benefit of Application Nos.
60/310,847, filed Aug. 9, 2001 (expired), Application No.
60/336,049, filed Nov. 19, 2001 (expired), and Application No.
60/338,692, filed Dec. 11, 2001 (expired). Application Ser. No.
10/225,068 is also a continuation-in-part of application Ser. No.
09/837,944, filed Apr. 18, 2001 (abandoned), and also a
continuation-in-part of application Ser. No. 10/171,468, filed Jun.
14, 2002 (abandoned). U.S. patent application Ser. No. 11/986,992
is also a continuation-in-part of application Ser. No. 10/225,066,
filed Aug. 9, 2002 (issued as U.S. Pat. No. 7,238,860), which
claims the benefit of Application No. 60/310,847, filed Aug. 9,
2001 (expired), which also claims the benefit of Application No.
60/336,049, filed Nov. 19, 2001 (expired), and Application No.
60/338,692, filed Dec. 11, 2001 (expired). Application Ser. No.
10/225,066 is also a continuation-in-part of application Ser. No.
09/837,944, filed Apr. 18, 2001 (abandoned), and is also a
continuation-in-part of application Ser. No. 10/171,468, filed Jun.
14, 2002 (abandoned). U.S. patent application Ser. No. 11/986,992
is also a continuation-in-part of application Ser. No. 10/225,067,
filed Aug. 9, 2002 (issued as U.S. Pat. No. 7,135,616), which
claims the benefit of Application Nos. 60/310,847, filed Aug. 9,
2001 (expired), Application No. 60/336,049, filed Nov. 19, 2001
(expired), and Application No. 60/338,692, filed Dec. 11, 2001
(expired). Application Ser. No. 10/225,067 is also a
continuation-in-part of application Ser. No. 09/837,944, filed Apr.
18, 2001 (abandoned), and is also a continuation-in-part of
application Ser. No. 10/171,468, filed Jun. 14, 2002 (abandoned).
U.S. patent application Ser. No. 11/986,992 is also a
continuation-in-part of application Ser. No. 10/374,780, filed Feb.
25, 2003 (issued as U.S. Pat. No. 7,511,190). U.S. patent
application Ser. No. 11/986,992 claims the benefit of U.S.
provisional patent application No. 60/434,166, filed Dec. 17, 2002
(expired). The contents of application Ser. Nos. 11/986,992,
10/412,699, 09/394,519, 09/489,376, 09/506,720, 09/533,030,
09/533,392, 09/533,029, 09/532,591, 09/533,648, 09/958,131,
PCT/US00/09448, 09/713,994, 09/819,142, 09/837,944, 60/310,847,
60/336,049, 60/338,692, 10/171,468, 10/225,066, 10/225,067,
10/225,068, 60/434,166, and 10/374,780 are hereby incorporated by
reference in their entirety.
TECHNICAL FIELD
[0002] This invention relates to the field of plant biology. More
particularly, the present invention pertains to compositions and
methods for phenotypically modifying a plant.
BACKGROUND OF THE INVENTION
[0003] A plant's traits, such as its biochemical, developmental, or
phenotypic characteristics, may be controlled through a number of
cellular processes. One important way to manipulate that control is
through transcription factors--proteins that influence the
expression of a particular gene or sets of genes. Transformed and
transgenic plants that comprise cells having altered levels of at
least one selected transcription factor, for example, possess
advantageous or desirable traits. Strategies for manipulating
traits by altering a plant cell's transcription factor content can
therefore result in plants and crops with new and/or improved
commercially valuable properties.
[0004] Transcription factors can modulate gene expression, either
increasing or decreasing (inducing or repressing) the rate of
transcription. This modulation results in differential levels of
gene expression at various developmental stages, in different
tissues and cell types, and in response to different exogenous
(e.g., environmental) and endogenous stimuli throughout the life
cycle of the organism.
[0005] Because transcription factors are key controlling elements
of biological pathways, altering the expression levels of one or
more transcription factors can change entire biological pathways in
an organism. For example, manipulation of the levels of selected
transcription factors may result in increased expression of
economically useful proteins or biomolecules in plants or
improvement in other agriculturally relevant characteristics.
Conversely, blocked or reduced expression of a transcription factor
may reduce biosynthesis of unwanted compounds or remove an
undesirable trait. Therefore, manipulating transcription factor
levels in a plant offers tremendous potential in agricultural
biotechnology for modifying a plant's traits. A number of the
agriculturally relevant characteristics of plants, and desirable
traits that may be imbued by modified transcription factor gene
expression, are listed below.
Useful Plant Traits
Category: Abiotic Stress; Desired Trait: Chilling Tolerance
[0006] The term "chilling sensitivity" has been used to describe
many types of physiological damage produced at low, but above
freezing, temperatures. Most crops of tropical origins such as
soybean, rice, maize and cotton are easily damaged by chilling
Typical chilling damage includes wilting, necrosis, chlorosis or
leakage of ions from cell membranes. The underlying mechanisms of
chilling sensitivity are not completely understood yet, but
probably involve the level of membrane saturation and other
physiological deficiencies. For example, photoinhibition of
photosynthesis (disruption of photosynthesis due to high light
intensities) often occurs under clear atmospheric conditions
subsequent to cold late summer/autumn nights. By some estimates,
chilling accounts for monetary losses in the United States (US)
second only to drought and flooding. For example, chilling may lead
to yield losses and lower product quality through the delayed
ripening of maize Another consequence of poor growth is the rather
poor ground cover of maize fields in spring, often resulting in
soil erosion, increased occurrence of weeds, and reduced uptake of
nutrients. A retarded uptake of mineral nitrogen could also lead to
increased losses of nitrate into the ground water.
Category: Abiotic Stress; Desired Trait: Freezing Tolerance.
[0007] Freezing is a major environmental stress that limits where
crops can be grown and that reduces yields considerably, depending
on the weather in a particular growing season. In addition to
exceptionally stressful years that cause measurable losses of
billions of dollars, less extreme stress almost certainly causes
smaller yield reductions over larger areas to produce yield
reductions of similar dollar value every year. For instance, in the
US, the 1995 early fall frosts are estimated to have caused losses
of over one billion dollars to corn and soybeans. The spring of
1998 saw an estimated $200 M of damages to Georgia alone, in the
peach, blueberry and strawberry industries. The occasional freezes
in Florida have shifted the citrus belt further south due to $100 M
or more losses. California sustained $650 M of damage in 1998 to
the citrus crop due to a winter freeze. In addition, certain crops
such as Eucalyptus, which has the very favorable properties of
rapid growth and good wood quality for pulping, are not able to
grow in the southeastern states due to occasional freezes.
[0008] Inherent winter hardiness of the crop determines in which
agricultural areas it can survive the winter. For example, for
wheat, the northern central portion of the US has winters that are
too cold for good winter wheat crops. Approximately 20% of the US
wheat crop is spring wheat, with a market value of $2 billion.
Areas growing spring wheat could benefit by growing winter wheat
that had increased winter hardiness. Assuming a 25% yield increase
when growing winter wheat, this would create $500 M of increased
value. Additionally, the existing winter wheat is severely stressed
by freezing conditions and should have improved yields with
increased tolerance to these stresses. An estimate of the yield
benefit of these traits is 10% of the $4.4 billion winter wheat
crop in the US or $444 M of yield increase, as well as better
survival in extreme freezing conditions that occur
periodically.
[0009] Thus plants more resistant to freezing, both midwinter
freezing and sudden freezes, would protect a farmers' investment,
improve yield and quality, and allow some geographies to grow more
profitable and productive crops. Additionally, winter crops such as
canola, wheat and barley have 25% to 50% yield increases relative
to spring planted varieties of the same crops. This yield increase
is due to the "head start" the fall planted crop has over the
spring planted crop and its reaching maturity earlier while the
temperatures, soil moisture and lack of pathogens provide more
favorable conditions.
Category: Abiotic Stress; Desired Trait: Salt Tolerance.
[0010] One in five hectares of irrigated land is damaged by salt,
an important historical factor in the decline of ancient agrarian
societies. This condition is only expected to worsen, further
reducing the availability of arable land and crop production, since
none of the top five food crops--wheat, corn, rice, potatoes, and
soybean--can tolerate excessive salt.
[0011] Detrimental effects of salt on plants are a consequence of
both water deficit resulting in osmotic stress (similar to drought
stress) and the effects of excess sodium ions on critical
biochemical processes. As with freezing and drought, high saline
causes water deficit; the presence of high salt makes it difficult
for plant roots to extract water from their environment (Buchanan
et al. (2000) in Biochemistry and Molecular Biology of Plants,
American Society of Plant Physiologists, Rockville, Md.). Soil
salinity is thus one of the more important variables that
determines where a plant may thrive. In many parts of the world,
sizable land areas are uncultivable due to naturally high soil
salinity. To compound the problem, salination of soils that are
used for agricultural production is a significant and increasing
problem in regions that rely heavily on agriculture. The latter is
compounded by over-utilization, over-fertilization and water
shortage, typically caused by climatic change and the demands of
increasing population. Salt tolerance is of particular importance
early in a plant's lifecycle, since evaporation from the soil
surface causes upward water movement, and salt accumulates in the
upper soil layer where the seeds are placed. Thus, germination
normally takes place at a salt concentration much higher than the
mean salt level in the whole soil profile.
Category: Abiotic Stress; Desired Trait: Drought Tolerance.
[0012] While much of the weather that we experience is brief and
short-lived, drought is a more gradual phenomenon, slowly taking
hold of an area and tightening its grip with time. In severe cases,
drought can last for many years, and can have devastating effects
on agriculture and water supplies. With burgeoning population and
chronic shortage of available fresh water, drought is not only the
number one weather related problem in agriculture, it also ranks as
one of the major natural disasters of all time, causing not only
economic damage, but also loss of human lives. For example, losses
from the US drought of 1988 exceeded $40 billion, exceeding the
losses caused by Hurricane Andrew in 1992, the Mississippi River
floods of 1993, and the San Francisco earthquake in 1989. In some
areas of the world, the effects of drought can be far more severe.
In the Horn of Africa the 1984-1985 drought led to a famine that
killed 750,000 people.
[0013] Problems for plants caused by low water availability include
mechanical stresses caused by the withdrawal of cellular water.
Drought also causes plants to become more susceptible to various
diseases (Simpson (1981). "The Value of Physiological Knowledge of
Water Stress in Plants", In Water Stress on Plants, (Simpson, G.
M., ed.), Praeger, N.Y., pp. 235-265).
[0014] In addition to the many land regions of the world that are
too arid for most if not all crop plants, overuse and
over-utilization of available water is resulting in an increasing
loss of agriculturally-usable land, a process which, in the
extreme, results in desertification. The problem is further
compounded by increasing salt accumulation in soils, as described
above, which adds to the loss of available water in soils.
Category: Abiotic Stress; Desired Trait: Heat Tolerance.
[0015] Germination of many crops is very sensitive to temperature.
A transcription factor that would enhance germination in hot
conditions would be useful for crops that are planted late in the
season or in hot climates.
[0016] Seedlings and mature plants that are exposed to excess heat
may experience heat shock, which may arise in various organs,
including leaves and particularly fruit, when transpiration is
insufficient to overcome heat stress. Heat also damages cellular
structures, including organelles and cytoskeleton, and impairs
membrane function (Buchanan, supra).
[0017] Heat shock may result a decrease in overall protein
synthesis, accompanied by expression of heat shock proteins. Heat
shock proteins function as chaperones and are involved in refolding
proteins denatured by heat.
Category: Abiotic Stress; Desired Trait: Tolerance to Low Nitrogen
and Phosphorus.
[0018] The ability of all plants to remove nutrients from their
environment is essential to survival. Thus, identification of genes
that encode polypeptides with transcription factor activity may
allow for the generation of transgenic plants that are better able
to make use of available nutrients in nutrient-poor
environments.
[0019] Among the most important macronutrients for plant growth
that have the largest impact on crop yield are nitrogenous and
phosphorus-containing compounds. Nitrogen- and
phosphorus-containing fertilizers are used intensively in
agriculture practices today. An increase in grain crop yields from
0.5 to 1.0 metric tons per hectare to 7 metric tons per hectare
accompanied the use of commercial fixed nitrogen fertilizer in
production farming (Vance (2001) Plant Physiol. 127: 390-397).
Given current practices, in order to meet food production demands
in years to come, considerable increases in the amount of nitrogen-
and phosphorus-containing fertilizers will be required (Vance,
supra).
[0020] Nitrogen is the most abundant element on earth yet it is one
of the most limiting elements to plant growth due to its lack of
availability in the soil. Plants obtain N from the soil from
several sources including commercial fertilizers, manure and the
mineralization of organic matter. The intensive use of N
fertilizers in present agricultural practices is problematic, the
energy intensive Haber-Bosch process makes N fertilizer and it is
estimated that the US uses annually between 3-5% of the nation's
natural gas for this process. In addition to the expense of N
fertilizer production and the depletion of non-renewable resources,
the use of N fertilizers has led to the eutrophication of
freshwater ecosystems and the contamination of drinking water due
to the runoff of excess fertilizer into ground water supplies.
[0021] Phosphorus is second only to N in its importance as a
macronutrient for plant growth and to its impact on crop yield.
Phosphorus (P) is extremely immobile and not readily available to
roots in the soil and is therefore often growth limiting to plants.
Inorganic phosphate (Pi) is a constituent of several important
molecules required for energy transfer, metabolic regulation and
protein activation (Marschner (1995) Mineral Nutrition of Higher
Plants, 2nd ed., Academic Press, San Diego, Calif.). Plants have
evolved several strategies to help cope with P and N deprivation
that include metabolic as well as developmental adaptations. Most,
if not all, of these strategies have components that are regulated
at the level of transcription and therefore are amenable to
manipulation by transcription factors. Metabolic adaptations
include increasing the availability of P and N by increasing uptake
from the soil though the induction of high affinity and low
affinity transporters, and/or increasing its mobilization in the
plant. Developmental adaptations include increases in primary and
secondary roots, increases in root hair number and length, and
associations with mycorrhizal fungi (Bates and Lynch (1996) Plant
Cell Environ. 19: 529-538; Harrison (1999) Annu. Rev. Plant
Physiol. Plant Mol. Biol. 50: 361-389).
Category: Biotic Stress; Desired Trait: Disease Resistance.
[0022] Disease management is a significant expense in crop
production worldwide. According to EPA reports for 1996 and 1997,
us farmers spend approximately $6 billion on fungicides annually.
Despite this expenditure, according to a survey conducted by the
food and agriculture organization, plant diseases still reduce
worldwide crop productivity by 12% and in the United States alone,
economic losses due to plant pathogens amounts to 9.1 billion
dollars (FAO, 1993). Data from these reports and others demonstrate
that despite the availability of chemical control only a small
proportion of the losses due to disease can be prevented. Not only
are fungicides and anti-bacterial treatments expensive to growers,
but their widespread application poses both environmental and
health risks. The use of plant biotechnology to engineer disease
resistant crops has the potential to make a significant economic
impact on agriculture and forestry industries in two ways: reducing
the monetary and environmental expense of fungicide application and
reducing both pre-harvest and post-harvest crop losses that occur
now despite the use of costly disease management practices.
[0023] Fungal, bacterial, oomycete, viral, and nematode diseases of
plants are ubiquitous and important problems, and often severely
impact yield and quality of crop and other plants. A very few
examples of diseases of plants include:
[0024] Powdery mildew, caused by the fungi Erysiphe, Sphaerotheca,
Phyllactinia, Microsphaera, Podosphaera or Uncinula, in, for
example, wheat, bean, cucurbit, lettuce, pea, grape, tree fruit
crops, as well as roses, phlox, lilacs, grasses, and Euonymus;
[0025] Fusarium-caused diseases such as Fusarium wilt in cucurbits,
Fusarium head blight in barley and wheat, wilt and crown and root
rot in tomatoes;
[0026] Sudden oak death, caused by the oomycete Phytophthora
ramorum; this disease was first detected in 1995 in California tan
oaks. The disease has since killed more than 100,000 tan oaks,
coast live oaks, black oaks, and Shreve's oaks in coastal regions
of northern California, and more recently in southwestern Oregon
(Roach (2001) National Geographic News, Dec. 6, 2001);
[0027] Black Sigatoka, a fungal disease caused by Mycosphaerella
species that attacks banana foliage, is spreading throughout the
regions of the world that are responsible for producing most of the
world's banana crop;
[0028] Eutypa dieback, caused by Eutypa lata, affects a number of
crop plants, including vine grape. Eutypa dieback delays shoot
emergence, and causes chlorosis, stunting, and tattering of
leaves;
[0029] Pierce's disease, caused by the bacterium Xylella
fastidiosa, precludes growth of grapes in the southeastern United
States, and threatens the profitable wine grape industry in
northern California. The bacterium clogs the vasculature of the
grapevines, resulting in foliar scorching followed by slow death of
the vines. There is no known treatment for Pierce's disease;
[0030] Bacterial Spot caused by the bacterium Xanthomonas
campestris causes serious disease problems on tomatoes and peppers.
It is a significant problem in the Florida tomato industry because
it spreads rapidly, especially in warm periods where there is
wind-driven rain. Under these conditions, there are no adequate
control measures;
[0031] Diseases caused by viruses of the family Geminiviridae are a
growing agricultural problem worldwide. Geminiviruses have caused
severe crop losses in tomato, cassava, and cotton. For instance, in
the 1991-1992 growing season in Florida, geminiviruses caused $140
million in damages to the tomato crop (Moffat (1991) Science 286:
1835). Geminiviruses have the ability to recombine between strains
to rapidly produce new virulent varieties. Therefore, there is a
pressing need for broad-spectrum geminivirus control;
[0032] The soybean cyst nematode, Heterodera glycines, causes
stunting and chlorosis of soybean plants, which results in yield
losses or plant death from severe infestation. Annual losses in the
United States have been estimated at $1.5 billion (University of
Minnesota Extension Service).
[0033] The aforementioned pathogens represent a very small fraction
of diverse species that seriously affect plant health and yield.
For a more complete description of numerous plant diseases, see,
for example, Vidhyasekaran (1997) Fungal Pathogenesis in Plants and
Crops: Molecular Biology and Host Defense Mechanisms, Marcel
Dekker, Monticello, N.Y.), or Agrios (1997) Plant Pathology,
Academic Press, New York, N.Y.). Plants that are able to resist
disease may produce significantly higher yields and improved food
quality. It is thus of considerable importance to find genes that
reduce or prevent disease.
Category: Light Response; Desired Trait: Reduced Shade
Avoidance.
[0034] Shade avoidance describes the process in which plants grown
in close proximity attempt to out-compete each other by increasing
stem length at the expense of leaf, fruit and storage organ
development. This is caused by the plant's response to far-red
radiation reflected from leaves of neighboring plants, which is
mediated by phytochrome photoreceptors. Close proximity to other
plants, as is produced in high-density crop plantings, increases
the relative proportion of far-red irradiation, and therefore
induces the shade avoidance response. Shade avoidance adversely
affects biomass and yield, particularly when leaves, fruits or
other storage organs constitute the desired crop (see, for example,
Smith (1982) Annu. Rev. Plant Physiol. 33: 481-518; Ballare et al.
(1990) Science 247: 329-332; Smith (1995) Annu. Dev. Plant Physiol.
Mol. Biol., 46: 289-315; and Schmitt et al. (1995), American
Naturalist, 146: 937-953). Alteration of the shade avoidance
response in tobacco through alteration of phytochrome levels has
been shown to produce an increase in harvest index (leaf
biomass/total biomass) at high planting density, which would result
in higher yield (Robson et al. (1996) Nature Biotechnol. 14:
995-998).
Category: Flowering Time Desired Trait: Altered Flowering Time and
Flowering Control.
[0035] Timing of flowering has a significant impact on production
of agricultural products. For example, varieties with different
flowering responses to environmental cues are necessary to adapt
crops to different production regions or systems. Such a range of
varieties have been developed for many crops, including wheat,
corn, soybean, and strawberry. Improved methods for alteration of
flowering time will facilitate the development of new,
geographically adapted varieties.
[0036] Breeding programs for the development of new varieties can
be limited by the seed-to-seed cycle. Thus, breeding new varieties
of plants with multi-year cycles (such as biennials, e.g. carrot,
or fruit trees, such as citrus) can be very slow. With respect to
breeding programs, there would be a significant advantage in having
commercially valuable plants that exhibit controllable and modified
periods to flowering ("flowering times"). For example, accelerated
flowering would shorten crop and tree breeding programs.
[0037] Improved flowering control allows more than one planting and
harvest of a crop to be made within a single season. Early
flowering would also improve the time to harvest plants in which
the flower portion of the plant constitutes the product (e.g.,
broccoli, cauliflower, and other edible flowers). In addition,
chemical control of flowering through induction or inhibition of
flowering in plants could provide a significant advantage to
growers by inducing more uniform fruit production (e.g., in
strawberry)
[0038] A sizable number of plants for which the vegetative portion
of the plant forms the valuable crop tend to "bolt" dramatically
(e.g., spinach, onions, lettuce), after which biomass production
declines and product quality diminishes (e.g., through
flowering-triggered senescence of vegetative parts). Delay or
prevention of flowering may also reduce or preclude dissemination
of pollen from transgenic plants.
Category: Growth Rate; Desired Trait: Modified Growth Rate.
[0039] For almost all commercial crops, it is desirable to use
plants that establish more quickly, since seedlings and young
plants are particularly susceptible to stress conditions such as
salinity or disease. Since many weeds may outgrow young crops or
out-compete them for nutrients, it would also be desirable to
determine means for allowing young crop plants to out compete weed
species. Increasing seedling growth rate (emergence) contributes to
seedling vigor and allows for crops to be planted earlier in the
season with less concern for losses due to environmental factors.
Early planting helps add days to the critical grain-filling period
and increases yield.
[0040] Providing means to speed up or slow down plant growth would
also be desirable to ornamental horticulture. If such means be
provided, slow growing plants may exhibit prolonged
pollen-producing or fruiting period, thus improving fertilization
or extending harvesting season.
Category: Growth Rate; Desired Trait: Modified Senescence and Cell
Death.
[0041] Premature senescence, triggered by various plant stresses,
can limit production of both leaf biomass and seed yield.
Transcription factor genes that suppress premature senescence or
cell death in response to stresses can provide means for increasing
yield. Delay of normal developmental senescence could enhance yield
also, particularly for those plants for which the vegetative part
of the plant represents the commercial product (e.g., spinach,
lettuce).
[0042] Although leaf senescence is thought to be an evolutionary
adaptation to recycle nutrients, the ability to control senescence
in an agricultural setting has significant value. For example, a
delay in leaf senescence in some maize hybrids is associated with a
significant increase in yields and a delay of a few days in the
senescence of soybean plants can have a large impact on yield. In
an experimental setting, tobacco plants engineered to inhibit leaf
senescence had a longer photosynthetic lifespan, and produced a 50%
increase in dry weight and seed yield (Gan and Amasino (1995)
Science 270: 1986-1988). Delayed flower senescence may generate
plants that retain their blossoms longer and this may be of
potential interest to the ornamental horticulture industry, and
delayed foliar and fruit senescence could improve post-harvest
shelf-life of produce.
[0043] Further, programmed cell death plays a role in other plant
responses, including the resistance response to disease, and some
symptoms of diseases, for example, as caused by necrotrophic
pathogens such as Botrytis cinerea and Sclerotinia sclerotiorum
(Dickman et al. Proc. Natl. Acad. Sci., 98: 6957-6962). Localized
senescence and/or cell death can be used by plants to contain the
spread of harmful microorganisms. A specific localized cell death
response, the "hypersensitive response", is a component of
race-specific disease resistance mediated by plant resistance
genes. The hypersensitive response is thought to help limit
pathogen growth and to initiate a signal transduction pathway that
leads to the induction of systemic plant defenses. Accelerated
senescence may be a defense against obligate pathogens, such as
powdery mildew, that rely on healthy plant tissue for nutrients.
With regard to powdery mildew, Botrytis cinerea and Sclerotinia
sclerotiorum and other pathogens, transcription factors that
ameliorate cell death and/or damage may reduce the significant
economic losses encountered, such as, for example, Botrytis cinerea
in strawberry and grape.
Category: Growth Regulator; Desired Trait: Altered Sugar
Sensing
[0044] Sugars are key regulatory molecules that affect diverse
processes in higher plants including germination, growth,
flowering, senescence, sugar metabolism and photosynthesis.
Sucrose, for example, is the major transport form of photosynthate
and its flux through cells has been shown to affect gene expression
and alter storage compound accumulation in seeds (source-sink
relationships). Glucose-specific hexose-sensing has also been
described in plants and is implicated in cell division and
repression of "famine" genes (photosynthetic or glyoxylate
cycles).
Category: Morphology; Desired Trait: Altered Morphology
[0045] Trichomes are branched or unbranched epidermal outgrowths or
hair structures on a plant. Trichomes produce a variety of
secondary biochemicals such as diterpenes and waxes, the former
being important as, for example, insect pheromones, and the latter
as protectants against desiccation and herbivorous pests. Since
diterpenes also have commercial value as flavors, aromas,
pesticides and cosmetics, and potential value as anti-tumor agents
and inflammation-mediating substances, they have been both products
and the target of considerable research. In most cases where the
metabolic pathways are impossible to engineer, increasing trichome
density or size on leaves may be the only way to increase plant
productivity. Thus, it would be advantageous to discover
trichome-affecting transcription factor genes for the purpose of
increasing trichome density, size, or type to produce plants that
are better protected from insects or that yield higher amounts of
secondary metabolites.
[0046] The ability to manipulate wax composition, amount, or
distribution could modify plant tolerance to drought and low
humidity or resistance to insects, as well as plant appearance. In
particular, a possible application for a transcription factor gene
that reduces wax production in sunflower seed coats would be to
reduce fouling during seed oil processing. Antisense or
co-suppression of transcription factors involved in wax
biosynthesis in a tissue specific manner can be used to
specifically alter wax composition, amount, or distribution in
those plants and crops from which wax is either a valuable
attribute or product or an undesirable constituent of plants.
[0047] Other morphological characteristics that may be desirable in
plants include those of an ornamental nature. These include changes
in seed color, overall color, leaf and flower shape, leaf color,
leaf size, or glossiness of leaves. Plants that produce dark leaves
may have benefits for human health; flavonoids, for example, have
been used to inhibit tumor growth, prevent of bone loss, and
prevention lipid oxidation in animals and humans. Plants in which
leaf size is increased would likely provide greater biomass, which
would be particularly valuable for crops in which the vegetative
portion of the plant constitutes the product. Plants with glossy
leaves generally produce greater epidermal wax, which, if it could
be augmented, resulted in a pleasing appearance for many
ornamentals, help prevent desiccation, and resist herbivorous
insects and disease-causing agents. Changes in plant or plant part
coloration, brought about by modifying, for example, anthocyanin
levels, would provide novel morphological features.
[0048] In many instances, the seeds of a plant constitute a
valuable crop. These include, for example, the seeds of many
legumes, nuts and grains. The discovery of means for producing
larger seed would provide significant value by bringing about an
increase in crop yield. Plants with altered inflorescence,
including, for example, larger flowers or distinctive floral
configurations, may have high value in the ornamental horticulture
industry.
[0049] Modifications to flower structure may have advantageous or
deleterious effects on fertility, and could be used, for example,
to decrease fertility by the absence, reduction or screening of
reproductive components. This could be a desirable trait, as it
could be exploited to prevent or minimize the escape of the pollen
of genetically modified organisms into the environment.
[0050] Manipulation of inflorescence branching patterns may also be
used to influence yield and offer the potential for more effective
harvesting techniques. For example, a "self pruning" mutation of
tomato results in a determinate growth pattern and facilitates
mechanical harvesting (Pnueli et al. (2001) Plant Cell 13(12):
2687-2702).
[0051] Alterations of apical dominance or plant architecture could
create new plant varieties. Dwarf plants may be of potential
interest to the ornamental horticulture industry.
Category: Seed Biochemistry; Desired Trait: Altered Seed Oil
[0052] The composition of seeds, particularly with respect to seed
oil quantity and/or composition, is very important for the
nutritional value and production of various food and feed products.
Desirable improvements to oils include enhanced heat stability,
improved nutritional quality through, for example, reducing the
number of calories in seed, increasing the number of calories in
animal feeds, or altering the ratio of saturated to unsaturated
lipids comprising the oils.
Category: Seed Biochemistry; Desired Trait: Altered Seed
Protein
[0053] As with seed oils, seed protein content and composition is
very important for the nutritional value and production of various
food and feed products. Altered protein content or concentration in
seeds may be used to provide nutritional benefits, and may also
prolong storage capacity, increase seed pest or disease resistance,
or modify germination rates. Altered amino acid composition of
seeds, through altered protein composition, is also a desired
objective for nutritional improvement.
Category: Seed Biochemistry; Desired Trait: Altered Prenyl
Lipids.
[0054] Prenyl lipids, including the tocopherols, play a role in
anchoring proteins in membranes or membranous organelles.
Tocopherols have both anti-oxidant and vitamin E activity. Modified
tocopherol composition of plants may thus be useful in improving
membrane integrity and function, which may mitigate abiotic
stresses such as heat stress. Increasing the anti-oxidant and
vitamin content of plants through increased tocopherol content can
provide useful human health benefits.
Category: Leaf Biochemistry; Desired Trait: Altered Glucosinolate
Levels
[0055] Increases or decreases in specific glucosinolates or total
glucosinolate content can be desirable depending upon the
particular application. For example: (i) glucosinolates are
undesirable components of the oilseeds used in animal feed, since
they produce toxic effects; low-glucosinolate varieties of canola
have been developed to combat this problem; (ii) some
glucosinolates have anti-cancer activity; thus, increasing the
levels or composition of these compounds can be of use in
production of nutraceuticals; and (iii) glucosinolates form part of
a plant's natural defense against insects; modification of
glucosinolate composition or quantity could therefore afford
increased protection from herbivores. Furthermore, tissue specific
promoters can be used in edible crops to ensure that these
compounds accumulate specifically in particular tissues, such as
the epidermis, which are not taken for human consumption.
Category: Leaf Biochemistry; Desired Trait: Flavonoid
Production.
[0056] Expression of transcription factors that increase flavonoid
production in plants, including anthocyanins and condensed tannins,
may be used to alter pigment production for horticultural purposes,
and possibly to increase stress resistance. Flavonoids have
antimicrobial activity and could be used to engineer pathogen
resistance. Several flavonoid compounds have human health promoting
effects such as inhibition of tumor growth, prevention of bone loss
and prevention of lipid oxidation. Increased levels of condensed
tannins in forage legumes would provide agronomic benefits in
ruminants by preventing pasture bloat by collapsing protein foams
within the rumen. For a review on the utilities of flavonoids and
their derivatives, see Dixon et al. (1999) Trends Plant Sci. 4:
394-400.
[0057] Genetic and molecular studies on Arabidopsis have revealed
that the timing of flowering is influenced by a large number of
different genes (Martinez-Zapater and Somerville (1990) Plant
Physiol. 92: 770-776; Koornneef et al. (1991) Mol. Gen. Genet. 229:
57-66; Martinez-Zapater et al. (1994) In Meyerowitz and Somerville,
editors, Arabidopsis, Cold Spring Harbor Laboratory Press, Cold
Spring Harbor, N.Y., pp 403-433; Koornneef et al. (1998a) Annu.
Rev. Plant Physiol. Plant Mol. Biol. 49: 345-370; Koornneef et al.
(1998b) Genetics 148: 885-892; Levy and Dean (1998) Plant Cell 10:
1973-1990; Simpson et al. (1999) Annu. Rev. Cell Dev. Biol. 15:
519-550; Simpson and Dean (2002) Science 296: 285-289; and
Ratcliffe and Riechmann (2002) Curr. Issues Mol. Biol. 4: 77-91).
Such loci ensure that the switch from vegetative to reproductive
growth takes place at the most appropriate time with respect to a
variety of abiotic and biotic variables. Amongst the most
intensively studied effects are the responses to day length and
prolonged exposure to low temperatures (vernalization).
[0058] Arabidopsis flowers rapidly in long day photoperiodic
conditions of 16 hours or continuous light. However, under short
day conditions of 8-10 hours of light, the plants display a much
more extensive period of vegetative growth prior to flowering.
Genes that control this day length response were originally
identified via mutations that cause late flowering under long days,
but which do not alter flowering time in short day conditions.
Examples of photoperiod pathway genes include CONSTANS (CO),
GIGANTEA (GI), FE, FD, and FHA. A second group of genes, which
includes LUMINIDEPENDENS (LD), FCA, FVE, FY, and FPA, form an
autonomous pathway that monitors the developmental state of the
plant and is active under all photoperiodic conditions. Mutants for
this second class of genes flower later than wild type controls
irrespective of the day length (Koornneef et al. (1991);
Martinez-Zapater et al. (1994); Koornneef et al. (1998a); and
Koornneef et al. (1998b); all supra).
[0059] Importantly, mutants from the photoperiod and autonomous
pathways also show a differential response to vernalization. Via a
vernalization response, Arabidopsis ecotypes from northern
latitudes, such as Stockholm, Sweden, are adapted to flower in the
spring following exposure to cold winter conditions. This avoids
flowering in the late summer when seed maturation might be
curtailed by the onset of winter conditions. (See, for example,
Vince-Prue (1975) In Photoperiodism in plants McGraw Hill, London,
UK, pp 263-291; Napp-Zinn (1957) Z. Indukt. Abstammungs
Vererbungsl. 88: 253-285; and Reeves and Coupland (2000) Curr.
Opin. Plant Biol. 3: 37-42).
[0060] When such ecotypes are grown in the laboratory they flower
late, but will flower much earlier if subjected to a cold period of
4-8 weeks while the seed is germinating. In a comparable manner,
mutants from the autonomous pathway exhibit a very marked reduction
in flowering time when subjected to vernalization. By contrast,
mutants from the photoperiod pathway show only a minor response to
cold treatments. Thus, vernalization can overcome the requirement
for the autonomous pathway. (See Martinez-Zapater and Somerville
(1990) supra; Koornneef et al. (1991) supra; Bagnall (1992) Aust.
J. Plant Physiol. 19: 401-409; Burn et al. (1993) Proc. Natl. Acad.
Sci. 90: 287-291; Lee et al. (1993) Mol. Gen. Genet. 237: 171-176;
Clarke and Dean (1994) Mol. Gen. Genet. 242: 81-89; Chandler et al.
(1996) Plant J. 10: 637-644; Koornneef et al. (1998b) supra.)
[0061] Genetic and molecular analyses have revealed that a MADS box
protein, FLOWERING LOCUS C (FLC), is a major determinant of the
vernalization response (Koornneef et al. (1994) supra; Lee et al.
(1994) supra; Sanda and Amasino (1996) Mol. Gen. Genet. 251: 69-74;
Michaels and Amasino (2000) Plant Cell and Environment 23:
1145-1153; Sheldon et al. (1999) Plant Cell 11: 445-458; Sheldon et
al. (2002) Plant Cell 14: 2527-2537; and Rouse et al. (2002) Plant
J. 29: 183-191). High levels of both FLC gene transcript and
protein are present in mutants for the autonomous pathway and also
in naturally late flowering northern ecotypes, which contain active
alleles of a second locus, FRIGIDA (FRI; Burn et al. (1993) supra;
Clarke and Dean (1994) supra; Johanson et al. (2000) Science 290:
344-347). By contrast, mutants from the photoperiod pathway, and
backgrounds lacking an active FRI allele, show relatively low
levels of FLC transcript. Furthermore, null alleles of flc
completely suppress the late flowering caused by autonomous pathway
mutations and active FRI alleles, but have no effect on the delayed
flowering in photoperiod pathway mutants (Michaels and Amasino
(2001) Plant Cell 13: 935-941). FLC gene expression therefore
appears to be supported by FRI and strongly repressed by floral
activators within the autonomous pathway.
[0062] During vernalization, FLC transcript and protein levels
fall, and the plants become competent to flower (Michaels and
Amasino (1999) Plant Cell 11: 949-956; Michaels and Amasino (2001)
supra; Sheldon et al. (1999) supra; Sheldon et al. (2000) Proc.
Natl. Acad. Sci. 97: 3753-3758; Johanson et al. (2000) supra; and
Rouse et al. (2002) supra). Additionally, overexpression of FLC
from a 35S CaMV promoter in the Landsberg ecotype (which lacks an
active FRI allele) is sufficient to severely delay or prevent
flowering, and renders the plants insensitive to vernalization
(Michaels and Amasino (1999) supra; Sheldon et al. (1999) supra).
These findings indicate that FLC is a potent floral repressor; it
has now been shown that such repression is achieved by FLC
inhibiting downstream genes that promote flowering, including SOC1
and FT (Borner et al. (2000) Plant J. 24: 591-599; Lee et al.
(2000) Genes Dev. 14: 2366-2376; Onouchi et al. (2000) Plant Cell
12: 885-900; Samach et al. (2000) Science 288: 1613-1616; Michaels
and Amasino (2001) supra). Thus, promotion of flowering by either
the autonomous pathway or vernalization involves repression of FLC
and the subsequent de-repression of FLC targets. Recently, regions
within the FLC gene and its promoter have been defined which are
required for its vernalization induced repression (Sheldon et al.
(2002) supra). However, the molecular signaling events that lead to
a fall in FLC levels during vernalization are still unclear. The
products of VERNALIZATION2 and VERNALIZATION1 maintain repression
of FLC, once levels of FLC transcript have declined (Gendall et al.
(2001) Cell 107: 525-535; Levy et al. (2002) Science 297: 243-246),
but it is not yet known how the decline is initially achieved.
[0063] A number of additional questions, regarding the molecular
basis of vernalization, still remain unanswered. First, it has been
observed that null flc mutants are responsive to vernalization
(Michaels and Amasino (2001) supra). Therefore vernalization can
promote flowering by other mechanisms as well as via repression of
FLC. In addition, vernalization is a quantitative response to
prolonged periods of cold (Sheldon et al. (2000) supra); a
mechanism must therefore exist to ensure that vernalization does
not always occur in response to short periods of cold, lasting only
a few days.
[0064] Vernalization may also be desirable in plants that do not
normally have a vernalization response. Such plants in which
expression of a polynucleotide creates a vernalization response
therefore may be propagated and cultivated at different latitudes
and/or altitudes compared with the native plant species that do not
express a polynucleotide creating a vernalization response.
[0065] The present invention relates to methods and compositions
for producing transgenic plants with modified traits, particularly
traits that address the agricultural and food needs described in
the above background information. These traits may provide
significant value in that they allow the plant to thrive in hostile
environments, where, for example, temperature, water and nutrient
availability or salinity may limit or prevent growth of
non-transgenic plants. The traits may also comprise desirable
morphological alterations, larger or smaller size, disease and pest
resistance, alterations in flowering time, light response, and
others.
[0066] We have identified polynucleotides encoding transcription
factors, developed numerous transgenic plants using these
polynucleotides, and have analyzed the plants for a variety of
important traits. In so doing, we have identified important
polynucleotide and polypeptide sequences for producing commercially
valuable plants and crops as well as the methods for making them
and using them. Other aspects and embodiments of the invention are
described below and can be derived from the teachings of this
disclosure as a whole.
SUMMARY OF THE INVENTION
[0067] Transgenic plants and methods for producing transgenic
plants are provided. The transgenic plants a recombinant
polynucleotide having a polynucleotide sequence, or a complementary
polynucleotide sequence thereof, that encodes a transcription
factor.
[0068] The polynucleotide sequences that may encode the
transcription factors are listed in the Sequence Listing and
include any of SEQ ID NO: 2N-1, where N=1-480, SEQ ID NO: 2N, where
N=856-969, or SEQ ID NO: 961, 962, 963, 964, 965, 967, 968, 969,
970, 971, 972, 973, 974, 975, 976, 977, 978, 979, 980, 981, 982,
983, 984, 985, 986, 987, 988, 992, 993, 994, 995, 996, 997, 998,
999, 1000, 1003, 1004, 1005, 1006, 1007, 1008, 1009, 1010, 1011,
1013, 1014, 1015, 1016, 1017, 1019, 1020, 1023, 1024, 1026, 1030,
1031, 1032, 1033, 1035, 1036, 1037, 1038, 1039, 1040, 1041, 1042,
1043, 1044, 1045, 1046, 1047, 1048, 1049, 1052, 1053, 1054, 1055,
1056, 1057, 1058, 1059, 1060, 1061, 1062, 1063, 1064, 1065, 1066,
1067, 1068, 1069, 1070, 1071, 1077, 1078, 1079, 1080, 1081, 1082,
1083, 1084, 1085, 1086, 1087, 1088, 1089, 1090, 1096, 1097, 1098,
1099, 1100, 1101, 1102, 1103, 1104, 1105, 1106, 1107, 1108, 1113,
1114, 1115, 1116, 1117, 1118, 1119, 1120, 1121, 1122, 1123, 1124,
1125, 1126, 1127, 1128, 1129, 1130, 1131, 1132, 1133, 1134, 1135,
1136, 1137, 1138, 1139, 1140, 1141, 1142, 1143, 1144, 1145, 1146,
1147, 1148, 1149, 1151, 1152, 1153, 1154, 1155, 1156, 1157, 1158,
1159, 1160, 1161, 1162, 1163, 1164, 1170, 1171, 1172, 1173, 1174,
1175, 1176, 1177, 1178, 1179, 1180, 1181, 1182, 1183, 1184, 1185,
1186, 1187, 1188, 1192, 1193, 1194, 1195, 1196, 1200, 1201, 1202,
1203, 1204, 1205, 1206, 1207, 1208, 1209, 1210, 1211, 1212, 1217,
1218, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1228, 1229, 1230,
1231, 1232, 1234, 1235, 1236, 1237, 1238, 1240, 1241, 1242, 1243,
1244, 1245, 1248, 1249, 1250, 1251, 1252, 1253, 1254, 1255, 1256,
1257, 1260, 1261, 1262, 1263, 1264, 1265, 1266, 1267, 1268, 1270,
1271, 1272, 1273, 1274, 1275, 1276, 1277, 1278, 1279, 1280, 1281,
1282, 1283, 1284, 1285, 1286, 1287, 1288, 1289, 1290, 1291, 1292,
1293, 1294, 1295, 1296, 1297, 1298, 1299, 1300, 1301, 1302, 1303,
1304, 1305, 1306, 1311, 1312, 1313, 1314, 1315, 1316, 1317, 1318,
1319, 1320, 1321, 1322, 1324, 1325, 1326, 1327, 1328, 1333, 1334,
1335, 1336, 1337, 1341, 1342, 1343, 1344, 1345, 1346, 1347, 1348,
1349, 1350, 1351, 1352, 1353, 1354, 1355, 1356, 1357, 1358, 1359,
1360, 1363, 1364, 1365, 1366, 1367, 1368, 1369, 1370, 1371, 1372,
1376, 1377, 1378, 1379, 1380, 1381, 1382, 1383, 1385, 1386, 1387,
1388, 1392, 1393, 1394, 1395, 1397, 1398, 1399, 1400, 1401, 1402,
1403, 1404, 1405, 1406, 1407, 1408, 1409, 1410, 1415, 1416, 1417,
1418, 1419, 1420, 1421, 1422, 1423, 1425, 1426, 1427, 1428, 1429,
1430, 1431, 1432, 1433, 1434, 1438, 1439, 1440, 1441, 1442, 1443,
1444, 1445, 1446, 1447, 1449, 1450, 1451, 1452, 1453, 1454, 1455,
1461, 1462, 1463, 1464, 1465, 1466, 1467, 1468, 1469, 1470, 1471,
1473, 1474, 1475, 1476, 1477, 1478, 1479, 1480, 1481, 1482, 1485,
1486, 1487, 1488, 1489, 1490, 1491, 1492, 1493, 1494, 1495, 1496,
1497, 1498, 1499, 1501, 1502, 1503, 1504, 1505, 1506, 1507, 1509,
1512, 1513, 1514, 1515, 1516, 1517, 1518, 1519, 1521, 1522, 1523,
1524, 1525, 1526, 1527, 1528, 1529, 1530, 1531, 1532, 1533, 1534,
1535, 1536, 1537, 1544, 1545, 1546, 1547, 1548, 1549, 1550, 1551,
1552, 1553, 1554, 1555, 1556, 1557, 1558, 1559, 1560, 1561, 1562,
1570, 1571, 1572, 1573, 1574, 1575, 1576, 1577, 1578, 1579, 1580,
1581, 1584, 1585, 1586, 1587, 1588, 1589, 1590, 1591, 1592, 1593,
1595, 1596, 1597, 1598, 1599, 1600, 1601, 1602, 1603, 1604, 1605,
1606, 1607, 1608, 1609, 1610, 1613, 1614, 1615, 1616, 1617, 1621,
1622, 1623, 1624, 1625, 1628, 1629, 1630, 1631, 1632, 1633, 1634,
1637, 1638, 1639, 1642, 1643, 1644, 1645, 1646, 1647, 1648, 1649,
1650, 1651, 1652, 1653, 1654, 1659, 1660, 1661, 1662, 1663, 1664,
1665, 1666, 1667, 1668, 1669, 1670, 1671, 1674, 1675, 1676, 1677,
1678, 1679, 1681, 1683, 1684, 1685, 1690, 1691, 1692, 1693, 1694,
1695, 1697, 1698, 1699, 1700, 1701, 1704, 1705, 1706, 1707, 1708,
1709, 1710, 1711, 1944, 1946, 1948, 1950, 1952, 1954, 1956, 1958,
1960, 1962, 1964, 1966, 1968, 1970, and 1972.
[0069] The transcription factors are comprised of polypeptide
sequences listed in the Sequence Listing and include any of SEQ ID
NO: 2N, wherein N=1-480, SEQ ID NO: 2N-1, where N=857-970, or SEQ
ID NO: 989, 990, 991, 1001, 1002, 1012, 1018, 1021, 1022, 1025,
1027, 1028, 1029, 1034, 1050, 1051, 1072, 1073, 1074, 1075, 1076,
1091, 1092, 1093, 1094, 1095, 1109, 1110, 1111, 1112, 1150, 1165,
1166, 1167, 1168, 1169, 1189, 1190, 1191, 1197, 1198, 1199, 1213,
1214, 1215, 1216, 1226, 1227, 1233, 1239, 1246, 1247, 1258, 1259,
1269, 1307, 1308, 1309, 1310, 1323, 1329, 1330, 1331, 1332, 1338,
1339, 1340, 1361, 1362, 1373, 1374, 1375, 1384, 1389, 1390, 1391,
1396, 1411, 1412, 1413, 1414, 1424, 1435, 1436, 1437, 1448, 1456,
1457, 1458, 1459, 1460, 1472, 1483, 1484, 1500, 1508, 1510, 1511,
1520, 1538, 1539, 1540, 1541, 1542, 1543, 1563, 1564, 1565, 1566,
1567, 1568, 1569, 1582, 1583, 1594, 1611, 1612, 1618, 1619, 1620,
1626, 1627, 1635, 1636, 1640, 1641, 1655, 1656, 1657, 1658, 1672,
1673, 1680, 1682, 1686, 1687, 1688, 1689, 1696, 1702, 1703, 1945,
1947, 1949, 1951, 1953, 1955, 1957, 1959, 1961, 1963, 1965, 1967,
1969, 1971, and 1973.
[0070] The transgenic plant that comprises the recombinant
polynucleotide has a polynucleotide sequence (or a sequence that is
complementary to this polynucleotide sequence) selected from
[0071] (a) a nucleotide sequence that encodes one of the
aforementioned transcription factor polypeptide sequences; or
[0072] (b) a polypeptide sequence that comprises one of the
aforementioned transcription factor polypeptides.
[0073] In an example of a preferred embodiment, the transcription
factor polynucleotide sequence of (a) comprises G682, or SEQ ID NO:
467. In another example of a preferred embodiment, the
transcription factor polypeptide of (b) comprises G682, or SEQ ID
NO: 468.
[0074] The transgenic plant may also comprise a polynucleotide
sequence that is a variant of the sequences in (a) and (b) that
encode a polypeptide and initiate transcription, including:
[0075] (c) a sequence variant of the nucleotide sequences of (a) or
(b);
[0076] (d) an allelic variant of the nucleotide sequences of (a) or
(b);
[0077] (e) a splice variant of the nucleotide sequences of (a) or
(b);
[0078] (f) an orthologous sequence of the nucleotide sequences of
(a) or (b);
[0079] (g) a paralogous sequence of the nucleotide sequences of (a)
or (b);
[0080] (h) a nucleotide sequence encoding a polypeptide comprising
a conserved domain that exhibits at least 70% sequence homology
with the polypeptide of (a), and the polypeptide comprises a
conserved domain that initiates transcription; or
[0081] (i) a nucleotide sequence that hybridizes under stringent
conditions to a nucleotide sequence of one or more polynucleotides
of (a) or (b), and the nucleotide sequence encodes a polypeptide
that initiates transcription.
[0082] A transcription factor sequence variant is one having at
least 26% amino acid sequence similarity, at least 40% amino acid
sequence identity, a preferred transcription factor sequence
variant is one having at least 50% amino acid sequence identity and
a more preferred transcription factor sequence variant is one
having at least 65% amino acid sequence identity to the
transcription factor amino acid sequences SEQ ID NO: 2N, wherein
N=1-480, SEQ ID NO: 2N-1, where N=857-970, or SEQ ID NO: 989, 990,
991, 1001, 1002, 1012, 1018, 1021, 1022, 1025, 1027, 1028, 1029,
1034, 1050, 1051, 1072, 1073, 1074, 1075, 1076, 1091, 1092, 1093,
1094, 1095, 1109, 1110, 1111, 1112, 1150, 1165, 1166, 1167, 1168,
1169, 1189, 1190, 1191, 1197, 1198, 1199, 1213, 1214, 1215, 1216,
1226, 1227, 1233, 1239, 1246, 1247, 1258, 1259, 1269, 1307, 1308,
1309, 1310, 1323, 1329, 1330, 1331, 1332, 1338, 1339, 1340, 1361,
1362, 1373, 1374, 1375, 1384, 1389, 1390, 1391, 1396, 1411, 1412,
1413, 1414, 1424, 1435, 1436, 1437, 1448, 1456, 1457, 1458, 1459,
1460, 1472, 1483, 1484, 1500, 1508, 1510, 1511, 1520, 1538, 1539,
1540, 1541, 1542, 1543, 1563, 1564, 1565, 1566, 1567, 1568, 1569,
1582, 1583, 1594, 1611, 1612, 1618, 1619, 1620, 1626, 1627, 1635,
1636, 1640, 1641, 1655, 1656, 1657, 1658, 1672, 1673, 1680, 1682,
1686, 1687, 1688, 1689, 1696, 1702, 1703, 1945, 1947, 1949, 1951,
1953, 1955, 1957, 1959, 1961, 1963, 1965, 1967, 1969, 1971, and
1973, and which contains at least one functional or structural
characteristic of the transcription factor amino acid sequences.
Sequences having lesser degrees of identity but comparable
biological activity are considered to be equivalents.
[0083] The transcription factor polypeptides of the present
invention include at least one conserved domain, and the portions
of the nucleotide sequences encoding the conserved domain exhibit
at least 70% sequence identity with the aforementioned preferred
nucleotide sequences. In the case of zinc finger transcription
factors, the percent identity across the conserved domain may be as
low as 50%.
[0084] The present invention also encompasses MAF transcription
factor sequence variants. A MAF transcription factor sequence
variant is one having at least 26% amino acid sequence similarity,
at least 40% amino acid sequence identity, a preferred MAF
transcription factor sequence variant is one having at least 50%
amino acid sequence identity and a more preferred MAF transcription
factor sequence variant is one having at least 65% amino acid
sequence identity to the MAF transcription factor sequences SEQ ID
NO: 568, SEQ ID NO: 944, SEQ ID NO: 946, SEQ ID NO: 948, SEQ ID NO:
1735, SEQ ID NO: 1875, SEQ ID NO: 1971, SEQ ID NO: 1973, SEQ ID NO:
1945, SEQ ID NO: 1947, SEQ ID NO: 1949, SEQ ID NO: 1951, SEQ ID NO:
1953, SEQ ID NO: 1955, SEQ ID NO: 1957, SEQ ID NO: 1959, SEQ ID NO:
1961, SEQ ID NO: 1963, SEQ ID NO: 1965, SEQ ID NO: 1967, SEQ ID NO:
1969, SEQ ID NO: 2010, or SEQ ID NO: 2011, and which contains at
least one functional or structural characteristic of the MAF
transcription factor amino acid sequences. In a further embodiment,
the invention is a polynucleotide encoding a polypeptide having at
least 36% amino acid residue identity to a MAF transcription factor
selected from the group consisting of SEQ ID NOs: 568, SEQ ID NO:
944, SEQ ID NO: 946, SEQ ID NO: 948, SEQ ID NO: 1735, SEQ ID NO:
1875, SEQ ID NO: 1971, SEQ ID NO: 1973, SEQ ID NO: 1945, SEQ ID NO:
1947, SEQ ID NO: 1949, SEQ ID NO: 1951, SEQ ID NO: 1953, SEQ ID NO:
1955, SEQ ID NO: 1957, SEQ ID NO: 1959, SEQ ID NO: 1961, SEQ ID NO:
1963, SEQ ID NO: 1965, SEQ ID NO: 1967, SEQ ID NO: 1969, SEQ ID NO:
2010, or SEQ ID NO: 2011, and having MAF transcription factor
activity. In a yet further embodiment the invention is a
polynucleotide encoding a polypeptide having a conserved domain of
a MAF transcription factor wherein the conserved domain has at
least 54% identity to the conserved domain of SEQ ID NO: 568
comprising amino acid residues 2-74 of SEQ ID NO: 568. In a still
further embodiment the invention is a polynucleotide encoding a
polypeptide having a conserved domain of a MAF transcription factor
wherein the conserved domain has at least 64% identity to the
conserved domain of SEQ ID NO: 568 comprising amino acid residues
2-57 of SEQ ID NO: 568. Sequences having lesser degrees of identity
but comparable biological activity are considered to be
equivalents.
[0085] In a further aspect, the invention provides a progeny plant
derived from a parental plant wherein said progeny plant exhibits,
with respect to a specific gene, at least three fold greater
messenger RNA (mRNA) levels than said parental plant, wherein the
mRNA encodes a DNA-binding protein that is capable of binding to a
DNA regulatory sequence and inducing expression of a plant trait
gene, wherein the progeny plant is characterized by a change in the
plant trait compared to said parental plant. In yet a further
aspect, the progeny plant exhibits at least ten fold greater mRNA
levels compared to said parental plant. In yet a further aspect,
the progeny plant exhibits at least fifty fold greater mRNA levels
compared to said parental plant.
[0086] Various types of plants may be used to generate the
transgenic plants, including soybean, wheat, corn, potato, cotton,
rice, oilseed rape, sunflower, alfalfa, clover, sugarcane, turf,
banana, blackberry, blueberry, strawberry, raspberry, cantaloupe,
carrot, cauliflower, coffee, cucumber, eggplant, grapes, honeydew,
lettuce, mango, melon, onion, papaya, peas, peppers, pineapple,
pumpkin, spinach, squash, sweet corn, tobacco, tomato, watermelon,
mint and other labiates, rosaceous fruits, and vegetable
brassicas.
[0087] The transgenic plant may be monocotyledonous, plant, and the
polynucleotide sequences used to transform the transgenic plant may
be derived from either a monocot or a dicot plant. Alternatively,
the transgenic plant may be dicotyledonous, plant, and the
polynucleotide sequences used to transform the transgenic plant may
be derived from either a monocot or a dicot plant.
[0088] These transgenic plants will generally possess traits that
are altered as compared to a control plant, such as a wild-type or
non-transformed plant (i.e., the non-transformed plant does not
comprise the recombinant polynucleotide), thus producing an
phenotype that is altered when compared to the control, wild-type
or non-transformed plant. These transgenic plants may also express
an altered level of one or more genes associated with a plant trait
as compared to the non-transformed plant. The encoded polypeptides
in these transgenic plants will generally be expressed and regulate
transcription of at least one gene; this gene will generally confer
at least one altered trait, phenotype or expression level.
[0089] The polynucleotide sequences (those listed in the Sequence
Listing, their complements, of functional variants) used to
transform the transgenic plants of the present invention may
further comprise regulatory elements, for example, a constitutive,
inducible, or tissue-specific promoter operably linked to the
polynucleotide sequence.
[0090] Transformation of plants with presently disclosed
transcription factor sequences will produce a variety of improved
traits. For example, the altered trait may be an enhanced tolerance
to abiotic stress, such as salt tolerance. Salt tolerance, a form
of osmotic stress, may be mediated by increased root growth or
increased root hairs relative to a non-transformed, control or
wild-type plant. Tolerance to abiotic stresses such as salt
tolerance may confer a number of survival, quality and yield
improvements, including improved seed germination and improved
seedling vigor, as well as improved yield, quality, and range.
[0091] Another example of an altered trait that may be conferred by
transforming plants with the presently disclosed transcription
factor sequences includes altered sugar sensing. Altered sugar
sensing may also be used to confer improved seed germination and
improved seedling vigor, as well as altered flowering, senescence,
sugar metabolism and photosynthesis characteristics.
[0092] The invention also pertains to method to produce these
transgenic plants.
[0093] The present invention also relates to a method of using
transgenic plants transformed with the presently disclosed
transcription factor sequences, their complements or their variants
to grow a progeny plant by crossing the transgenic plant with
either itself or another plant, selecting seed that develops as a
result of the crossing; and then growing the progeny plant from the
seed. The progeny plant will generally express mRNA that encodes a
transcription factor: that is, a DNA-binding protein that binds to
a DNA regulatory sequence and induces expression, such as that of a
plant trait gene. The mRNA will generally be expressed at a level
greater than a non-transformed plant; and the progeny plant is
characterized by a change in a plant trait compared to the
non-transformed plant.
[0094] The present invention also pertains to an expression
cassette. The expression cassette comprises at least two elements,
including:
[0095] (1) a constitutive, inducible, or tissue-specific promoter;
and
[0096] (2) a recombinant polynucleotide having a polynucleotide
sequence, or a complementary polynucleotide sequence thereof,
selected from the group consisting of a nucleotide sequence
encoding a polypeptide sequence selected from the transcription
factor sequences in the sequence listing, for example, polypeptide
sequence G682, SEQ ID NO: 468; a nucleotide sequence selected from
the transcription factor polynucleotides of the Sequence Listing,
for example, polynucleotide sequence G682, SEQ ID NO: 467, or
sequence variants such as allelic or splice variants of the
nucleotide sequences of (a) or (b), where the sequence variant
encodes a polypeptide that initiates transcription. The nucleotide
sequence may also comprise an orthologous or paralogous sequence of
the nucleotide sequences of (a) or (b), and these sequences encodes
a polypeptide that initiates transcription, a nucleotide sequence
that encodes a polypeptide having a conserved domain that exhibits
72% or greater sequence homology with the polypeptide of (a), where
the polypeptide comprising the conserved domain initiates
transcription, or a nucleotide sequence that hybridizes under
stringent conditions to a nucleotide sequence of one or more
polynucleotides of (a) or (b), where the latter nucleotide sequence
initiates transcription. In all of these cases, the recombinant
polynucleotide is operably linked to the promoter of the expression
cassette.
[0097] The invention includes a host cell that comprises the
expression cassette. The host cell may be a plant cell, such as a
cell of a crop plant.
[0098] The invention also concerns a method for identifying at
least one downstream polynucleotide sequence that is subject to a
regulatory effect of any of the polypeptide transcription factors
of the present invention, or a sequence variant, ortholog or
paralog of any of these sequences. This method is conducted by
expressing a polypeptide transcription factor, variant, ortholog or
paralog in a plant cell, and then identifying an expression
product, such as RNA or protein, produced as a result. The
identification method used can be any method that identifies RNA or
protein products of expression, such as, for example, Northern
analysis, RT-PCR, microarray gene expression assays, reporter gene
expression systems subtractive hybridization, differential display,
representational differential analysis, or by two-dimensional gel
electrophoresis of one or more protein products.
[0099] In another aspect the invention is a method of screening a
plurality of plants to identify at least one plant that comprises a
polynucleotide encoding a MAF transcription factor protein wherein
the expression of the polynucleotide alters at least one of the
plant's traits. The method comprises (a) selecting a first
polynucleotide from the group consisting of a combination of plant
polynucleotide sequences of SEQ ID NO: 567, SEQ ID NO: 943, SEQ ID
NO: 945, SEQ ID NO: 947, SEQ ID NO: 1734, SEQ ID NO: 1874, SEQ ID
NO: 1014, SEQ ID NO: 1970, SEQ ID NO: 1972, SEQ ID NO: 1944, SEQ ID
NO: 1946, SEQ ID NO: 1948, SEQ ID NO: 1950, SEQ ID NO: 1952, SEQ ID
NO: 1954, SEQ ID NO: 1956, SEQ ID NO: 1958, SEQ ID NO: 1960, SEQ ID
NO: 1962, SEQ ID NO: 1964, SEQ ID NO: 1966, or SEQ ID NO: 1968; (b)
comparing the first polynucleotide sequence with a second
polynucleotide sequence wherein the second polynucleotide sequence
is isolated from a second plant; (c) selecting the second
polynucleotide sequence, wherein the second polynucleotide sequence
encodes a polypeptide sequence that has at least 60% identity with
a polypeptide sequence encoded by the sequence of the first
polynucleotide; (d) comparing the second polynucleotide sequence
with a third polynucleotide sequence wherein the third
polynucleotide sequence is isolated from a third plant, wherein the
third plant is selected from a plurality of plants; (e) selecting
the third polynucleotide sequence, wherein the third polynucleotide
sequence encodes a polypeptide sequence that has at least one amino
acid substitution compared with a polypeptide sequence encoded by
the sequence of the second polynucleotide; (f) identifying the
third plant from which the third polynucleotide came; (g) measuring
the expression level of the endogenous third polynucleotide
sequence in another third plant; (h) identifying which other third
plant expresses the third polynucleotide sequence; and (i)
identifying a trait in the other third plant of step (h) which is
changed when compared with the same trait in the second plant,
wherein the trait is selected from the group consisting of at least
one trait listed below.
[0100] In another embodiment, the method further comprises the
third polynucleotide sequence that has at last one nucleotide base
substitution compared with the polynucleotide sequence of the
second polynucleotide.
BRIEF DESCRIPTION OF THE SEQUENCE LISTING, TABLES, AND DRAWINGS
[0101] The Sequence Listing provides exemplary polynucleotide and
polypeptide sequences of the invention. The traits associated with
the use of the sequences are included in the Examples.
[0102] Incorporation of the Sequence Listing.
[0103] The Sequence Listing provides exemplary polynucleotide and
polypeptide sequences. The copy of the Sequence Listing, being
submitted electronically with this patent application, provided
under 37 CFR .sctn.1.821-1.825, is a read-only memory
computer-readable file in ASCII text format. The Sequence Listing
is named "MBI0048-3DIV.ST25.txt", the electronic file of the
Sequence Listing was created on Feb. 11, 2014, and is 4,370,027
bytes in size (4.16 megabytes in size as measured in MS-WINDOWS).
The Sequence Listing is herein incorporated by reference in its
entirety.
[0104] Table 8 (file name: MBI-0048CIP_Table.sub.--8_rev.txt,
841,046 bytes in size, created May 15, 2006, and herein
incorporated by reference) lists a summary of homologous sequences
identified using BLAST (tblastx program). The first column shows
the polynucleotide sequence identifier (SEQ ID NO:), the second
column shows the corresponding cDNA identifier (Gene ID or GID),
the third column shows the orthologous or homologous polynucleotide
GenBank Accession Number (Test Sequence ID), the fourth column
shows the calculated probability value that the sequence identity
is due to chance (Smallest Sum Probability), the fifth column shows
the plant species from which the test sequence was isolated (Test
Sequence Species), and the sixth column shows the orthologous or
homologous test sequence GenBank annotation (Test Sequence GenBank
Annotation).
[0105] Table 14 shows the polypeptide sequence identities and
similarities between exemplary polypeptides of the invention. The
first column and first row shows the polypeptide SEQ ID NO
(polypeptide SEQ ID NO); the second column and second row shows the
Mendel Name (Name); the third column and third row shows the Mendel
Gene identifier number (Gene ID). The percentage identity, and
percentage similarity in parentheses, between the two polypeptide
sequences are indicated at the intersection of each column and
row.
[0106] Table 15 shows flowering times for the maf2 mutant. The
first column shows the genotype of the Arabidopsis plant tested.
The second column shows the number of plants tested; N=number. The
third column shows the number of days the plant was cold-treated.
The fourth column shows the photoperiod in hours. The fifth column
shows the number of days elapsed from beginning of cold treatment
at which time flower buds were visible. The sixth column shows the
total leaf primordia produced by primary shoot meristem before
first flower. Four separate experiments were done (Experiments 1
through 4).
TABLE-US-LTS-CD-00001 LENGTHY TABLES The patent application
contains a lengthy table section. A copy of the table is available
in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140201864A1).
An electronic copy of the table will also be available from the
USPTO upon request and payment of the fee set forth in 37 CFR
1.19(b)(3).
[0107] Table 16 shows flowering times of transgenic plants
over-expressing MAF2 (SEQ ID NO: 567), MAF3 (SEQ ID NO: 943), MAF4
(SEQ ID NO: 945), and MAF5 (SEQ ID NO: 947) in Arabidopsis
Stockholm accession and Columbia accession transgenic T1 lines. The
first column lists the genotype of the transgenic plants
(Genotype). The second column shows the observed phenotype in the
transgenic plants (Phenotype). The third column shows the
penetrance of the observed altered phenotype as a fraction of total
transgenic plants (Penetrance). The fourth column shows the number
of days to a visible flower bud in all transgenic plants (Days to
visible flower bud; range and (mean+/-S.E.M.)). The fifth column
shows the total leaf number of all transgenic plants (Total leaf
number; range and (mean+/-S.E.M.)).
[0108] Table 17 shows flowering times of transgenic plants
over-expressing MAF2 (SEQ ID NO: 567), MAF3 (SEQ ID NO: 943), MAF4
(SEQ ID NO: 945), and MAF5 (SEQ ID NO: 947) in Arabidopsis T2
Columbia accession and Landsberg accession transgenic T1 lines. The
first column lists the genotype of the transgenic plants
(Genotype). The second column shows the T2 line analyzed (Line).
The third column shows the total number of plants analyzed (N). The
fourth column shows the observed phenotype in the T1 transgenic
plants (T1 phenotype). The fifth column shows the observed
phenotype in the T2 transgenic plants (T2 phenotype). The sixth
column shows the number of days of cold treatment for the T2 lines
(Days of cold treatment). The seventh column show the number of
hours the transgenic plants were exposed to light per day
(Photoperiod (hours)). The eighth column shows the number of days
to a visible flower bud in all transgenic plants (Days to visible
flower bud; range and (mean+/-S.E.M.)). The ninth column shows the
total leaf number of all transgenic plants (Total leaf number;
range and (mean+/-S.E.M.)). NA: not applicable; ND: not
determined.
[0109] FIG. 1 shows a conservative estimate of phylogenetic
relationships among the orders of flowering plants (modified from
Angiosperm Phylogeny Group (1998) Ann. Missouri Bot. Gard. 84:
1-49). Those plants with a single cotyledon (monocots) are a
monophyletic clade nested within at least two major lineages of
dicots; the eudicots are further divided into rosids and asterids.
Arabidopsis is a rosid eudicot classified within the order
Brassicales; rice is a member of the monocot order Poales. FIG. 1
was adapted from Daly et al. (2001) Plant Physiol. 127:
1328-1333.
[0110] FIG. 2 shows a phylogenic dendogram depicting phylogenetic
relationships of higher plant taxa, including clades containing
tomato and Arabidopsis; adapted from Ku et al. (2000) Proc. Natl.
Acad. Sci. 97: 9121-9126; and Chase et al. (1993) Ann. Missouri
Bot. Gard. 80: 528-580.
[0111] FIGS. 3A, and 3B show an alignment of G682 (SEQ ID NO: 468)
and polypeptide sequences that are paralogous and orthologous to
G682.
[0112] FIGS. 4A, 4B, 4C and 4D show an alignment of G867 (SEQ ID
NO: 580) and polypeptide sequences that are paralogous and
orthologous to G867.
[0113] FIGS. 5A, 5B, 5C, 5D, 5E and 5F show an alignment of G912
(SEQ ID NO: 616) and polypeptide sequences that are paralogous and
orthologous to G912.
[0114] FIG. 6 shows an alignment of the polypeptide sequences of
FLC (SEQ ID NO: 1875) and MAF1-5 (SEQ ID NOs: 1735, 568, 944, 946,
and 948) full-length polypeptides encoded by SEQ ID NOs: 1874,
1734, 567, 943, 945, and 947, respectively. The alignment was
produced by manual alignment of the polypeptide sequences.
[0115] FIGS. 7A and 7B show an alignment of the polypeptide
sequences of SEQ ID NO: 948 (G1844.pep; MAF5), SEQ ID NO: 946
(G1843.pep; MAF4), SEQ ID NO: 944 (G1842.pep; MAF3), SEQ ID NO: 568
(G859.pep; MAF2), SEQ ID NO: 1735 (G157.pep; MAF1), SEQ ID NO: 1875
(G1759.pep; FLC), SEQ ID NO: 1971 (Soy1.pep; SOY MADS1), and SEQ ID
NO: 1973 (Soy3.pep; SOY MADS3) full-length polypeptides encoded by
SEQ ID NOs: 947, 945, 943, 567, 1734, 1874, 1970, and 1972,
respectively. Regions of identity between the polypeptide sequences
are boxed. The calculated consensus sequence is shown beneath the
alignments. The alignment was made using the CLUSTALW alignment
program in the MACVECTOR sequence data package (MACVECTOR6.0 or
MACVECTOR 6.5 applications, Accelrys, San Diego Calif.).
[0116] FIG. 8 shows the effects of vernalization on endogenous
expression of MAF2-5 (SEQ ID NOs: 567, 943, 945, and 947) in
different genetic backgrounds (accessions). Expression was
monitored by RT-PCR (MAF1, 2, 3, 4, and 5, and FLC transcripts).
Vernalized (+) samples were cold-treated for 6 weeks at 4.degree.
C., whereas non-vernalized (-) samples were stratified for only 3
days at 4.degree. C. as imbibed seeds. Col=Columbia, Pi-0=Pitztal,
St-0=Stockholm, fca=fca-9 mutant.
[0117] FIG. 9 is a schematic diagram summarizing the responses of
FLC and MAF1-5 (SEQ ID NOs: 567, 943, 945, and 947) to
vernalization, and their potential effects on the floral
transition. Arrows indicate positive interactions, blunt-ended
lines denote inhibition.
[0118] FIG. 10 shows the effect of vernalization on the maf2
mutant: (A) in the absence of vernalization; (B) following a
vernalization treatment; (C) days to visible bud of maf2 mutant
compared with wild type; and (D) RT-PCR transcript analysis of
endogenous genes of maf2 mutant compared with those in wild
type.
[0119] FIG. 11 shows the effects of MAF2 overexpression in the
Columbia ecotype; (A) shows vernalized or non-vernalized transgenic
35S:MAF2 plants and wild type plants; and (B) shows RT-PCR
transcript analysis of endogenous FLC, MAF2, and SOC1 transcripts
in wild type (Columbia accession), transgenic 35S:MAF2, and
transgenic 35S:FLC seedlings.
DETAILED DESCRIPTION OF EXEMPLARY EMBODIMENTS
[0120] In an important aspect, the present invention relates to
polynucleotides and polypeptides, for example, for modifying
phenotypes of plants. Throughout this disclosure, various
information sources are referred to and/or are specifically
incorporated. The information sources include scientific journal
articles, patent documents, textbooks, and World Wide Web
browser-inactive page addresses, for example. While the reference
to these information sources clearly indicates that they can be
used by one of skill in the art, each and every one of the
information sources cited herein are specifically incorporated in
their entirety, whether or not a specific mention of "incorporation
by reference" is noted. The contents and teachings of each and
every one of the information sources can be relied on and used to
make and use embodiments of the invention.
[0121] It must be noted that as used herein and in the appended
claims, the singular forms "a," "an," and "the" include plural
reference unless the context clearly dictates otherwise. Thus, for
example, a reference to "a plant" includes a plurality of such
plants, and a reference to "a stress" is a reference to one or more
stresses and equivalents thereof known to those skilled in the art,
and so forth.
[0122] The polynucleotide sequences of the invention encode
polypeptides that are members of well-known transcription factor
families, including plant transcription factor families, as
disclosed in Tables 4-5. Generally, the transcription factors
encoded by the present sequences are involved in cell
differentiation and proliferation and the regulation of growth.
Accordingly, one skilled in the art would recognize that by
expressing the present sequences in a plant, one may change the
expression of autologous genes or induce the expression of
introduced genes. By affecting the expression of similar autologous
sequences in a plant that have the biological activity of the
present sequences, or by introducing the present sequences into a
plant, one may alter a plant's phenotype to one with improved
traits. The sequences of the invention may also be used to
transform a plant and introduce desirable traits not found in the
wild-type cultivar or strain. Plants may then be selected for those
that produce the most desirable degree of over- or under-expression
of target genes of interest and coincident trait improvement.
[0123] The sequences of the present invention may be from any
species, particularly plant species, in a naturally occurring form
or from any source whether natural, synthetic, semi-synthetic or
recombinant. The sequences of the invention may also include
fragments of the present amino acid sequences. In this context, a
"fragment" refers to a fragment of a polypeptide sequence which is
at least 5 to about 15 amino acids in length, most preferably at
least 14 amino acids, and which retain some biological activity of
a transcription factor. Where "amino acid sequence" is recited to
refer to an amino acid sequence of a naturally occurring protein
molecule, "amino acid sequence" and like terms are not meant to
limit the amino acid sequence to the complete native amino acid
sequence associated with the recited protein molecule.
[0124] As one of ordinary skill in the art recognizes,
transcription factors can be identified by the presence of a region
or domain of structural similarity or identity to a specific
consensus sequence or the presence of a specific consensus
DNA-binding site or DNA-binding site motif (see, for example,
Riechmann et al. (2000) Science 290: 2105-2110). The plant
transcription factors may belong to one of the following
transcription factor families: the AP2 (APETALA2) domain
transcription factor family (Riechmann and Meyerowitz (1998) Biol.
Chem. 379: 633-646); the MYB transcription factor family (ENBib;
Martin and Paz-Ares (1997) Trends Genet. 13: 67-73); the MADS
domain transcription factor family (Riechmann and Meyerowitz (1997)
Biol. Chem. 378: 1079-1101; Immink et al. (2003) Mol. Gen. Genomics
268:598-606); the WRKY protein family (Ishiguro and Nakamura (1994)
Mol. Gen. Genet. 244: 563-571); the ankyrin-repeat protein family
(Zhang et al. (1992) Plant Cell 4: 1575-1588); the zinc finger
protein (Z) family (Klug and Schwabe (1995) FASEB J. 9: 597-604);
Takatsuji (1998) Cell. Mol. Life. Sci. 54:582-596); the homeobox
(HB) protein family (Buerglin (1994) in Guidebook to the Homeobox
Genes, Duboule (ed.) Oxford University Press); the CAAT-element
binding proteins (Forsburg and Guarente (1989) Genes Dev. 3:
1166-1178); the squamosa promoter binding proteins (SPB) (Klein et
al. (1996) Mol. Gen. Genet. 1996 250: 7-16); the NAM protein family
(Souer et al. (1996) Cell 85: 159-170); the IAA/AUX proteins (Abel
et al. (1995) J. Mol. Biol. 251: 533-549); the HLH/MYC protein
family (Littlewood et al. (1994) Prot. Profile 1: 639-709); the
DNA-binding protein (DBP) family (Tucker et al. (1994) EMBO J. 13:
2994-3002); the bZIP family of transcription factors (Foster et al.
(1994) FASEB J. 8: 192-200); the Box P-binding protein (the BPF-1)
family (da Costa e Silva et al. (1993) Plant 4: 125-135); the high
mobility group (HMG) family (Bustin and Reeves (1996) Prog. Nucl.
Acids Res. Mol. Biol. 54: 35-100); the scarecrow (SCR) family (Di
Laurenzio et al. (1996) Cell 86: 423-433); the GF14 family (Wu et
al. (1997) Plant Physiol. 114: 1421-1431); the polycomb (PCOMB)
family (Goodrich et al. (1997) Nature 386: 44-51); the teosinte
branched (TEO) family (Luo et al. (1996) Nature 383: 794-799); the
ABI3 family (Giraudat et al. (1992) Plant Cell 4: 1251-1261); the
triple helix (TH) family (Dehesh et al. (1990) Science 250:
1397-1399); the EIL family (Chao et al. (1997) Cell 89: 1133-44);
the AT-HOOK family (Reeves and Nissen (1990) J. Biol. Chem. 265:
8573-8582); the S1FA family (Zhou et al. (1995) Nucleic Acids Res.
23: 1165-1169); the bZIPT2 family (Lu and Ferl (1995) Plant
Physiol. 109: 723); the YABBY family (Bowman et al. (1999)
Development 126: 2387-96); the PAZ family (Bohmert et al. (1998)
EMBO J. 17: 170-80); a family of miscellaneous (MISC) transcription
factors including the DPBF family (Kim et al. (1997) Plant J. 11:
1237-1251) and the SPF1 family (Ishiguro and Nakamura (1994) Mol.
Gen. Genet. 244: 563-571); the GARP family (Hall et al. (1998)
Plant Cell 10: 925-936), the TUBBY family (Boggin et al (1999)
Science 286: 2119-2125), the heat shock family (Wu (1995) Annu.
Rev. Cell Dev. Biol. 11: 441-469), the ENBP family (Christiansen et
al. (1996) Plant Mol. Biol. 32: 809-821), the RING-zinc family
(Jensen et al. (1998) FEBS Letters 436: 283-287), the PDBP family
(Janik et al. (1989) Virology 168: 320-329), the PCF family (Cubas
et al. Plant J. (1999) 18: 215-22), the SRS(SHI-related) family
(Fridborg et al. (1999) Plant Cell 11: 1019-1032), the CPP
(cysteine-rich polycomb-like) family (Cvitanich et al. (2000) Proc.
Natl. Acad. Sci. 97: 8163-8168), the ARF (auxin response factor)
family (Ulmasov et al. (1999) Proc. Natl. Acad. Sci. 96:
5844-5849), the SWI/SNF family (Collingwood et al. (1999) J. Mol.
Endocrinol. 23: 255-275), the ACBF family (Seguin et al. (1997)
Plant Mol. Biol. 35: 281-291), PCGL (CG-1 like) family (da Costa e
Silva et al. (1994) Plant Mol. Biol. 25: 921-924) the ARID family
(Vazquez et al. (1999) Development 126: 733-742), the Jumonji
family (Balciunas et al. (2000), Trends Biochem. Sci. 25: 274-276),
the bZIP-NIN family (Schauser et al. (1999) Nature 402: 191-195),
the E2F family (Kaelin et al. (1992) Cell 70: 351-364) and the
GRF-like family (Knaap et al. (2000) Plant Physiol. 122: 695-704).
As indicated by any part of the list above and as known in the art,
transcription factors have been sometimes categorized by class,
family, and sub-family according to their structural content and
consensus DNA-binding site motif, for example. Many of the classes
and many of the families and sub-families are listed here. However,
the inclusion of one sub-family and not another, or the inclusion
of one family and not another, does not mean that the invention
does not encompass polynucleotides or polypeptides of a certain
family or sub-family. The list provided here is merely an example
of the types of transcription factors and the knowledge available
concerning the consensus sequences and consensus DNA-binding site
motifs that help define them as known to those of skill in the art
(each of the references noted above are specifically incorporated
herein by reference). A transcription factor may include, but is
not limited to, any polypeptide that can activate or repress
transcription of a single gene or a number of genes. This
polypeptide group includes, but is not limited to, DNA-binding
proteins, DNA-binding protein binding proteins, protein kinases,
protein phosphatases, protein methyltransferases, GTP-binding
proteins, and receptors, and the like.
[0125] In addition to methods for modifying a plant phenotype by
employing one or more polynucleotides and polypeptides of the
invention described herein, the polynucleotides and polypeptides of
the invention have a variety of additional uses. These uses include
their use in the recombinant production (i.e., expression) of
proteins; as regulators of plant gene expression, as diagnostic
probes for the presence of complementary or partially complementary
nucleic acids (including for detection of natural coding nucleic
acids); as substrates for further reactions, e.g., mutation
reactions, PCR reactions, or the like; as substrates for cloning
e.g., including digestion or ligation reactions; and for
identifying exogenous or endogenous modulators of the transcription
factors. A "polynucleotide" is a nucleic acid sequence comprising a
plurality of polymerized nucleotides, e.g., at least about 15
consecutive polymerized nucleotides, optionally at least about 30
consecutive nucleotides, at least about 50 consecutive nucleotides.
In many instances, a polynucleotide comprises a nucleotide sequence
encoding a polypeptide (or protein) or a domain or fragment
thereof. Additionally, the polynucleotide may comprise a promoter,
an intron, an enhancer region, a polyadenylation site, a
translation initiation site, 5' or 3' untranslated regions, a
reporter gene, a selectable marker, or the like. The polynucleotide
can be single stranded or double stranded DNA or RNA. The
polynucleotide optionally comprises modified bases or a modified
backbone. The polynucleotide can be, e.g., genomic DNA or RNA, a
transcript (such as an mRNA), a cDNA, a PCR product, a cloned DNA,
a synthetic DNA or RNA, or the like. The polynucleotide can
comprise a sequence in either sense or antisense orientations.
DEFINITIONS
[0126] A "recombinant polynucleotide" is a polynucleotide that is
not in its native state, e.g., the polynucleotide comprises a
nucleotide sequence not found in nature, or the polynucleotide is
in a context other than that in which it is naturally found, e.g.,
separated from nucleotide sequences with which it typically is in
proximity in nature, or adjacent (or contiguous with) nucleotide
sequences with which it typically is not in proximity For example,
the sequence at issue can be cloned into a vector, or otherwise
recombined with one or more additional nucleic acid.
[0127] An "isolated polynucleotide" is a polynucleotide whether
naturally occurring or recombinant, that is present outside the
cell in which it is typically found in nature, whether purified or
not. Optionally, an isolated polynucleotide is subject to one or
more enrichment or purification procedures, e.g., cell lysis,
extraction, centrifugation, precipitation, or the like.
[0128] A "polypeptide" is an amino acid sequence comprising a
plurality of consecutive polymerized amino acid residues e.g., at
least about 15 consecutive polymerized amino acid residues,
optionally at least about 30 consecutive polymerized amino acid
residues, at least about 50 consecutive polymerized amino acid
residues. In many instances, a polypeptide comprises a polymerized
amino acid residue sequence that is a transcription factor or a
domain or portion or fragment thereof. Additionally, the
polypeptide may comprise 1) a localization domain, 2) an activation
domain, 3) a repression domain, 4) an oligomerization domain, or 5)
a DNA-binding domain, or the like. The polypeptide optionally
comprises modified amino acid residues, naturally occurring amino
acid residues not encoded by a codon, non-naturally occurring amino
acid residues.
[0129] A "recombinant polypeptide" is a polypeptide produced by
translation of a recombinant polynucleotide. A "synthetic
polypeptide" is a polypeptide created by consecutive polymerization
of isolated amino acid residues using methods well known in the
art. An "isolated polypeptide," whether a naturally occurring or a
recombinant polypeptide, is more enriched in (or out of) a cell
than the polypeptide in its natural state in a wild-type cell,
e.g., more than about 5% enriched, more than about 10% enriched, or
more than about 20%, or more than about 50%, or more, enriched,
i.e., alternatively denoted: 105%, 110%, 120%, 150% or more,
enriched relative to wild type standardized at 100%. Such an
enrichment is not the result of a natural response of a wild-type
plant. Alternatively, or additionally, the isolated polypeptide is
separated from other cellular components with which it is typically
associated, e.g., by any of the various protein purification
methods herein.
[0130] "Identity" or "similarity" refers to sequence similarity
between two polynucleotide sequences or between two polypeptide
sequences, with identity being a more strict comparison. The
phrases "percent identity" and "% identity" refer to the percentage
of sequence similarity found in a comparison of two or more
polynucleotide sequences or two or more polypeptide sequences.
"Sequence similarity" refers to the percent similarity in base pair
sequence (as determined by any suitable method) between two or more
polynucleotide sequences. Two or more sequences can be anywhere
from 0-100% similar, or any integer value therebetween. Identity or
similarity can be determined by comparing a position in each
sequence that may be aligned for purposes of comparison. When a
position in the compared sequence is occupied by the same
nucleotide base or amino acid, then the molecules are identical at
that position. A degree of similarity or identity between
polynucleotide sequences is a function of the number of identical
or matching nucleotides at positions shared by the polynucleotide
sequences. A degree of identity of polypeptide sequences is a
function of the number of identical amino acids at positions shared
by the polypeptide sequences. A degree of homology or similarity of
polypeptide sequences is a function of the number of amino acids at
positions shared by the polypeptide sequences.
[0131] "Alignment" refers to a number of DNA or amino acid
sequences aligned by lengthwise comparison so that components in
common (i.e., nucleotide bases or amino acid residues) may be
readily and graphically identified. The number of components in
common is related to the homology or identity between the
sequences. Alignments such as those of FIG. 3, 4 or 5 may be used
to identify "conserved domains" and relatedness within these
domains. An alignment may suitably be determined by means of
computer programs known in the art, such as MacVector (1999)
(Accelrys, Inc., San Diego, Calif.).
[0132] The terms "highly stringent" or "highly stringent condition"
refer to conditions that permit hybridization of DNA strands whose
sequences are highly complementary, wherein these same conditions
exclude hybridization of significantly mismatched DNAs.
Polynucleotide sequences capable of hybridizing under stringent
conditions with the polynucleotides of the present invention may
be, for example, variants of the disclosed polynucleotide
sequences, including allelic or splice variants, or sequences that
encode orthologs or paralogs of presently disclosed polypeptides.
Nucleic acid hybridization methods are disclosed in detail by
Kashima et al. (1985) Nature 313:402-404, and Sambrook et al.
(1989) Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring
Harbor Laboratory, Cold Spring Harbor, N.Y. ("Sambrook"); and by
Haymes et al., "Nucleic Acid Hybridization: A Practical Approach",
IRL Press, Washington, D.C. (1985), which references are
incorporated herein by reference.
[0133] In general, stringency is determined by the temperature,
ionic strength, and concentration of denaturing agents (e.g.,
formamide) used in a hybridization and washing procedure (for a
more detailed description of establishing and determining
stringency, see below). The degree to which two nucleic acids
hybridize under various conditions of stringency is correlated with
the extent of their similarity. Thus, similar nucleic acid
sequences from a variety of sources, such as within a plant's
genome (as in the case of paralogs) or from another plant (as in
the case of orthologs) that may perform similar functions can be
isolated on the basis of their ability to hybridize with known
transcription factor sequences. Numerous variations are possible in
the conditions and means by which nucleic acid hybridization can be
performed to isolate transcription factor sequences having
similarity to transcription factor sequences known in the art and
are not limited to those explicitly disclosed herein. Such an
approach may be used to isolate polynucleotide sequences having
various degrees of similarity with disclosed transcription factor
sequences, such as, for example, transcription factors having 60%
identity, or more preferably greater than about 70% identity, most
preferably 72% or greater identity with disclosed transcription
factors.
[0134] The term "equivalog" describes members of a set of
homologous proteins that are conserved with respect to function
since their last common ancestor. Related proteins are grouped into
equivalog families, and otherwise into protein families with other
hierarchically defined homology types (definition provided the
Institute for Genomic Research (TIGR) website).
[0135] The term "variant", as used herein, may refer to
polynucleotides or polypeptides, that differ from the presently
disclosed polynucleotides or polypeptides, respectively, in
sequence from each other, and as set forth below.
[0136] With regard to polynucleotide variants, differences between
presently disclosed polynucleotides and polynucleotide variants are
limited so that the nucleotide sequences of the former and the
latter are closely similar overall and, in many regions, identical.
Due to the degeneracy of the genetic code, differences between the
former and latter nucleotide sequences may be silent (i.e., the
amino acids encoded by the polynucleotide are the same, and the
variant polynucleotide sequence encodes the same amino acid
sequence as the presently disclosed polynucleotide. Variant
nucleotide sequences may encode different amino acid sequences, in
which case such nucleotide differences will result in amino acid
substitutions, additions, deletions, insertions, truncations or
fusions with respect to the similar disclosed polynucleotide
sequences. These variations result in polynucleotide variants
encoding polypeptides that share at least one functional
characteristic. The degeneracy of the genetic code also dictates
that many different variant polynucleotides can encode identical
and/or substantially similar polypeptides in addition to those
sequences illustrated in the Sequence Listing.
[0137] Also within the scope of the invention is a variant of a
transcription factor nucleic acid listed in the Sequence Listing,
that is, one having a sequence that differs from the one of the
polynucleotide sequences in the Sequence Listing, or a
complementary sequence, that encodes a functionally equivalent
polypeptide (i.e., a polypeptide having some degree of equivalent
or similar biological activity) but differs in sequence from the
sequence in the Sequence Listing, due to degeneracy in the genetic
code. Included within this definition are polymorphisms that may or
may not be readily detectable using a particular oligonucleotide
probe of the polynucleotide encoding polypeptide, and improper or
unexpected hybridization to allelic variants, with a locus other
than the normal chromosomal locus for the polynucleotide sequence
encoding polypeptide.
[0138] "Allelic variant" or "polynucleotide allelic variant" refers
to any of two or more alternative forms of a gene occupying the
same chromosomal locus. Allelic variation arises naturally through
mutation, and may result in phenotypic polymorphism within
populations. Gene mutations may be "silent" or may encode
polypeptides having altered amino acid sequence. "Allelic variant"
and "polypeptide allelic variant" may also be used with respect to
polypeptides, and in this case the term refer to a polypeptide
encoded by an allelic variant of a gene.
[0139] "Splice variant" or "polynucleotide splice variant" as used
herein refers to alternative forms of RNA transcribed from a gene.
Splice variation naturally occurs as a result of alternative sites
being spliced within a single transcribed RNA molecule or between
separately transcribed RNA molecules, and may result in several
different forms of mRNA transcribed from the same gene. This,
splice variants may encode polypeptides having different amino acid
sequences, which may or may not have similar functions in the
organism. "Splice variant" or "polypeptide splice variant" may also
refer to a polypeptide encoded by a splice variant of a transcribed
mRNA.
[0140] As used herein, "polynucleotide variants" may also refer to
polynucleotide sequences that encode paralogs and orthologs of the
presently disclosed polypeptide sequences. "Polypeptide variants"
may refer to polypeptide sequences that are paralogs and orthologs
of the presently disclosed polypeptide sequences.
[0141] Differences between presently disclosed polypeptides and
polypeptide variants are limited so that the sequences of the
former and the latter are closely similar overall and, in many
regions, identical. Presently disclosed polypeptide sequences and
similar polypeptide variants may differ in amino acid sequence by
one or more substitutions, additions, deletions, fusions and
truncations, which may be present in any combination. These
differences may produce silent changes and result in a functionally
equivalent transcription factor. Thus, it will be readily
appreciated by those of skill in the art, that any of a variety of
polynucleotide sequences is capable of encoding the transcription
factors and transcription factor homolog polypeptides of the
invention. A polypeptide sequence variant may have "conservative"
changes, wherein a substituted amino acid has similar structural or
chemical properties. Deliberate amino acid substitutions may thus
be made on the basis of similarity in polarity, charge, solubility,
hydrophobicity, hydrophilicity, and/or the amphipathic nature of
the residues, as long as the functional or biological activity of
the transcription factor is retained. For example, negatively
charged amino acids may include aspartic acid and glutamic acid,
positively charged amino acids may include lysine and arginine, and
amino acids with uncharged polar head groups having similar
hydrophilicity values may include leucine, isoleucine, and valine;
glycine and alanine; asparagine and glutamine; serine and
threonine; and phenylalanine and tyrosine (for more detail on
conservative substitutions, see Table 2). More rarely, a variant
may have "non-conservative" changes, e.g., replacement of a glycine
with a tryptophan. Similar minor variations may also include amino
acid deletions or insertions, or both. Related polypeptides may
comprise, for example, additions and/or deletions of one or more
N-linked or O-linked glycosylation sites, or an addition and/or a
deletion of one or more cysteine residues. Guidance in determining
which and how many amino acid residues may be substituted, inserted
or deleted without abolishing functional or biological activity may
be found using computer programs well known in the art, for
example, DNASTAR software (see U.S. Pat. No. 5,840,544).
[0142] The term "plant" includes whole plants, shoot vegetative
organs/structures (e.g., leaves, stems and tubers), roots, flowers
and floral organs/structures (e.g., bracts, sepals, petals,
stamens, carpels, anthers and ovules), seed (including embryo,
endosperm, and seed coat) and fruit (the mature ovary), plant
tissue (e.g., vascular tissue, ground tissue, and the like) and
cells (e.g., guard cells, egg cells, and the like), and progeny of
same. The class of plants that can be used in the method of the
invention is generally as broad as the class of higher and lower
plants amenable to transformation techniques, including angiosperms
(monocotyledonous and dicotyledonous plants), gymnosperms, ferns,
horsetails, psilophytes, lycophytes, bryophytes, and multicellular
algae. (See for example, FIG. 1, adapted from Daly et al. (2001)
Plant Physiol. 127: 1328-1333; FIG. 2, adapted from Ku et al.
(2000) Proc. Natl. Acad. Sci. 97: 9121-9126; and see also Tudge, in
The Variety of Life, Oxford University Press, New York, N.Y. (2000)
pp. 547-606).
[0143] A "transgenic plant" refers to a plant that contains genetic
material not found in a wild-type plant of the same species,
variety or cultivar. The genetic material may include a transgene,
an insertional mutagenesis event (such as by transposon or T-DNA
insertional mutagenesis), an activation tagging sequence, a mutated
sequence, a homologous recombination event or a sequence modified
by chimeraplasty. Typically, the foreign genetic material has been
introduced into the plant by human manipulation, but any method can
be used as one of skill in the art recognizes.
[0144] A transgenic plant may contain an expression vector or
cassette. The expression cassette typically comprises a
polypeptide-encoding sequence operably linked (i.e., under
regulatory control of) to appropriate inducible or constitutive
regulatory sequences that allow for the expression of polypeptide.
The expression cassette can be introduced into a plant by
transformation or by breeding after transformation of a parent
plant. A plant refers to a whole plant as well as to a plant part,
such as seed, fruit, leaf, or root, plant tissue, plant cells or
any other plant material, e.g., a plant explant, as well as to
progeny thereof, and to in vitro systems that mimic biochemical or
cellular components or processes in a cell.
[0145] "Fragment", with respect to a polynucleotide, refers to a
clone or any part of a polynucleotide molecule that retains a
usable, functional characteristic. Useful fragments include
oligonucleotides and polynucleotides that may be used in
hybridization or amplification technologies or in the regulation of
replication, transcription or translation. A polynucleotide
fragment" refers to any subsequence of a polynucleotide, typically,
of at least about 9 consecutive nucleotides, preferably at least
about 30 nucleotides, more preferably at least about 50
nucleotides, of any of the sequences provided herein. Exemplary
polynucleotide fragments are the first sixty consecutive
nucleotides of the transcription factor polynucleotides listed in
the Sequence Listing. Exemplary fragments also include fragments
that comprise a region that encodes a conserved domain of a
transcription factor.
[0146] Fragments may also include subsequences of polypeptides and
protein molecules, or a subsequence of the polypeptide. Fragments
may have uses in that they may have antigenic potential. In some
cases, the fragment or domain is a subsequence of the polypeptide
which performs at least one biological function of the intact
polypeptide in substantially the same manner, or to a similar
extent, as does the intact polypeptide. For example, a polypeptide
fragment can comprise a recognizable structural motif or functional
domain such as a DNA-binding site or domain that binds to a DNA
promoter region, an activation domain, or a domain for
protein-protein interactions, and may initiate transcription.
Fragments can vary in size from as few as 3 amino acids to the full
length of the intact polypeptide, but are preferably at least about
30 amino acids in length and more preferably at least about 60
amino acids in length. Exemplary polypeptide fragments are the
first twenty consecutive amino acids of a mammalian protein encoded
by are the first twenty consecutive amino acids of the
transcription factor polypeptides listed in the Sequence Listing.
Exemplary fragments also include fragments that comprise a
conserved domain of a transcription factor, for example, amino acid
residues 27-63 of G682 (SEQ ID NO: 468), as noted in Table 5.
[0147] The invention also encompasses production of DNA sequences
that encode transcription factors and transcription factor
derivatives, or fragments thereof, entirely by synthetic chemistry.
After production, the synthetic sequence may be inserted into any
of the many available expression vectors and cell systems using
reagents well known in the art. Moreover, synthetic chemistry may
be used to introduce mutations into a sequence encoding
transcription factors or any fragment thereof.
[0148] A "conserved domain" or "conserved region" as used herein
refers to a region in heterologous polynucleotide or polypeptide
sequences where there is a relatively high degree of sequence
identity between the distinct sequences.
[0149] With respect to polynucleotides encoding presently disclosed
transcription factors, a conserved region is preferably at least 10
base pairs (bp) in length.
[0150] A "conserved domain", with respect to presently disclosed
polypeptides refers to a domain within a transcription factor
family that exhibits a higher degree of sequence homology, such as
at least 26% sequence similarity, at least 16% sequence identity,
preferably at least 40% sequence identity, preferably at least 65%
sequence identity including conservative substitutions, and more
preferably at least 80% sequence identity, and even more preferably
at least 85%, or at least about 86%, or at least about 87%, or at
least about 88%, or at least about 90%, or at least about 95%, or
at least about 98% amino acid residue sequence identity of a
polypeptide of consecutive amino acid residues. A fragment or
domain can be referred to as outside a conserved domain, outside a
consensus sequence, or outside a consensus DNA-binding site that is
known to exist or that exists for a particular transcription factor
class, family, or sub-family. In this case, the fragment or domain
will not include the exact amino acids of a consensus sequence or
consensus DNA-binding site of a transcription factor class, family
or sub-family, or the exact amino acids of a particular
transcription factor consensus sequence or consensus DNA-binding
site. Furthermore, a particular fragment, region, or domain of a
polypeptide, or a polynucleotide encoding a polypeptide, can be
"outside a conserved domain" if all the amino acids of the
fragment, region, or domain fall outside of a defined conserved
domain(s) for a polypeptide or protein. Sequences having lesser
degrees of identity but comparable biological activity are
considered to be equivalents.
[0151] As one of ordinary skill in the art recognizes, conserved
domains may be identified as regions or domains of identity to a
specific consensus sequence (see, for example, Riechmann et al.
(2000) supra). Thus, by using alignment methods well known in the
art, the conserved domains of the plant transcription factors for
each of the following may be determined: the AP2 (APETALA2) domain
transcription factor family (Riechmann and Meyerowitz (1998) supra;
the MYB transcription factor family (ENBib; Martin and Paz-Ares
(1997) supra); the MADS domain transcription factor family
(Riechmann and Meyerowitz (1997) supra; Immink et al. (2003)
supra); the WRKY protein family (Ishiguro and Nakamura (1994)
supra); the ankyrin-repeat protein family (Zhang et al. (1992)
supra); the zinc finger protein (Z) family (Klug and Schwabe (1995)
supra; Takatsuji (1998) supra); the homeobox (HB) protein family
(Buerglin (1994) supra); the CAAT-element binding proteins
(Forsburg and Guarente (1989) supra); the squamosa promoter binding
proteins (SPB) (Klein et al. (1996) supra); the NAM protein family
(Souer et al. (1996) supra); the IAA/AUX proteins (Abel et al.
(1995) supra); the HLH/MYC protein family (Littlewood et al. (1994)
supra); the DNA-binding protein (DBP) family (Tucker et al. (1994)
supra); the bZIP family of transcription factors (Foster et al.
(1994) supra); the Box P-binding protein (the BPF-1) family (da
Costa e Silva et al. (1993) supra); the high mobility group (HMG)
family (Bustin and Reeves (1996) supra); the scarecrow (SCR) family
(Di Laurenzio et al. (1996) supra); the GF14 family (Wu et al.
(1997) supra); the polycomb (PCOMB) family (Goodrich et al. (1997)
supra); the teosinte branched (TEO) family (Luo et al. (1996)
supra); the ABI3 family (Giraudat et al. (1992) supra); the triple
helix (TH) family (Dehesh et al. (1990) supra); the EIL family
(Chao et al. (1997) Cell supra); the AT-HOOK family (Reeves and
Nissen (1990 supra); the S1FA family (Zhou et al. (1995) supra);
the bZIPT2 family (Lu and Ferl (1995) supra); the YABBY family
(Bowman et al. (1999) supra); the PAZ family (Bohmert et al. (1998)
supra); a family of miscellaneous (MISC) transcription factors
including the DPBF family (Kim et al. (1997) supra) and the SPF1
family (Ishiguro and Nakamura (1994) supra); the GARP family (Hall
et al. (1998) supra), the TUBBY family (Boggin et al. (1999)
supra), the heat shock family (Wu (1995 supra), the ENBP family
(Christiansen et al. (1996) supra), the RING-zinc family (Jensen et
al. (1998) supra), the PDBP family (Janik et al. (1989) supra), the
PCF family (Cubas et al. (1999) supra), the SRS(SHI-related) family
(Fridborg et al. (1999) supra), the CPP (cysteine-rich
polycomb-like) family (Cvitanich et al. (2000) supra), the ARF
(auxin response factor) family (Ulmasov et al. (1999) supra), the
SWI/SNF family (Collingwood et al. (1999) supra), the ACBF family
(Seguin et al. (1997) supra), PCGL (CG-1 like) family (da Costa e
Silva et al. (1994) supra) the ARID family (Vazquez et al. (1999)
supra), the Jumonji family, (Balciunas et al. (2000) supra), the
bZIP-NIN family (Schauser et al. (1999) supra), the E2F family
Kaelin et al. (1992) supra) and the GRF-like family (Knaap et al
(2000) supra).
[0152] The conserved domains for each of polypeptides of SEQ ID NO:
2N, wherein N=1-480, are listed in Table 5 as described in Example
VII. Also, many of the polypeptides of Table 5 have conserved
domains specifically indicated by start and stop sites. A
comparison of the regions of the polypeptides in SEQ ID NO: 2N,
wherein N=1-480, or of those in Table 5, allows one of skill in the
art to identify conserved domain(s) for any of the polypeptides
listed or referred to in this disclosure, including those in Tables
4-8.
[0153] The conserved domains for each of polypeptides of SEQ ID
NOs: 568, 944, 946, 948, 1735, 1875, 1971, and 1973, are listed in
Table 5 as described in Example VII. Also, many of the polypeptides
of Table 5 have conserved domains specifically indicated by start
and stop sites. A comparison of the regions of the polypeptides in
SEQ ID NO: 568, SEQ ID NO: 944, SEQ ID NO: 946, SEQ ID NO: 948, SEQ
ID NO: 1735, SEQ ID NO: 1875, SEQ ID NO: 1971, SEQ ID NO: 1973, SEQ
ID NO: 1945, SEQ ID NO: 1947, SEQ ID NO: 1949, SEQ ID NO: 1951, SEQ
ID NO: 1953, SEQ ID NO: 1955, SEQ ID NO: 1957, SEQ ID NO: 1959, SEQ
ID NO: 1961, SEQ ID NO: 1963, SEQ ID NO: 1965, SEQ ID NO: 1967, or
SEQ ID NO: 1969, or of those in Table 5, allows one of skill in the
art to identify conserved domain(s) for any of the polypeptides
listed or referred to in this disclosure, including those in Tables
4-8.
[0154] A gene is a functional unit of inheritance, and in physical
terms is a particular segment or sequence of nucleotides along a
molecule of DNA (or RNA, in the case of RNA viruses) involved in
producing a polypeptide chain. The latter may be subjected to
subsequent processing such as splicing and folding to obtain a
functional protein or polypeptide. A gene may be isolated,
partially isolated, or be found with an organism's genome. By way
of example, a transcription factor gene encodes a transcription
factor polypeptide, which may be functional or require processing
to function as an initiator of transcription.
[0155] Operationally, genes may be defined by the cis-trans test, a
genetic test that determines whether two mutations occur in the
same gene and which may be used to determine the limits of the
genetically active unit (Rieger et al. (1976) Glossary of Genetics
and Cytogenetics: Classical and Molecular, 4th ed., Springer
Verlag. Berlin). A gene generally includes regions preceding
("leaders"; upstream) and following ("trailers"; downstream) of the
coding region. A gene may also include intervening, non-coded
sequences, referred to as "introns", located between individual
coding segments, referred to as "exons". Most genes have an
associated promoter region, a regulatory sequence 5' of the
transcription initiation codon (there are some genes that do not
have an identifiable promoter). The function of a gene may also be
regulated by enhancers, operators, and other regulatory
elements.
[0156] A "trait" refers to a physiological, morphological,
biochemical, or physical characteristic of a plant or particular
plant material or cell. In some instances, this characteristic is
visible to the human eye, such as seed or plant size, or can be
measured by biochemical techniques, such as detecting the protein,
starch, or oil content of seed or leaves, or by observation of a
metabolic or physiological process, e.g. by measuring uptake of
carbon dioxide, or by the observation of the expression level of a
gene or genes, e.g., by employing Northern analysis, RT-PCR,
microarray gene expression assays, or reporter gene expression
systems, or by agricultural observations such as stress tolerance,
yield, or pathogen tolerance. Any technique can be used to measure
the amount of, comparative level of, or difference in any selected
chemical compound or macromolecule in the transgenic plants,
however.
[0157] "Trait modification" refers to a detectable difference in a
characteristic in a plant ectopically expressing a polynucleotide
or polypeptide of the present invention relative to a plant not
doing so, such as a wild-type plant. In some cases, the trait
modification can be evaluated quantitatively. For example, the
trait modification can entail at least about a 2% increase or
decrease in an observed trait (difference), at least a 5%
difference, at least about a 10% difference, at least about a 20%
difference, at least about a 30%, at least about a 50%, at least
about a 70%, or at least about a 100%, or an even greater
difference compared with a wild-type plant. It is known that there
can be a natural variation in the modified trait. Therefore, the
trait modification observed entails a change of the normal
distribution of the trait in the plants compared with the
distribution observed in wild-type plant.
[0158] "Wild type", as used herein, refers to a cell, tissue or
plant that has not been genetically modified to knock out or
overexpress one or more of the presently disclosed transcription
factors. Wild-type cells, tissue or plants may be used as controls
to compare levels of expression and the extent and nature of trait
modification with cells, tissue or plants in which transcription
factor expression is altered or ectopically expressed, e.g., in
that it has been knocked out or overexpressed.
[0159] The term "transcript profile" refers to the expression
levels of a set of genes in a cell in a particular state,
particularly by comparison with the expression levels of that same
set of genes in a cell of the same type in a reference state. For
example, the transcript profile of a particular transcription
factor in a suspension cell is the expression levels of a set of
genes in a cell overexpressing that transcription factor compared
with the expression levels of that same set of genes in a
suspension cell that has normal levels of that transcription
factor. The transcript profile can be presented as a list of those
genes whose expression level is significantly different between the
two treatments, and the difference ratios. Differences and
similarities between expression levels may also be evaluated and
calculated using statistical and clustering methods.
[0160] "Ectopic expression" or "altered expression" in reference to
a polynucleotide indicates that the pattern of expression in, e.g.,
a transgenic plant or plant tissue, is different from the
expression pattern in a wild-type plant or a reference plant of the
same species. The pattern of expression may also be compared with a
reference expression pattern in a wild-type plant of the same
species. For example, the polynucleotide or polypeptide is
expressed in a cell or tissue type other than a cell or tissue type
in which the sequence is expressed in the wild-type plant, or by
expression at a time other than at the time the sequence is
expressed in the wild-type plant, or by a response to different
inducible agents, such as hormones or environmental signals, or at
different expression levels (either higher or lower) compared with
those found in a wild-type plant. The term also refers to altered
expression patterns that are produced by lowering the levels of
expression to below the detection level or completely abolishing
expression. The resulting expression pattern can be transient or
stable, constitutive or inducible. In reference to a polypeptide,
the term "ectopic expression or altered expression" further may
relate to altered activity levels resulting from the interactions
of the polypeptides with exogenous or endogenous modulators or from
interactions with factors or as a result of the chemical
modification of the polypeptides.
[0161] The term "overexpression" as used herein refers to a greater
expression level of a gene in a plant, plant cell or plant tissue,
compared to expression in a wild-type plant, cell or tissue, at any
developmental or temporal stage for the gene. Overexpression can
occur when, for example, the genes encoding one or more
transcription factors are under the control of a strong expression
signal, such as one of the promoters described herein (e.g., the
cauliflower mosaic virus 35S transcription initiation region).
Overexpression may occur throughout a plant or in specific tissues
of the plant, depending on the promoter used, as described
below.
[0162] Overexpression may take place in plant cells normally
lacking expression of polypeptides functionally equivalent or
identical to the present transcription factors. Overexpression may
also occur in plant cells where endogenous expression of the
present transcription factors or functionally equivalent molecules
normally occurs, but such normal expression is at a lower level.
Overexpression thus results in a greater than normal production, or
"overproduction" of the transcription factor in the plant, cell or
tissue.
[0163] The term "phase change" refers to a plant's progression from
embryo to adult, and, by some definitions, the transition wherein
flowering plants gain reproductive competency. It is believed that
phase change occurs either after a certain number of cell divisions
in the shoot apex of a developing plant, or when the shoot apex
achieves a particular distance from the roots. Thus, altering the
timing of phase changes may affect a plant's size, which, in turn,
may affect yield and biomass.
Traits that May be Modified in Overexpressing or Knock-Out
Plants
[0164] Trait modifications of particular interest include those to
seed (such as embryo or endosperm), fruit, root, flower, leaf,
stem, shoot, seedling or the like, including: enhanced tolerance to
environmental conditions including freezing, chilling, heat,
drought, water saturation, radiation and ozone; improved tolerance
to microbial, fungal or viral diseases; improved tolerance to pest
infestations, including insects, nematodes, mollicutes, parasitic
higher plants or the like; decreased herbicide sensitivity;
improved tolerance of heavy metals or enhanced ability to take up
heavy metals; improved growth under poor photoconditions (e.g., low
light and/or short day length), or changes in expression levels of
genes of interest. Other phenotype that can be modified relate to
the production of plant metabolites, such as variations in the
production of taxol, tocopherol, tocotrienol, sterols,
phytosterols, vitamins, wax monomers, anti-oxidants, amino acids,
lignins, cellulose, tannins, prenyllipids (such as chlorophylls and
carotenoids), glucosinolates, and terpenoids, enhanced or
compositionally altered protein or oil production (especially in
seeds), or modified sugar (insoluble or soluble) and/or starch
composition. Physical plant characteristics that can be modified
include cell development (such as the number of trichomes), fruit
and seed size and number, yields of plant parts such as stems,
leaves, inflorescences, and roots, the stability of the seeds
during storage, characteristics of the seed pod (e.g.,
susceptibility to shattering), root hair length and quantity,
internode distances, or the quality of seed coat. Plant growth
characteristics that can be modified include growth rate,
germination rate of seeds, vigor of plants and seedlings, leaf and
flower senescence, male sterility, apomixis, flowering time, flower
abscission, rate of nitrogen uptake, osmotic sensitivity to soluble
sugar concentrations, biomass or transpiration characteristics, as
well as plant architecture characteristics such as apical
dominance, branching patterns, number of organs, organ identity,
organ shape or size.
Transcription Factors Modify Expression of Endogenous Genes
[0165] Expression of genes that encode transcription factors that
modify expression of endogenous genes, polynucleotides, and
proteins are well known in the art. In addition, transgenic plants
comprising isolated polynucleotides encoding transcription factors
may also modify expression of endogenous genes, polynucleotides,
and proteins. Examples include Peng et al. (1997) Genes and
Development 11: 3194-3205, and Peng et al. (1999) Nature 400:
256-261. In addition, many others have demonstrated that an
Arabidopsis transcription factor expressed in an exogenous plant
species elicits the same or very similar phenotypic response. See,
for example, Fu et al. (2001) Plant Cell 13: 1791-1802; Nandi et
al. (2000, Curr. Biol. 10: 215-218; Coupland (1995) Nature 377:
482-483; and Weigel and Nilsson (1995) Nature 377: 482-500.
[0166] In another example, Mandel et al. (1992) Cell 71-133-143 and
Suzuki et al. (2001) Plant J. 28: 409-418, teach that a
transcription factor expressed in another plant species elicits the
same or very similar phenotypic response of the endogenous
sequence, as often predicted in earlier studies of Arabidopsis
transcription factors in Arabidopsis (see Mandel et al. (1992)
supra; Suzuki et al. (2001) supra).
[0167] Other examples include Muller et al. (2001) Plant J. 28:
169-179; Kim et al. (2001) Plant J. 25: 247-259; Kyozuka and
Shimamoto (2002) Plant Cell Physiol. 43: 130-135; Boss and Thomas
(2002) Nature 416: 847-850; He et al. (2000) Transgenic Res. 9:
223-227; and Robson et al. (2001) Plant J. 28: 619-631.
[0168] In yet another example, Gilmour et al. (1998) Plant J. 16:
433-442, teach an Arabidopsis AP2 transcription factor, CBF1 (SEQ
ID NO: 44), which, when overexpressed in transgenic plants,
increases plant freezing tolerance. Jaglo et al. (2001) Plant
Physiol. 127: 910-917, further identified sequences in Brassica
napus which encode CBF-like genes and that transcripts for these
genes accumulated rapidly in response to low temperature.
Transcripts encoding CBF-like proteins were also found to
accumulate rapidly in response to low temperature in wheat, as well
as in tomato. An alignment of the CBF proteins from Arabidopsis, B.
napus, wheat, rye, and tomato revealed the presence of conserved
consecutive amino acid residues, PKK/RPAGRxKFxETRHP (e.g., in SEQ
ID NO: 44 beginning at amino acid 34) and DSAWR (e.g., in SEQ ID
NO: 44 beginning at amino acid 105), that bracket the AP2/EREBP DNA
binding domains of the proteins and distinguish them from other
members of the AP2/EREBP protein family (See Jaglo et al.
supra).
[0169] Gao et al. (2002) Plant Molec. Biol. 49: 459-471) have
recently described four CBF transcription factors from Brassica
napus: BNCBFs 5, 7, 16 and 17. They note that the first three CBFs
(GenBank Accession Numbers AAM18958, AAM18959, and AAM18960,
respectively) are very similar to Arabidopsis CBF1, whereas BNCBF17
(GenBank Accession Number AAM18961) is similar but contains two
extra regions of 16 and 21 amino acids in its acidic activation
domain. All four B. napus CBFs accumulate in leaves of the plants
after cold-treatment, and BNCBFs 5, 7, 16 accumulated after salt
stress treatment. The authors concluded that these BNCBFs likely
function in low-temperature responses in B. napus.
[0170] In a functional study of CBF genes, Hsieh et al. ((2002)
Plant Physiol. 129: 1086-1094) found that heterologous expression
of Arabidopsis CBF1 in tomato plants confers increased tolerance to
chilling and considerable tolerance to oxidative stress, which
suggested to the authors that ectopic Arabidopsis CBF1 expression
may induce several tomato stress responsive genes to protect the
plants.
Polypeptides and Polynucleotides of the Invention
[0171] The present invention provides, among other things,
transcription factors (TFs), and transcription factor homolog
polypeptides, and isolated or recombinant polynucleotides encoding
the polypeptides, or novel sequence variant polypeptides or
polynucleotides encoding novel variants of transcription factors
derived from the specific sequences provided here. These
polypeptides and polynucleotides may be employed to modify a
plant's characteristics.
[0172] Exemplary polynucleotides encoding the polypeptides of the
invention were identified in the Arabidopsis thaliana GenBank
database using publicly available sequence analysis programs and
parameters. Sequences initially identified were then further
characterized to identify sequences comprising specified sequence
strings corresponding to sequence motifs present in families of
known transcription factors. In addition, further exemplary
polynucleotides encoding the polypeptides of the invention were
identified in the plant GenBank database using publicly available
sequence analysis programs and parameters. Sequences initially
identified were then further characterized to identify sequences
comprising specified sequence strings corresponding to sequence
motifs present in families of known transcription factors.
Polynucleotide sequences meeting such criteria were confirmed as
transcription factors.
[0173] Additional polynucleotides of the invention were identified
by screening Arabidopsis thaliana and/or other plant cDNA libraries
with probes corresponding to known transcription factors under low
stringency hybridization conditions. Additional sequences,
including full length coding sequences were subsequently recovered
by the rapid amplification of cDNA ends (RACE) procedure, using a
commercially available kit according to the manufacturer's
instructions. Where necessary, multiple rounds of RACE are
performed to isolate 5' and 3' ends. The full-length cDNA was then
recovered by a routine end-to-end polymerase chain reaction (PCR)
using primers specific to the isolated 5' and 3' ends. Exemplary
sequences are provided in the Sequence Listing.
[0174] The polynucleotides of the invention can be or were
ectopically expressed in overexpressor or knockout plants and the
changes in the characteristic(s) or trait(s) of the plants
observed. Therefore, the polynucleotides and polypeptides can be
employed to improve the characteristics of plants.
[0175] The polynucleotides of the invention can be or were
ectopically expressed in overexpressor plant cells and the changes
in the expression levels of a number of genes, polynucleotides,
and/or proteins of the plant cells observed. Therefore, the
polynucleotides and polypeptides can be employed to change
expression levels of a genes, polynucleotides, and/or proteins of
plants.
Mads Affecting Flowering (MAF) Transcription Factor Gene Family
Polynucleotide And Polypeptide Sequences
[0176] Examination of the Arabidopsis genome sequence has revealed
the existence of five MADS box genes which encode proteins that are
highly related to FLC (Alvarez-Buylla et al. (2000a) Proc. Natl.
Acad. Sci. 97: 5328-5333; Ratcliffe et al. (2001) Plant Physiol.
126: 122-132). The first of the genes to be analyzed, MADS
AFFECTING FLOWERING1, MAF1 (which has also been referred to as
FLOWERING LOCUS M, FLM, Scortecci et al. (2001) Plant J. 26:
229-236, and as AGL27, Alvarez-Buylla et al. (2000a) supra), was
shown to be a floral repressor (Ratcliffe et al. (2001) supra;
Scortecci et al. (2001) supra). MAF1 expression shows a less
clear-cut association with the vernalization response than that of
FLC, and the gene potentially acts downstream or independently of
FLC transcription (Ratcliffe et al. (2001) supra). The functions of
four FLC related genes were analyzed and it was demonstrated that
they influence the timing of flowering. In particular, a mechanism
that prevents Arabidopsis plants becoming vernalized by short
periods of cold was revealed.
[0177] The Arabidopsis genome contains four genes, which are highly
related to FLC and MAF1, arranged in a tight cluster at the bottom
of chromosome 5 (Ratcliffe et. al. (2001) supra). The gene cluster
occupies approximately 22 kb and comprises At5g65050 (which
corresponds to AGL31; Alvarez-Buylla et al. (2000a) supra),
At5g65060, At5g65070, and At5g65080. As shown in FIG. 6, an
alignment of the full-length protein sequences of SEQ ID NO: 1875
(FLC), SEQ ID NO: 1735 (MAF1), SEQ ID NO: 568 (MAF2), SEQ ID NO:
944 (MAF3), SEQ ID NO: 946 (MAF4), and SEQ ID NO: 948 (MAF5), shows
that the protein sequences share a large degree of identity
(residue identity denoted by asterisk: "*"; residue similarity
denoted by period: ".") across the entire sequence, depending upon
the pair-wise combination. This similarity suggested that the
polynucleotide sequences and the encoded polypeptide sequences of
MAF2, MAF3, MAF4, and MAF5 are MADS-domain family transcription
factors which have functions related to those of MAF1 and FLC in
the regulation of flowering time (Riechmann and Meyerowitz (1997)
supra).
[0178] MAF polypeptide sequences from Arabidopsis and soy were
aligned using the CLUSTAL W(1.4) multiple sequence alignment
algorithm (MACVETOR) to create pairwise alignments. The results are
shown in Table 14.
[0179] As shown in Table 14, SEQ ID NO: 568 (MAF2; G859) has 61%
identity and 74% similarity to SEQ ID NO: 1875 (FLC: G1759), 76%
identity and 85% similarity to SEQ ID NO: 1735 (MAF1: G157), 87%
identity and 90% similarity to SEQ ID NO: 944 (MAF3: G1842), 64%
identity and 77% similarity to SEQ ID NO: 946 (MAF4: G1843), 63%
identity and 79% similarity to SEQ ID NO: 948 (MAF5: G1844), 34%
identity and 52% similarity to SEQ ID NO: 1971 (SOY1: SOY MADS1),
and 34% identity and 53% similarity to SEQ ID NO: 1973 (SOY3: SOY
MADS3), respectively.
[0180] In addition, Table 14 shows that SEQ ID NO: 944 (MAF3;
G1842) has 60% identity and 75% similarity to SEQ ID NO: 1875 (FLC:
G1759), 78% identity and 87% similarity to SEQ ID NO: 1735 (MAF1:
G157), 87% identity and 90% similarity to SEQ ID NO: 568 (MAF2:
G859), 64% identity and 78% similarity to SEQ ID NO: 946 (MAF4:
G1843), 65% identity and 81% similarity to SEQ ID NO: 948 (MAF5:
G1844), 32% identity and 43% similarity to SEQ ID NO: 1971 (SOY1:
SOY MADS1), and 34% identity and 56% similarity to SEQ ID NO: 1973
(SOY3: SOY MADS3), respectively.
[0181] In addition, Table 14 shows that SEQ ID NO: 946 (MAF4;
G1843) has 57% identity and 74% similarity to SEQ ID NO: 1875 (FLC:
G1759), 65% identity and 81% similarity to SEQ ID NO: 1735 (MAF1:
G157), 64% identity and 77% similarity to SEQ ID NO: 568 (MAF2:
G859), 64% identity and 78% similarity to SEQ ID NO: 944 (MAF3:
G1842), 71% identity and 83% similarity to SEQ ID NO: 948 (MAF5:
G1844), 35% identity and 53% similarity to SEQ ID NO: 1971 (SOY1:
SOY MADS1), and 36% identity and 55% similarity to SEQ ID NO: 1973
(SOY3: SOY MADS3), respectively. In addition, Table 14 shows that
SEQ ID NO: 948 (MAF5; G1844) has 53% identity and 73% similarity to
SEQ ID NO: 1875 (FLC: G1759), 63% identity and 80% similarity to
SEQ ID NO: 1735 (MAF1: G157), 63% identity and 79% similarity to
SEQ ID NO: 568 (MAF2: G859), 65% identity and 81% similarity to SEQ
ID NO: 944 (MAF3: G1842), 71% identity and 83% similarity to SEQ ID
NO: 946 (MAF4: G1843), 36% identity and 54% similarity to SEQ ID
NO: 1971 (SOY1: SOY MADS1), and 36% identity and 56% similarity to
SEQ ID NO: 1973 (SOY3: SOY MADS3), respectively.
[0182] The results show that a polypeptide of 186 amino acid
residues (the length of the shortest of the MAF sequences; Soy1.SOY
MADS1; SEQ ID NO:1971) shows at least 32% identity over the
complete polypeptide sequence compared with SEQ ID NO: 944 (MAF3:
G1842).
[0183] FIGS. 7A and 7B shows the alignment between the Arabidopsis
and soy MAF polypeptide sequences produced using the CLASTAL W(1.4)
multiple sequence alignment algorithm.
[0184] As shown in FIGS. 7A and 7B, a conserved domain of SEQ ID
NO: 568 (MAF2, G859.pep; amino acid residues Gly2 through Ser57)
has amino acid sequence identity with a conserved domain of SEQ ID
NO: 1875 (FLC; G1759.pep; 83.9%), SEQ ID NO: 1735 (MAF1, G157.pep;
87.5%), SEQ ID NO: 944 (MAF3, G1842.pep; 92.9%), SEQ ID NO: 946
(MAF4, G1843.pep; 76.8%), SEQ ID NO: 948 (MAF5, G1844.pep; 78.6%),
SEQ ID NO:14 (SOY MADS1, Soy1.pep; 69.6%), and SEQ ID NO: 1973 (SOY
MADS3, Soy3.pep; 66.1%). SOY MADS1 (SEQ ID NO:14) and SOY MADS3
(SEQ ID NO:16) are therefore soy (Glycine max) MAF homologs of the
Arabidopsis SEQ ID NOs: 568, 944, 946, 948, 1735, and 1875.
[0185] The conserved domain of MAF transcription factors
exemplified by amino acid residues Gly2 through Ser57 of SEQ ID NO:
568 as shown in FIG. 7A is defined by the consensus amino acid
residue sequence
GX.sub.1X.sub.1X.sub.1X.sub.2EIKRIENKSXRQX.sub.2TFXKRRXGLXXKARX.sub.3LSX.-
sub.2 LCXXXX.sub.2AX.sub.2XX.sub.2XSXX.sub.4GX.sub.1LYXX, wherein
X.sub.1 represents a basic residue such as K or R, X.sub.2
represents an aliphatic residue such as V, I, L, A, or G, X.sub.3
represents an acid or amide residue such as E or Q, or D or N,
X.sub.4 represents an aliphatic hydroxyl residue such as T or S,
and wherein X represents any amino acid residue. An exemplary
consensus sequence is SEQ ID NO: 2010.
[0186] As also shown in FIG. 7A, an additional conserved domain
(amino acid residues Ala58 through Gln74) flanks a region
C-terminal to the conserved domain of amino acid residues Gly2
through Ser57 of SEQ ID NO: 568. This conserved domain of SEQ ID
NO: 568 (MAF2, G859.pep; amino acid residues Ala58 through Gln74)
has amino acid sequence identity with a conserved domain of SEQ ID
NO: 1875 (FLC; G1759.pep; 58.8%), SEQ ID NO: 1735 (MAF1, G157.pep;
76.5%), SEQ ID NO: 944 (MAF3, G1842.pep; 100%), SEQ ID NO: 946
(MAF4, G1843.pep; 59.2%), SEQ ID NO: 948 (MAF5, G1844.pep; 58.8%),
SEQ ID NO: 1971 (SOY MADS1, Soy1.pep; 23.5%), and SEQ ID NO: 1973
(SOY MADS3, Soy3.pep; 23.5%).
[0187] As also shown in FIG. 7A, the larger conserved domain (amino
acid residues Gly2 through Gln74) of SEQ ID NO: 568. This conserved
domain of SEQ ID NO: 568 (MAF2, G859.pep; amino acid residues Gly2
through Gln74) has amino acid sequence identity with a conserved
domain of SEQ ID NO: 1875 (FLC; G1759.pep; 78.1%), SEQ ID NO: 1735
(MAF1, G157.pep; 84.9%), SEQ ID NO: 944 (MAF3, G1842.pep; 93.2%),
SEQ ID NO: 946 (MAF4, G1843.pep; 72.6%), SEQ ID NO: 948 (MAF5,
G1844.pep; 72.6%), SEQ ID NO: 1971 (SOY MADS1, Soy1.pep; 65.8%),
and SEQ ID NO: 1973 (SOY MADS3, Soy3.pep; 54.8%).
[0188] The larger conserved domain shown in FIG. 7A is defined by
the consensus amino acid residue sequence
GX.sub.1X.sub.1X.sub.1X.sub.2EIKRIENKSXRQX.sub.2TFXKRRXGLXXKARX.sub.3LSX.-
sub.2
LCXXXX.sub.2AX.sub.2XX.sub.2XSXX.sub.4GX.sub.1LYXXXXGDXXXXX.sub.2X.s-
ub.2XXX.sub.5XXXX, wherein X.sub.1 represent a basic residue such
as K or R, X.sub.2 represent an aliphatic residue such as V, I, L,
A, or G, X.sub.3 represents an acid or amide residue such as E or
Q, or D or N, X.sub.4 represents an aliphatic hydroxyl residue such
as T or S, X.sub.5 represents an aromatic residue such as F or Y,
and wherein X represents any amino acid residue. An exemplary
consensus sequence is SEQ ID NO: 2011.
[0189] In addition, FIG. 7 shows that FLC, MAF1, MAF2, MAF3, MAF4,
MAF5, SOY MADS1, and SOY MADS3 share three potential protein kinase
C phosphorylation sites at amino acid residues Ser15, Ser22, and
Ser51; two potential protein kinase A phosphorylation sites at
amino acid residues Thr20 and Ser36; a potential CaMPKII
phosphorylation site at amino acid residue Ser36; FLC, MAF1, MAF2,
MAF3, MAF4, and MAF5 share three potential protein kinase casein
kinase I phosphorylation sites at amino acid residues Y55, 5116,
and 5129; and MAF1, MAF2, MAF3, and MAF5 share three potential
protein kinase casein kinase II phosphorylation sites at amino acid
residue S57, S59, and 5119.
[0190] Allelic variants of MAF2-5 are represented by SEQ ID NOs:
567, 1944, 1946, 1948, and 1950 (MAF2 variants); SEQ ID NOs: 943,
1952, 1954, 1956, and 1958 (MAF3 variants); SEQ ID NOs: 945, 1960,
1962, 1964, and 1966 (MAF4 variants); and SEQ ID NOs: 947 and 1968
(MAF5 variants).
[0191] FIG. 8 shows the effects of vernalization on expression of
MAF2-5 (SEQ ID NOs: 567, 943, 945, and 947) in different genetic
backgrounds (Arabidopsis accessions). FIG. 9 shows a schematic
diagram summarizing the responses of FLC and MAF1-5 to
vernalization, and their potential effects on the floral
transition. Arrows indicate positive interactions, blunt-ended
lines denote inhibition.
[0192] MAF2-5 (SEQ ID NOs: 567, 943, 945, and 947; encoding SEQ ID
NOs: 568, 944, 946, and 948, respectively) are involved in
regulation of the vernalization response. MAF2 (SEQ ID NO: 567)
encodes a floral repressor (SEQ ID NO: 568), which participates in
a previously unrecognized mechanism that prevents the plants being
vernalized by short cold periods. MAF3 and MAF4 (SEQ ID NO: 943 and
SEQ ID NO: 945, encoding SEQ ID NOs: 944 and 946, respectively) may
have parallel roles to FLC in the maintenance of a vernalization
requirement. MAF5 (SEQ ID NO: 947; encoding SEQ ID NO: 948), is
activated by vernalization, and could therefore have an opposing
role to FLC and MAF1-4.
[0193] Therefore, it was concluded that MAF2 (SEQ ID NO: 567;
encoding SEQ ID NO: 568) compensates for the decrease in FLC levels
that occurs following short cold spells, and thereby prevents a
flowering response being triggered. In some environments, promotion
of flowering in response to a few days of cold weather might be
advantageous. However, winter annual strains of Arabidopsis from
northern latitudes have evolved to over-winter vegetatively and
commence flowering in the spring only after a sustained period of
low temperature (Reeves and Coupland (2000) supra; Michaels and
Amasino (2000) supra). Individual plants without MAF2-like activity
would be more susceptible to transient cold spells in the autumn,
when conditions for seed set are unfavorable. Thus, there would be
likely a selective advantage for a plant to evolve MAF2 function.
It would be advantageous for a plant that does not have an
endogenous MAF2-like activity to be bred and/or transformed to have
MAF2-like (MAF) activity in order to be less susceptible to
transient cold.
[0194] The polynucleotide sequences of SEQ ID NOs: 1970, and 1972
may be altered such that amino acid sequences SEQ ID NOs: 1971 and
1973 (SOY MADS1 and SOY MADS3, respectively) have conservative and
non-conservative similar amino acid substitutions to create
sequences which can have MAF (such as MAF2-like) activity.
[0195] In general, a wide variety of applications exist for systems
that either lengthen or shorten the time to flowering.
[0196] Accelerated Flowering:
[0197] Most modern crop varieties are the result of extensive
breeding programs. Many generations of backcrossing can be required
to introduce desired traits. Transgenic plants comprising systems
that accelerate flowering could have valuable applications in such
programs. A faster generation time can allow additional harvests of
a crop to be made within a given growing season. With the advent of
transformation systems for tree species such as oil palm and
Eucalyptus, forest biotechnology is a growing area of interest.
Acceleration of flowering, again, can reduce generation times and
make breeding programs feasible which would otherwise be
impossible. That this is a real possibility has already been
demonstrated in aspen, a tree species that usually takes 8-20 years
to flower. Transgenic aspen that over-express the Arabidopsis LFY
gene flower after only 5 months. The flowers produced by these
young aspen plants, however, were sterile (Weigel and Nilsson
(1995) Nature 377: 495-500).
[0198] Delayed Flowering:
[0199] In species such as sugarbeet, where the vegetative parts of
the plants constitute the crop and the reproductive tissues are
discarded, it would be advantageous to delay or prevent flowering.
Extending vegetative development could bring about large increases
in yields.
[0200] Inducible Flowering:
[0201] By regulating the expression of flowering-time controlling
genes, using inducible promoters, flowering could potentially be
triggered as desired (for example, by application of a chemical
inducer). This would allow, for example, flowering to be
synchronized across a crop and facilitate more efficient
harvesting. Such inducible systems could be used to tune the
flowering of crop varieties to different latitudes. At present,
species such as soybean and cotton are available as a series of
maturity groups that are suitable for different latitudes on the
basis of their flowering time (which is governed by day-length). A
system in which flowering could be chemically controlled would
allow a single high-yielding northern maturity group to be grown at
any latitude. In southern regions such plants could be grown for
longer, thereby increasing yields, before flowering was induced. In
more northern areas, the induction would be used to ensure that the
crop flowers prior to the first winter frosts. Currently, the
existence of a series of maturity groups for different latitudes
represents a major barrier to the introduction of new valuable
traits. Any trait (e.g. disease resistance, vernalization response)
has to be bred into each of the different maturity groups
separately; a laborious and costly exercise. The availability of
single strain, which could be grown at any latitude, would
therefore greatly increase the potential for introducing new traits
to crop species such as soybean and cotton.
Producing Polypeptides
[0202] The polynucleotides of the invention include sequences that
encode transcription factors and transcription factor homolog
polypeptides and sequences complementary thereto, as well as unique
fragments of coding sequence, or sequence complementary thereto.
Such polynucleotides can be, e.g., DNA or RNA, e.g., mRNA, cRNA,
synthetic RNA, genomic DNA, cDNA synthetic DNA, oligonucleotides,
etc. The polynucleotides are either double-stranded or
single-stranded, and include either, or both sense (i.e., coding)
sequences and antisense (i.e., non-coding, complementary)
sequences. The polynucleotides include the coding sequence of a
transcription factor, or transcription factor homolog polypeptide,
in isolation, in combination with additional coding sequences
(e.g., a purification tag, a localization signal, as a
fusion-protein, as a pre-protein, or the like), in combination with
non-coding sequences (e.g., introns or inteins, regulatory elements
such as promoters, enhancers, terminators, and the like), and/or in
a vector or host environment in which the polynucleotide encoding a
transcription factor or transcription factor homolog polypeptide is
an endogenous or exogenous gene.
[0203] A variety of methods exist for producing the polynucleotides
of the invention. Procedures for identifying and isolating DNA
clones are well known to those of skill in the art, and are
described in, e.g., Berger and Kimmel, Guide to Molecular Cloning
Techniques, Methods in Enzymology, vol. 152 Academic Press, Inc.,
San Diego, Calif. ("Berger"); Sambrook et al. (1989) Molecular
Cloning--A Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring
Harbor Laboratory, Cold Spring Harbor, N.Y., and Current Protocols
in Molecular Biology, Ausubel et al. eds., Current Protocols, a
joint venture between Greene Publishing Associates, Inc. and John
Wiley & Sons, Inc., (supplemented through 2000)
("Ausubel").
[0204] Alternatively, polynucleotides of the invention, can be
produced by a variety of in vitro amplification methods adapted to
the present invention by appropriate selection of specific or
degenerate primers. Examples of protocols sufficient to direct
persons of skill through in vitro amplification methods, including
the polymerase chain reaction (PCR) the ligase chain reaction
(LCR), Q.beta.-replicase amplification and other RNA polymerase
mediated techniques (e.g., NASBA), e.g., for the production of the
homologous nucleic acids of the invention are found in Berger
(supra), Sambrook (supra), and Ausubel (supra), as well as Mullis
et al. (1987) PCR Protocols A Guide to Methods and Applications
(Innis et al. eds) Academic Press Inc. San Diego, Calif. (1990)
(Innis). Improved methods for cloning in vitro amplified nucleic
acids are described in Wallace et al. U.S. Pat. No. 5,426,039.
Improved methods for amplifying large nucleic acids by PCR are
summarized in Cheng et al. (1994) Nature 369: 684-685 and the
references cited therein, in which PCR amplicons of up to 40 kb are
generated. One of skill will appreciate that essentially any RNA
can be converted into a double stranded DNA suitable for
restriction digestion, PCR expansion and sequencing using reverse
transcriptase and a polymerase. See, e.g., Ausubel, Sambrook and
Berger, all supra.
[0205] Alternatively, polynucleotides and oligonucleotides of the
invention can be assembled from fragments produced by solid-phase
synthesis methods. Typically, fragments of up to approximately 100
bases are individually synthesized and then enzymatically or
chemically ligated to produce a desired sequence, e.g., a
polynucleotide encoding all or part of a transcription factor. For
example, chemical synthesis using the phosphoramidite method is
described, e.g., by Beaucage et al. (1981) Tetrahedron Letters 22:
1859-1869; and Matthes et al. (1984) EMBO J. 3: 801-805. According
to such methods, oligonucleotides are synthesized, purified,
annealed to their complementary strand, ligated and then optionally
cloned into suitable vectors. And if so desired, the
polynucleotides and polypeptides of the invention can be custom
ordered from any of a number of commercial suppliers.
Homologous Sequences
[0206] Sequences homologous, i.e., that share significant sequence
identity or similarity, to those provided in the Sequence Listing,
derived from Arabidopsis thaliana or from other plants of choice,
are also an aspect of the invention. Homologous sequences can be
derived from any plant including monocots and dicots and in
particular agriculturally important plant species, including but
not limited to, crops such as soybean, wheat, corn (maize), potato,
cotton, rice, rape, oilseed rape (including canola), sunflower,
alfalfa, clover, sugarcane, and turf; or fruits and vegetables,
such as banana, blackberry, blueberry, strawberry, and raspberry,
cantaloupe, carrot, cauliflower, coffee, cucumber, eggplant,
grapes, honeydew, lettuce, mango, melon, onion, papaya, peas,
peppers, pineapple, pumpkin, spinach, squash, sweet corn, tobacco,
tomato, tomatillo, watermelon, rosaceous fruits (such as apple,
peach, pear, cherry and plum) and vegetable brassicas (such as
broccoli, cabbage, cauliflower, Brussels sprouts, and kohlrabi).
Other crops, including fruits and vegetables, whose phenotype can
be changed and which comprise homologous sequences include barley;
rye; millet; sorghum; currant; avocado; citrus fruits such as
oranges, lemons, grapefruit and tangerines, artichoke, cherries;
nuts such as the walnut and peanut; endive; leek; roots such as
arrowroot, beet, cassava, turnip, radish, yam, and sweet potato;
and beans. The homologous sequences may also be derived from woody
species, such pine, poplar and eucalyptus, or mint or other
labiates. In addition, homologous sequences may be derived from
plants that are evolutionarily-related to crop plants, but which
may not have yet been used as crop plants. Examples include deadly
nightshade (Atropa belladona), related to tomato; jimson weed
(Datura strommium), related to peyote; and teosinte (Zea species),
related to corn (maize)
Orthologs and Paralogs
[0207] Homologous sequences as described above can comprise
orthologous or paralogous sequences. Several different methods are
known by those of skill in the art for identifying and defining
these functionally homologous sequences. Three general methods for
defining orthologs and paralogs are described; an ortholog or
paralog, including equivalogs, may be identified by one or more of
the methods described below.
[0208] Orthologs and paralogs are evolutionarily related genes that
have similar sequence and similar functions. Orthologs are
structurally related genes in different species that are derived by
a speciation event. Paralogs are structurally related genes within
a single species that are derived by a duplication event.
[0209] Within a single plant species, gene duplication may cause
two copies of a particular gene, giving rise to two or more genes
with similar sequence and often similar function known as paralogs.
A paralog is therefore a similar gene formed by duplication within
the same species. Paralogs typically cluster together or in the
same clade (a group of similar genes) when a gene family phylogeny
is analyzed using programs such as CLUSTAL (Thompson et al. (1994)
Nucleic Acids Res. 22: 4673-4680; Higgins et al. (1996) Methods
Enzymol. 266: 383-402). Groups of similar genes can also be
identified with pair-wise BLAST analysis (Feng and Doolittle (1987)
J. Mol. Evol. 25: 351-360). For example, a clade of very similar
MADS domain transcription factors from Arabidopsis all share a
common function in flowering time (Ratcliffe et al. (2001) Plant
Physiol. 126: 122-132), and a group of very similar AP2 domain
transcription factors from Arabidopsis are involved in tolerance of
plants to freezing (Gilmour et al. (1998) Plant J. 16: 433-442).
Analysis of groups of similar genes with similar function that fall
within one clade can yield sub-sequences that are particular to the
clade. These sub-sequences, known as consensus sequences, can not
only be used to define the sequences within each clade, but define
the functions of these genes; genes within a clade may contain
paralogous sequences, or orthologous sequences that share the same
function (see also, for example, Mount (2001), in Bioinformatics:
Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press,
Cold Spring Harbor, N.Y., page 543.)
[0210] Speciation, the production of new species from a parental
species, can also give rise to two or more genes with similar
sequence and similar function. These genes, termed orthologs, often
have an identical function within their host plants and are often
interchangeable between species without losing function. Because
plants have common ancestors, many genes in any plant species will
have a corresponding orthologous gene in another plant species.
Once a phylogenic tree for a gene family of one species has been
constructed using a program such as CLUSTAL (Thompson et al. (1994)
Nucleic Acids Res. 22: 4673-4680; Higgins et al. (1996) supra)
potential orthologous sequences can be placed into the phylogenetic
tree and their relationship to genes from the species of interest
can be determined. Orthologous sequences can also be identified by
a reciprocal BLAST strategy. Once an orthologous sequence has been
identified, the function of the ortholog can be deduced from the
identified function of the reference sequence.
[0211] Results from alignment analysis using SSERCH of 2,079
protein domains have shown that alignment of two unrelated
polypeptide sequences have an upper threshold of percentage amino
acid residue identity and that this percentage identity threshold
decreases with the length of the alignment (Brenner et al. (1998)
Proc. Natl. Acad. Sci. 95: 6073-6078). Brenner suggested that it is
probably necessary for alignments to be at least 70 residues in
length before 40% identity is a reasonable threshold, such that the
likelihood of two sequences being related is not due to chance.
Furthermore, Brenner et al. (1998, supra) showed that two sequences
which have 30% identity is a reliable threshold for the database of
2,079 domains only for sequence alignments of at least 150
residues. Brenner et al. disclosed a chart which showed where the
percentage identity and alignment length limits of such unrelated
sequences cluster (see Brenner et al. (1998, supra), FIG. 3, page
6075). From such a chart, an alignment of two polypeptide sequences
may be plotted to ascertain whether they fall within or without the
region of unrelated sequences. For example, two polypeptide
sequences which are aligned over 73 residues having at least 50%
sequence identity are above the threshold for which they might be
considered unrelated and therefore are, more likely than not,
related to one another.
[0212] In addition, Bork has shown that there is a 70% accuracy
rate for bioinformatics-based predictions in general, and a 90%
accuracy rate for the prediction of functional features by homology
(Bork (2000) Genome Res. 10:398-400; Table 1 on page 399).
[0213] Transcription factor gene sequences are conserved across
diverse eukaryotic species lines (Goodrich et al. (1993) Cell 75:
519-530; Lin et al. (1991) Nature 353: 569-571; Sadowski et al.
(1988) Nature 335: 563-564). et al. Plants are no exception to this
observation; diverse plant species possess transcription factors
that have similar sequences and functions.
[0214] Orthologous genes from different organisms have highly
conserved functions, and very often essentially identical functions
(Lee et al. (2002) Genome Res. 12: 493-502; Remm et al. (2001) J.
Mol. Biol. 314: 1041-1052). Paralogous genes, which have diverged
through gene duplication, may retain similar functions of the
encoded proteins. In such cases, paralogs can be used
interchangeably with respect to certain embodiments of the instant
invention (for example, transgenic expression of a coding
sequence). An example of such highly related paralogs is the CBF
family, with three well-defined members in Arabidopsis and at least
one ortholog in Brassica napus (SEQ ID NOs: 44, 46, 48, and 1941,
respectively), all of which control pathways involved in both
freezing and drought stress (Gilmour et al. (1998) Plant J. 16:
433-442; Jaglo et al. (1998) Plant Physiol. 127: 910-917).
[0215] The following references represent a small sampling of the
many studies that demonstrate that conserved transcription factor
genes from diverse species are likely to function similarly (i.e.,
regulate similar target sequences and control the same traits), and
that transcription factors may be transformed into diverse species
to confer or improve traits.
[0216] (1) The Arabidopsis NPR1 gene regulates systemic acquired
resistance (SAR); over-expression of NPR1 leads to enhanced
resistance in Arabidopsis. When either Arabidopsis NPR1 or the rice
NPR1 ortholog was overexpressed in rice (which, as a monocot, is
diverse from Arabidopsis), challenge with the rice bacterial blight
pathogen Xanthomonas oryzae pv. Oryzae, the transgenic plants
displayed enhanced resistance (Chem et al. (2001) Plant J. 27:
101-113). NPR1 acts through activation of expression of
transcription factor genes, such as TGA2 (Fan and Dong (2002) Plant
Cell 14: 1377-1389).
[0217] (2) E2F genes are involved in transcription of plant genes
for proliferating cell nuclear antigen (PCNA). Plant E2Fs share a
high degree of similarity in amino acid sequence between monocots
and dicots, and are even similar to the conserved domains of the
animal E2Fs. Such conservation indicates a functional similarity
between plant and animal E2Fs. E2F transcription factors that
regulate meristem development act through common cis-elements, and
regulate related (PCNA) genes (Kosugi and Ohashi, (2002) Plant J.
29: 45-59).
[0218] (3) The ABI5 gene (abscisic acid (ABA) insensitive 5)
encodes a basic leucine zipper factor required for ABA response in
the seed and vegetative tissues. Co-transformation experiments with
ABI5 cDNA constructs in rice protoplasts resulted in specific
transactivation of the ABA-inducible wheat, Arabidopsis, bean, and
barley promoters. These results demonstrate that sequentially
similar ABI5 transcription factors are key targets of a conserved
ABA signaling pathway in diverse plants. (Gampala et al. (2001) J.
Biol. Chem. 277: 1689-1694).
[0219] (4) Sequences of three Arabidopsis GAMYB-like genes were
obtained on the basis of sequence similarity to GAMYB genes from
barley, rice, and L. temulentum. These three Arabadopsis genes were
determined to encode transcription factors (AtMYB33, AtMYB65, and
AtMYB101) and could substitute for a barley GAMYB and control
.alpha.-amylase expression (Gocal et al. (2001) Plant Physiol. 127:
1682-1693).
[0220] (5) The floral control gene LEAFY from Arabidopsis can
dramatically accelerate flowering in numerous dictoyledonous
plants. Constitutive expression of Arabidopsis LEAFY also caused
early flowering in transgenic rice (a monocot), with a heading date
that was 26-34 days earlier than that of wild-type plants. These
observations indicate that floral regulatory genes from Arabidopsis
are useful tools for heading date improvement in cereal crops (He
et al. (2000) Transgenic Res. 9: 223-227).
[0221] (6) Bioactive gibberellins (GAs) are essential endogenous
regulators of plant growth. GA signaling tends to be conserved
across the plant kingdom. GA signaling is mediated via GAL a
nuclear member of the GRAS family of plant transcription factors.
Arabidopsis GAI has been shown to function in rice to inhibit
gibberellin response pathways (Fu et al. (2001) Plant Cell 13:
1791-1802).
[0222] (7) The Arabidopsis gene SUPERMAN(SUP), encodes a putative
transcription factor that maintains the boundary between stamens
and carpels. By over-expressing Arabidopsis SUP in rice, the effect
of the gene's presence on whorl boundaries was shown to be
conserved. This demonstrated that SUP is a conserved regulator of
floral whorl boundaries and affects cell proliferation (Nandi et
al. (2000) Curr. Biol. 10: 215-218).
[0223] (8) Maize, petunia and Arabidopsis myb transcription factors
that regulate flavonoid biosynthesis are very genetically similar
and affect the same trait in their native species, therefore
sequence and function of these myb transcription factors correlate
with each other in these diverse species (Borevitz et al. (2000)
Plant Cell 12: 2383-2394).
[0224] (9) Wheat reduced height-1 (Rht-B1/Rht-D1) and maize dwarf-8
(d8) genes are orthologs of the Arabidopsis gibberellin insensitive
(GAI) gene. Both of these genes have been used to produce dwarf
grain varieties that have improved grain yield. These genes encode
proteins that resemble nuclear transcription factors and contain an
SH2-like domain, indicating that phosphotyrosine may participate in
gibberellin signaling. Transgenic rice plants containing a mutant
GAI allele from Arabidopsis have been shown to produce reduced
responses to gibberellin and are dwarfed, indicating that mutant
GAI orthologs could be used to increase yield in a wide range of
crop species (Peng et al. (1999) Nature 400: 256-261).
[0225] Transcription factors that are homologous to the listed
sequences will typically share, in at least one conserved domain,
at least about 70% amino acid sequence identity, and with regard to
zinc finger transcription factors, at least about 50% amino acid
sequence identity. More closely related transcription factors can
share at least about 70%, or about 75% or about 80% or about 90% or
about 95% or about 98% or more sequence identity with the listed
sequences, or with the listed sequences but excluding or outside a
known consensus sequence or consensus DNA-binding site, or with the
listed sequences excluding one or all conserved domain. Factors
that are most closely related to the listed sequences share, e.g.,
at least about 85%, about 90% or about 95% or more % sequence
identity to the listed sequences, or to the listed sequences but
excluding or outside a known consensus sequence or consensus
DNA-binding site or outside one or all conserved domain. At the
nucleotide level, the sequences will typically share at least about
40% nucleotide sequence identity, preferably at least about 50%,
about 60%, about 70% or about 80% sequence identity, and more
preferably about 85%, about 90%, about 95% or about 97% or more
sequence identity to one or more of the listed sequences, or to a
listed sequence but excluding or outside a known consensus sequence
or consensus DNA-binding site, or outside one or all conserved
domain. The degeneracy of the genetic code enables major variations
in the nucleotide sequence of a polynucleotide while maintaining
the amino acid sequence of the encoded protein. Conserved domains
within a transcription factor family may exhibit a higher degree of
sequence homology, such as at least 65% amino acid sequence
identity including conservative substitutions, and preferably at
least 80% sequence identity, and more preferably at least 85%, or
at least about 86%, or at least about 87%, or at least about 88%,
or at least about 90%, or at least about 95%, or at least about 98%
sequence identity. Transcription factors that are homologous to the
listed sequences should share at least 30%, or at least about 60%,
or at least about 75%, or at least about 80%, or at least about
90%, or at least about 95% amino acid sequence identity over the
entire length of the polypeptide or the homolog.
[0226] Percent identity can be determined electronically, e.g., by
using the MEGALIGN program (DNASTAR, Inc. Madison, Wis.). The
MEGALIGN program can create alignments between two or more
sequences according to different methods, for example, the clustal
method. (See, for example, Higgins and Sharp (1988) Gene 73:
237-244.) The clustal algorithm groups sequences into clusters by
examining the distances between all pairs. The clusters are aligned
pairwise and then in groups. Other alignment algorithms or programs
may be used, including FASTA, BLAST, or ENTREZ, FASTA and BLAST,
and which may be used to calculate percent similarity. These are
available as a part of the GCG sequence analysis package
(University of Wisconsin, Madison, Wis.), and can be used with or
without default settings. ENTREZ is available through the National
Center for Biotechnology Information. In one embodiment, the
percent identity of two sequences can be determined by the GCG
program with a gap weight of 1, e.g., each amino acid gap is
weighted as if it were a single amino acid or nucleotide mismatch
between the two sequences (see U.S. Pat. No. 6,262,333).
[0227] Other techniques for alignment are described in Doolittle,
R. F. (1996) Methods in Enzymology: Computer Methods for
Macromolecular Sequence Analysis, vol. 266, Academic Press,
Orlando, Fla., USA. Preferably, an alignment program that permits
gaps in the sequence is utilized to align the sequences. The
Smith-Waterman is one type of algorithm that permits gaps in
sequence alignments (see Shpaer (1997) Methods Mol. Biol. 70:
173-187). Also, the GAP program using the Needleman and Wunsch
alignment method can be utilized to align sequences. An alternative
search strategy uses MPSRCH software, which runs on a MASPAR
computer. MPSRCH uses a Smith-Waterman algorithm to score sequences
on a massively parallel computer. This approach improves ability to
pick up distantly related matches, and is especially tolerant of
small gaps and nucleotide sequence errors. Nucleic acid-encoded
amino acid sequences can be used to search both protein and DNA
databases.
[0228] The percentage similarity between two polypeptide sequences,
e.g., sequence A and sequence B, is calculated by dividing the
length of sequence A, minus the number of gap residues in sequence
A, minus the number of gap residues in sequence B, into the sum of
the residue matches between sequence A and sequence B, times one
hundred. Gaps of low or of no similarity between the two amino acid
sequences are not included in determining percentage similarity.
Percent identity between polynucleotide sequences can also be
counted or calculated by other methods known in the art, e.g., the
Jotun Hein method. (See, e.g., Hein (1990) Methods Enzymol. 183:
626-645.) Identity between sequences can also be determined by
other methods known in the art, e.g., by varying hybridization
conditions (see US Patent Application No. 20010010913).
[0229] The percent identity between two conserved domains of a
transcription factor DNA-binding domain consensus polypeptide
sequence can be as low as 16%, as exemplified in the case of GATA1
family of eukaryotic Cys.sub.2/Cys.sub.2-type zinc finger
transcription factors. The DNA-binding domain consensus polypeptide
sequence of the GATA1 family is CX.sub.2CX.sub.17CX.sub.2C, where X
is any amino acid residue. (See, for example, Takatsuji, supra.)
Other examples of such conserved consensus polypeptide sequences
with low overall percent sequence identity are well known to those
of skill in the art.
[0230] Thus, the invention provides methods for identifying a
sequence similar or paralogous or orthologous or homologous to one
or more polynucleotides as noted herein, or one or more target
polypeptides encoded by the polynucleotides, or otherwise noted
herein and may include linking or associating a given plant
phenotype or gene function with a sequence. In the methods, a
sequence database is provided (locally or across an internet or
intranet) and a query is made against the sequence database using
the relevant sequences herein and associated plant phenotypes or
gene functions.
[0231] In addition, one or more polynucleotide sequences or one or
more polypeptides encoded by the polynucleotide sequences may be
used to search against a BLOCKS (Bairoch et al. (1997) Nucleic
Acids Res. 25: 217-221), PFAM, and other databases which contain
previously identified and annotated motifs, sequences and gene
functions. Methods that search for primary sequence patterns with
secondary structure gap penalties (Smith et al. (1992) Protein
Engineering 5: 35-51) as well as algorithms such as Basic Local
Alignment Search Tool (BLAST; Altschul (1993) J. Mol. Evol. 36:
290-300; Altschul et al. (1990) supra), BLOCKS (Henikoff and
Henikoff (1991) Nucleic Acids Res. 19: 6565-6572), Hidden Markov
Models (HMM; Eddy (1996) Curr. Opin. Str. Biol. 6: 361-365;
Sonnhammer et al. (1997) Proteins 28: 405-420), and the like, can
be used to manipulate and analyze polynucleotide and polypeptide
sequences encoded by polynucleotides. These databases, algorithms
and other methods are well known in the art and are described in
Ausubel et al. (1997; Short Protocols in Molecular Biology, John
Wiley & Sons, New York, N.Y., unit 7.7) and in Meyers (1995;
Molecular Biology and Biotechnology, Wiley VCH, New York, N.Y., p
856-853).
[0232] Furthermore, methods using manual alignment of sequences
similar or homologous to one or more polynucleotide sequences or
one or more polypeptides encoded by the polynucleotide sequences
may be used to identify regions of similarity and conserved
domains. Such manual methods are well-known of those of skill in
the art and can include, for example, comparisons of tertiary
structure between a polypeptide sequence encoded by a
polynucleotide which comprises a known function with a polypeptide
sequence encoded by a polynucleotide sequence which has a function
not yet determined. Such examples of tertiary structure may
comprise predicted .alpha.-helices, .beta.-sheets, amphipathic
helices, leucine zipper motifs, zinc finger motifs, proline-rich
regions, cysteine repeat motifs, and the like.
[0233] Orthologs and paralogs of presently disclosed transcription
factors may be cloned using compositions provided by the present
invention according to methods well known in the art. cDNAs can be
cloned using mRNA from a plant cell or tissue that expresses one of
the present transcription factors. Appropriate mRNA sources may be
identified by interrogating Northern blots with probes designed
from the present transcription factor sequences, after which a
library is prepared from the mRNA obtained from a positive cell or
tissue. Transcription factor-encoding cDNA is then isolated using,
for example, PCR, using primers designed from a presently disclosed
transcription factor gene sequence, or by probing with a partial or
complete cDNA or with one or more sets of degenerate probes based
on the disclosed sequences. The cDNA library may be used to
transform plant cells. Expression of the cDNAs of interest is
detected using, for example, methods disclosed herein such as
microarrays, Northern blots, quantitative PCR, or any other
technique for monitoring changes in expression. Genomic clones may
be isolated using similar techniques to those.
Identifying Polynucleotides or Nucleic Acids by Hybridization
[0234] Polynucleotides homologous to the sequences illustrated in
the Sequence Listing and tables can be identified, e.g., by
hybridization to each other under stringent or under highly
stringent conditions. Single stranded polynucleotides hybridize
when they associate based on a variety of well characterized
physical-chemical forces, such as hydrogen bonding, solvent
exclusion, base stacking and the like. The stringency of a
hybridization reflects the degree of sequence identity of the
nucleic acids involved, such that the higher the stringency, the
more similar are the two polynucleotide strands. Stringency is
influenced by a variety of factors, including temperature, salt
concentration and composition, organic and non-organic additives,
solvents, etc. present in both the hybridization and wash solutions
and incubations (and number thereof), as described in more detail
in the references cited above.
[0235] Encompassed by the invention are polynucleotide sequences
that are capable of hybridizing to the claimed polynucleotide
sequences, including any of the transcription factor
polynucleotides within the Sequence Listing, and fragments thereof
under various conditions of stringency (See, for example, Wahl and
Berger (1987) Methods Enzymol. 152: 399-407; and Kimmel (1987)
Methods Enzymol. 152: 507-511). In addition to the nucleotide
sequences listed in Tables 4 and 5, full length cDNA, orthologs,
and paralogs of the present nucleotide sequences may be identified
and isolated using well-known methods. The cDNA libraries,
orthologs, and paralogs of the present nucleotide sequences may be
screened using hybridization methods to determine their utility as
hybridization target or amplification probes.
[0236] With regard to hybridization, conditions that are highly
stringent, and means for achieving them, are well known in the art.
See, for example, Sambrook et al. (1989) "Molecular Cloning: A
Laboratory Manual" (2nd ed., Cold Spring Harbor Laboratory); Berger
and Kimmel, eds., (1987) "Guide to Molecular Cloning Techniques",
In Methods in Enzymology:152: 467-469; and Anderson and Young
(1985) "Quantitative Filter Hybridisation." In: Hames and Higgins,
ed., Nucleic Acid Hybridisation, A Practical Approach. Oxford, IRL
Press, 73-111.
[0237] Stability of DNA duplexes is affected by such factors as
base composition, length, and degree of base pair mismatch.
Hybridization conditions may be adjusted to allow DNAs of different
sequence relatedness to hybridize. The melting temperature
(T.sub.m) is defined as the temperature when 50% of the duplex
molecules have dissociated into their constituent single strands.
The melting temperature of a perfectly matched duplex, where the
hybridization buffer contains formamide as a denaturing agent, may
be estimated by the following equations:
T.sub.m(.degree. C.)=81.5+16.6(log [Na+])+0.41(% G+C)-0.62(%
formamide)-500/L (I) DNA-DNA:
T.sub.m(.degree. C.)=79.8+18.5(log [Na+])+0.58(% G+C)+0.12(%
G+C).sup.2-0.5(% formamide)-820/L (II) DNA-RNA:
T.sub.m(.degree. C.)=79.8+18.5(log [Na+])+0.58(% G+C)+0.12(%
G+C).sup.2-0.35(% formamide)-820/L (III) RNA-RNA:
[0238] where L is the length of the duplex formed, [Na+] is the
molar concentration of the sodium ion in the hybridization or
washing solution, and % G+C is the percentage of (guanine+cytosine)
bases in the hybrid. For imperfectly matched hybrids, approximately
1.degree. C. is required to reduce the melting temperature for each
1% mismatch.
[0239] Hybridization experiments are generally conducted in a
buffer of pH between 6.8 to 7.4, although the rate of hybridization
is nearly independent of pH at ionic strengths likely to be used in
the hybridization buffer (Anderson et al. (1985) supra). In
addition, one or more of the following may be used to reduce
non-specific hybridization: sonicated salmon sperm DNA or another
non-complementary DNA, bovine serum albumin, sodium pyrophosphate,
sodium dodecylsulfate (SDS), polyvinyl-pyrrolidone, ficoll and
Denhardt's solution. Dextran sulfate and polyethylene glycol 6000
act to exclude DNA from solution, thus raising the effective probe
DNA concentration and the hybridization signal within a given unit
of time. In some instances, conditions of even greater stringency
may be desirable or required to reduce non-specific and/or
background hybridization. These conditions may be created with the
use of higher temperature, lower ionic strength and higher
concentration of a denaturing agent such as formamide.
[0240] Stringency conditions can be adjusted to screen for
moderately similar fragments such as homologous sequences from
distantly related organisms, or to highly similar fragments such as
genes that duplicate functional enzymes from closely related
organisms. The stringency can be adjusted either during the
hybridization step or in the post-hybridization washes. Salt
concentration, formamide concentration, hybridization temperature
and probe lengths are variables that can be used to alter
stringency (as described by the formula above). As a general
guidelines high stringency is typically performed at
T.sub.m-5.degree. C. to T.sub.m-20.degree. C., moderate stringency
at T.sub.m-20.degree. C. to T.sub.m-35.degree. C. and low
stringency at T.sub.m-35.degree. C. to T.sub.m-50.degree. C. for
duplex>150 base pairs. Hybridization may be performed at low to
moderate stringency (25-50.degree. C. below T.sub.m), followed by
post-hybridization washes at increasing stringencies. Maximum rates
of hybridization in solution are determined empirically to occur at
T.sub.m-25.degree. C. for DNA-DNA duplex and T.sub.m-15.degree. C.
for RNA-DNA duplex. Optionally, the degree of dissociation may be
assessed after each wash step to determine the need for subsequent,
higher stringency wash steps.
[0241] High stringency conditions may be used to select for nucleic
acid sequences with high degrees of identity to the disclosed
sequences. An example of stringent hybridization conditions
obtained in a filter-based method such as a Southern or northern
blot for hybridization of complementary nucleic acids that have
more than 100 complementary residues is about 5.degree. C. to
20.degree. C. lower than the thermal melting point (T.sub.m) for
the specific sequence at a defined ionic strength and pH.
Conditions used for hybridization may include about 0.02 M to about
0.15 M sodium chloride, about 0.5% to about 5% casein, about 0.02%
SDS or about 0.1% N-laurylsarcosine, about 0.001 M to about 0.03 M
sodium citrate, at hybridization temperatures between about
50.degree. C. and about 70.degree. C. More preferably, high
stringency conditions are about 0.02 M sodium chloride, about 0.5%
casein, about 0.02% SDS, about 0.001 M sodium citrate, at a
temperature of about 50.degree. C. Nucleic acid molecules that
hybridize under stringent conditions will typically hybridize to a
probe based on either the entire DNA molecule or selected portions,
e.g., to a unique subsequence, of the DNA.
[0242] Stringent salt concentration will ordinarily be less than
about 750 mM NaCl and 75 mM trisodium citrate. Increasingly
stringent conditions may be obtained with less than about 500 mM
NaCl and 50 mM trisodium citrate, to even greater stringency with
less than about 250 mM NaCl and 25 mM trisodium citrate. Low
stringency hybridization can be obtained in the absence of organic
solvent, e.g., formamide, whereas high stringency hybridization may
be obtained in the presence of at least about 35% formamide, and
more preferably at least about 50% formamide. Stringent temperature
conditions will ordinarily include temperatures of at least about
30.degree. C., more preferably of at least about 37.degree. C., and
most preferably of at least about 42.degree. C. with formamide
present. Varying additional parameters, such as hybridization time,
the concentration of detergent, e.g., sodium dodecyl sulfate (SDS)
and ionic strength, are well known to those skilled in the art.
Various levels of stringency are accomplished by combining these
various conditions as needed.
[0243] The washing steps that follow hybridization may also vary in
stringency; the post-hybridization wash steps primarily determine
hybridization specificity, with the most critical factors being
temperature and the ionic strength of the final wash solution. Wash
stringency can be increased by decreasing salt concentration or by
increasing temperature. Stringent salt concentration for the wash
steps will preferably be less than about 30 mM NaCl and 3 mM
trisodium citrate, and most preferably less than about 15 mM NaCl
and 1.5 mM trisodium citrate.
[0244] Thus, hybridization and wash conditions that may be used to
bind and remove polynucleotides with less than the desired homology
to the nucleic acid sequences or their complements that encode the
present transcription factors include, for example:
[0245] 6.times.SSC at 65.degree. C.;
[0246] 50% formamide, 4.times.SSC at 42.degree. C.; or
[0247] 0.5.times.SSC, 0.1% SDS at 65.degree. C.;
[0248] with, for example, two wash steps of 10-30 minutes each.
Useful variations on these conditions will be readily apparent to
those skilled in the art.
[0249] A person of skill in the art would not expect substantial
variation among polynucleotide species encompassed within the scope
of the present invention because the highly stringent conditions
set forth in the above formulae yield structurally similar
polynucleotides.
[0250] If desired, one may employ wash steps of even greater
stringency, including about 0.2.times.SSC, 0.1% SDS at 65.degree.
C. and washing twice, each wash step being about 30 min, or about
0.1.times.SSC, 0.1% SDS at 65.degree. C. and washing twice for 30
min. The temperature for the wash solutions will ordinarily be at
least about 25.degree. C., and for greater stringency at least
about 42.degree. C. Hybridization stringency may be increased
further by using the same conditions as in the hybridization steps,
with the wash temperature raised about 3.degree. C. to about
5.degree. C., and stringency may be increased even further by using
the same conditions except the wash temperature is raised about
6.degree. C. to about 9.degree. C. For identification of less
closely related homolog, wash steps may be performed at a lower
temperature, e.g., 50.degree. C.
[0251] An example of a low stringency wash step employs a solution
and conditions of at least 25.degree. C. in 30 mM NaCl, 3 mM
trisodium citrate, and 0.1% SDS over 30 min. Greater stringency may
be obtained at 42.degree. C. in 15 mM NaCl, with 1.5 mM trisodium
citrate, and 0.1% SDS over 30 min Even higher stringency wash
conditions are obtained at 65.degree. C.-68.degree. C. in a
solution of 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS.
Wash procedures will generally employ at least two final wash
steps. Additional variations on these conditions will be readily
apparent to those skilled in the art (see, for example, U.S. Patent
Application No. 20010010913).
[0252] Stringency conditions can be selected such that an
oligonucleotide that is perfectly complementary to the coding
oligonucleotide hybridizes to the coding oligonucleotide with at
least about a 5-10.times. higher signal to noise ratio than the
ratio for hybridization of the perfectly complementary
oligonucleotide to a nucleic acid encoding a transcription factor
known as of the filing date of the application. It may be desirable
to select conditions for a particular assay such that a higher
signal to noise ratio, that is, about 15.times. or more, is
obtained. Accordingly, a subject nucleic acid will hybridize to a
unique coding oligonucleotide with at least a 2.times. or greater
signal to noise ratio as compared to hybridization of the coding
oligonucleotide to a nucleic acid encoding known polypeptide. The
particular signal will depend on the label used in the relevant
assay, e.g., a fluorescent label, a colorimetric label, a
radioactive label, or the like. Labeled hybridization or PCR probes
for detecting related polynucleotide sequences may be produced by
oligolabeling, nick translation, end-labeling, or PCR amplification
using a labeled nucleotide.
Identifying Polynucleotides or Nucleic Acids with Expression
Libraries
[0253] In addition to hybridization methods, transcription factor
homolog polypeptides can be obtained by screening an expression
library using antibodies specific for one or more transcription
factors. With the provision herein of the disclosed transcription
factor, and transcription factor homolog nucleic acid sequences,
the encoded polypeptide(s) can be expressed and purified in a
heterologous expression system (e.g., E. coli) and used to raise
antibodies (monoclonal or polyclonal) specific for the
polypeptide(s) in question. Antibodies can also be raised against
synthetic peptides derived from transcription factor, or
transcription factor homolog, amino acid sequences. Methods of
raising antibodies are well known in the art and are described in
Harlow and Lane (1988), Antibodies: A Laboratory Manual, Cold
Spring Harbor Laboratory, New York. Such antibodies can then be
used to screen an expression library produced from the plant from
which it is desired to clone additional transcription factor
homologs, using the methods described above. The selected cDNAs can
be confirmed by sequencing and enzymatic activity.
[0254] Encompassed by the invention are polynucleotide sequences
that are capable of hybridizing to the claimed polynucleotide
sequences, and, in particular, to those shown in SEQ ID NO: 567,
SEQ ID NO: 943, SEQ ID NO: 945, SEQ ID NO: 947, SEQ ID NO: 1734,
SEQ ID NO: 1874, SEQ ID NO: 1014, SEQ ID NO: 1970, SEQ ID NO: 1972,
SEQ ID NO: 1944, SEQ ID NO: 1946, SEQ ID NO: 1948, SEQ ID NO: 1950,
SEQ ID NO: 1952, SEQ ID NO: 1954, SEQ ID NO: 1956, SEQ ID NO: 1958,
SEQ ID NO: 1960, SEQ ID NO: 1962, SEQ ID NO: 1964, SEQ ID NO: 1966,
SEQ ID NO: 1968, SEQ ID NO: 1970, SEQ ID NO: 1972, and fragments
thereof under various conditions of stringency. (See, e.g., Wahl
and Berger (1987) Methods Enzymol. 152: 399-407; Kimmel (1987)
Methods Enzymol. 152: 507-511.) Estimates of homology are provided
by either DNA-DNA or DNA-RNA hybridization under conditions of
stringency as is well understood by those skilled in the art (Hames
and Higgins, Eds. (1985) Nucleic Acid Hybridisation, IRL Press,
Oxford, U.K.). Stringency conditions can be adjusted to screen for
moderately similar fragments, such as homologous sequences from
distantly related organisms, to highly similar fragments, such as
genes that duplicate functional enzymes from closely related
organisms. Post-hybridization washes determine stringency
conditions.
Sequence Variations
[0255] It will readily be appreciated by those of skill in the art,
that any of a variety of polynucleotide sequences are capable of
encoding the transcription factors and transcription factor homolog
polypeptides of the invention. Due to the degeneracy of the genetic
code, many different polynucleotides can encode identical and/or
substantially similar polypeptides in addition to those sequences
illustrated in the Sequence Listing. Nucleic acids having a
sequence that differs from the sequences shown in the Sequence
Listing, or complementary sequences, that encode functionally
equivalent peptides (i.e., peptides having some degree of
equivalent or similar biological activity) but differ in sequence
from the sequence shown in the Sequence Listing due to degeneracy
in the genetic code, are also within the scope of the
invention.
[0256] Altered polynucleotide sequences encoding polypeptides
include those sequences with deletions, insertions, or
substitutions of different nucleotides, resulting in a
polynucleotide encoding a polypeptide with at least one functional
characteristic of the instant polypeptides. Included within this
definition are polymorphisms which may or may not be readily
detectable using a particular oligonucleotide probe of the
polynucleotide encoding the instant polypeptides, and improper or
unexpected hybridization to allelic variants, with a locus other
than the normal chromosomal locus for the polynucleotide sequence
encoding the instant polypeptides.
[0257] Allelic variant refers to any of two or more alternative
forms of a gene occupying the same chromosomal locus. Allelic
variation arises naturally through mutation, and may result in
phenotypic polymorphism within populations. Gene mutations can be
silent (i.e., no change in the encoded polypeptide) or may encode
polypeptides having altered amino acid sequence. The term allelic
variant is also used herein to denote a protein encoded by an
allelic variant of a gene. Splice variant refers to alternative
forms of RNA transcribed from a gene. Splice variation arises
naturally through use of alternative splicing sites within a
transcribed RNA molecule, or less commonly between separately
transcribed RNA molecules, and may result in several mRNAs
transcribed from the same gene. Splice variants may encode
polypeptides having altered amino acid sequence. The term splice
variant is also used herein to denote a protein encoded by a splice
variant of an mRNA transcribed from a gene.
[0258] Those skilled in the art would recognize that, for example,
G682, SEQ ID NO: 468, represents a single transcription factor;
allelic variation and alternative splicing may be expected to
occur. Allelic variants of SEQ ID NO: 467 can be cloned by probing
cDNA or genomic libraries from different individual organisms
according to standard procedures. Allelic variants of the DNA
sequence shown in SEQ ID NO: 467, including those containing silent
mutations and those in which mutations result in amino acid
sequence changes, are within the scope of the present invention, as
are proteins which are allelic variants of SEQ ID NO: 468. cDNAs
generated from alternatively spliced mRNAs, which retain the
properties of the transcription factor are included within the
scope of the present invention, as are polypeptides encoded by such
cDNAs and mRNAs. Allelic variants and splice variants of these
sequences can be cloned by probing cDNA or genomic libraries from
different individual organisms or tissues according to standard
procedures known in the art (see U.S. Pat. No. 6,388,064).
[0259] Those skilled in the art would recognize that G859, SEQ ID
NOs: 567 and 568, represents a single MAF transcription factor;
allelic variation and alternative splicing may be expected to
occur. Allelic variants of SEQ ID NO: 567 can be cloned by probing
cDNA or genomic libraries from different individual organisms
according to standard procedures. Allelic variants of the DNA
sequence shown in SEQ ID NO: 567, including those containing silent
mutations and those in which mutations result in amino acid
sequence changes, are within the scope of the present invention, as
are proteins which are allelic variants of SEQ ID NO: 568. cDNAs
generated from alternatively spliced mRNAs, which retain the
properties of the MAF transcription factor are included within the
scope of the present invention, as are polypeptides encoded by such
cDNAs and mRNAs. Allelic variants and splice variants of these
sequences can be cloned by probing cDNA or genomic libraries from
different individual organisms or tissues according to standard
procedures known in the art (see U.S. Pat. No. 6,388,064).
[0260] An example of allelic variants or alternatively spliced
variants of SEQ ID NO: 567 (G859) are SEQ ID NO: 1946 (G859.1), SEQ
ID NO: 1944 (G859.3), SEQ ID NO: 1948 (G859.4), and SEQ ID NO: 1950
(G849.5). These variants encode SEQ ID NOs: 1947, 1945, 1949, and
1951, respectively, which are variants of SEQ ID NO: 568.
[0261] Thus, in addition to the sequences set forth in the Sequence
Listing and in Table 4, the invention also encompasses related
nucleic acid molecules that include allelic or splice variants of
SEQ ID NO: 567, SEQ ID NO: 943, SEQ ID NO: 945, SEQ ID NO: 947, SEQ
ID NO: 1734, SEQ ID NO: 1874, SEQ ID NO: 1014, SEQ ID NO: 1970, SEQ
ID NO: 1972, SEQ ID NO: 1944, SEQ ID NO: 1946, SEQ ID NO: 1948, SEQ
ID NO: 1950, SEQ ID NO: 1952, SEQ ID NO: 1954, SEQ ID NO: 1956, SEQ
ID NO: 1958, SEQ ID NO: 1960, SEQ ID NO: 1962, SEQ ID NO: 1964, SEQ
ID NO: 1966, or SEQ ID NO: 1968, and include sequences which are
complementary to any of the above nucleotide sequences. Related
nucleic acid molecules also include nucleotide sequences encoding a
polypeptide comprising or consisting essentially of a substitution,
modification, addition and/or deletion of one or more amino acid
residues compared to the polypeptide as set forth in any of SEQ ID
NO: 568, SEQ ID NO: 944, SEQ ID NO: 946, SEQ ID NO: 948, SEQ ID NO:
1735, SEQ ID NO: 1875, SEQ ID NO: 1971, SEQ ID NO: 1973, SEQ ID NO:
1945, SEQ ID NO: 1947, SEQ ID NO: 1949, SEQ ID NO: 1951, SEQ ID NO:
1953, SEQ ID NO: 1955, SEQ ID NO: 1957, SEQ ID NO: 1959, SEQ ID NO:
1961, SEQ ID NO: 1963, SEQ ID NO: 1965, SEQ ID NO: 1967, or SEQ ID
NO: 1969. Such related polypeptides may comprise, for example,
additions and/or deletions of one or more N-linked or O-linked
glycosylation sites, or an addition and/or a deletion of one or
more cysteine residues.
[0262] Thus, in addition to the transcription factor sequences set
forth in the Sequence Listing, the invention also encompasses
related nucleic acid molecules that include allelic or splice
variants of the transcription factor sequences in the Sequence
Listing, and include sequences that are complementary to any of the
above nucleotide sequences. Related nucleic acid molecules also
include nucleotide sequences encoding a polypeptide comprising or
consisting essentially of a substitution, modification, addition
and/or deletion of one or more amino acid residues compared to the
polypeptide as set forth in any of SEQ ID NO: 2N, wherein N=1-SEQ
ID NO: 2N, wherein N=1-480, SEQ ID NO: 2N-1, where N=857-970, or
SEQ ID NO: 989, 990, 991, 1001, 1002, 1012, 1018, 1021, 1022, 1025,
1027, 1028, 1029, 1034, 1050, 1051, 1072, 1073, 1074, 1075, 1076,
1091, 1092, 1093, 1094, 1095, 1109, 1110, 1111, 1112, 1150, 1165,
1166, 1167, 1168, 1169, 1189, 1190, 1191, 1197, 1198, 1199, 1213,
1214, 1215, 1216, 1226, 1227, 1233, 1239, 1246, 1247, 1258, 1259,
1269, 1307, 1308, 1309, 1310, 1323, 1329, 1330, 1331, 1332, 1338,
1339, 1340, 1361, 1362, 1373, 1374, 1375, 1384, 1389, 1390, 1391,
1396, 1411, 1412, 1413, 1414, 1424, 1435, 1436, 1437, 1448, 1456,
1457, 1458, 1459, 1460, 1472, 1483, 1484, 1500, 1508, 1510, 1511,
1520, 1538, 1539, 1540, 1541, 1542, 1543, 1563, 1564, 1565, 1566,
1567, 1568, 1569, 1582, 1583, 1594, 1611, 1612, 1618, 1619, 1620,
1626, 1627, 1635, 1636, 1640, 1641, 1655, 1656, 1657, 1658, 1672,
1673, 1680, 1682, 1686, 1687, 1688, 1689, 1696, 1702 or 1703. Such
related polypeptides may comprise, for example, additions and/or
deletions of one or more N-linked or O-linked glycosylation sites,
or an addition and/or a deletion of one or more cysteine
residues.
[0263] For example, Table 1 illustrates, e.g., that the codons AGC,
AGT, TCA, TCC, TCG, and TCT all encode the same amino acid: serine.
Accordingly, at each position in the sequence where there is a
codon encoding serine, any of the above trinucleotide sequences can
be used without altering the encoded polypeptide.
TABLE-US-00001 TABLE 1 Amino acid Possible Codons Alanine Ala A GCA
GCC GCG GCU Cysteine Cys C TGC TGT Aspartic acid Asp D GAC GAT
Glutamic acid Glu E GAA GAG Phenylalanine Phe F TTC TTT Glycine Gly
G GGA GGC GGG GGT Histidine His H CAC CAT Isoleucine Ile I ATA ATC
ATT Lysine Lys K AAA AAG Leucine Leu L TTA TTG CTA CTC CTG CTT
Methionine Met M ATG Asparagine Asn N AAC AAT Proline Pro P CCA CCC
CCG CCT Glutamine Gln Q CAA CAG Arginine Arg R AGA AGG CGA CGC CGG
CGT Serine Ser S AGC AGT TCA TCC TCG TCT Threonine Thr T ACA ACC
ACG ACT Valine Val V GTA GTC GTG GTT Tryptophan Trp W TGG Tyrosine
Tyr Y TAC TAT
[0264] Sequence alterations that do not change the amino acid
sequence encoded by the polynucleotide are termed "silent"
variations. With the exception of the codons ATG and TGG, encoding
methionine and tryptophan, respectively, any of the possible codons
for the same amino acid can be substituted by a variety of
techniques, e.g., site-directed mutagenesis, available in the art.
Accordingly, any and all such variations of a sequence selected
from the above table are a feature of the invention.
[0265] In addition to silent variations, other conservative
variations that alter one, or a few amino acids in the encoded
polypeptide, can be made without altering the function of the
polypeptide, these conservative variants are, likewise, a feature
of the invention.
[0266] For example, substitutions, deletions and insertions
introduced into the sequences provided in the Sequence Listing, are
also envisioned by the invention. Such sequence modifications can
be engineered into a sequence by site-directed mutagenesis (Wu
(ed.) Methods Enzymol. (1993) vol. 217, Academic Press) or the
other methods noted below Amino acid substitutions are typically of
single residues; insertions usually will be on the order of about
from 1 to 10 amino acid residues; and deletions will range about
from 1 to 30 residues. In preferred embodiments, deletions or
insertions are made in adjacent pairs, e.g., a deletion of two
residues or insertion of two residues. Substitutions, deletions,
insertions or any combination thereof can be combined to arrive at
a sequence. The mutations that are made in the polynucleotide
encoding the transcription factor should not place the sequence out
of reading frame and should not create complementary regions that
could produce secondary mRNA structure. Preferably, the polypeptide
encoded by the DNA performs the desired function.
[0267] Conservative substitutions are those in which at least one
residue in the amino acid sequence has been removed and a different
residue inserted in its place. Such substitutions generally are
made in accordance with the Table 2 when it is desired to maintain
the activity of the protein. Table 2 shows amino acids which can be
substituted for an amino acid in a protein and which are typically
regarded as conservative substitutions.
TABLE-US-00002 TABLE 2 Conservative Residue Substitutions Ala Ser
Arg Lys Asn Gln; His Asp Glu Gln Asn Cys Ser Glu Asp Gly Pro His
Asn; Gln Ile Leu, Val Leu Ile; Val Lys Arg; Gln Met Leu; Ile Phe
Met; Leu; Tyr Ser Thr; Gly Thr Ser; Val Trp Tyr Tyr Trp; Phe Val
Ile; Leu
[0268] Similar substitutions are those in which at least one
residue in the amino acid sequence has been removed and a different
residue inserted in its place. Such substitutions generally are
made in accordance with the Table 3 when it is desired to maintain
the activity of the protein. Table 3 shows amino acids which can be
substituted for an amino acid in a protein and which are typically
regarded as structural and functional substitutions. For example, a
residue in column 1 of Table 3 may be substituted with a residue in
column 2; in addition, a residue in column 2 of Table 3 may be
substituted with the residue of column 1.
TABLE-US-00003 TABLE 3 Residue Similar Substitutions Ala Ser; Thr;
Gly; Val; Leu; Ile Arg Lys; His; Gly Asn Gln; His; Gly; Ser; Thr
Asp Glu, Ser; Thr Gln Asn; Ala Cys Ser; Gly Glu Asp Gly Pro; Arg
His Asn; Gln; Tyr; Phe; Lys; Arg Ile Ala; Leu; Val; Gly; Met Leu
Ala; Ile; Val; Gly; Met Lys Arg; His; Gln; Gly; Pro Met Leu; Ile;
Phe Phe Met; Leu; Tyr; Trp; His; Val; Ala Ser Thr; Gly; Asp; Ala;
Val; Ile; His Thr Ser; Val; Ala; Gly Trp Tyr; Phe; His Tyr Trp;
Phe; His Val Ala; Ile; Leu; Gly; Thr; Ser; Glu
[0269] Substitutions that are less conservative than those in Table
2 can be selected by picking residues that differ more
significantly in their effect on maintaining (a) the structure of
the polypeptide backbone in the area of the substitution, for
example, as a sheet or helical conformation, (b) the charge or
hydrophobicity of the molecule at the target site, or (c) the bulk
of the side chain. The substitutions which in general are expected
to produce the greatest changes in protein properties will be those
in which (a) a hydrophilic residue, e.g., seryl or threonyl, is
substituted for (or by) a hydrophobic residue, e.g., leucyl,
isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline
is substituted for (or by) any other residue; (c) a residue having
an electropositive side chain, e.g., lysyl, arginyl, or histidyl,
is substituted for (or by) an electronegative residue, e.g.,
glutamyl or aspartyl; or (d) a residue having a bulky side chain,
e.g., phenylalanine, is substituted for (or by) one not having a
side chain, e.g., glycine.
[0270] Further Modifying Sequences of the
Invention--Mutation/Forced Evolution
[0271] In addition to generating silent or conservative
substitutions as noted, above, the present invention optionally
includes methods of modifying the sequences of the Sequence
Listing. In the methods, nucleic acid or protein modification
methods are used to alter the given sequences to produce new
sequences and/or to chemically or enzymatically modify given
sequences to change the properties of the nucleic acids or
proteins.
[0272] Thus, in one embodiment, given nucleic acid sequences are
modified, e.g., according to standard mutagenesis or artificial
evolution methods to produce modified sequences. The modified
sequences may be created using purified natural polynucleotides
isolated from any organism or may be synthesized from purified
compositions and chemicals using chemical means well know to those
of skill in the art. For example, Ausubel, supra, provides
additional details on mutagenesis methods. Artificial forced
evolution methods are described, for example, by Stemmer (1994)
Nature 370: 389-391, Stemmer (1994) Proc. Natl. Acad. Sci. 91:
10747-10751, and U.S. Pat. Nos. 5,811,238, 5,837,500, and
6,242,568. Methods for engineering synthetic transcription factors
and other polypeptides are described, for example, by Zhang et al.
(2000) J. Biol. Chem. 275: 33850-33860, Liu et al. (2001) J. Biol.
Chem. 276: 11323-11334, and Isalan et al. (2001) Nature Biotechnol.
19: 656-660. Many other mutation and evolution methods are also
available and expected to be within the skill of the
practitioner.
[0273] Similarly, chemical or enzymatic alteration of expressed
nucleic acids and polypeptides can be performed by standard
methods. For example, sequence can be modified by addition of
lipids, sugars, peptides, organic or inorganic compounds, by the
inclusion of modified nucleotides or amino acids, or the like. For
example, protein modification techniques are illustrated in
Ausubel, supra. Further details on chemical and enzymatic
modifications can be found herein. These modification methods can
be used to modify any given sequence, or to modify any sequence
produced by the various mutation and artificial evolution
modification methods noted herein.
[0274] Accordingly, the invention provides for modification of any
given nucleic acid by mutation, evolution, chemical or enzymatic
modification, or other available methods, as well as for the
products produced by practicing such methods, e.g., using the
sequences herein as a starting substrate for the various
modification approaches.
[0275] For example, optimized coding sequence containing codons
preferred by a particular prokaryotic or eukaryotic host can be
used e.g., to increase the rate of translation or to produce
recombinant RNA transcripts having desirable properties, such as a
longer half-life, as compared with transcripts produced using a
non-optimized sequence. Translation stop codons can also be
modified to reflect host preference. For example, preferred stop
codons for Saccharomyces cerevisiae and mammals are TAA and TGA,
respectively. The preferred stop codon for monocotyledonous plants
is TGA, whereas insects and E. coli prefer to use TAA as the stop
codon.
[0276] The polynucleotide sequences of the present invention can
also be engineered in order to alter a coding sequence for a
variety of reasons, including but not limited to, alterations which
modify the sequence to facilitate cloning, processing and/or
expression of the gene product. For example, alterations are
optionally introduced using techniques which are well known in the
art, e.g., site-directed mutagenesis, to insert new restriction
sites, to alter glycosylation patterns, to change codon preference,
to introduce splice sites, etc.
[0277] Furthermore, a fragment or domain derived from any of the
polypeptides of the invention can be combined with domains derived
from other transcription factors or synthetic domains to modify the
biological activity of a transcription factor. For instance, a
DNA-binding domain derived from a transcription factor of the
invention can be combined with the activation domain of another
transcription factor or with a synthetic activation domain. A
transcription activation domain assists in initiating transcription
from a DNA-binding site. Examples include the transcription
activation region of VP16 or GAL4 (Moore et al. (1998) Proc. Natl.
Acad. Sci. 95: 376-381; Aoyama et al. (1995) Plant Cell 7:
1773-1785), peptides derived from bacterial sequences (Ma and
Ptashne (1987) Cell 51: 113-119) and synthetic peptides (Giniger
and Ptashne (1987) Nature 330: 670-672).
[0278] Expression and Modification of Polypeptides
[0279] Typically, polynucleotide sequences of the invention are
incorporated into recombinant DNA (or RNA) molecules that direct
expression of polypeptides of the invention in appropriate host
cells, transgenic plants, in vitro translation systems, or the
like. Due to the inherent degeneracy of the genetic code, nucleic
acid sequences which encode substantially the same or a
functionally equivalent amino acid sequence can be substituted for
any listed sequence to provide for cloning and expressing the
relevant homolog.
[0280] The transgenic plants of the present invention comprising
recombinant polynucleotide sequences are generally derived from
parental plants, which may themselves be non-transformed (or
non-transgenic) plants. These transgenic plants may either have a
transcription factor gene "knocked out" (for example, with a
genomic insertion by homologous recombination, an antisense or
ribozyme construct) or expressed to a normal or wild-type extent.
However, overexpressing transgenic "progeny" plants will exhibit
greater mRNA levels, wherein the mRNA encodes a transcription
factor, that is, a DNA-binding protein that is capable of binding
to a DNA regulatory sequence and inducing transcription, and
preferably, expression of a plant trait gene. Preferably, the mRNA
expression level will be at least three-fold greater than that of
the parental plant, or more preferably at least ten-fold greater
mRNA levels compared to said parental plant, and most preferably at
least fifty-fold greater compared to said parental plant.
[0281] Vectors, Promoters, and Expression Systems
[0282] The present invention includes recombinant constructs
comprising one or more of the nucleic acid sequences herein. The
constructs typically comprise a vector, such as a plasmid, a
cosmid, a phage, a virus (e.g., a plant virus), a bacterial
artificial chromosome (BAC), a yeast artificial chromosome (YAC),
or the like, into which a nucleic acid sequence of the invention
has been inserted, in a forward or reverse orientation. In a
preferred aspect of this embodiment, the construct further
comprises regulatory sequences, including, for example, a promoter,
operably linked to the sequence. Large numbers of suitable vectors
and promoters are known to those of skill in the art, and are
commercially available.
[0283] General texts that describe molecular biological techniques
useful herein, including the use and production of vectors,
promoters and many other relevant topics, include Berger, Sambrook,
supra and Ausubel, supra. Any of the identified sequences can be
incorporated into a cassette or vector, e.g., for expression in
plants. A number of expression vectors suitable for stable
transformation of plant cells or for the establishment of
transgenic plants have been described including those described in
Weissbach and Weissbach (1989) Methods for Plant Molecular Biology,
Academic Press, and Gelvin et al. (1990) Plant Molecular Biology
Manual, Kluwer Academic Publishers. Specific examples include those
derived from a Ti plasmid of Agrobacterium tumefaciens, as well as
those disclosed by Herrera-Estrella et al. (1983) Nature 303: 209,
Bevan (1984) Nucleic Acids Res. 12: 8711-8721, Klee (1985)
Bio/Technology 3: 637-642, for dicotyledonous plants.
[0284] Alternatively, non-Ti vectors can be used to transfer the
DNA into monocotyledonous plants and cells by using free DNA
delivery techniques. Such methods can involve, for example, the use
of liposomes, electroporation, microprojectile bombardment, silicon
carbide whiskers, and viruses. By using these methods transgenic
plants such as wheat, rice (Christou (1991) Bio/Technology 9:
957-962) and corn (Gordon-Kamm (1990) Plant Cell 2: 603-618) can be
produced. An immature embryo can also be a good target tissue for
monocots for direct DNA delivery techniques by using the particle
gun (Weeks et al. (1993) Plant Physiol. 102: 1077-1084; Vasil
(1993) Bio/Technology 10: 667-674; Wan and Lemeaux (1994) Plant
Physiol. 104: 37-48, and for Agrobacterium-mediated DNA transfer
(Ishida et al. (1996) Nature Biotechnol. 14: 745-750).
[0285] Typically, plant transformation vectors include one or more
cloned plant coding sequence (genomic or cDNA) under the
transcriptional control of 5' and 3' regulatory sequences and a
dominant selectable marker. Such plant transformation vectors
typically also contain a promoter (e.g., a regulatory region
controlling inducible or constitutive, environmentally- or
developmentally-regulated, or cell- or tissue-specific expression),
a transcription initiation start site, an RNA processing signal
(such as intron splice sites), a transcription termination site,
and/or a polyadenylation signal.
[0286] A potential utility for the transcription factor
polynucleotides disclosed herein is the isolation of promoter
elements from these genes that can be used to program expression in
plants of any genes. Each transcription factor gene disclosed
herein is expressed in a unique fashion, as determined by promoter
elements located upstream of the start of translation, and
additionally within an intron of the transcription factor gene or
downstream of the termination codon of the gene. As is well known
in the art, for a significant portion of genes, the promoter
sequences are located entirely in the region directly upstream of
the start of translation. In such cases, typically the promoter
sequences are located within 2.0 kb of the start of translation, or
within 1.5 kb of the start of translation, frequently within 1.0 kb
of the start of translation, and sometimes within 0.5 kb of the
start of translation.
[0287] The promoter sequences can be isolated according to methods
known to one skilled in the art.
[0288] Examples of constitutive plant promoters which can be useful
for expressing the TF sequence include: the cauliflower mosaic
virus (CaMV) 35S promoter, which confers constitutive, high-level
expression in most plant tissues (see, e.g., Odell et al. (1985)
Nature 313: 810-812); the nopaline synthase promoter (An et al.
(1988) Plant Physiol. 88: 547-552); and the octopine synthase
promoter (Fromm et al. (1989) Plant Cell 1: 977-984).
[0289] A variety of plant gene promoters that regulate gene
expression in response to environmental, hormonal, chemical,
developmental signals, and in a tissue-active manner can be used
for expression of a TF sequence in plants. Choice of a promoter is
based largely on the phenotype of interest and is determined by
such factors as tissue (e.g., seed, fruit, root, pollen, vascular
tissue, flower, carpel, etc.), inducibility (e.g., in response to
wounding, heat, cold, drought, light, pathogens, etc), timing,
developmental stage, and the like. Numerous known promoters have
been characterized and can favorably be employed to promote
expression of a polynucleotide of the invention in a transgenic
plant or cell of interest. For example, tissue specific promoters
include: seed-specific promoters (such as the napin, phaseolin or
DC3 promoter described in U.S. Pat. No. 5,773,697), fruit-specific
promoters that are active during fruit ripening (such as the dru 1
promoter (U.S. Pat. No. 5,783,393), or the 2A11 promoter (U.S. Pat.
No. 4,943,674) and the tomato polygalacturonase promoter (Bird et
al. (1988) Plant Mol. Biol. 11: 651-662), root-specific promoters,
such as those disclosed in U.S. Pat. Nos. 5,618,988, 5,837,848 and
5,905,186, pollen-active promoters such as PTA29, PTA26 and PTA13
(U.S. Pat. No. 5,792,929), promoters active in vascular tissue
(Ringli and Keller (1998) Plant Mol. Biol. 37: 977-988),
flower-specific (Kaiser et al. (1995) Plant Mol. Biol. 28:
231-243), pollen (Baerson et al. (1994) Plant Mol. Biol. 26:
1947-1959), carpels (Ohl et al. (1990) Plant Cell 2: 837-848),
pollen and ovules (Baerson et al. (1993) Plant Mol. Biol. 22:
255-267), auxin-inducible promoters (such as that described in van
der Kop et al. (1999) Plant Mol. Biol. 39: 979-990 or Baumann et
al. (1999) Plant Cell 11: 323-334), cytokinin-inducible promoter
(Guevara-Garcia (1998) Plant Mol. Biol. 38: 743-753), promoters
responsive to gibberellin (Shi et al. (1998) Plant Mol. Biol. 38:
1053-1060, Willmott et al. (1998) 38: 817-825) and the like.
Additional promoters are those that elicit expression in response
to heat (Ainley et al. (1993) Plant Mol. Biol. 22: 13-23), light
(e.g., the pea rbcS-3A promoter, Kuhlemeier et al. (1989) Plant
Cell 1: 471-478, and the maize rbcS promoter, Schaffner and Sheen
(1991) Plant Cell 3: 997-1012); wounding (e.g., wunI, Siebertz et
al. (1989) Plant Cell 1: 961-968); pathogens (such as the PR-1
promoter described in Buchel et al. (1999) Plant Mol. Biol. 40:
387-396, and the PDF1.2 promoter described in Manners et al. (1998)
Plant Mol. Biol. 38: 1071-1080), and chemicals such as methyl
jasmonate or salicylic acid (Gatz (1997) Annu. Rev. Plant Physiol.
Plant Mol. Biol. 48: 89-108). In addition, the timing of the
expression can be controlled by using promoters such as those
acting at senescence (Gan and Amasino (1995) Science 270:
1986-1988); or late seed development (Odell et al. (1994) Plant
Physiol. 106: 447-458).
[0290] Plant expression vectors can also include RNA processing
signals that can be positioned within, upstream or downstream of
the coding sequence. In addition, the expression vectors can
include additional regulatory sequences from the 3'-untranslated
region of plant genes, e.g., a 3' terminator region to increase
mRNA stability of the mRNA, such as the PI-II terminator region of
potato or the octopine or nopaline synthase 3' terminator
regions.
Additional Expression Elements
[0291] Specific initiation signals can aid in efficient translation
of coding sequences. These signals can include, e.g., the ATG
initiation codon and adjacent sequences. In cases where a coding
sequence, its initiation codon and upstream sequences are inserted
into the appropriate expression vector, no additional translational
control signals may be needed. However, in cases where only coding
sequence (e.g., a mature protein coding sequence), or a portion
thereof, is inserted, exogenous transcriptional control signals
including the ATG initiation codon can be separately provided. The
initiation codon is provided in the correct reading frame to
facilitate transcription. Exogenous transcriptional elements and
initiation codons can be of various origins, both natural and
synthetic. The efficiency of expression can be enhanced by the
inclusion of enhancers appropriate to the cell system in use.
Expression Hosts
[0292] The present invention also relates to host cells which are
transduced with vectors of the invention, and the production of
polypeptides of the invention (including fragments thereof) by
recombinant techniques. Host cells are genetically engineered
(i.e., nucleic acids are introduced, e.g., transduced, transformed
or transfected) with the vectors of this invention, which may be,
for example, a cloning vector or an expression vector comprising
the relevant nucleic acids herein. The vector is optionally a
plasmid, a viral particle, a phage, a naked nucleic acid, etc. The
engineered host cells can be cultured in conventional nutrient
media modified as appropriate for activating promoters, selecting
transformants, or amplifying the relevant gene. The culture
conditions, such as temperature, pH and the like, are those
previously used with the host cell selected for expression, and
will be apparent to those skilled in the art and in the references
cited herein, including, Sambrook, supra and Ausubel, supra.
[0293] The host cell can be a eukaryotic cell, such as a yeast
cell, or a plant cell, or the host cell can be a prokaryotic cell,
such as a bacterial cell. Plant protoplasts are also suitable for
some applications. For example, the DNA fragments are introduced
into plant tissues, cultured plant cells or plant protoplasts by
standard methods including electroporation (Fromm et al. (1985)
Proc. Natl. Acad. Sci. 82: 5824-5828, infection by viral vectors
such as cauliflower mosaic virus (CaMV) (Hohn et al. (1982)
Molecular Biology of Plant Tumors Academic Press, New York, N.Y.,
pp. 549-560; U.S. Pat. No. 4,407,956), high velocity ballistic
penetration by small particles with the nucleic acid either within
the matrix of small beads or particles, or on the surface (Klein et
al. (1987) Nature 327: 70-73), use of pollen as vector (WO
85/01856), or use of Agrobacterium tumefaciens or A. rhizogenes
carrying a T-DNA plasmid in which DNA fragments are cloned. The
T-DNA plasmid is transmitted to plant cells upon infection by
Agrobacterium tumefaciens, and a portion is stably integrated into
the plant genome (Horsch et al. (1984) Science 233: 496-498; Fraley
et al. (1983) Proc. Natl. Acad. Sci. 80: 4803-4807).
[0294] The cell can include a nucleic acid of the invention that
encodes a polypeptide, wherein the cell expresses a polypeptide of
the invention. The cell can also include vector sequences, or the
like. Furthermore, cells and transgenic plants that include any
polypeptide or nucleic acid above or throughout this specification,
e.g., produced by transduction of a vector of the invention, are an
additional feature of the invention.
[0295] For long-term, high-yield production of recombinant
proteins, stable expression can be used. Host cells transformed
with a nucleotide sequence encoding a polypeptide of the invention
are optionally cultured under conditions suitable for the
expression and recovery of the encoded protein from cell culture.
The protein or fragment thereof produced by a recombinant cell may
be secreted, membrane-bound, or contained intracellularly,
depending on the sequence and/or the vector used. As will be
understood by those of skill in the art, expression vectors
containing polynucleotides encoding mature proteins of the
invention can be designed with signal sequences which direct
secretion of the mature polypeptides through a prokaryotic or
eukaryotic cell membrane.
Modified Amino Acid Residues
[0296] Polypeptides of the invention may contain one or more
modified amino acid residues. The presence of modified amino acids
may be advantageous in, for example, increasing polypeptide
half-life, reducing polypeptide antigenicity or toxicity,
increasing polypeptide storage stability, or the like Amino acid
residue(s) are modified, for example, co-translationally or
post-translationally during recombinant production or modified by
synthetic or chemical means.
[0297] Non-limiting examples of a modified amino acid residue
include incorporation or other use of acetylated amino acids,
glycosylated amino acids, sulfated amino acids, prenylated (e.g.,
farnesylated, geranylgeranylated) amino acids, PEG modified (e.g.,
"PEGylated") amino acids, biotinylated amino acids, carboxylated
amino acids, phosphorylated amino acids, etc. References adequate
to guide one of skill in the modification of amino acid residues
are replete throughout the literature.
[0298] The modified amino acid residues may prevent or increase
affinity of the polypeptide for another molecule, including, but
not limited to, polynucleotide, proteins, carbohydrates, lipids and
lipid derivatives, and other organic or synthetic compounds.
Identification of Additional Factors
[0299] A transcription factor provided by the present invention can
also be used to identify additional endogenous or exogenous
molecules that can affect a phentoype or trait of interest. On the
one hand, such molecules include organic (small or large molecules)
and/or inorganic compounds that affect expression of (i.e.,
regulate) a particular transcription factor. Alternatively, such
molecules include endogenous molecules that are acted upon either
at a transcriptional level by a transcription factor of the
invention to modify a phenotype as desired. For example, the
transcription factors can be employed to identify one or more
downstream genes that are subject to a regulatory effect of the
transcription factor. In one approach, a transcription factor or
transcription factor homolog of the invention is expressed in a
host cell, e.g., a transgenic plant cell, tissue or explant, and
expression products, either RNA or protein, of likely or random
targets are monitored, e.g., by hybridization to a microarray of
nucleic acid probes corresponding to genes expressed in a tissue or
cell type of interest, by two-dimensional gel electrophoresis of
protein products, or by any other method known in the art for
assessing expression of gene products at the level of RNA or
protein. Alternatively, a transcription factor of the invention can
be used to identify promoter sequences (such as binding sites on
DNA sequences) involved in the regulation of a downstream target.
After identifying a promoter sequence, interactions between the
transcription factor and the promoter sequence can be modified by
changing specific nucleotides in the promoter sequence or specific
amino acids in the transcription factor that interact with the
promoter sequence to alter a plant trait. Typically, transcription
factor DNA-binding sites are identified by gel shift assays. After
identifying the promoter regions, the promoter region sequences can
be employed in double-stranded DNA arrays to identify molecules
that affect the interactions of the transcription factors with
their promoters (Bulyk et al. (1999) Nature Biotechnol. 17:
573-577).
[0300] The identified transcription factors are also useful to
identify proteins that modify the activity of the transcription
factor. Such modification can occur by covalent modification, such
as by phosphorylation, or by protein-protein (homo or
-heteropolymer) interactions. Any method suitable for detecting
protein-protein interactions can be employed. Among the methods
that can be employed are co-immunoprecipitation, cross-linking and
co-purification through gradients or chromatographic columns, and
the two-hybrid yeast system.
[0301] The two-hybrid system detects protein interactions in vivo
and is described in Chien et al. (1991) Proc. Natl. Acad. Sci. 88:
9578-9582, and is commercially available from Clontech (Palo Alto,
Calif.). In such a system, plasmids are constructed that encode two
hybrid proteins: one consists of the DNA-binding domain of a
transcription activator protein fused to the TF polypeptide and the
other consists of the transcription activator protein's activation
domain fused to an unknown protein that is encoded by a cDNA that
has been recombined into the plasmid as part of a cDNA library. The
DNA-binding domain fusion plasmid and the cDNA library are
transformed into a strain of the yeast Saccharomyces cerevisiae
that contains a reporter gene (e.g., lacZ) whose regulatory region
contains the transcription activator's binding site. Either hybrid
protein alone cannot activate transcription of the reporter gene.
Interaction of the two hybrid proteins reconstitutes the functional
activator protein and results in expression of the reporter gene,
which is detected by an assay for the reporter gene product. Then,
the library plasmids responsible for reporter gene expression are
isolated and sequenced to identify the proteins encoded by the
library plasmids. After identifying proteins that interact with the
transcription factors, assays for compounds that interfere with the
TF protein-protein interactions can be preformed.
Identification of Modulators
[0302] In addition to the intracellular molecules described above,
extracellular molecules that alter activity or expression of a
transcription factor, either directly or indirectly, can be
identified. For example, the methods can entail first placing a
candidate molecule in contact with a plant or plant cell. The
molecule can be introduced by topical administration, such as
spraying or soaking of a plant, or incubating a plant in a solution
containing the molecule, and then the molecule's effect on the
expression or activity of the TF polypeptide or the expression of
the polynucleotide monitored. Changes in the expression of the TF
polypeptide can be monitored by use of polyclonal or monoclonal
antibodies, gel electrophoresis or the like. Changes in the
expression of the corresponding polynucleotide sequence can be
detected by use of microarrays, Northerns, quantitative PCR, or any
other technique for monitoring changes in mRNA expression. These
techniques are exemplified in Ausubel et al. (eds.) Current
Protocols in Molecular Biology, John Wiley & Sons (1998, and
supplements through 2001). Changes in the activity of the
transcription factor can be monitored, directly or indirectly, by
assaying the function of the transcription factor, for example, by
measuring the expression of promoters known to be controlled by the
transcription factor (using promoter-reporter constructs),
measuring the levels of transcripts using microarrays, Northern
blots, quantitative PCR, etc. Such changes in the expression levels
can be correlated with modified plant traits and thus identified
molecules can be useful for soaking or spraying on fruit, vegetable
and grain crops to modify traits in plants.
[0303] Essentially any available composition can be tested for
modulatory activity of expression or activity of any nucleic acid
or polypeptide herein. Thus, available libraries of compounds such
as chemicals, polypeptides, nucleic acids and the like can be
tested for modulatory activity. Often, potential modulator
compounds can be dissolved in aqueous or organic (e.g., DMSO-based)
solutions for easy delivery to the cell or plant of interest in
which the activity of the modulator is to be tested. Optionally,
the assays are designed to screen large modulator composition
libraries by automating the assay steps and providing compounds
from any convenient source to assays, which are typically run in
parallel (e.g., in microtiter formats on microplates in robotic
assays).
[0304] In one embodiment, high throughput screening methods involve
providing a combinatorial library containing a large number of
potential compounds (potential modulator compounds). Such
"combinatorial chemical libraries" are then screened in one or more
assays, as described herein, to identify those library members
(particular chemical species or subclasses) that display a desired
characteristic activity. The compounds thus identified can serve as
target compounds.
[0305] A combinatorial chemical library can be, e.g., a collection
of diverse chemical compounds generated by chemical synthesis or
biological synthesis. For example, a combinatorial chemical library
such as a polypeptide library is formed by combining a set of
chemical building blocks (e.g., in one example, amino acids) in
every possible way for a given compound length (i.e., the number of
amino acids in a polypeptide compound of a set length). Exemplary
libraries include peptide libraries, nucleic acid libraries,
antibody libraries (see, e.g., Vaughn et al. (1996) Nature
Biotechnol. 14: 309-314 and PCT/US96/10287), carbohydrate libraries
(see, e.g., Liang et al. Science (1996) 274: 1520-1522 and U.S.
Pat. No. 5,593,853), peptide nucleic acid libraries (see, e.g.,
U.S. Pat. No. 5,539,083), and small organic molecule libraries
(see, e.g., benzodiazepines, in Baum Chem. & Engineering News
Jan. 18, 1993, page 33; isoprenoids, U.S. Pat. No. 5,569,588;
thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974;
pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino
compounds, U.S. Pat. No. 5,506,337) and the like.
[0306] Preparation and screening of combinatorial or other
libraries is well known to those of skill in the art. Such
combinatorial chemical libraries include, but are not limited to,
peptide libraries (see, e.g., U.S. Pat. No. 5,010,175; Furka,
(1991) Int. J. Pept. Prot. Res. 37: 487-493; and Houghton et al.
(1991) Nature 354: 84-88). Other chemistries for generating
chemical diversity libraries can also be used.
[0307] In addition, as noted, compound screening equipment for
high-throughput screening is generally available, e.g., using any
of a number of well known robotic systems that have also been
developed for solution phase chemistries useful in assay systems.
These systems include automated workstations including an automated
synthesis apparatus and robotic systems utilizing robotic arms. Any
of the above devices are suitable for use with the present
invention, e.g., for high-throughput screening of potential
modulators. The nature and implementation of modifications to these
devices (if any) so that they can operate as discussed herein will
be apparent to persons skilled in the relevant art.
[0308] Indeed, entire high-throughput screening systems are
commercially available. These systems typically automate entire
procedures including all sample and reagent pipetting, liquid
dispensing, timed incubations, and final readings of the microplate
in detector(s) appropriate for the assay. These configurable
systems provide high throughput and rapid start up as well as a
high degree of flexibility and customization. Similarly,
microfluidic implementations of screening are also commercially
available.
[0309] The manufacturers of such systems provide detailed protocols
the various high throughput. Thus, for example, Zymark Corp.
provides technical bulletins describing screening systems for
detecting the modulation of gene transcription, ligand binding, and
the like. The integrated systems herein, in addition to providing
for sequence alignment and, optionally, synthesis of relevant
nucleic acids, can include such screening apparatus to identify
modulators that have an effect on one or more polynucleotides or
polypeptides according to the present invention.
[0310] In some assays it is desirable to have positive controls to
ensure that the components of the assays are working properly. At
least two types of positive controls are appropriate. That is,
known transcriptional activators or inhibitors can be incubated
with cells or plants, for example, in one sample of the assay, and
the resulting increase/decrease in transcription can be detected by
measuring the resulting increase in RNA levels and/or protein
expression, for example, according to the methods herein. It will
be appreciated that modulators can also be combined with
transcriptional activators or inhibitors to find modulators that
inhibit transcriptional activation or transcriptional repression.
Either expression of the nucleic acids and proteins herein or any
additional nucleic acids or proteins activated by the nucleic acids
or proteins herein, or both, can be monitored.
[0311] In an embodiment, the invention provides a method for
identifying compositions that modulate the activity or expression
of a polynucleotide or polypeptide of the invention. For example, a
test compound, whether a small or large molecule, is placed in
contact with a cell, plant (or plant tissue or explant), or
composition comprising the polynucleotide or polypeptide of
interest and a resulting effect on the cell, plant, (or tissue or
explant) or composition is evaluated by monitoring, either directly
or indirectly, one or more of: expression level of the
polynucleotide or polypeptide, activity (or modulation of the
activity) of the polynucleotide or polypeptide. In some cases, an
alteration in a plant phenotype can be detected following contact
of a plant (or plant cell, or tissue or explant) with the putative
modulator, e.g., by modulation of expression or activity of a
polynucleotide or polypeptide of the invention. Modulation of
expression or activity of a polynucleotide or polypeptide of the
invention may also be caused by molecular elements in a signal
transduction second messenger pathway and such modulation can
affect similar elements in the same or another signal transduction
second messenger pathway.
Subsequences
[0312] Also contemplated are uses of polynucleotides, also referred
to herein as oligonucleotides, typically having at least 12 bases,
preferably at least 15, more preferably at least 20, 30, or 50
bases, which hybridize under at least highly stringent (or
ultra-high stringent or ultra-ultra-high stringent conditions)
conditions to a polynucleotide sequence described above. The
polynucleotides may be used as probes, primers, sense and antisense
agents, and the like, according to methods as noted supra.
[0313] Subsequences of the polynucleotides of the invention,
including polynucleotide fragments and oligonucleotides are useful
as nucleic acid probes and primers. An oligonucleotide suitable for
use as a probe or primer is at least about 15 nucleotides in
length, more often at least about 18 nucleotides, often at least
about 21 nucleotides, frequently at least about 30 nucleotides, or
about 40 nucleotides, or more in length. A nucleic acid probe is
useful in hybridization protocols, e.g., to identify additional
polypeptide homologs of the invention, including protocols for
microarray experiments. Primers can be annealed to a complementary
target DNA strand by nucleic acid hybridization to form a hybrid
between the primer and the target DNA strand, and then extended
along the target DNA strand by a DNA polymerase enzyme. Primer
pairs can be used for amplification of a nucleic acid sequence,
e.g., by the polymerase chain reaction (PCR) or other nucleic-acid
amplification methods. See Sambrook, supra, and Ausubel, supra.
[0314] In addition, the invention includes an isolated or
recombinant polypeptide including a subsequence of at least about
15 contiguous amino acids encoded by the recombinant or isolated
polynucleotides of the invention. For example, such polypeptides,
or domains or fragments thereof, can be used as immunogens, e.g.,
to produce antibodies specific for the polypeptide sequence, or as
probes for detecting a sequence of interest. A subsequence can
range in size from about 15 amino acids in length up to and
including the full length of the polypeptide.
[0315] To be encompassed by the present invention, an expressed
polypeptide which comprises such a polypeptide subsequence performs
at least one biological function of the intact polypeptide in
substantially the same manner, or to a similar extent, as does the
intact polypeptide. For example, a polypeptide fragment can
comprise a recognizable structural motif or functional domain such
as a DNA binding domain that activates transcription, e.g., by
binding to a specific DNA promoter region an activation domain, or
a domain for protein-protein interactions.
Production of Transgenic Plants
Modification of Traits
[0316] The polynucleotides of the invention are favorably employed
to produce transgenic plants with various traits, or
characteristics, that have been modified in a desirable manner,
e.g., to improve the seed characteristics of a plant. For example,
alteration of expression levels or patterns (e.g., spatial or
temporal expression patterns) of one or more of the transcription
factors (or transcription factor homologs) of the invention, as
compared with the levels of the same protein found in a wild-type
plant, can be used to modify a plant's traits. An illustrative
example of trait modification, improved characteristics, by
altering expression levels of a particular transcription factor is
described further in the Examples and the Sequence Listing.
Arabidopsis as a Model System
[0317] Arabidopsis thaliana is the object of rapidly growing
attention as a model for genetics and metabolism in plants.
Arabidopsis has a small genome, and well-documented studies are
available. It is easy to grow in large numbers and mutants defining
important genetically controlled mechanisms are either available,
or can readily be obtained. Various methods to introduce and
express isolated homologous genes are available (see Koncz et al.
eds., et al. Methods in Arabidopsis Research (1992) et al. World
Scientific, New Jersey, N.J., in "Preface"). Because of its small
size, short life cycle, obligate autogamy and high fertility,
Arabidopsis is also a choice organism for the isolation of mutants
and studies in morphogenetic and development pathways, and control
of these pathways by transcription factors (Koncz supra, p. 72). A
number of studies introducing transcription factors into A.
thaliana have demonstrated the utility of this plant for
understanding the mechanisms of gene regulation and trait
alteration in plants. (See, for example, Koncz supra, and U.S. Pat.
No. 6,417,428).
Arabidopsis Genes in Transgenic Plants.
[0318] Expression of genes which encode transcription factors
modify expression of endogenous genes, polynucleotides, and
proteins are well known in the art. In addition, transgenic plants
comprising isolated polynucleotides encoding transcription factors
may also modify expression of endogenous genes, polynucleotides,
and proteins. Examples include Peng et al. (1997) et al. Genes and
Development 11: 3194-3205, and Peng et al. (1999) Nature 400:
256-261. In addition, many others have demonstrated that an
Arabidopsis transcription factor expressed in an exogenous plant
species elicits the same or very similar phenotypic response. See,
for example, Fu et al. (2001) Plant Cell 13: 1791-1802; Nandi et
al. (2000) Curr. Biol. 10: 215-218; Coupland (1995) Nature 377:
482-483; and Weigel and Nilsson (1995) Nature 377: 482-500.
Homologous Genes Introduced into Transgenic Plants.
[0319] Homologous genes that may be derived from any plant, or from
any source whether natural, synthetic, semi-synthetic or
recombinant, and that share significant sequence identity or
similarity to those provided by the present invention, may be
introduced into plants, for example, crop plants, to confer
desirable or improved traits. Consequently, transgenic plants may
be produced that comprise a recombinant expression vector or
cassette with a promoter operably linked to one or more sequences
homologous to presently disclosed sequences. The promoter may be,
for example, a plant or viral promoter.
[0320] The invention thus provides for methods for preparing
transgenic plants, and for modifying plant traits. These methods
include introducing into a plant a recombinant expression vector or
cassette comprising a functional promoter operably linked to one or
more sequences homologous to presently disclosed sequences. Plants
and kits for producing these plants that result from the
application of these methods are also encompassed by the present
invention.
[0321] Transcription Factors of Interest for the Modification of
Plant Traits
[0322] Currently, the existence of a series of maturity groups for
different latitudes represents a major barrier to the introduction
of new valuable traits. Any trait (e.g. disease resistance) has to
be bred into each of the different maturity groups separately, a
laborious and costly exercise. The availability of single strain,
which could be grown at any latitude, would therefore greatly
increase the potential for introducing new traits to crop species
such as soybean and cotton.
[0323] For many of the specific effects, traits and utilities
listed in Table 4 and Table 6 that may be conferred to plants, one
or more transcription factor genes may be used to increase or
decrease, advance or delay, or improve or prove deleterious to a
given trait. Overexpressing or suppressing one or more genes can
impart significant differences in production of plant products,
such as different fatty acid ratios. For example, overexpression of
G720 caused a plant to become more freezing tolerant, but knocking
out the same transcription factor imparted greater susceptibility
to freezing. Thus, suppressing a gene that causes a plant to be
more sensitive to cold may improve a plant's tolerance of cold.
More than one transcription factor gene may be introduced into a
plant, either by transforming the plant with one or more vectors
comprising two or more transcription factors, or by selective
breeding of plants to yield hybrid crosses that comprise more than
one introduced transcription factor.
[0324] A listing of specific effects and utilities that the
presently disclosed transcription factor genes have on plants, as
determined by direct observation and assay analysis, is provided in
Table 4. Table 4 shows the polynucleotides identified by SEQ ID NO;
Mendel Gene ID No. (GID); and if the polynucleotide was tested in a
transgenic assay. The first column shows the polynucleotide SEQ ID
NO; the second column shows the GID; the third column shows whether
the gene was overexpressed (OE) or knocked out (KO) in plant
studies; the fourth column shows the trait(s) resulting from the
knock out or overexpression of the polynucleotide in the transgenic
plant; the fifth column shows the category of the trait; and the
sixth column ("Comment"), includes specific observations made with
respect to the polynucleotide of the first column.
TABLE-US-00004 TABLE 4 Traits, trait categories, and effects and
utilities that transcription factor genes have on plants. SEQ ID
NO: GID No. OE/KO Trait(s) Category Observations 1 G3 OE Size Dev
and morph Small plant OE Heat Abiotic stress More sensitive to heat
in a growth assay 5 G5 OE Size Dev and morph Small plant 11 G8 OE
Flowering time Flowering time Late flowering 13 G9 OE Root Dev and
morph Increased root mass 21 G19 OE Erysiphe Disease Increased
tolerance to Erysiphe Hormone sensitivity Hormone sensitivity
Repressed by methyl jasmonate and induced by ACC 23 G20 OE Seed
sterols Seed biochemistry Increase in campesterol 25 G21 OE Size
Dev and morph Reduced size 27 G22 OE Sodium chloride Abiotic stress
Increased tolerance to high salt 29 G24 OE Morphology: other Dev
and morph Reduced size OE Necrosis Dev and morph Necrotic patches
31 G25 OE Trichome Dev and morph Fewer trichomes at seedling stage
OE Fusarium Disease Expression induced by Fusarium infection 33 G26
OE Sugar sensing Sugar sensing Decreased germination and growth on
glucose medium 35 G27 OE Morphology: other Dev and morph Abnormal
development, small 37 G28 OE Botrytis Disease Increased tolerance
to Botrytis OE Erysiphe Disease Increased resistance to Erysiphe OE
Sclerotinia Disease Increased tolerance to Sclerotinia 39 G32 OE
Leaf Dev and morph Curled leaves 41 G38 OE Sugar sensing Sugar
sensing Reduced germination on glucose medium 49 G43 OE Sugar
sensing Sugar sensing Decreased germination and growth on glucose
medium 53 G46 OE Size Dev and morph Increased size OE Drought
Abiotic stress Increased tolerance to drought 55 G134 OE Flower Dev
and morph Homeotic transformation OE Cold Abiotic stress Increased
sensitivity to cold 57 G142 OE Flowering time Flowering time Early
flowering 59 G145 OE Flowering time Flowering time Early flowering
OE Inflorescence Dev and morph Terminal flowers 61 G146 OE Abiotic
stress Abiotic stress Better growth in low nitrogen OE Nutrient
uptake Abiotic stress Altered C:N sensing: reduced anthocyanin
production on high sucrose/low nitrogen OE Flowering time Flowering
time Early flowering 65 G153 OE Abiotic stress Abiotic stress
Tolerant to low nitrogen conditions 67 G156 KO Seed Dev and morph
Seed color alteration 69 G157 OE Flowering time Flowering time
Modest overexpression triggers early flowering; greater
overexpression delays flowering 71 G162 OE Seed oil content Seed
biochemistry Increased seed oil content OE Seed protein content
Seed biochemistry Altered seed protein content 77 G171 OE Cold
Abiotic stress Expression induced by cold and heat OE Heat Abiotic
stress 87 G180 OE Seed oil content Seed biochemistry Decreased seed
oil OE Flowering time Flowering time Early flowering 89 G184 OE
Flowering time Flowering time Early flowering OE Size Dev and morph
Small plant 91 G185 OE Leaf glucosinolates Leaf biochemistry
Increased M39481 OE Flowering time Flowering time Early flowering
95 G187 OE Morphology: other Dev and morph Variety of morphological
alterations 97 G188 KO Osmotic Abiotic stress Better germination
under osmotic stress KO Fusarium Disease Increased susceptibility
to Fusarium 101 G192 OE Seed oil content Seed biochemistry
Decreased oil content OE Flowering time Flowering time Late
flowering 103 G194 OE Size Dev and morph Small plant 105 G196 OE
Sodium chloride Abiotic stress Increased tolerance to high salt 109
G198 OE Flowering time Flowering time Late flowering 111 G201 OE
Seed protein content Seed biochemistry Increased seed protein
content OE Seed oil content Seed biochemistry Decreased seed oil
content 115 G206 OE Seed Dev and morph Large seeds 117 G207 OE
Sugar sensing Sugar sensing Decreased germination on glucose medium
KO Botrytis Disease Increased susceptibility to Botrytis 119 G208
OE Flowering time Flowering time Early flowering 121 G211 OE Leaf
insoluble sugars Leaf biochemistry Increase in xylose 123 G212 OE
Trichome Dev and morph Partially to fully glabrous on adaxial
surface of leaves 127 G214 OE Leaf fatty acids Leaf biochemistry
Increased leaf fatty acids OE Leaf prenyl lipids Leaf biochemistry
Increased leaf chlorophyll and carotenoids OE Flowering time
Flowering time Late flowering OE Seed prenyl lipids Seed
biochemistry Increased seed lutein 135 G222 OE Seed oil content
Seed biochemistry Decreased seed oil content OE Seed protein
content Seed biochemistry Increased seed protein content 137 G224
OE Cold Abiotic stress Increased tolerance to cold OE Leaf Dev and
morph Altered leaf shape OE Sugar sensing Sugar sensing Increased
germination and seedling vigor on high glucose 139 G225 OE Root Dev
and morph Increased root hairs OE Trichome Dev and morph Glabrous,
lack of trichomes OE Nutrient uptake Abiotic stress Increased
tolerance to nitrogen-limited medium 141 G226 OE Nutrient uptake
Abiotic stress Increased tolerance to nitrogen-limited medium OE
Seed protein content Seed biochemistry Increased seed protein OE
Root Dev and morph Increased root hairs OE Trichome Dev and morph
Glabrous, lack of trichomes OE Sodium chloride Abiotic stress
Increased tolerance to high salt 143 G227 OE Flowering time
Flowering time Early flowering 147 G229 OE Seed protein content
Seed biochemistry Decreased seed protein OE Seed oil content Seed
biochemistry Increased seed oil OE Biochemistry: other Biochem:
misc Up-regulation of genes involved in secondary metabolism 151
G231 OE Leaf fatty acids Leaf biochemistry Increased leaf
unsaturated fatty acids OE Seed protein content Seed biochemistry
Decreased seed protein content OE Seed oil content Seed
biochemistry Increased seed oil content 157 G234 OE Flowering time
Flowering time Late flowering, small plant 159 G237 OE Leaf
insoluble sugars Leaf biochemistry Increased leaf insoluble sugars
OE Erysiphe Disease Increased tolerance to Erysiphe 161 G239 OE ABA
Abiotic stress Expression induced by ABA OE Drought Abiotic stress
Expression induced by drought OE Heat Abiotic stress Expression
induced by heat OE Osmotic stress Abiotic stress Expression induced
by osmotic stress 163 G241 OE Seed oil content Seed biochemistry
Decreased seed oil KO Seed protein content Seed biochemistry
Altered seed protein content OE Sugar sensing Sugar sensing
Decreased germination and growth on glucose medium 165 G242 OE Leaf
insoluble sugars Leaf biochemistry Increased arabinose 169 G247 OE
Trichome Dev and morph Altered trichome distribution 171 G248 OE
Botrytis Disease Increased susceptibility to Botrytis 173 G249 OE
Flowering time Flowering time Late flowering OE Senescence Dev and
morph Delayed senescence 179 G254 OE Sugar sensing Sugar sensing
Decreased germination and growth on glucose medium 181 G255 OE
Flowering time Flowering time Early flowering 183 G256 OE Cold
Abiotic stress Better germination and growth in cold 187 G258 OE
Size Dev and morph Reduced size 191 G261 OE Botrytis Disease
Increased susceptibility to Botrytis 193 G263 OE Sugar sensing
Sugar sensing Decreased root growth on sucrose medium, root
specific expression 199 G274 OE Leaf insoluble sugars Leaf
biochemistry Increased leaf arabinose 203 G280 OE Size Dev and
morph Reduced size OE Leaf prenyl lipids Leaf biochemistry
Increased .delta.- and .gamma.-tocopherol 209 G291 OE Seed oil
content Seed biochemistry Increased seed oil content 215 G307 OE
Leaf insoluble sugars Leaf biochemistry Altered leaf insoluble
sugars 217 G308 OE Sugar sensing Sugar sensing No germination on
glucose medium 223 G325 OE Osmotic Abiotic stress Better
germination on high sucrose and high NaCl 231 G346 OE Leaf fatty
acids Leaf biochemistry Altered leaf fatty acids OE Seed oil
content Seed biochemistry Decreased seed oil 235 G351 OE Light
response Dev and morph Altered leaf orientation and light green
coloration 237 G361 OE Flowering time Flowering time Late flowering
239 G374 KO Embryo lethal Dev and morph Embryo lethal 241 G378 OE
Erysiphe Disease Increased resistance 245 G385 OE Size Dev and
morph Small plant OE Inflorescence Dev and morph Short
inflorescence stems OE Leaf Dev and morph Dark green plant 249 G390
OE Flowering time Flowering time Early flowering OE Architecture
Dev and morph Altered shoot development 251 G394 OE Cold Abiotic
stress More sensitive to chilling 261 G409 OE Erysiphe Disease
Increased tolerance to Erysiphe 267 G418 OE Pseudomonas Disease
Increased tolerance OE Seed protein content Seed biochemistry
Decreased seed protein content 269 G419 OE Nutrient uptake Abiotic
stress Increased tolerance to potassium-free medium 271 G428 OE
Leaf insoluble sugars Leaf biochemistry Increased leaf insoluble
sugars OE Leaf Dev and morph Altered leaf shape 273 G431 OE
Morphology: other Dev and morph Developmental defect, sterile 275
G434 OE Flowering time Flowering time Late flowering 277 G435 OE
Leaf insoluble sugars Leaf biochemistry Increased leaf insoluble
sugars 283 G438 KO Architecture Dev and morph Reduced branching KO
Stem Dev and morph Reduced lignin OE Leaf Dev and morph Increased
leaf size OE Leaf Dev and morph Altered leaf shape 285 G447 OE Size
Dev and morph Reduced size OE Morphology: other Dev and morph
Altered cotyledon shape OE Leaf Dev and morph Dark green leaves 287
G456 OE Seed protein content Seed biochemistry Decreased seed
protein OE Seed oil content Seed biochemistry Increased seed oil
291 G464 OE Seed oil content Seed biochemistry Increased seed oil
OE Heat Abiotic stress Better germination and growth in heat OE
Leaf Dev and morph Altered leaf shape OE Seed protein content Seed
biochemistry Decreased seed protein content 295 G470 OE Fertility
Dev and morph Short stamen filaments 301 G475 OE Flowering time
Flowering time Early flowering 303 G477 OE Sclerotinia Disease
Increased susceptibility to Sclerotinia OE Oxidative Abiotic stress
Increased sensitivity to oxidative stress 305 G482 OE Sodium
chloride Abiotic stress Tolerant to high salt 307 G486 OE Flowering
time Flowering time Late flowering 309 G489 OE Osmotic Abiotic
stress Increased tolerance to osmotic stress 313 G502 KO Osmotic
Abiotic stress Increased sensitivity to osmotic stress 317 G509 KO
Seed oil content Seed biochemistry Altered seed oil content KO Seed
protein content Seed biochemistry Altered seed protein content 327
G515 OE Morphology: other Dev and morph Lethal when overexpressed
331 G521 OE Leaf Dev and morph Leaf cell expansion 337 G525 OE
Pseudomonas Disease Increased tolerance to Pseudomonas OE Leaf
insoluble sugars Leaf biochemistry Increased leaf insoluble sugars
339 G526 OE Osmotic Abiotic stress Increased sensitivity to osmotic
stress 343 G536 OE Sugar sensing Sugar sensing Decreased
germination and growth on glucose medium 345 G545 OE Sodium
chloride Abiotic stress Susceptible to high salt OE Nutrient uptake
Abiotic stress Increased tolerance to phosphate-free medium OE
Erysiphe Disease Increased susceptibility to Erysiphe OE
Pseudomonas Disease Increased susceptibility to Pseudomonas OE
Fusarium Disease Increased susceptibility to Fusarium 355 G558 OE
Defense gene Disease Increased expression of defense genes
expression 357 G559 OE Architecture Dev and morph Loss of apical
dominance OE Fertility Dev and morph Reduced fertility 359 G561 OE
Seed oil content Seed biochemistry Altered seed oil content OE
Nutrient uptake Abiotic stress Increased tolerance to
potassium-free medium 361 G562 OE Flowering time Flowering time
Late flowering 369 G567 OE Seed protein content Seed biochemistry
Altered seed protein content OE Seed oil content Seed biochemistry
Altered seed oil content OE Sugar sensing Sugar sensing Decreased
seedling vigor on high glucose 371 G569 OE Defense gene Disease
Decreased expression of defense genes expression 375 G571 KO
Senescence Dev and morph Delayed senescence KO Flowering time
Flowering time Late flowering 379 G578 OE Morphology: other Dev and
morph Lethal when overexpressed 381 G580 OE Flower Dev and morph
Altered development OE Architecture Dev and morph Altered
inflorescences 385 G584 OE Seed Dev and morph Large seeds 387 G590
KO Seed oil content Seed biochemistry Increased seed oil
content
OE Flowering time Flowering time Early flowering 389 G591 OE
Erysiphe Disease Increased tolerance to Erysiphe OE Flowering time
Flowering time Late flowering 391 G592 OE Flowering time Flowering
time Early flowering 393 G598 OE Seed oil content Seed biochemistry
Increased seed oil OE Leaf insoluble sugars Leaf biochemistry
Altered insoluble sugars 395 G605 OE Leaf fatty acids Leaf
biochemistry Altered leaf fatty acid composition 399 G615 OE
Architecture Dev and morph Altered plant architecture OE Fertility
Dev and morph Little or no pollen production, poor filament
elongation 401 G616 OE Erysiphe Disease Increased tolerance to
Erysiphe 403 G624 OE Sodium chloride Abiotic stress Increased
tolerance to high salt Size Dev and morph Increased biomass
Nutrient uptake Abiotic stress Increased tolerance to low phosphate
Flowering time Flowering time Late flowering 405 G627 OE Flowering
time Flowering time Early flowering 407 G629 OE Leaf Dev and morph
Altered leaf morphology OE Seed oil content Seed biochemistry
Increased seed protein content 409 G630 OE Seed protein content
Seed biochemistry Increased seed protein content, embryo specific
expression 415 G634 OE Trichome Dev and morph Increased trichome
density and size 417 G636 OE Senescence Dev and morph Premature
senescence OE Size Dev and morph Reduced size 419 G638 OE Flower
Dev and morph Altered flower development 435 G663 OE Seed oil
content Seed biochemistry Decreased seed oil OE Seed protein
content Seed biochemistry Increased seed protein OE Biochemistry:
other Biochem: misc Increased anthocyanins in leaf, root, seed 437
G664 OE Cold Abiotic stress Better germination and growth in cold
443 G668 OE Seed protein content Seed biochemistry Increased seed
protein content OE Seed oil content Seed biochemistry Decreased
seed oil content OE Seed Dev and morph Reduced seed color 447 G670
OE Size Dev and morph Small plant 449 G671 OE Stem Dev and morph
Altered inflorescence stem structure OE Flower Dev and morph
Reduced petal abscission OE Leaf Dev and morph Altered leaf shape
OE Size Dev and morph Small plant OE Fertility Dev and morph
Reduced fertility 457 G676 OE Trichome Dev and morph Reduced
trichomes 463 G680 OE Flowering time Flowering time Late flowering
OE Sugar sensing Sugar sensing Reduced germination on glucose
medium 465 G681 OE Leaf glucosinolates Leaf biochemistry Increase
in M39480 467 G682 OE Heat Abiotic stress Better germination and
growth in heat OE Trichome Dev and morph Glabrous, lack of
trichomes 473 G718 OE Seed protein content Seed biochemistry
Increased seed protein OE Leaf fatty acids Leaf biochemistry
Altered leaf fatty acid composition OE Seed prenyl lipids Seed
biochemistry Increased seed lutein OE Seed oil content Seed
biochemistry Decreased seed oil 483 G732 OE Seed protein content
Seed biochemistry One OE line had increased, another decreased seed
protein content OE Seed oil content Seed biochemistry One OE line
had increased, another decreased seed oil content OE Architecture
Dev and morph Reduced apical dominance OE Flower Dev and morph
Abnormal flowers 487 G736 OE Flowering time Flowering time Late
flowering OE Leaf Dev and morph Altered leaf shape 489 G738 OE
Flowering time Flowering time Late flowering OE Size Dev and morph
Reduced size 491 G740 OE Morphology: other Dev and morph Slow
growth 497 G748 OE Stem Dev and morph More vascular bundles in stem
OE Flowering time Flowering time Late flowering OE Seed prenyl
lipids Seed biochemistry Increased lutein content 503 G752 OE
Flowering time Flowering time Late flowering 507 G760 OE Hormone
sensitivity Hormone sensitivity Hypersensitive to ACC OE Size Dev
and morph Reduced size 519 G776 OE Seed oil composition Seed
biochemistry Altered seed fatty acid composition 521 G777 OE Seed
oil content Seed biochemistry Decreased seed oil OE Leaf insoluble
sugars Leaf biochemistry Increased leaf rhamnose 523 G778 OE Seed
oil composition Seed biochemistry Increased seed 18:1 fatty acid
525 G779 OE Fertility Dev and morph Reduced fertility OE Flower Dev
and morph Homeotic transformations 529 G782 OE Sugar sensing Sugar
sensing Better germination and growth on sucrose medium 531 G783 OE
Sugar sensing Sugar sensing Better germination and growth on
sucrose medium 539 G789 OE Sclerotinia Disease Increased
susceptibility to Sclerotinia OE Flowering time Flowering time
Early flowering OE Oxidative Abiotic stress Increased sensitivity
541 G791 OE Seed oil composition Seed biochemistry Decreased seed
fatty acid composition OE Leaf insoluble sugars Leaf biochemistry
Altered leaf cell wall polysaccharide composition OE Leaf fatty
acids Leaf biochemistry Altered leaf fatty acid composition 549
G801 OE Sodium chloride Abiotic stress Better germination on NaCl
553 G805 OE Sclerotinia Disease Increased susceptibility to
Sclerotinia 557 G831 OE Size Dev and morph Reduced size 565 G849 KO
Seed protein content Seed biochemistry Altered seed protein content
KO Seed oil content Seed biochemistry Increased seed oil content
567 G859 OE Flowering time Flowering time Late flowering 571 G861
OE Seed oil composition Seed biochemistry Increase in 16:1 573 G864
OE Size Dev and morph Small plant OE Cold Abiotic stress Adult
stage chilling sensitivity OE Heat Abiotic stress Better
germination in heat 575 G865 OE Erysiphe Disease Increased
susceptibility to Erysiphe OE Seed protein content Seed
biochemistry Increased seed protein OE Botrytis Disease Increased
susceptibility to Botrytis OE Flowering time Flowering time Early
flowering OE Morphology: other Dev and morph Altered morphology 579
G867 OE Sugar sensing Sugar sensing Better seedling vigor on
sucrose medium OE Sodium chloride Abiotic stress Better seedling
vigor on high salt 581 G869 OE Leaf insoluble sugars Leaf
biochemistry Increased fucose OE Erysiphe Disease Increased
tolerance to Erysiphe OE Morphology: other Dev and morph Small and
spindly plant OE Flower Dev and morph Abnormal anther development
OE Seed oil composition Seed biochemistry Altered seed fatty acids
OE Leaf fatty acids Leaf biochemistry Altered leaf fatty acids 583
G877 KO Embryo lethal Dev and morph Embryo lethal 585 G878 OE
Senescence Dev and morph Delayed senescence OE Flowering time
Flowering time Late flowering 587 G881 OE Botrytis Disease
Increased susceptibility to Botrytis OE Erysiphe Disease Increased
susceptibility to Erysiphe 589 G883 OE Seed prenyl lipids Seed
biochemistry Decreased seed lutein 591 G884 OE Sodium chloride
Abiotic stress Increased root growth in high salt OE Size Dev and
morph Reduced size 595 G896 KO Fusarium Disease Increased
susceptibility to Fusarium 603 G903 OE Leaf Dev and morph Altered
leaf morphology 605 G905 OE Flowering time Flowering time Late
flowering OE Leaf Dev and morph Altered leaf shape OE Sugar sensing
Sugar sensing Increased seedling vigor on high glucose 613 G911 OE
Nutrient uptake Abiotic stress Increased growth on potassium-free
medium OE Seed protein content Seed biochemistry Increased seed
protein content OE Seed oil content Seed biochemistry Decreased
seed oil content 615 G912 OE Freezing Abiotic stress Increased
freezing tolerance OE Morphology: other Dev and morph Dark green
color OE Drought Abiotic stress Increased survival in drought
conditions OE Sugar sensing Sugar sensing Reduced cotyledon
expansion in glucose OE Size Dev and morph Small plant OE Flowering
time Flowering time Late flowering 619 G921 OE Osmotic Abiotic
stress Increased sensitivity to osmotic stress OE Leaf Dev and
morph Serrated leaves 627 G932 OE Leaf Dev and morph Altered
development, dark green color OE Size Dev and morph Reduced size
631 G938 OE Seed oil composition Seed biochemistry Overexpressors
had increased 16:0, 18:0, 20:0, and 18:3 fatty acids, decreased
18:2, 20:1, 22:1 fatty acids 633 G961 KO Seed oil content Seed
biochemistry Increased seed oil content 635 G964 OE Heat Abiotic
stress More tolerant to heat in germination assay 637 G965 OE Seed
oil composition Seed biochemistry Increase in 18:1 fatty acid 639
G971 OE Flowering time Flowering time Late flowering 641 G974 OE
Seed oil content Seed biochemistry Altered seed oil content 643
G975 OE Leaf fatty acids Leaf biochemistry Increased wax in leaves
647 G977 OE Size Dev and morph Small plant OE Morphology: other Dev
and morph Dark green OE Leaf Dev and morph Altered leaf shape OE
Fertility Dev and morph Reduced fertility 649 G979 KO Seed Dev and
morph Altered seed development, ripening, and germination 653 G987
KO Leaf fatty acids Leaf biochemistry Reduction in 16:3 fatty acid
KO Leaf prenyl lipids Leaf biochemistry Presence of two
xanthophylls, tocopherol not normally found in leaves; reduced
chlorophyll a and b 655 G991 OE Size Dev and morph Slightly reduced
size 657 G994 OE Flowering time Flowering time Late flowering OE
Size Dev and morph Small plants 659 G996 OE Sugar sensing Sugar
sensing Reduced germination on glucose medium 671 G1012 OE Leaf
insoluble sugars Leaf biochemistry Decreased rhamnose 673 G1020 OE
Size Dev and morph Very small T1 plants 677 G1023 OE Size Dev and
morph Reduced size 685 G1037 KO Flowering time Flowering time Early
flowering 687 G1038 OE Leaf Dev and morph Altered leaf shape OE
Leaf insoluble sugars Leaf biochemistry Decreased insoluble sugars
695 G1048 OE Erysiphe Disease Increased tolerance to Erysiphe
orontii OE Seed protein content Seed biochemistry Increased seed
protein content 697 G1050 OE Senescence Dev and morph Delayed
senescence 699 G1052 OE Flowering time Flowering time Late
flowering OE Seed prenyl lipids Seed biochemistry Decrease in
lutein and increase in xanthophyll 1 701 G1053 OE Size Dev and
morph Small plant 713 G1062 KO Light response Dev and morph
Constitutive photomorphogenesis KO Hormone sensitivity Hormone
sensitivity Altered response to ethylene KO Seed Dev and morph
Altered seed shape KO Morphology: other Dev and morph Slow growth
717 G1067 OE Leaf Dev and morph Altered leaf shape OE Size Dev and
morph Small plant OE Fertility Dev and morph Reduced fertility 719
G1068 OE Sugar sensing Sugar sensing Reduced cotyledon expansion in
glucose 721 G1069 OE Osmotic Abiotic stress Better germination
under osmotic stress OE Hormone sensitivity Hormone sensitivity
Reduced ABA sensitivity OE Leaf glucosinolates Leaf biochemistry
Altered composition 723 G1073 OE Size Dev and morph Increased plant
size OE Leaf Dev and morph Serrated leaves OE Flowering time
Flowering time Flowering slightly delayed 725 G1075 OE Size Dev and
morph Small plant OE Flower Dev and morph Reduced or absent petals,
sepals and stamens OE Fertility Dev and morph Reduced fertility OE
Leaf Dev and morph Altered leaf shape 727 G1076 OE Morphology:
other Dev and morph Lethal when overexpressed 731 G1089 KO Osmotic
Abiotic stress Better germination under osmotic stress OE
Morphology: other Dev and morph Developmental defects at seedling
stage 737 G1128 OE Leaf Dev and morph Dark green leaves OE
Senescence Dev and morph Premature leaf and flower senescence 739
G1133 OE Leaf prenyl lipids Leaf biochemistry Decreased leaf lutein
741 G1134 OE Silique Dev and morph Siliques with altered shape OE
Hormone sensitivity Hormone sensitivity Altered response to the
growth hormone ethylene 745 G1136 OE Flowering time Flowering time
Late flowering OE Nutrient uptake Abiotic stress Increased
sensitivity to low nitrogen 749 G1145 OE Seed Seed morphology
Reduced seed size OE Seed Seed morphology Altered seed shape 753
G1181 OE Size Dev and morph Small T1 plants 759 G1190 OE Seed oil
content Seed biochemistry Increased seed oil content 763 G1198 OE
Seed oil content Seed biochemistry Increased seed oil content OE
Leaf glucosinolates Leaf biochemistry Altered glucosinolate
composition 775 G1228 OE Size Dev and morph Reduced size 787 G1242
OE Flowering time Flowering time Early flowering 793 G1255 OE Seed
Dev and morph Increased seed size OE Morphology: other Dev and
morph Reduced apical dominance OE Botrytis Disease Increased
susceptibility to Botrytis 799 G1266 OE Leaf fatty acids Leaf
biochemistry Changes in leaf fatty acids OE Erysiphe Disease
Increased tolerance to Erysiphe OE Size Dev and morph Small
plant
OE Fertility Dev and morph Reduced fertility OE Leaf insoluble
sugars Leaf biochemistry Changes in leaf insoluble sugars 801 G1267
OE Size Dev and morph Small plant OE Leaf Leaf morphology Dark
green leaves OE Leaf Leaf morphology Shiny leaves 803 G1269 OE Leaf
Dev and morph Long petioles, upturned leaves 805 G1274 OE Cold
Abiotic stress Increased tolerance to cold OE Nutrient uptake
Abiotic stress Increased tolerance to nitrogen-limited medium OE
Morphology: other Dev and morph Inflorescence architecture OE Leaf
Dev and morph Large leaves 807 G1275 OE Size Dev and morph Small
plant OE Architecture Dev and morph Reduced apical dominance 809
G1277 OE Size Dev and morph Small plant 817 G1304 OE Morphology:
other Dev and morph Lethal when overexpressed 819 G1305 OE
Flowering time Flowering time Early flowering OE Heat Abiotic
stress Reduced chlorosis at high temperature 825 G1309 OE Size Dev
and morph Small plant OE Leaf insoluble sugars Leaf biochemistry
Increased mannose 827 G1311 OE Fertility Dev and morph Reduced
fertility OE Size Dev and morph Small plant 829 G1313 OE
Morphology: other Dev and morph Increased seedling size 831 G1314
OE Sugar sensing Sugar sensing Reduced seedling vigor on high
glucose OE Size Dev and morph Reduced size 837 G1317 OE Size Dev
and morph Reduced size 841 G1322 OE Cold Abiotic stress Increased
seedling vigor in cold conditions OE Leaf glucosinolates Leaf
biochemistry Increase in M39480 OE Light response Dev and morph
Photomorphogenesis in the dark OE Size Dev and morph Reduced size
843 G1323 OE Seed oil content Seed biochemistry Decreased seed oil
OE Seed protein content Seed biochemistry Increased seed protein OE
Size Dev and morph Small T1 plants, dark green 845 G1324 OE Leaf
prenyl lipids Leaf biochemistry Decreased leaf lutein, increased
leaf xanthophyll 849 G1326 OE Flower Dev and morph Petals and
sepals are smaller OE Size Dev and morph Small plant OE Fertility
Dev and morph Reduced fertility 851 G1327 OE Leaf Dev and morph
Dark green leaves 853 G1328 OE Seed prenyl lipids Seed biochemistry
Decreased seed lutein 855 G1332 OE Trichome Dev and morph Reduced
trichome density OE Size Dev and morph Reduced plant size 857 G1334
OE Size Dev and morph Small plants OE Leaf Leaf morphology Dark
green leaves 859 G1335 OE Flowering time Flowering time Late
flowering OE Dev and morph Dev and morph Slow growth 861 G1337 OE
Sugar sensing Sugar sensing Decreased germination on sucrose medium
OE Leaf fatty acids Leaf biochemistry Altered leaf fatty acid
composition 867 G1380 OE Flowering time Flowering time Early
flowering 869 G1382 OE Size Dev and morph Small plant 877 G1399 OE
Leaf fatty acids Leaf biochemistry Altered composition 879 G1412 OE
Hormone sensitivity Hormone sensitivity ABA insensitive Osmotic
Abiotic stress Increased tolerance to osmotic stress 881 G1417 KO
Morphology: other Dev and morph Reduced seedling germination and
vigor KO Seed oil composition Seed biochemistry Increase in 18:2,
decrease in 18:3 fatty acids 883 G1425 OE Flower Dev and morph
Altered flower and inflorescence development 887 G1435 OE Flowering
time Flowering time Late flowering OE Size Dev and morph Increased
plant size 891 G1449 OE Seed protein content Seed biochemistry
Increased seed protein content OE Flower Dev and morph Altered
flower structure 893 G1451 OE Leaf Dev and morph Large leaf size KO
Seed oil content Seed biochemistry Altered seed oil content OE
Morphology: other Dev and morph Increased plant size OE Flowering
time Flowering time Late flowering 895 G1468 OE Flowering time
Flowering time Late flowering Size Dev and morph Increased biomass
Leaf Dev and morph Grayish and narrow leaves Morphology: other Dev
and morph Slow growth rate 897 G1471 OE Seed oil content Seed
biochemistry Increased seed oil content 899 G1472 OE Morphology:
other Dev and morph No shoot meristem 901 G1474 OE Morphology:
other Dev and morph Reduced plant size OE Flowering time Flowering
time Late flowering OE Inflorescence Dev and morph Inflorescence
architecture 903 G1476 OE Morphology: other Dev and morph Faster
seedling growth rate 905 G1482 KO Root Dev and morph Increased root
growth OE Biochemistry: other Biochem: misc Increased anthocyanins
911 G1493 OE Sugar sensing Sugar sensing Increased seedling vigor
on high glucose OE Flowering time Flowering time Late flowering OE
Leaf Dev and morph Altered leaf shape 913 G1499 OE Architecture Dev
and morph Altered plant architecture OE Flower Dev and morph
Altered floral organ identity and development OE Morphology: other
Dark green color Dark green leaves 919 G1540 OE Morphology: other
Dev and morph Reduced cell differentiation in meristem 921 G1545 OE
Flowering time Flowering time Early flowering OE Size Dev and morph
Reduced size 925 G1560 OE Fertility Dev and morph Reduced fertility
OE Size Dev and morph Reduced size OE Flower Dev and morph Abnormal
flowers 927 G1634 OE Seed protein content Seed biochemistry Altered
seed protein content 929 G1645 OE Inflorescence Dev and morph
Altered inflorescence structure OE Leaf Dev and morph Altered leaf
development OE Heat Abiotic stress Reduced germination vigor 937
G1760 OE Flowering time Flowering time Early flowering 939 G1816 OE
Trichome Dev and morph Glabrous OE Root Dev and morph Ectopic root
hairs, more root hairs OE Nutrient uptake Abiotic stress Improved
tolerance to low nitrogen OE Sugar sensing Sugar sensing
Insensitive to growth retardation effects of high glucose OE
Pigment Dev and morph Reduced pigment 941 G1820 OE Osmotic Abiotic
stress Better germination in NaCl OE Seed protein content Seed
biochemistry Increased seed protein content Seed oil content Seed
biochemistry Decreased seed oil content OE Hormone sensitivity
Hormone sensitivity Reduced ABA sensitivity OE Flowering time
Flowering time Early flowering OE Drought Abiotic stress Increased
tolerance to drought 943 G1842 OE Flowering time Flowering time
Early flowering 945 G1843 OE Flowering time Flowering time Early
flowering 949 G1947 KO Fertility Dev and morph Reduced fertility KO
Flower Dev and morph Extended period of flowering 951 G2010 OE
Flowering time Flowering time Early flowering 957 G2347 OE
Flowering time Flowering time Early flowering 959 G2718 OE Trichome
Devel and morph Reduction in trichome density ranging from mild to
glabrous OE Nutrient uptake Abiotic stress Tolerant to low nitrogen
conditions OE Root Dev and morph Ectopic root hairs, more root
hairs OE Pigment Dev and morph Reduced pigment
[0325] Tables 5A and 5B show the polypeptides identified by SEQ ID
NO; Mendel Gene ID (GID) No.; the transcription factor family to
which the polypeptide belongs, and conserved domains of the
polypeptide. The first column shows the polypeptide SEQ ID NO; the
third column shows the transcription factor family to which the
polynucleotide belongs; and the fourth column shows the amino acid
residue positions of the conserved domain in amino acid (AA)
co-ordinates.
TABLE-US-00005 TABLE 5A Gene families and conserved domains
Conserved Domains Polypeptide in Amino Acid SEQ ID NO: GID No.
Family Coordinates 2 G3 AP2 28-95 4 G4 AP2 121-188 6 G5 AP2 149-216
8 G6 AP2 22-89 10 G7 AP2 58-125 12 G8 AP2 151-217, 243-296 14 G9
AP2 62-127 16 G10 AP2 21-88 18 G13 AP2 19-86 20 G14 AP2 122-189 22
G19 AP2 76-145 24 G20 AP2 68-144 26 G21 AP2 97-164 28 G22 AP2
89-157 30 G24 AP2 25-93 32 G25 AP2 47-114 34 G26 AP2 67-134 36 G27
AP2 37-104 38 G28 AP2 145-213 40 G32 AP2 17-84 42 G38 AP2 76-143 44
G40 AP2 45-112 46 G41 AP2 39-106 48 G42 AP2 48-115 50 G43 AP2
104-172 52 G44 AP2 85-154 54 G46 AP2 107-175 56 G134 MADS 1-57 58
G142 MADS 2-57 60 G145 MADS 1-57 62 G146 MADS 1-57 64 G152 MADS
2-57 66 G153 MADS 1-57 68 G156 MADS 2-57 70 G157 MADS 2-57 72 G162
MADS 2-57 74 G166 MADS 2-56 76 G170 MADS 2-57 78 G171 MADS 1-57 80
G173 MADS 1-57 82 G176 WRKY 117-173, 234-290 84 G177 WRKY 166-221,
328-384 86 G179 WRKY 65-121 88 G180 WRKY 118-174 90 G184 WRKY
295-352 92 G185 WRKY 113-172 94 G186 WRKY 312-369 96 G187 WRKY
172-228 98 G188 WRKY 175-222 100 G190 WRKY 110-169 102 G192 WRKY
128-185 104 G194 WRKY 174-230 106 G196 WRKY 223-283 108 G197
MYB-(R1)R2R3 14-119 110 G198 MYB-(R1)R2R3 14-117 112 G201
MYB-(R1)R2R3 14-114 114 G203 MYB-(R1)R2R3 93-191 116 G206
MYB-(R1)R2R3 13-116 118 G207 MYB-(R1)R2R3 6-106 120 G208
MYB-(R1)R2R3 14-116 122 G211 MYB-(R1)R2R3 24-137 124 G212
MYB-(R1)R2R3 15-116 126 G213 MYB-(R1)R2R3 20-120 128 G214
MYB-related 22-71 130 G215 MYB-related 117-184 132 G216
MYB-(R1)R2R3 19-151 134 G220 MYB-(R1)R2R3 15-116 136 G222
MYB-(R1)R2R3 13-119 138 G224 PMR 7-114 140 G225 MYB-related 39-76
142 G226 MYB-related 28-78 144 G227 MYB-(R1)R2R3 13-112 146 G228
MYB-related 59-135 148 G229 MYB-(R1)R2R3 14-120 150 G230
MYB-(R1)R2R3 13-114 152 G231 MYB-(R1)R2R3 14-118 154 G232
MYB-(R1)R2R3 14-115 156 G233 MYB-(R1)R2R3 14-114 158 G234
MYB-(R1)R2R3 14-115 160 G237 MYB-(R1)R2R3 11-113 162 G239
MYB-(R1)R2R3 21-125 164 G241 MYB-(R1)R2R3 14-114 166 G242
MYB-(R1)R2R3 6-105 168 G245 MYB-(R1)R2R3 14-114 170 G247
MYB-(R1)R2R3 15-116 172 G248 MYB-(R1)R2R3 264-332 174 G249
MYB-(R1)R2R3 19-116 176 G251 MYB-(R1)R2R3 9-112 178 G252
MYB-(R1)R2R3 14-115 180 G254 MYB-related 62-106 182 G255
MYB-(R1)R2R3 14-115 184 G256 MYB-(R1)R2R3 13-115 186 G257
MYB-(R1)R2R3 20-120 188 G258 MYB-(R1)R2R3 24-124 190 G260 HS 192
G261 HS 194 G263 HS 196 G266 HS 45-135 198 G270 AKR 259-424 200
G274 AKR 202 G279 HMG 204 G280 AT-hook 97-104, 130-137-155-162,
185-192 206 G285 MISC 208 G290 SWI/SNF 538-784, 919-958, 1086-1169
210 G291 MISC 132-160 212 G295 bZIP 287-354 214 G301 216 G307 SCR
323-339 218 G308 SCR 270-274 220 G313 SCR 11-279 222 G315 SCR
205-209 224 G325 Z-CO-like 5-28, 48-71 226 G326 Z-CO-like 11-94,
354-400 228 G335 Z-Tall-1 205-218 230 G341 Z-C3H 254-374 232 G346
GATA/Zn 196-221 234 G348 RING/C3HC4 28-53 236 G351 Z-C2H2 77-97,
118-140 238 G361 Z-C2H2 43-63 240 G374 Z-ZPF 35-67, 286-318 242
G378 RING/C3H2C3 196-237 244 G384 HB 14-77 246 G385 HB 60-123 248
G389 HB 84-147 250 G390 HB 18-81 252 G394 HB 121-182 254 G395 HB
72-135 256 G398 HB 128-191 258 G399 HB 260 G404 HB 65-128 262 G409
HB 64-124 264 G413 HB 37-97 266 G414 HB 61-124 268 G418 HB 500-560
270 G419 HB 392-452 272 G428 HB 229-292 274 G431 HB 286-335 276
G434 HB 39-99 278 G435 HB 4-67 280 G436 HB 22-85 282 G437 HB 13-76
284 G438 HB 22-85 286 G447 ARF 22-356 288 G456 IAA 7-14, 71-81,
120-153, 185-221 290 G462 IAA 292 G464 IAA 20-28, 71-82, 126-142,
187-224 294 G467 IAA 296 G470 ARF 61-393 298 G471 ARF 22-354 300
G472 ARF 12-343 302 G475 SBP 53-127 304 G477 SBP 108-233 306 G482
CAAT 25-116 308 G486 CAAT 5-66 310 G489 CAAT 57-156 312 G501 NAC
314 G502 NAC 10-155 316 G503 NAC 12-158 318 G509 NAC 13-169 320
G511 NAC 8-159 322 G512 NAC 24-160 324 G513 NAC 16-161 326 G514 NAC
19-161 328 G515 NAC 6-144 330 G516 NAC 10-131 332 G521 NAC 7-156
334 G523 NAC 20-140 336 G524 NAC 18-157 338 G525 NAC 23-167 340
G526 NAC 21-149 342 G528 GF14 230-237 344 G536 GF14 226-233 346
G545 Z-C2H2 82-102, 136-154 348 G548 HS 12-101 350 G553 bZIP 94-160
352 G554 bZIP 82-142 354 G555 bZIP 38-110 356 G558 bZIP 45-105 358
G559 bZIP 203-264 360 G561 bZIP 248-308 362 G562 bZIP 253-315 364
G563 bZIP 186-248 366 G564 bZIP 22-82 368 G566 bZIP 227-290 370
G567 bZIP 210-270 372 G569 bZIP 90-153 374 G570 bZIP 370-430 376
G571 bZIP 160-220, 441-452 378 G572 bZIP 120-186 380 G578 bZIP
36-96 382 G580 bZIP 162-218 384 G582 HLH/MYC 152-204 386 G584
HLH/MYC 401-494 388 G590 HLH/MYC 202-254 390 G591 HLH/MYC 143-240
392 G592 HLH/MYC 290-342 394 G598 DBP 205-263 396 G605 AT-hook
132-143 398 G610 BPF-1 330-410, 530-622 400 G615 TEO 88-147 402
G616 TEO 39-95 404 G624 ABI3/VP-1 327-406 406 G627 MADS 1-57 408
G629 bZIP 92-152 410 G630 bZIP 74-146 412 G631 bZIP 212-282 414
G632 TH 70-160 416 G634 TH 62-147, 189-245 418 G636 TH 55-145,
405-498 420 G638 TH 119-206 422 G639 TH 304-389 424 G640 TH 426
G641 TH 23-102 428 G654 Z-LIM 10-61, 108-159 430 G656 MYB-(R1)R2R3
14-114 432 G659 MYB-(R1)R2R3 16-116 434 G661 MYB-(R1)R2R3 13-116
436 G663 MYB-(R1)R2R3 9-111 438 G664 MYB-(R1)R2R3 13-116 440 G665
MYB-related 88-157 442 G667 MYB-(R1)R2R3 14-116 444 G668
MYB-(R1)R2R3 13-113 446 G669 MYB-(R1)R2R3 15-118 448 G670
MYB-(R1)R2R3 14-122 450 G671 MYB-(R1)R2R3 15-115 452 G672
MYB-related 92-161 454 G673 MYB-related 37-95 456 G675 MYB-(R1)R2R3
13-116 458 G676 MYB-(R1)R2R3 17-119 460 G677 MYB-(R1)R2R3 12-116
462 G679 MYB-related 98-167 464 G680 MYB-related 24-70 466 G681
MYB-(R1)R2R3 14-120 468 G682 MYB-related 27-63 470 G699 HB 52-115
472 G713 HB 23-86 474 G718 SBP 169-242 476 G722 GARP 188-236
478 G723 GARP 480 G726 GARP 482 G729 GARP 224-272 484 G732 bZIP
31-91 486 G735 bZIP 153-237 488 G736 Z-Dof 54-111 490 G738 Z-Dof
351-393 492 G740 Z-CLDSH 24-42, 232-268 494 G743 Z-ZPF 51-82 496
G746 RING/C3HC4 139-178 498 G748 Z-Dof 112-140 500 G749 Z-C3H 502
G751 Z-Dof 37-82 504 G752 RING/C3H2C3 439-479 506 G759 NAC 17-159
508 G760 NAC 12-156 510 G763 NAC 17-157 512 G764 NAC 27-171 514
G765 NAC 23-167 516 G767 NAC 8-158 518 G773 NAC 17-159 520 G776 NAC
27-175 522 G777 HLH/MYC 47-101 524 G778 HLH/MYC 220-267 526 G779
HLH/MYC 126-182 528 G780 HLH/MYC 530 G782 HLH/MYC 1-88 532 G783
HLH/MYC 20-109 534 G784 HLH/MYC 139-191 536 G786 HLH/MYC 538 G787
HLH/MYC 61-124 540 G789 HLH/MYC 253-313 542 G791 HLH/MYC 75-143 544
G792 HLH/MYC 70-138 546 G793 HLH/MYC 151-206 548 G795 DBP 550 G801
PCF 32-93 552 G802 PCF 554 G805 PCF 51-114 556 G820 AKR 558 G831
AKR 470-591 560 G832 AKR 562 G837 AKR 548-869 564 G838 AKR 274-420
566 G849 BPF-1 324-413, 504-583 568 G859 MADS 2-57 570 G860 MADS
2-57 572 G861 MADS 2-57 574 G864 AP2 119-186 576 G865 AP2 36-103
578 G866 WRKY 43-300 580 G867 AP2 59-124 582 G869 AP2 109-177 584
G877 WRKY 272-328, 487-603 586 G878 WRKY 250-305, 415-475 588 G881
WRKY 176-233 590 G883 WRKY 245-302 592 G884 WRKY 227-285, 407-465
594 G886 BZIPT2 1-53, 542-652 596 G896 Z-LSD-like 18-39 598 G897
Z-CO-like 8-39, 51-82 600 G901 Z-CO-like 1-98 602 G902 Z-CO-like
604 G903 Z-C2H2 68-92 606 G905 RING/C3H2C3 118-159 608 G907 Z-C3H
124-174 610 G908 Z-C2H2 612 G909 Z-LIM 614 G911 RING/C3H2C3 86-129
616 G912 AP2 51-118 618 G915 WRKY 184-239, 362-418 620 G921 WRKY
146-203 622 G928 CAAT 179-239 624 G929 CAAT 97-158 626 G931 CAAT
172-232 628 G932 MYB-(R1)R2R3 12-118 630 G935 ARF 632 G938 EIL
96-104 634 G961 NAC 12-180 636 G964 HB 126-186 638 G965 HB 423-486
640 G971 AP2 120-186 642 G974 AP2 81-140 644 G975 AP2 4-71 646 G976
AP2 87-153 648 G977 AP2 5-72 650 G979 AP2 63-139, 165-233 652 G986
WRKY 146-203 654 G987 SCR 428-432, 704-708 656 G991 IAA 7-14,
48-59, 82-115, 128-164 658 G994 MYB-(R1)R2R3 14-123 660 G996
MYB-(R1)R2R3 14-114 662 G997 MYB-related 9-63 664 G998 MYB-(R1)R2R3
28-131 666 G1004 AP2 153-221 668 G1005 AP2 25-92 670 G1006 AP2
114-182 672 G1012 WRKY 30-86 674 G1020 AP2 28-95 676 G1022 WRKY
281-340 678 G1023 AP2 128-195 680 G1025 SWI/SNF 682 G1030 HMG 684
G1034 bZIP 97-160 686 G1037 GARP 11-134, 200-248 688 G1038 GARP
198-247 690 G1039 GARP 214-262 692 G1043 WRKY 120-179 694 G1045
bZIP 96-156 696 G1048 bZIP 138-190 698 G1050 bZIP 372-425 700 G1052
bZIP 201-261 702 G1053 bZIP 74-120 704 G1055 bZIP 192-249 706 G1056
bZIP 183-246 708 G1057 bZIP 305-365 710 G1058 bZIP 292-386 712
G1061 HLH/MYC 149-200 714 G1062 HLH/MYC 308-359 716 G1065 DBP 718
G1067 AT-hook 86-93 720 G1068 AT-hook 143-150 722 G1069 AT-hook
67-74 724 G1073 AT-hook 33-42, 78-175 726 G1075 AT-hook 78-85 728
G1076 AT-hook 82-89 730 G1087 BZIPT2 732 G1089 BZIPT2 425-500 734
G1090 AP2 19-85 736 G1091 WRKY 262-319 738 G1128 AT-hook 181-247
740 G1133 HLH/MYC 256-326 742 G1134 HLH/MYC 198-247 744 G1135
HLH/MYC 363-440 746 G1136 HLH/MYC 397-474 748 G1141 AP2 75-142 750
G1145 bZIP 227-270 752 G1149 PAZ 870-880 754 G1181 HS 24-114 756
G1183 758 G1186 AKR 14-611 760 G1190 AKR 762 G1197 GARP 764 G1198
bZIP 173-223 766 G1211 MISC 123-179 768 G1212 MISC 110-131 770
G1216 BPF-1 490-543 772 G1218 MISC 66-250, 323-481, 575-645 774
G1222 776 G1228 HLH/MYC 179-233 778 G1232 Z-C4HC3 780 G1233 Z-C4HC3
782 G1237 Z-C4HC3 197-245 784 G1240 MISC 786 G1241 MISC 788 G1242
SWI/SNF 2-165 790 G1243 SWI/SNF 216-609 792 G1249 CAAT 13-110 794
G1255 Z-CO-like 18-56 796 G1258 Z-Dof 798 G1261 Z-CO-like 141-182,
184-207 800 G1266 AP2 79-147 802 G1267 WRKY 70-127 804 G1269
MYB-related 27-83 806 G1274 WRKY 111-164 808 G1275 WRKY 113-169 810
G1277 AP2 18-85 812 G1278 bZIP 230-328 814 G1290 AKR 270-366 816
G1300 Z-C4HC3 197-245 818 G1304 MYB-(R1)R2R3 13-118 820 G1305
MYB-(R1)R2R3 15-118 822 G1307 MYB-(R1)R2R3 14-114 824 G1308
MYB-(R1)R2R3 1-128 826 G1309 MYB-(R1)R2R3 9-114 828 G1311
MYB-(R1)R2R3 11-112 830 G1313 MYB-(R1)R2R3 32-135 832 G1314
MYB-(R1)R2R3 14-116 834 G1315 MYB-(R1)R2R3 14-115 836 G1316
MYB-(R1)R2R3 26-126 838 G1317 MYB-(R1)R2R3 13-118 840 G1319
MYB-(R1)R2R3 14-114 842 G1322 MYB-(R1)R2R3 26-130 844 G1323
MYB-(R1)R2R3 15-116 846 G1324 MYB-(R1)R2R3 20-118 848 G1325
MYB-(R1)R2R3 43-147 850 G1326 MYB-(R1)R2R3 18-121 852 G1327
MYB-(R1)R2R3 14-116 854 G1328 MYB-(R1)R2R3 14-119 856 G1332
MYB-(R1)R2R3 13-116 858 G1334 CAAT 18-190 860 G1335 Z-CLDSH 24-43,
131-144, 185-203 862 G1337 Z-CO-like 9-75 864 G1362 MYB-related
115-166 866 G1366 bZIP 14-74 868 G1380 AP2 24-92 870 G1382 WRKY
210-266, 385-437 872 G1391 GARP 230-277 874 G1395 S1FA 1-72 876
G1398 DBP 162-203 878 G1399 AT-hook 86-93 880 G1412 NAC 13-162 882
G1417 WRKY 239-296 884 G1425 NAC 20-173 886 G1426 NAC 3-131 888
G1435 GARP 146-194 890 G1448 IAA 43-50, 144-154, 187-220, 254-290
892 G1449 IAA 48-53, 74-107, 122-152 894 G1451 ARF 22-357 896 G1468
Z-C2H2 95-115, 170-190 898 G1471 Z-C2H2 49-70 900 G1472 Z-C2H2
83-106 902 G1474 Z-C2H2 41-68 904 G1476 Z-C2H2 37-57 906 G1482
Z-CO-like 5-63 908 G1483 Z-CO-like 17-66 910 G1490 GARP 193-241 912
G1493 GARP 242-289 914 G1499 HLH/MYC 118-181 916 G1504 GATA/Zn
193-206 918 G1508 GATA/Zn 38-63 920 G1540 HB 35-98 922 G1545 HB
54-117 924 G1552 SBP 101-177 926 G1560 HS 62-151 928 G1634
MYB-related 129-180 930 G1645 MYB-(R1)R2R3 90-210 932 G1650 HLH/MYC
284-334 934 G1664 HLH/MYC 936 G1669 Z-CO-like 938 G1760 MADS 2-57
940 G1816 MYB-related 31-81 942 G1820 CAAT 70-133 944 G1842 MADS
2-57 946 G1843 MADS 2-57 948 G1844 MADS 2-57 950 G1947 HS 37-120
952 G2010 SBP 53-127 954 G2119 RING/C3H2C3 956 G2120 VAR 0-0 958
G2347 SBP 60-136 960 G2718 MYB-related 21-76
TABLE-US-00006 TABLE 5B MAF Gene family and conserved domains
Polypeptide Conserved SEQ ID NO: GID No. Family Domains 568 G859
MADS 2-57 944 G1842 MADS 2-57 946 G1843 MADS 2-57 948 G1844 MADS
2-57 1735 G157 MADS 2-57 1875 G1759 MADS 2-57 1971 Soy1 MADS 2-57
1973 Soy3 MADS 2-57 1945 G859.3 MADS 2-57 1947 G859.1 MADS 2-57
1949 G859.4 MADS 2-57 1951 G859.5 MADS 2-57 1953 G1842.2 MADS 2-57
1955 G1842.7 MADS 2-57 1957 G1842.8 MADS 2-57 1959 G1842.6 MADS
2-57 1961 G1843.1 MADS 2-57 1963 G1843.2 MADS 2-57 1965 G1843.3
MADS 2-57 1967 G1843.4 MADS 2-57 1969 G1844.2 MADS 2-57 1971 Soy
MADS1 MADS 2-57 1973 Soy MADS3 MADS 2-57
[0326] For many crops, high yielding winter strains can only be
grown in regions where the growing season is sufficiently cold and
prolonged to elicit vernalization. A system that could trigger
flowering at higher temperatures would greatly expand the acreage
over which winter varieties can be cultivated. The finding that
G157 (SEQ ID NO:1734) overexpression causes early flowering in
Arabidopsis Stockholm and Pitztal plants, indicates that the gene
can overcome the high level of FRIGIDA and FLC activity present in
those late-ecotypes. The effects are similar to those caused by
vernalization, which implies that G157 (SEQ ID NO: 1734) and the
related MADS-box transcription factors (MAFs; SEQ ID NOs: 567,
1944, 1946, 1948, 1950, 943, 1952, 1954, 1956, 1958, 945, 1960,
1962, 1964, 1966, 947, 1968, 1970, and 1972) might be used in
winter strains of crop species. To date, a substantial number of
genes have been found to promote flowering. Many, however,
including those encoding the transcription factors, APETALA1,
LEAFY, and CONSTANS, produce extreme dwarfing and/or shoot
termination when over-expressed. Importantly, overexpression of
G157 was not observed to have deleterious effects. In particular,
35S::G157 transgenic Arabidopsis plants are healthy and attain a
wild-type stature when mature. Irrespective of the mode of G157
action, and whether its true biological role is as an activator or
a repressor of flowering, the results suggest that G157 can be
applied to produce either early or late flowering, according to the
level of over-expression of the particular polynucleotide.
[0327] Examples of some of the utilities that may be desirable in
plants, and that may be provided by transforming the plants with
the presently disclosed sequences, are listed in Table 6. Many of
the transcription factors listed in Table 6 may be operably linked
with a specific promoter that causes the transcription factor to be
expressed in response to environmental, tissue-specific or temporal
signals. For example, G362 induces ectopic trichomes on flowers but
also produces small plants. The former may be desirable to produce
insect or herbivore resistance, or increased cotton yield, but the
latter may be undesirable in that it may reduce biomass. However,
by operably linking G362 with a flower-specific promoter, one may
achieve the desirable benefits of the gene without affecting
overall biomass to a significant degree. For examples of flower
specific promoters, see Kaiser et al. (supra). For examples of
other tissue-specific, temporal-specific or inducible promoters,
see the above discussion under the heading "Vectors, Promoters, and
Expression Systems".
TABLE-US-00007 TABLE 6 Genes, traits and utilities that affect
plant characteristics Transcription factor genes that Trait
Category Phenotype(s) impact traits Utility Abiotic stress Effect
of chilling on plants Improved germination, growth Increased
sensitivity G394; G864 rate, earlier planting, yield Increased
tolerance G256; G664; G1274 Germination in cold Earlier planting;
improved Increased sensitivity G134 survival, yield Increased
tolerance G224; G256; G664; G1274; G1322 Freezing tolerance Earlier
planting; improved Increased tolerance G912 quality, survival,
yield Drought Improved survival, vigor, Increased tolerance G46;
G912; G1820 appearance, yield Heat Improved germination, growth
Increased sensitivity G3; G1645 rate, later planting, yield
Increased tolerance G464; G682; G864; G964; G1305 Osmotic stress
Abiotic stress response Increased sensitivity G502; G526; G921
manipulation Increased tolerance G188; G325; G489; Improved
germination rate, G1069; G1089; G1412; survival, yield G1820 Salt
tolerance Manipulation of response to Increased sensitivity G545
high salt conditions Increased tolerance G22; G196; G226; Improved
germination rate, G482; G624; G801; survival, yield; extended
growth G867; G884 range Nitrogen stress Manipulation of response to
low More sensitive to N limitation G1136 nutrient conditions Less
sensitive to N limitation G153; G225; G226; Improved yield and
nutrient G1274; G1816; G2718 stress tolerance, decreased fertilizer
usage Phosphate stress Manipulation of response to low More
sensitive to P limitation nutrient conditions Less sensitive to P
limitation G545; G624 Improved yield and nutrient stress tolerance,
decreased fertilizer usage Potassium stress Improved yield and
nutrient Increased tolerance to K G419; G561; G911 stress
tolerance, decreased limitation fertilizer usage Oxidative stress
Improved yield, quality, Increased sensitivity G477; G789
ultraviolet and chemical stress Increased tolerance tolerance
Herbicide Glyphosate Generation of glyphosate- resistant plants to
improve weed control Hormone sensitivity Abscisic acid (ABA)
Modification of seed sensitivity development, improved seed Reduced
sensitivity or G1412; G1069; G1820 dormancy, cold and dehydration
insensitive to ABA tolerance Sensitivity to ethylene Manipulation
of fruit ripening Hypersensitive to ACC G760 Manipulation of fruit
ripening Altered response G1062; G1134 Manipulation of fruit
ripening Insensitive to ethylene Disease Botrytis Manipulation of
response to Increased susceptibility G207; G248; G261; disease
organism G865; G881; G1255 Improved yield, appearance, Increased
resistance or G28 survival, extended range tolerance Fusarium
Manipulation of response to Increased susceptibility G188; G545;
G896 disease organism Increased resistance or Improved yield,
appearance, tolerance survival, extended range Erysiphe
Manipulation of response to Increased susceptibility G545; G865;
G881 disease organism Increased resistance or G19; G28; G237; G378;
Improved yield, appearance, tolerance G409; G591; G616; survival,
extended range G869; G1048; G1266 Pseudomonas Manipulation of
response to Increased susceptibility G545 disease organism
Increased resistance or G418; G525 Improved yield, appearance,
tolerance survival, extended range Sclerotinia Manipulation of
response to Increased susceptibility G477; G789; G805 disease
organism Increased resistance or G28 Improved yield, appearance,
tolerance survival, extended range Growth regulator Altered sugar
sensing Alteration of energy balance, Decreased tolerance G26; G38;
G43; G207; photosynthetic rate, to sugars G241; G254; G263;
carbohydrate accumulation, G308; G536; G567; biomass production,
source-sink G680; G912; G996; relationships, senescence; G1068;
G1314; G1337 alteration of storage compound Increased tolerance
G224; G782; G783; accumulation in seeds to sugars G867; G905;
G1493; G1816 Altered C/N sensing G153 Modification of sensing and
respond to changes C and N metabolite levels, regulation of
expression and activity of proteins involved in C and N transport
and metabolism Flowering time Early flowering G142; G145; G146;
Faster generation time; G157; G180; G184; synchrony of flowering;
G185; G208; G227; additional harvests within a G255; G390; G475;
growing season, shortening of G590; G592; G627; breeding programs
G789; G865; G1037; G1242; G1305; G1380; G1545; G1760; G1820; G1842;
G1843; G2010; G2347 Late flowering G8; G157; G192; G198; Increased
yield or biomass, G214; G234; G249; alleviate risk of transgenic
G361; G434; G486; pollen escape, synchrony of G562; G571; G591;
flowering G624; G680; G736; G738; G748; G752; G859; G878; G903;
G9121 G971; G994; G1052; G1073; G1136; G1335; G1435; G1451; G1468;
G1474; G1493 Extended period of G1947 Increased fertilization,
yield, flowering ornamental applications Development and Altered
flower structure Ornamental modification of morphology Stamen G470;
G615; G869; plant architecture, improved or G1425; G1499; G1560
reduced fertility to mitigate Sepal G1075; G1326 escape of
transgenic pollen, Petal G638; G671; G1075; improved fruit size,
shape, G1326; G1449; G1499; number or yield G1560 Pedicel Carpel
Homeotic transformation G134; G638; G779 Multiple alterations G187;
G580; G615; G671; G732; G1075; G1425; G1449; G1499; G1560; G1645
Enlarged floral organs Siliques G1134 Reduced fertility G559; G615;
G638; G671; G779; G977; G1067; G1075; G1266; G1311; G1326; G1560;
G1645; G1947 Aerial rosettes Inflorescence architectural Ornamental
modification of change flower architecture; timing of Altered
branching pattern flowering; altered plant habit for Short
internodes/bushy G385; G580; G865; yield or harvestability benefit;
inflorescences G1274; G1425; G1474 reduction in pollen production
Internode elongation G1274 of genetically modified plants; Terminal
flowers G145 manipulation of seasonality and Poorly developed
annual or perennial habit; inflorescences manipulation of
determinate vs. Lack of inflorescence G1499 indeterminate growth
Altered shoot meristem Ornamental modification of development plant
architecture, manipulation Stem bifurcations G390 of growth and
development, No shoot meristem G1472 increase in leaf numbers,
Reduced meristem cell G1540 modulation of branching differentiation
patterns to provide improved yield or biomass Altered branching
pattern G438; G1499 Ornamental modification of plant architecture,
improved lodging resistance Altered phyllotaxy G638 Ornamental
modification of plant architecture Apical dominance Ornamental
modification of Reduced apical dominance G559; G732; G1255; plant
architecture G1275; G1645 Altered trichome density; Ornamental
modification of development, or structure plant architecture,
increased Reduced or no trichomes G25; G212; G225; plant product
(e.g., diterpenes, G226; G676; G682; cotton) productivity, insect
and G1332; G1816; G2718 herbivore resistance Ectopic
trichomes/altered G247 trichome distribution or development/cell
fate Increased trichome number, G634 density and/or size Stem
morphology and altered G438; G748 Modulation of lignin content;
vascular tissue structure improvement of wood, palatability of
fruits and vegetables Root development Improved yield, stress
tolerance; Increased root growth and G9; G1482 anchorage
proliferation Modification of root architecture Decreased root
growth and mass Increased root hairs G225; G226; G682; Improved
yield, stress tolerance; G1816; G2718 anchorage Altered seed
development, G979 Modification of seed ripening and germination
germination properties and performance Cell differentiation and
cell G1540 Increase in carpel or fruit proliferation development;
improve regeneration of shoots from callus in transformation or
micro-propagation systems Rapid growth and/or Promote faster
development and development reproduction in plants Slow growth
G447; G740; G1062; Ornamental applications G1335; G1468; G1474
Senescence Improvement in response to Premature senescence G636;
G1128 disease, fruit ripening Delayed senescence G249; G571; G878;
G1050 Lethality when overexpressed G374; G515; G578; Herbicide
target; ablation of G877; G1076; G1304 specific tissues or organs
such as stamen to prevent pollen escape Necrosis G24 Disease
resistance Plant size Increased plant size G46; G624; G1073;
Improved yield, biomass, G1435; G1451; G1468 appearance Larger
seedlings G1313 Increased survival and vigor of seedlings, yield
Dwarfed or more G3; G5; G21; G24; G27; Dwarfism, lodging
resistance, compact plants G184; G194; G258; manipulation of
gibberellin G280; G385; G447; responses G636; G670; G671; G738;
G760; G831; G864; G869; G884; G932; G977; G991; G994; G1020; G1023;
G1053; G1067; G1075; G1181; G1228; G1266; G1267; G1275; G1277;
G1309; G1311; G1314; G1317; G1322; G1323; G1326; G1332; G1334;
G1382; G1474; G1545; G1560 Leaf morphology Dark green leaves G385;
G447; G912; Increased photosynthesis, G932; G977; G1128; biomass,
yield; ornamental G1267; G1323; G1327; applications G1334; G1499
Change in leaf shape G32; G224; G428; Ornamental applications G464;
G629; G671; G736; G903; G905; G921; G932; G977; G1038; G1067;
G1073; G1075; G1269; G1468; G1493; G1645 Altered leaf development
G1645 Ornamental applications Altered leaf size Increased yield,
ornamental Increased leaf size G438; G1274; G1451 applications and
mass Gray leaves G1468 Ornamental applications
Variegation Ornamental applications Glossy leaves G975; G1267
Ornamental applications, manipulation of wax composition, amount,
or distribution Cell expansion G521 Ornamental applications;
modification of adaptation to environmental changes or damage Seed
morphology Altered seed coloration G156; G663; G668 Appearance,
ornamental applications Seed size and shape Yield, appearance
Increased seed size G206; G584; G1255 Appearance Decreased seed
size G1145 Appearance Altered seed shape G1062; G1145 Leaf
biochemistry Increased leaf wax G975; G1267 Insect, pathogen
resistance Leaf prenyl lipids Improved antioxidant and Reduced
chlorophyll vitamin E content, nutritional Increase in tocopherols
G280; G987 content; prevention of ARMD; Increased lutein content
G214 modified photosynthetic Decreased lutein content G1133; G1324;
G1328 capability Increase in chlorophyll or G214; G987; G1324
carotenoids Decrease in chlorophyll or G987 carotenoids Leaf
insoluble sugars Alteration of plant cell wall Increased leaf
insoluble G211; G237; G242; composition affecting food sugars
including xylose, G274; G307; G428; digestibility, plant tensile
fucose, rhamnose, G435; G525; G598; strength, wood quality,
pathogen galactose, arabinose or G777; G869; G1309 resistance and
pulp production. mannose Decreased leaf insoluble G307; G428; G1012
Alteration of plant cell wall sugars, including composition
affecting food rhamnose, arabinose or digestibility, plant tensile
mannose strength, wood quality, pathogen resistance and pulp
production. Increased leaf anthocyanins G663 Increased
photosynthesis, biomass, yield; ornamental applications Leaf fatty
acids Modification of nutritional Reduction in leaf G718; G1266;
G1347 content; heat stability of fatty acids essential oils
Increase in leaf G214; G231 fatty acids Altered leaf G185; G681;
G1069; Modification of toxic glucosinolate content G1198; G1322
glucosinolate content in animal feeds; anti-cancer activity Seed
biochemistry Seed oil content Improved oil yield Increased oil
content G162; G229; G231; G291; G456; G464; G561; G590; G598; G732;
G849; G961; G1190; G1198 Decreased oil content G180; G192; G201;
Reduced caloric content G222; G241; G663; G668; G718; G732; G777;
G911; G1323; G1820 Altered oil content G509; G567; G732;
Modification of seed caloric G974; G1451; G1471 content and
nutritional value Seed protein content Improved protein yield,
Increased protein content G201; G222; G226; nutritional value G241;
G629; G630; G663; G668; G718; G732; G865; G911; G1048; G1323;
G1449; G1820 Decreased protein content G229; G231; G418; Reduced
caloric content G456; G464; G732; G1634 Altered protein content
G162; G509; G567; Modification of seed caloric G732; G849 content
and nutritional value Altered seed prenyl G214; G718; G748;
Improved antioxidant and lipid content G883; G1052 vitamin E
content; prevention of ARMD Seed glucosinolate Modification of
toxic Altered profile glucosinolate content in animal feeds;
anti-cancer activity Increased seed anthocyanins Ornamental
applications Increased seed sterols G20 Alteration of human steroid
precursors content, some of which have cholesterol-lowering
activity Increased seed fatty acid G778; G861; G869; Modification
of seed caloric composition G938; G965; G1399; content and
nutritional value G1417 Decreased seed fatty acid G776; G791; G938;
Modification of seed caloric composition G987; G1417 content and
nutritional value Up-regulation of genes G229 Alteration of
tolerance to insect involved in secondary herbivores, UV, oxidative
stress, metabolism and pathogen attack; increased production of
valuable alkaloid- base medicines Root Biochemistry Increased root
anthocyanins G663 Ornamental applications, improved anti-cancer
activity Light response/shade Altered cotyledon, hypocotyl, G351;
G1062; G1322 Potential for increased planting avoidance petiole
development; densities and yield enhancement altered leaf
orientation; constitutive photomorphogenesis; photomorphogenesis in
low light Pigment Increased anthocyanin level G663; G1482 Enhanced
health benefits, improved ornamental appearance, increased stress
resistance, attraction of pollinating and seed-dispersing animals
Abbreviations: N = nitrogen P = phosphate ABA = abscisic acid C/N =
carbon/nitrogen balance
Detailed Description of Genes, Traits and Utilities that Affect
Plant Characteristics
[0328] The following descriptions of traits and utilities
associated with the present transcription factors offer a more
comprehensive description than that provided in Table 6.
Abiotic Stress, General Considerations
[0329] Plant transcription factors can modulate gene expression,
and, in turn, be modulated by the environmental experience of a
plant. Significant alterations in a plant's environment invariably
result in a change in the plant's transcription factor gene
expression pattern. Altered transcription factor expression
patterns generally result in phenotypic changes in the plant.
Transcription factor gene product(s) in transgenic plants then
differ(s) in amounts or proportions from that found in wild-type or
non-transformed plants, and those transcription factors likely
represent polypeptides that are used to alter the response to the
environmental change. By way of example, it is well accepted in the
art that analytical methods based on altered expression patterns
may be used to screen for phenotypic changes in a plant far more
effectively than can be achieved using traditional methods.
[0330] Abiotic Stress: Adult Stage Chilling.
[0331] Enhanced chilling tolerance may extend the effective growth
range of chilling sensitive crop species by allowing earlier
planting or later harvest. a gene that enhances growth under such
conditions could also enhance yields, extend the effective growth
range of chilling sensitive crop species, and reduce fertilizer and
herbicide usage Chilling tolerance could also serve as a model for
understanding how plants adapt to water deficit. Both chilling and
water stress share similar signal transduction pathways and
tolerance/adaptation mechanisms. For example, acclimation to
chilling temperatures can be induced by water stress or treatment
with abscisic acid. Genes induced by low temperature include
dehydrins (or LEA proteins). Dehydrins are also induced by
salinity, abscisic acid, water stress, and during the late stages
of embryogenesis.
[0332] Another large impact of chilling occurs during post-harvest
storage. For example, some fruits and vegetables do not store well
at low temperatures (for example, bananas, avocados, melons, and
tomatoes). The normal ripening process of the tomato is impaired if
it is exposed to cool temperatures. Transcription factor genes
conferring resistance to chilling temperatures, including G256,
G664, G1274 and their equivalogs, may thus enhance tolerance during
post-harvest storage.
[0333] Improved chilling tolerance may be conferred by increased
expression of glycerol-3-phosphate acetyltransferase in
chloroplasts (see, for example, Wolter et al. (1992) et al. EMBO J.
4685-4692.
[0334] Chilling tolerance could also serve as a model for
understanding how plants adapt to water deficit. Both chilling and
water stress share similar sensory transduction pathways and
tolerance/adaptation mechanisms. For example, acclimation to
chilling temperatures can be induced by water stress or treatment
with abscisic acid. Genes induced by low temperature include
dehydrins (or LEA proteins). Dehydrins are also induced by
salinity, abscisic acid, water stress or during the late stages of
embryogenesis. Thus, genes that protect the plant against chilling
could also have a role in protection against water deficit.
[0335] Abiotic Stress: Cold Germination.
[0336] Several of the presently disclosed transcription factor
genes confer better germination and growth in cold conditions. For
example, the improved germination in cold conditions seen with
G224, G256, G664, G1274, and G1322, indicates a role in regulation
of cold responses by these genes and their equivalogs. These genes
might be engineered to manipulate the response to low temperature
stress. Genes that would allow germination and seedling vigor in
the cold would have highly significant utility in allowing seeds to
be planted earlier in the season with a high rate of survival.
Transcription factor genes that confer better survival in cooler
climates allow a grower to move up planting time in the spring and
extend the growing season further into autumn for higher crop
yields. Germination of seeds and survival at temperatures
significantly below that of the mean temperature required for
germination of seeds and survival of non-transformed plants would
increase the potential range of a crop plant into regions in which
it would otherwise fail to thrive.
[0337] Abiotic Stress: Freezing Tolerance and Osmotic Stress.
[0338] Presently disclosed transcription factor genes, including
G188, G325, G489, G1069, G1089, G1412, G1820 and their equivalogs,
that may increase germination rate and/or growth under adverse
osmotic conditions, could impact survival and yield of seeds and
plants. Osmotic stresses may be regulated by specific molecular
control mechanisms that include genes controlling water and ion
movements, functional and structural stress-induced proteins,
signal perception and transduction, and free radical scavenging,
and many others (Wang et al. (2001) Acta Hort. (ISHS) 560:
285-292). Instigators of osmotic stress include freezing, drought
and high salinity, each of which are discussed in more detail
below.
[0339] In many ways, freezing, high salt and drought have similar
effects on plants, not the least of which is the induction of
common polypeptides that respond to these different stresses. For
example, freezing is similar to water deficit in that freezing
reduces the amount of water available to a plant. Exposure to
freezing temperatures may lead to cellular dehydration as water
leaves cells and forms ice crystals in intercellular spaces
(Buchanan, supra). As with high salt concentration and freezing,
the problems for plants caused by low water availability include
mechanical stresses caused by the withdrawal of cellular water.
Thus, the incorporation of transcription factors that modify a
plant's response to osmotic stress or improve tolerance to (e.g.,
by G912 or its equivalogs) into, for example, a crop or ornamental
plant, may be useful in reducing damage or loss. Specific effects
caused by freezing, high salt and drought are addressed below.
[0340] Abiotic Stress: Drought and Low Humidity Tolerance.
[0341] Exposure to dehydration invokes similar survival strategies
in plants as does freezing stress (see, for example, Yelenosky
(1989) Plant Physiol 89: 444-451) and drought stress induces
freezing tolerance (see, for example, Siminovitch et al. (1982)
Plant Physiol 69: 250-255; and Guy et al. (1992) Planta 188:
265-270). In addition to the induction of cold-acclimation
proteins, strategies that allow plants to survive in low water
conditions may include, for example, reduced surface area, or
surface oil or wax production. A number of presently disclosed
transcription factor genes, e.g., G46, G912, and G1820, increase a
plant's tolerance to low water conditions and, along with their
equivalogs, would provide the benefits of improved survival,
increased yield and an extended geographic and temporal planting
range.
[0342] Abiotic Stress: Heat Stress Tolerance.
[0343] The germination of many crops is also sensitive to high
temperatures. Presently disclosed transcription factor genes that
provide increased heat tolerance, including G464, G682, G864, G964,
G1305 and their equivalogs, would be generally useful in producing
plants that germinate and grow in hot conditions, may find
particular use for crops that are planted late in the season, or
extend the range of a plant by allowing growth in relatively hot
climates.
[0344] Abiotic Stress: Salt.
[0345] The genes in Table 6 that provide tolerance to salt may be
used to engineer salt tolerant crops and trees that can flourish in
soils with high saline content or under drought conditions. In
particular, increased salt tolerance during the germination stage
of a plant enhances survival and yield. Presently disclosed
transcription factor genes, including G22, G196, G226, G482, G624,
G801, G867, G884, and their equivalogs that provide increased salt
tolerance during germination, the seedling stage, and throughout a
plant's life cycle, would find particular value for imparting
survival and yield in areas where a particular crop would not
normally prosper.
[0346] Nutrient Uptake and Utilization: Nitrogen and
Phosphorus.
[0347] Presently disclosed transcription factor genes introduced
into plants provide a means to improve uptake of essential
nutrients, including nitrogenous compounds, phosphates, potassium,
and trace minerals. The enhanced performance of, for example, G153,
G225, G226, G682, G1274, G1816, G2718 and other overexpressing
lines under low nitrogen, and G545 and G624 under low phosphorous
conditions indicate that these genes and their equivalogs can be
used to engineer crops that could thrive under conditions of
reduced nutrient availability. Phosphorus, in particular, tends to
be a limiting nutrient in soils and is generally added as a
component in fertilizers. Young plants have a rapid intake of
phosphate and sufficient phosphate is important for yield of root
crops such as carrot, potato and parsnip.
[0348] The effect of these modifications is to increase the
seedling germination and range of ornamental and crop plants. The
utilities of presently disclosed transcription factor genes
conferring tolerance to conditions of low nutrients also include
cost savings to the grower by reducing the amounts of fertilizer
needed, environmental benefits of reduced fertilizer runoff into
watersheds; and improved yield and stress tolerance. In addition,
by providing improved nitrogen uptake capability, these genes can
be used to alter seed protein amounts and/or composition in such a
way that could impact yield as well as the nutritional value and
production of various food products.
[0349] A number of the transcription factor-overexpressing lines
make less anthocyanin on high sucrose plus glutamine indicates that
these genes can be used to modify carbon and nitrogen status, and
hence assimilate partitioning (assimilate partitioning refers to
the manner in which an essential element, such as nitrogen, is
distributed among different pools inside a plant, generally in a
reduced form, for the purpose of transport to various tissues).
[0350] Increased Tolerance of Plants to Oxidative Stress.
[0351] In plants, as in all living things, abiotic and biotic
stresses induce the formation of oxygen radicals, including
superoxide and peroxide radicals. This has the effect of
accelerating senescence, particularly in leaves, with the resulting
loss of yield and adverse effect on appearance. Generally, plants
that have the highest level of defense mechanisms, such as, for
example, polyunsaturated moieties of membrane lipids, are most
likely to thrive under conditions that introduce oxidative stress
(e.g., high light, ozone, water deficit, particularly in
combination). Introduction of the presently disclosed transcription
factor genes, including G477, G789 and their equivalogs, that
increase the level of oxidative stress defense mechanisms would
provide beneficial effects on the yield and appearance of plants.
One specific oxidizing agent, ozone, has been shown to cause
significant foliar injury, which impacts yield and appearance of
crop and ornamental plants. In addition to reduced foliar injury
that would be found in ozone resistant plant created by
transforming plants with some of the presently disclosed
transcription factor genes, the latter have also been shown to have
increased chlorophyll fluorescence (Yu-Sen Chang et al. (2001) Bot.
Bull. Acad. Sin. 42: 265-272).
[0352] Decreased Herbicide Sensitivity.
[0353] Presently disclosed transcription factor genes that confer
resistance or tolerance to herbicides (e.g., glyphosate) will find
use in providing means to increase herbicide applications without
detriment to desirable plants. This would allow for the increased
use of a particular herbicide in a local environment, with the
effect of increased detriment to undesirable species and less harm
to transgenic, desirable cultivars.
[0354] Knockouts of a number of the presently disclosed
transcription factor genes, including G374 and G877, have been
shown to be lethal to developing embryos. Thus, these genes and
their equivalogs are potentially useful as herbicide targets.
[0355] Hormone Sensitivity.
[0356] ABA plays regulatory roles in a host of physiological
processes in all higher as well as in lower plants (Davies et al.
(1991) Abscisic Acid: Physiology and Biochemistry. Bios Scientific
Publishers, Oxford, UK; Zeevaart et al. (1988) Ann Rev Plant
Physiol. Plant Mol. Biol. 49: 439-473; Shimizu-Sato et al. (2001)
Plant Physiol 127: 1405-1413). ABA mediates stress tolerance
responses in higher plants, is a key signal compound that regulates
stomatal aperture and, in concert with other plant signaling
compounds, is implicated in mediating responses to pathogens and
wounding or oxidative damage (for example, see Larkindale et al.
(2002) Plant Physiol. 128: 682-695). In seeds, ABA promotes seed
development, embryo maturation, synthesis of storage products
(proteins and lipids), desiccation tolerance, and is involved in
maintenance of dormancy (inhibition of germination), and apoptosis
(Zeevaart et al. (1988) Ann Rev Plant Physiol. Plant Mol. Biol. 49:
439-473; Davies (1991), supra; Thomas (1993) Plant Cell 5:
1401-1410; and Bethke et al. (1999) Plant Cell 11: 1033-1046). ABA
also affects plant architecture, including root growth and
morphology and root-to-shoot ratios. ABA action and metabolism is
modulated not only by environmental signals but also by endogenous
signals generated by metabolic feedback, transport, hormonal
cross-talk and developmental stage. Manipulation of ABA levels, and
hence by extension the sensitivity to ABA, has been described as a
very promising means to improve productivity, performance and
architecture in plants Zeevaart (1999) in: Biochemistry and
Molecular Biology of Plant Hormones, Hooykaas et al. eds, Elsevier
Science pp 189-207; and Cutler et al. (1999) Trends Plant Sci. 4:
472-478).
[0357] A number of the presently disclosed transcription factor
genes affect plant abscisic acid (ABA) sensitivity, including
G1069, G1412, and G1820. Thus, by affecting ABA sensitivity, these
introduced transcription factor genes and their equivalogs would
affect cold, drought, oxidative and other stress sensitivities,
plant architecture, and yield.
[0358] Several other of the present transcription factor genes have
been used to manipulate ethylene signal transduction and response
pathways. These genes, including G760, G1062, G1134 and their
equivalogs, may thus be used to manipulate the processes influenced
by ethylene, such as seed germination or fruit ripening, and to
improve seed or fruit quality.
[0359] Diseases, Pathogens and Pests.
[0360] A number of the presently disclosed transcription factor
genes have been shown to or are likely to affect a plants response
to various plant diseases, pathogens and pests. The offending
organisms include fungal pathogens Fusarium oxysporum, Botrytis
cinerea, Sclerotinia sclerotiorum, and Erysiphe orontii. Bacterial
pathogens to which resistance may be conferred include Pseudomonas
syringae. Other problem organisms may potentially include
nematodes, mollicutes, parasites, or herbivorous arthropods. In
each case, one or more transformed transcription factor genes may
provide some benefit to the plant to help prevent or overcome
infestation, or be used to manipulate any of the various plant
responses to disease. These mechanisms by which the transcription
factors work could include increasing surface waxes or oils,
surface thickness, or the activation of signal transduction
pathways that regulate plant defense in response to attacks by
herbivorous pests (including, for example, protease inhibitors).
Another means to combat fungal and other pathogens is by
accelerating local cell death or senescence, mechanisms used to
impair the spread of pathogenic microorganisms throughout a plant.
For instance, the best known example of accelerated cell death is
the resistance gene-mediated hypersensitive response, which causes
localized cell death at an infection site and initiates a systemic
defense response. Because many defenses, signaling molecules, and
signal transduction pathways are common to defense against
different pathogens and pests, such as fungal, bacterial, oomycete,
nematode, and insect, transcription factors that are implicated in
defense responses against the fungal pathogens tested may also
function in defense against other pathogens and pests. These
transcription factors include, for example, G28 (improved
resistance or tolerance to Botrytis), G19, G28, G237, G378, G409,
G591, G616, G869, G1048, G1266 (improved resistance or tolerance to
Erysiphe), G418, G525 (improved resistance or tolerance to
Pseudomonas), G28 (improved resistance or tolerance to
Sclerotinia), and their equivalogs.
[0361] Growth Regulator: Sugar Sensing.
[0362] In addition to their important role as an energy source and
structural component of the plant cell, sugars are central
regulatory molecules that control several aspects of plant
physiology, metabolism and development (Hsieh et al. (1998) Proc.
Natl. Acad. Sci. 95: 13965-13970). It is thought that this control
is achieved by regulating gene expression and, in higher plants,
sugars have been shown to repress or activate plant genes involved
in many essential processes such as photosynthesis, glyoxylate
metabolism, respiration, starch and sucrose synthesis and
degradation, pathogen response, wounding response, cell cycle
regulation, pigmentation, flowering and senescence. The mechanisms
by which sugars control gene expression are not understood.
[0363] Because sugars are important signaling molecules, the
ability to control either the concentration of a signaling sugar or
how the plant perceives or responds to a signaling sugar could be
used to control plant development, physiology or metabolism. For
example, the flux of sucrose (a disaccharide sugar used for
systemically transporting carbon and energy in most plants) has
been shown to affect gene expression and alter storage compound
accumulation in seeds. Manipulation of the sucrose signaling
pathway in seeds may therefore cause seeds to have more protein,
oil or carbohydrate, depending on the type of manipulation.
Similarly, in tubers, sucrose is converted to starch which is used
as an energy store. It is thought that sugar signaling pathways may
partially determine the levels of starch synthesized in the tubers.
The manipulation of sugar signaling in tubers could lead to tubers
with a higher starch content.
[0364] Thus, the presently disclosed transcription factor genes
that manipulate the sugar signal transduction pathway, including
G26, G38, G43, G207, G224, G241, G254, G263, G308, G536, G567,
G680, G782, G783, G867, G905, G912, G996, G1068, G1314, G1347, and
G1493, along with their equivalogs, may lead to altered gene
expression to produce plants with desirable traits. In particular,
manipulation of sugar signal transduction pathways could be used to
alter source-sink relationships in seeds, tubers, roots and other
storage organs leading to increase in yield.
[0365] Growth Regulator: C/N Sensing.
[0366] Nitrogen and carbon metabolism are tightly linked in almost
every biochemical pathway in the plant. Carbon metabolites regulate
genes involved in N acquisition and metabolism, and are known to
affect germination and the expression of photosynthetic genes
(Coruzzi et al. (2001) Plant Physiol. 125: 61-64) and hence growth.
Early studies on nitrate reductase (NR) in 1976 showed that NR
activity could be affected by Glc/Suc (Crawford (1995) Plant Cell
7: 859-886; Daniel-Vedele et al. (1996) CR Acad Sci Paris 319:
961-968). Those observations were supported by later experiments
that showed sugars induce NR mRNA in dark-adapted, green seedlings
(Cheng C L, et al. (1992) Proc Natl Acad Sci USA 89: 1861-1864). C
and N may have antagonistic relationships as signaling molecules;
light induction of NR activity and mRNA levels can be mimicked by C
metabolites and N-metabolites cause repression of NR induction in
tobacco (Vincentz et al. (1992) Plant J 3: 315-324). Gene
regulation by C/N status has been demonstrated for a number of
N-metabolic genes (Stitt (1999) Curr. Opin. Plant. Biol. 2:
178-186); Coruzzi et al. (2001) supra). Thus, transcription factor
genes that affect C/N sensing such as G153 or its equivalogs can be
used to alter or improve germination and growth under
nitrogen-limiting conditions.
[0367] Flowering Time: Early, Late and Inducible Flowering.
[0368] Early Flowering.
[0369] Presently disclosed transcription factor genes that
accelerate flowering, which include G142, G145, G146, G153, G157,
G180, G184, G185, G208, G227, G255, G390, G475, G590, G592, G627,
G789, G865, G1037, G1242, G1305, G1380, G1545, G1760, G1820, G1842,
G1843, G1844, G2010, G2347, and their functional equivalogs, could
have valuable applications in such programs, since they allow much
faster generation times. In a number of species, for example,
broccoli, cauliflower, where the reproductive parts of the plants
constitute the crop and the vegetative tissues are discarded, it
would be advantageous to accelerate time to flowering. Accelerating
flowering could shorten crop and tree breeding programs.
Additionally, in some instances, a faster generation time would
allow additional harvests of a crop to be made within a given
growing season. A number of Arabidopsis genes have already been
shown to accelerate flowering when constitutively expressed. These
include LEAFY, APETALA1 and CONSTANS (Mandel et al. (1995) Nature
377: 522-524; Weigel and Nilsson (1995) Nature 377:et al. 495-500;
Simon et al. (1996) Nature 384: 59-62).
[0370] With the advent of transformation systems for tree species
such as oil palm and Eucalyptus, forest biotechnology is a growing
area of interest. Acceleration of flowering, again, might reduce
generation times and make breeding programs feasible which would
otherwise be impossible, such as with plants with multi-year cycles
(such as biennials, e.g. carrot, or fruit trees, such as citrus)
that can be very slow to develop and begin flowering. That this is
a real possibility has already been demonstrated in aspen, a tree
species that usually takes 8-20 years to flower. Transgenic aspen
that over-express the Arabidopsis LFY gene flower after only 5
months. The flowers produced by these young aspen plants, however,
were sterile; the challenge of producing fertile early flowering
trees therefore still remains (Weigel, D. and Nilsson, O., 1995,
Nature 377, 495-500).
[0371] Breeding programs for the development of new varieties can
be limited by the seed-to-seed cycle.
[0372] Inducible Flowering.
[0373] By regulating the expression of potential flowering using
inducible promoters, flowering could be triggered by application of
an inducer chemical. This would allow flowering to be synchronized
across a crop and facilitate more efficient harvesting (e.g.,
strawberry). Such inducible systems could also be used to tune the
flowering of crop varieties to different latitudes. At present,
species such as soybean and cotton are available as a series of
maturity groups that are suitable for different latitudes on the
basis of their flowering time (which is governed by day-length). A
system in which flowering could be chemically controlled would
allow a single high-yielding northern maturity group to be grown at
any latitude. In southern regions such plants could be grown for
longer periods before flowering was induced, thereby increasing
yields. In more northern areas, the induction would be used to
ensure that the crop flowers prior to the first winter frosts.
Currently, the existence of a series of maturity groups for
different latitudes represents a major barrier to the introduction
of new valuable traits. Any trait (e.g. disease resistance) has to
be bred into each of the different maturity groups separately; a
laborious and costly exercise. The availability of single strain,
which could be grown at any latitude, would therefore greatly
increase the potential for introducing new traits to crop species
such as soybean and cotton.
[0374] Late Flowering.
[0375] In a sizeable number of species, for example, root crops,
where the vegetative parts of the plants constitute the crop (e.g.,
onions, lettuce) and the reproductive tissues are discarded, it is
advantageous to identify and incorporate transcription factor genes
that delay or prevent flowering in order to prevent resources being
diverted into reproductive development. For example, G8, G157,
G192, G198, G214, G234, G249, G361, G434, G486, G562, G571, G591,
G624, G680, G736, G738, G748, G752, G859, G878, G903, G9121 G971,
G994, G1052, G1073, G1136, G1335, G1435, G1451, G1468, G1474,
G1493, and equivalogs, delay flowering time in transgenic plants.
Extending vegetative development with presently disclosed
transcription factor genes could thus bring about large increases
in yields. Prevention of flowering can help maximize vegetative
yields and prevent escape of genetically modified organism (GMO)
pollen.
[0376] Presently disclosed transcription factors that extend
flowering time, including G1947, have utility in engineering plants
with longer-lasting flowers for the horticulture industry, and for
extending the time in which the plant is fertile.
[0377] A number of the presently disclosed transcription factors
may extend flowering time, and delay flower abscission, which would
have utility in engineering plants with longer-lasting flowers for
the horticulture industry. This would provide a significant benefit
to the ornamental industry, for both cut flowers and woody plant
varieties (of, for example, maize), as well as have the potential
to lengthen the fertile period of a plant, which could positively
impact yield and breeding programs.
[0378] General Development and Morphology: Flower Structure and
Inflorescence: Architecture, Altered Flower Organs, Reduced
Fertility, Multiple Alterations, Aerial Rosettes, Branching,
Internode Distance, Terminal Flowers And Phase Change.
[0379] Presently disclosed transgenic transcription factors such as
G134, G187, G470, G580, G615, G638, G671, G732, G779, G869, G1075,
G1134, G1326, G1425, G1449, G1499, G1645, and their equivalogs, may
be used to create plants with larger flowers or arrangements of
flowers that are distinct from wild-type or non-transformed
cultivars. This would likely have the most value for the ornamental
horticulture industry, where larger flowers or interesting floral
configurations are generally preferred and command the highest
prices.
[0380] Flower structure may have advantageous or deleterious
effects on fertility, and could be used, for example, to decrease
fertility by the absence, reduction or screening of reproductive
components. In fact, plants that overexpress a sizable number of
the presently disclosed transcription factor genes e.g., G559,
G615, G638, G671, G779, G977, G1067, G1075, G1266, G1311, G1326,
G1645, G1947 and their functional equivalogs, possess reduced
fertility; flowers are infertile and fail to yield seed. These
could be desirable traits, as low fertility could be exploited to
prevent or minimize the escape of the pollen of genetically
modified organisms (GMOs) into the environment.
[0381] The morphological phenotype shown by plants overexpressing
some of the present transcription factors indicate that these genes
and their equivalogs may be used to alter inflorescence
architecture. In particular, a reduction in pedicel length and a
change in the position at which flowers and fruits are held, might
influence harvesting or pollination efficiency. Additionally, such
changes may produce attractive novel forms for the ornamental
markets.
[0382] One interesting application for manipulation of flower
structure, for example, by introduced transcription factors could
be in the increased production of edible flowers or flower parts,
including saffron, which is derived from the stigmas of Crocus
sativus.
[0383] Genes that later silique conformation in brassicates may be
used to modify fruit ripening processes in brassicates and other
plants, which may positively affect seed or fruit quality.
[0384] A number of the presently disclosed transcription factors
may affect the timing of phase changes in plants. Since the timing
or phase changes generally affects a plant's eventual size, these
genes may prove beneficial by providing means for improving yield
and biomass.
[0385] General Development and Morphology: Shoot Meristem and
Branching Patterns.
[0386] Several of the presently disclosed transcription factor
genes, including G390, when introduced into plants, have been shown
to cause stem bifurcations in developing shoots in which the shoot
meristems split to form two or three separate shoots. These
transcription factors and their functional equivalogs may thus be
used to manipulate branching. This would provide a unique
appearance, which may be desirable in ornamental applications, and
may be used to modify lateral branching for use in the forestry
industry. A reduction in the formation of lateral branches (e.g.,
with G1499 or equivalogs) could reduce knot formation. Conversely,
increasing the number of lateral branches (e.g., with G438 or
equivalogs) could provide utility when a plant is used as a view-
or windscreen.
[0387] General Development and Morphology: Apical Dominance:
[0388] The modified expression of presently disclosed transcription
factors (e.g., G559, G732, G1255, G1275, G1645, and their
equivalogs) that reduce apical dominance could be used in
ornamental horticulture, for example, to modify plant architecture,
for example, to produce a shorter, more bushy stature than wild
type. The latter form would have ornamental utility as well as
provide increased resistance to lodging.
[0389] General Development and Morphology: Trichome Density,
Development or Structure.
[0390] Several of the presently disclosed transcription factor
genes have been used to modify trichome number, density, trichome
cell fate, amount of trichome products produced by plants, or
produce ectopic trichome formation. These may include G25, G212,
G225, G226, G247, G634, G676, G682, G1332 G1816, G2718, and their
equivalogs. In most cases where the metabolic pathways are
impossible to engineer, increasing trichome density or size on
leaves may be the only way to increase plant productivity. Thus, by
increasing trichome density, size or type, these trichome-affecting
genes and their functional equivalogs would have profound utilities
in molecular farming practices by making use of trichomes as a
manufacturing system for complex secondary metabolites.
[0391] Trichome glands on the surface of many higher plants produce
and secrete exudates that give protection from the elements and
pests such as insects, microbes and herbivores. These exudates may
physically immobilize insects and spores, may be insecticidal or
ant-microbial or they may act as allergens or irritants to protect
against herbivores. By modifying trichome location, density or
activity with presently disclosed transcription factors that modify
these plant characteristics, plants that are better protected and
higher yielding may be the result.
[0392] A potential application for these trichome-affecting genes
and their equivalogs also exists in cotton: cotton fibers are
modified unicellular trichomes that develop from the outer ovule
epidermis. In fact, only about 30% of these epidermal cells develop
into trichomes, but all have the potential to develop a trichome
fate. Trichome-affecting genes can trigger an increased number of
these cells to develop as trichomes and thereby increase the yield
of cotton fibers. Since the mallow family is closely related to the
Brassica family, genes involved in trichome formation will likely
have homologs in cotton or function in cotton.
[0393] If the effects on trichome patterning reflect a general
change in heterochronic processes, trichome-affecting transcription
factors or their equivalogs can be used to modify the way meristems
and/or cells develop during different phases of the plant life
cycle. In particular, altering the timing of phase changes could
afford positive effects on yield and biomass production.
[0394] General Development and Morphology: Stem Morphology and
Altered Vascular Tissue Structure.
[0395] Plants transformed with transcription factor genes that
modify stem morphology or lignin content may be used to affect
overall plant architecture and the distribution of lignified fiber
cells within the stem.
[0396] Modulating lignin content might allow the quality of wood
used for furniture or construction to be improved. Lignin is energy
rich; increasing lignin composition could therefore be valuable in
raising the energy content of wood used for fuel. Conversely, the
pulp and paper industries seek wood with a reduced lignin content.
Currently, lignin must be removed in a costly process that involves
the use of many polluting chemicals. Consequently, lignin is a
serious barrier to efficient pulp and paper production (Tzfira et
al. (1998) TIBTECH 16: 439-446; Robinson (1999) Nature
Biotechnology 17: 27-30). In addition to forest biotechnology
applications, changing lignin content by selectively expressing or
repressing transcription factors in fruits and vegetables might
increase their palatability.
[0397] Transcription factors that modify stem structure, including
G438, G748 and their equivalogs, may also be used to achieve
reduction of higher-order shoot development, resulting in
significant plant architecture modification. Overexpression of the
genes that encode these transcription factors in woody plants might
result in trees that lack side branches, and have fewer knots in
the wood. Altering branching patterns could also have applications
amongst ornamental and agricultural crops. For example,
applications might exist in any species where secondary shoots
currently have to be removed manually, or where changes in
branching pattern could increase yield or facilitate more efficient
harvesting.
[0398] General Development and Morphology: Altered Root
Development.
[0399] By modifying the structure or development of roots by
transforming into a plant one or more of the presently disclosed
transcription factor genes, including G9, G225, G226, G1482, and
their equivalogs, plants may be produced that have the capacity to
thrive in otherwise unproductive soils. For example, grape roots
extending further into rocky soils would provide greater anchorage,
greater coverage with increased branching, or would remain viable
in waterlogged soils, thus increasing the effective planting range
of the crop and/or increasing yield and survival. It may be
advantageous to manipulate a plant to produce short roots, as when
a soil in which the plant will be growing is occasionally flooded,
or when pathogenic fungi or disease-causing nematodes are
prevalent.
[0400] In addition, presently disclosed transcription factors
including G225; G226; G682; G1816; G2718 and their equivalogs may
be used to increase root hair density and thus increase tolerance
to abiotic stresses, thereby improving yield and quality.
[0401] General Development and Morphology: Seed Development,
Ripening and Germination Rate.
[0402] A number of the presently disclosed transcription factor
genes (e.g., G979) have been shown to modify seed development and
germination rate, including when the seeds are in conditions
normally unfavorable for germination (e.g., cold, heat or salt
stress, or in the presence of ABA), and may, along with functional
equivalogs, thus be used to modify and improve germination rates
under adverse conditions.
[0403] General Development and Morphology: Cell Differentiation and
Cell Proliferation.
[0404] Several of the disclosed transcription factors regulate cell
proliferation and/or differentiation, including G1540 and its
functional equivalogs. Control of these processes could have
valuable applications in plant transformation, cell culture or
micro-propagation systems, as well as in control of the
proliferation of particular useful tissues or cell types.
Transcription factors that induce the proliferation of
undifferentiated cells can be operably linked with an inducible
promoter to promote the formation of callus that can be used for
transformation or production of cell suspension cultures.
Transcription factors that prevent cells from differentiating, such
as G1540 or its equivalogs, could be used to confer stem cell
identity to cultured cells. Transcription factors that promote
differentiation of shoots could be used in transformation or
micro-propagation systems, where regeneration of shoots from callus
is currently problematic. In addition, transcription factors that
regulate the differentiation of specific tissues could be used to
increase the proportion of these tissues in a plant. Genes that
promote the differentiation of carpel tissue could be introduced
into commercial species to induce formation of increased numbers of
carpels or fruits. A particular application might exist in saffron,
one of the world's most expensive spices. Saffron filaments, or
threads, are actually the dried stigmas of the saffron flower,
Crocus sativus Linneaus. Each flower contains only three stigmas,
and more than 75,000 of these flowers are needed to produce just
one pound of saffron filaments. An increase in carpel number would
increase the quantity of stigmatic tissue and improve yield.
[0405] General Development and Morphology: Cell Expansion.
[0406] Plant growth results from a combination of cell division and
cell expansion. Transcription factors such as G521 or its
equivalogs may be useful in regulation of cell expansion. Altered
regulation of cell expansion could affect stem length, an important
agronomic characteristic. For instance, short cultivars of wheat
contributed to the Green Revolution, because plants that put fewer
resources into stem elongation allocate more resources into
developing seed and produce higher yield. These plants are also
less vulnerable to wind and rain damage. These cultivars were found
to be altered in their sensitivity to gibberellins, hormones that
regulate stem elongation through control of both cell expansion and
cell division. Altered cell expansion in leaves could also produce
novel and ornamental plant forms.
[0407] General Development and Morphology: Phase Change and Floral
Reversion.
[0408] Transcription factors that regulate phase change can
modulate the developmental programs of plants and regulate
developmental plasticity of the shoot meristem. In particular,
these genes might be used to manipulate seasonality and influence
whether plants display an annual or perennial habit.
[0409] General Development and Morphology: Rapid Growth and/or
Development.
[0410] A number of the presently disclosed transcription factor
genes have been shown to have significant effects on plant growth
rate and development. These observations have included, for
example, more rapid or delayed growth and development of
reproductive organs. Thus, by causing more rapid development, genes
that induce rapid growth or development and their functional
equivalogs would prove useful for regions with short growing
seasons; other transcription factors that delay development may be
useful for regions with longer growing seasons. Accelerating plant
growth would also improve early yield or increase biomass at an
earlier stage, when such is desirable (for example, in producing
forestry products or vegetable sprouts for consumption).
Transcription factors that promote faster development such as G807
and its functional equivalogs may also be used to modify the
reproductive cycle of plants.
[0411] General Development and Morphology: Slow Growth Rate.
[0412] A number of the presently disclosed transcription factor
genes, including G447, G740, G1062, G1335, G1468, and G1474, have
been shown to have significant effects on retarding plant growth
rate and development. These observations have included, for
example, delayed growth and development of reproductive organs.
Slow growing plants may be highly desirable to ornamental
horticulturists, both for providing house plants that display
little change in their appearance over time, or outdoor plants for
which wild-type or rapid growth is undesirable (e.g., ornamental
palm trees). Slow growth may also provide for a prolonged fruiting
period, thus extending the harvesting season, particularly in
regions with long growing seasons. Slow growth could also provide a
prolonged period in which pollen is available for improved self- or
cross-fertilization, or cross-fertilization of cultivars that
normally flower over non-overlapping time periods. The latter
aspect may be particularly useful to plants comprising two or more
distinct grafted cultivars (e.g., fruit trees) with normally
non-overlapping flowering periods.
[0413] General Development and Morphology: Senescence.
[0414] Presently disclosed transcription factor genes may be used
to alter senescence responses in plants. Although leaf senescence
is thought to be an evolutionary adaptation to recycle nutrients,
the ability to control senescence in an agricultural setting has
significant value. For example, a delay in leaf senescence in some
maize hybrids is associated with a significant increase in yields
and a delay of a few days in the senescence of soybean plants can
have a large impact on yield. In an experimental setting, tobacco
plants engineered to inhibit leaf senescence had a longer
photosynthetic lifespan, and produced a 50% increase in dry weight
and seed yield (Gan and Amasino (1995) Science 270: 1986-1988).
Delayed flower senescence caused by overexpression of transcription
factors (e.g., G249, G571, G878, G1050 or their equivalogs) may
generate plants that retain their blossoms longer and this may be
of potential interest to the ornamental horticulture industry, and
delayed foliar and fruit senescence could improve post-harvest
shelf-life of produce.
[0415] Premature senescence caused by, for example, G636, G1128 and
their equivalogs may be used to improve a plant's response to
disease and hasten fruit ripening.
[0416] Growth Rate and Development: Lethality and Necrosis.
[0417] Overexpression of transcription factors, for example, G24,
G374, G515; G578, G877, G1076, G1304 and their equivalogs that have
a role in regulating cell death may be used to induce lethality in
specific tissues or necrosis in response to pathogen attack. For
example, if a transcription factor gene inducing lethality or
necrosis was specifically active in gametes or reproductive organs,
its expression in these tissues would lead to ablation and
subsequent male or female sterility. Alternatively, under
pathogen-regulated expression, a necrosis-inducing transcription
factor can restrict the spread of a pathogen infection through a
plant.
[0418] Plant Size: Large Plants.
[0419] Plants overexpressing G46, G624, G1073, G1435, G1451, and
G1468, for example, have been shown to be larger than controls. For
some ornamental plants, the ability to provide larger varieties
with these genes or their equivalogs may be highly desirable. For
many plants, including fruit-bearing trees, trees that are used for
lumber production, or trees and shrubs that serve as view or wind
screens, increased stature provides improved benefits in the forms
of greater yield or improved screening. Crop species may also
produce higher yields on larger cultivars, particularly those in
which the vegetative portion of the plant is edible.
[0420] Plant Size: Large Seedlings.
[0421] Presently disclosed transcription factor genes, that produce
large seedlings can be used to produce crops that become
established faster. Large seedlings are generally hardier, less
vulnerable to stress, and better able to out-compete weed species.
Seedlings transformed with presently disclosed transcription
factors, including G1313, for example, have been shown to possess
larger cotyledons and were more developmentally advanced than
control plants. Rapid seedling development made possible by
manipulating expression of these genes or their equivalogs is
likely to reduce loss due to diseases particularly prevalent at the
seedling stage (e.g., damping off) and is thus important for
survivability of plants germinating in the field or in controlled
environments.
[0422] Plant Size: Dwarfed Plants.
[0423] Presently disclosed transcription factor genes, including
G24 and many others and their equivalogs, for example, that can be
used to decrease plant stature are likely to produce plants that
are more resistant to damage by wind and rain, have improved
lodging resistance, or more resistant to heat or low humidity or
water deficit. Dwarf plants are also of significant interest to the
ornamental horticulture industry, and particularly for home garden
applications for which space availability may be limited.
[0424] Plant Size: Fruit Size and Number.
[0425] Introduction of presently disclosed transcription factor
genes that affect fruit size will have desirable impacts on fruit
size and number, which may comprise increases in yield for fruit
crops, or reduced fruit yield, such as when vegetative growth is
preferred (e.g., with bushy ornamentals, or where fruit is
undesirable, as with ornamental olive trees).
[0426] Leaf Morphology: Dark Leaves.
[0427] Color-affecting components in leaves include chlorophylls
(generally green), anthocyanins (generally red to blue) and
carotenoids (generally yellow to red). Transcription factor genes
that increase these pigments in leaves, including G385, G447, G912,
G932, G977, G1128, G1267, G1323, G1327, G1334, G1499, and their
equivalogs, may positively affect a plant's value to the ornamental
horticulture industry. Variegated varieties, in particular, would
show improved contrast. Other uses that result from overexpression
of transcription factor genes include improvements in the
nutritional value of foodstuffs. For example, lutein is an
important nutraceutical; lutein-rich diets have been shown to help
prevent age-related macular degeneration (ARMD), the leading cause
of blindness in elderly people. Consumption of dark green leafy
vegetables has been shown in clinical studies to reduce the risk of
ARMD.
[0428] Enhanced chlorophyll and carotenoid levels could also
improve yield in crop plants. Lutein, like other xanthophylls such
as zeaxanthin and violaxanthin, is an essential component in the
protection of the plant against the damaging effects of excessive
light. Specifically, lutein contributes, directly or indirectly, to
the rapid rise of non-photochemical quenching in plants exposed to
high light. Crop plants engineered to contain higher levels of
lutein could therefore have improved photo-protection, leading to
less oxidative damage and better growth under high light (e.g.,
during long summer days, or at higher altitudes or lower latitudes
than those at which a non-transformed plant would survive).
Additionally, elevated chlorophyll levels increases photosynthetic
capacity.
[0429] Leaf Morphology: Changes in Leaf Shape.
[0430] Presently disclosed transcription factors produce marked and
diverse effects on leaf development and shape. The transcription
factors include G32; G224; G428; G464; G629; G671; G736; G903;
G905; G921; G932; G977; G1038; G1067; G1073; G1075; G1269; G1493;
G1645, G1468, and their equivalogs. At early stages of growth,
transgenic seedlings have developed narrow, upward pointing leaves
with long petioles, possibly indicating a disruption in
circadian-clock controlled processes or nyctinastic movements.
Other transcription factor genes can be used to alter leaf shape in
a significant manner from wild type, some of which may find use in
ornamental applications.
[0431] Leaf Morphology: Altered Leaf Size.
[0432] Large leaves, such as those produced in plants
overexpressing G438, G1274, G1451 and their functional equivalogs,
generally increase plant biomass. This provides benefit for crops
where the vegetative portion of the plant is the marketable
portion.
[0433] Leaf Morphology: Light Green, Gray and Variegated
Leaves.
[0434] Transcription factor genes that provide an altered
appearance, including G1468 and its equivalogs, may positively
affect a plant's value to the ornamental horticulture industry.
[0435] Leaf Morphology: Glossy Leaves.
[0436] Transcription factor genes such as G1267 and its equivalogs
that induce the formation of glossy leaves generally do so by
elevating levels of epidermal wax. Thus, the genes could be used to
engineer changes in the composition and amount of leaf surface
components, including waxes. The ability to manipulate wax
composition, amount, or distribution could modify plant tolerance
to drought and low humidity, or resistance to insects or pathogens.
Additionally, wax may be a valuable commodity in some species, and
altering its accumulation and/or composition could enhance
yield.
[0437] Seed Morphology: Altered Seed Coloration.
[0438] Presently disclosed transcription factor genes, including
G156, and G668 have been used to modify seed color, which, along
with the equivalogs of these genes, could provide added appeal to
seeds or seed products.
[0439] Seed Morphology: Altered Seed Size and Shape.
[0440] The introduction of presently disclosed transcription factor
genes into plants that increase (e.g., G206, G584, G1255) or
decrease (e.g., 01145), the size of seeds may have a significant
impact on yield and appearance, particularly when the product is
the seed itself (e.g., in the case of grains, legumes, nuts, etc.).
Seed size, in addition to seed coat integrity, thickness and
permeability, seed water content and a number of other components
including antioxidants and oligosaccharides, also affects affect
seed longevity in storage, with larger seeds often being more
desirable for prolonged storage.
[0441] Transcription factor genes that alter seed shape, including
G1062, G1145 and their equivalogs may have both ornamental
applications and improve or broaden the appeal of seed
products.
[0442] Leaf Biochemistry: Increased Leaf Wax.
[0443] Overexpression of transcription factors genes, including
G975 and its equivalogs, which results in increased leaf wax could
be used to manipulate wax composition, amount, or distribution.
These transcription factors can improve yield in those plants and
crops from which wax is a valuable product. The genes may also be
used to modify plant tolerance to drought and/or low humidity or
resistance to insects, as well as plant appearance (glossy leaves).
The effect of increased wax deposition on leaves of a plant like
may improve water use efficiency. Manipulation of these genes may
reduce the wax coating on sunflower seeds; this wax fouls the oil
extraction system during sunflower seed processing for oil. For the
latter purpose or any other where wax reduction is valuable,
antisense or cosuppression of the transcription factor genes in a
tissue-specific manner would be valuable.
[0444] Leaf Biochemistry: Leaf Prenyl Lipids, Including
Tocopherol.
[0445] Prenyl lipids play a role in anchoring proteins in membranes
or membranous organelles. Thus modifying the prenyl lipid content
of seeds and leaves could affect membrane integrity and function.
One important group of prenyl lipids, the tocopherols, have both
anti-oxidant and vitamin E activity. A number of presently
disclosed transcription factor genes, including G214, G280, G987,
G1133, G1324, and G1328 have been shown to modify the prenyl lipid
content of leaves in plants, and these genes and their equivalogs
may thus be used to alter prenyl lipid content of leaves.
[0446] Leaf Biochemistry: Altered Leaf Insoluble Sugars.
[0447] Overexpression of a number of presently disclosed
transcription factors, including G211, G237, G242, G274, G307,
G428, G435, G525, G598, G777, G869, G1012, and G1309, resulted in
plants with altered leaf insoluble sugar content. This
transcription factor and its equivalogs that alter plant cell wall
composition have several potential applications including altering
food digestibility, plant tensile strength, wood quality, pathogen
resistance and in pulp production. In particular, hemicellulose is
not desirable in paper pulps because of its lack of strength
compared with cellulose. Thus modulating the amounts of cellulose
vs. hemicellulose in the plant cell wall is desirable for the
paper/lumber industry. Increasing the insoluble carbohydrate
content in various fruits, vegetables, and other edible consumer
products will result in enhanced fiber content. Increased fiber
content would not only provide health benefits in food products,
but might also increase digestibility of forage crops. In addition,
the hemicellulose and pectin content of fruits and berries affects
the quality of jam and catsup made from them. Changes in
hemicellulose and pectin content could result in a superior
consumer product.
[0448] Leaf Biochemistry: Increased Leaf Anthocyanin.
[0449] Several presently disclosed transcription factor genes,
including G663 and its equivalogs, may be used to alter anthocyanin
production in numerous plant species. Expression of presently
disclosed transcription factor genes that increase flavonoid
production in plants, including anthocyanins and condensed tannins,
may be used to alter in pigment production for horticultural
purposes, and possibly increasing stress resistance. A number of
flavonoids have been shown to have antimicrobial activity and could
be used to engineer pathogen resistance. Several flavonoid
compounds have health promoting effects such as inhibition of tumor
growth, prevention of bone loss and prevention of the oxidation of
lipids. Increased levels of condensed tannins, in forage legumes
would be an important agronomic trait because they prevent pasture
bloat by collapsing protein foams within the rumen. For a review on
the utilities of flavonoids and their derivatives, refer to Dixon
et al. (1999) Trends Plant Sci. 4: 394-400.
[0450] Leaf and Seed Biochemistry: Altered Fatty Acid Content.
[0451] A number of the presently disclosed transcription factor
genes have been shown to alter the fatty acid composition in
plants, and seeds and leaves in particular. This modification
suggests several utilities, including improving the nutritional
value of seeds or whole plants. Dietary fatty acids ratios have
been shown to have an effect on, for example, bone integrity and
remodeling (see, for example, Weiler (2000) Pediatr. Res. 47:5
692-697). The ratio of dietary fatty acids may alter the precursor
pools of long-chain polyunsaturated fatty acids that serve as
precursors for prostaglandin synthesis. In mammalian connective
tissue, prostaglandins serve as important signals regulating the
balance between resorption and formation in bone and cartilage.
Thus dietary fatty acid ratios altered in seeds may affect the
etiology and outcome of bone loss.
[0452] Transcription factors that reduce leaf fatty acids, for
example, 16:3 fatty acids, may be used to control thylakoid
membrane development, including proplastid to chloroplast
development. The genes that encode these transcription factors
(e.g., G718, G1266, and G1347) might thus be useful for controlling
the transition from proplastid to chromoplast in fruits and
vegetables. It may also be desirable to change the expression of
these genes to prevent cotyledon greening in Brassica napus or B.
campestris to avoid green oil due to early frost.
[0453] Transcription factor genes that increase leaf fatty acid
production, including G214 and G231, could potentially be used to
manipulate seed composition, which is very important for the
nutritional value and production of various food products. A number
of transcription factor genes are involved in mediating an aspect
of the regulatory response to temperature. These genes may be used
to alter the expression of desaturases that lead to production of
18:3 and 16:3 fatty acids, the balance of which affects membrane
fluidity and mitigates damage to cell membranes and photosynthetic
structures at high and low temperatures.
[0454] Leaf and Seed Biochemistry: Glucosinolates.
[0455] A number of glucosinolates have been shown to have
anti-cancer activity; thus, increasing the levels or composition of
these compounds by introducing several of the presently disclosed
transcription factors, including G185, G681, G1069; G1198, and
G1322, can have a beneficial effect on human diet.
[0456] Glucosinolates are undesirable components of the oilseeds
used in animal feed since they produce toxic effects.
Low-glucosinolate varieties of canola, for example, have been
developed to combat this problem. Glucosinolates form part of a
plant's natural defense against insects. Modification of
glucosinolate composition or quantity by introducing transcription
factors that affect these characteristics can therefore afford
increased protection from herbivores. Furthermore, in edible crops,
tissue specific promoters can be used to ensure that these
compounds accumulate specifically in tissues, such as the
epidermis, which are not taken for consumption.
[0457] Leaf and Seed Biochemistry: Production of Seed and Leaf
Phytosterols:
[0458] Presently disclosed transcription factor genes that modify
levels of phytosterols in plants may have at least two utilities.
First, phytosterols are an important source of precursors for the
manufacture of human steroid hormones. Thus, regulation of
transcription factor expression or activity could lead to elevated
levels of important human steroid precursors for steroid
semi-synthesis. For example, transcription factors that cause
elevated levels of campesterol in leaves, or sitosterols and
stigmasterols in seed crops, would be useful for this purpose.
Phytosterols and their hydrogenated derivatives phytostanols also
have proven cholesterol-lowering properties, and transcription
factor genes that modify the expression of these compounds in
plants would thus provide health benefits.
[0459] Seed Biochemistry: Modified Seed Oil and Fatty Acid
Content.
[0460] The composition of seeds, particularly with respect to seed
oil amounts and/or composition, is very important for the
nutritional and caloric value and production of various food and
feed products. Several of the presently disclosed transcription
factor genes in seed lipid saturation that alter seed oil content
could be used to improve the heat stability of oils or to improve
the nutritional quality of seed oil, by, for example, reducing the
number of calories in seed by decreasing oil or fatty acid content
(e.g., G180, G192, G201, G222, G241, G663, G668, G718, G732, G777,
G911, G1323, and G1820), increasing the number of calories in
animal feeds by increasing oil or fatty acid content (e.g. G162,
G229, G231, G291, G456, G464, G561, G590, G598, G732, G849, G961,
G1190, and G1198), or altering seed oil content (G509, G567, G732,
G974, G1451, and G1471).
[0461] Seed Biochemistry: Modified Seed Protein Content.
[0462] As with seed oils, the composition of seeds, particularly
with respect to protein amounts and/or composition, is very
important for the nutritional value and production of various food
and feed products. A number of the presently disclosed
transcription factor genes modify the protein concentrations in
seeds, including G201, G222, G226, G241, G629, G630, G663, G668,
G718, G732, G865, G911, G1048, G1323, G1449, and G1820, which
increase seed protein, G229, G231, G418, G456, G464, G732, and
G1634, which decrease seed protein, and G162, G509, G567, G732, and
G849, which alter seed protein content, would provide nutritional
benefits, and may be used to prolong storage, increase seed pest or
disease resistance, or modify germination rates.
[0463] Seed Biochemistry: Seed Prenyl Lipids.
[0464] Prenyl lipids play a role in anchoring proteins in membranes
or membranous organelles. Thus, presently disclosed transcription
factor genes and their equivalogs that modify the prenyl lipid
content of seeds and leaves could affect membrane integrity and
function. A number of presently disclosed transcription factor
genes, including G214, G718, G748, G883, and G1052, have been shown
to modify the tocopherol composition of plants. .alpha.-Tocopherol
is better known as vitamin E. Tocopherols such as .alpha.- and
.gamma.-tocopherol both have anti-oxidant activity.
[0465] Seed Biochemistry: Increased Seed Anthocyanin.
[0466] Several presently disclosed transcription factor genes,
including G663 and its equivalogs, may be used to alter anthocyanin
production in the seeds of plants. As with leaf anthocyanins,
expression of presently disclosed transcription factor genes that
increase flavonoid (anthocyanins and condensed tannins) production
in seeds, including G663 and its equivalogs, may be used to alter
in pigment production for horticultural purposes, and possibly
increasing stress resistance, antimicrobial activity and health
promoting effects such as inhibition of tumor growth, prevention of
bone loss and prevention of the oxidation of lipids.
[0467] Root Biochemistry: Increased Root Anthocyanin.
[0468] Presently disclosed transcription factor genes, including
G663, may be used to alter anthocyanin production in the root of
plants. As described above for seed anthocyanins, expression of
presently disclosed transcription factor genes that increase
flavonoid (anthocyanins and condensed tannins) production in seeds,
including G663 and its equivalogs, may be used to alter in pigment
production for horticultural purposes, and possibly increasing
stress resistance, antimicrobial activity and health promoting
effects such as inhibition of tumor growth, prevention of bone loss
and prevention of the oxidation of lipids.
[0469] Light Response/Shade Avoidance:
[0470] altered cotyledon, hypocotyl, petiole development, altered
leaf orientation, constitutive photomorphogenesis,
photomorphogenesis in low light. Presently disclosed transcription
factor genes, including G351, G1062, and G1322, that modify a
plant's response to light may be useful for modifying plant growth
or development, for example, photomorphogenesis in poor light, or
accelerating flowering time in response to various light
intensities, quality or duration to which a non-transformed plant
would not similarly respond. Examples of such responses that have
been demonstrated include leaf number and arrangement, and early
flower bud appearances. Elimination of shading responses may lead
to increased planting densities with subsequent yield enhancement.
As these genes may also alter plant architecture, they may find use
in the ornamental horticulture industry.
[0471] Pigment: Increased Anthocyanin Level in Various Plant Organs
and Tissues.
[0472] In addition to seed, leaves and roots, as mentioned above,
several presently disclosed transcription factor genes (i.e., G663
and equivalogs) can be used to alter anthocyanin levels in one or
more tissues, depending on the organ in which these genes are
expressed. The potential utilities of these genes include
alterations in pigment production for horticultural purposes, and
possibly increasing stress resistance, antimicrobial activity and
health promoting effects such as inhibition of tumor growth,
prevention of bone loss and prevention of the oxidation of
lipids.
[0473] Miscellaneous Biochemistry: Diterpenes in Leaves and Other
Plant Parts.
[0474] Depending on the plant species, varying amounts of diverse
secondary biochemicals (often lipophilic terpenes) are produced and
exuded or volatilized by trichomes. These exotic secondary
biochemicals, which are relatively easy to extract because they are
on the surface of the leaf, have been widely used in such products
as flavors and aromas, drugs, pesticides and cosmetics. Thus, the
overexpression of genes that are used to produce diterpenes in
plants may be accomplished by introducing transcription factor
genes that induce said overexpression. One class of secondary
metabolites, the diterpenes, can effect several biological systems
such as tumor progression, prostaglandin synthesis and tissue
inflammation. In addition, diterpenes can act as insect pheromones,
termite allomones, and can exhibit neurotoxic, cytotoxic and
antimitotic activities. As a result of this functional diversity,
diterpenes have been the target of research several pharmaceutical
ventures. In most cases where the metabolic pathways are impossible
to engineer, increasing trichome density or size on leaves may be
the only way to increase plant productivity.
[0475] Miscellaneous Biochemistry: Production of Miscellaneous
Secondary Metabolites.
[0476] Microarray data suggests that flux through the aromatic
amino acid biosynthetic pathways and primary and secondary
metabolite biosynthetic pathways are up-regulated. Gene coding for
enzymes involved in alkaloid biosynthesis include indole-3-glycerol
phosphatase and strictosidine synthase are induced in G229
overexpressors. Genes for enzymes involved in aromatic amino acid
biosynthesis are also up-regulated including tryptophan synthase
and tyrosine transaminase. Phenylalanine ammonia lyase, chalcone
synthase and trans-cinnamate mono-oxygenase are also induced and
are involved in phenylpropenoid biosynthesis.
Antisense and Co-suppression
[0477] In addition to expression of the nucleic acids of the
invention as gene replacement or plant phenotype modification
nucleic acids, the nucleic acids are also useful for sense and
anti-sense suppression of expression, e.g., to down-regulate
expression of a nucleic acid of the invention, e.g., as a further
mechanism for modulating plant phenotype. That is, the nucleic
acids of the invention, or subsequences or anti-sense sequences
thereof, can be used to block expression of naturally occurring
homologous nucleic acids. A variety of sense and anti-sense
technologies are known in the art, e.g., as set forth in
Lichtenstein and Nellen (1997) Antisense Technology: A Practical
Approach IRL Press at Oxford University Press, Oxford, U.K.
Antisense regulation is also described in Crowley et al. (1985)
Cell 43: 633-641; Rosenberg et al. (1985) Nature 313: 703-706;
Preiss et al. (1985) Nature 313: 27-32; Melton (1985) Proc. Natl.
Acad. Sci. 82: 144-148; Izant and Weintraub (1985) Science 229:
345-352; and Kim and Wold (1985) Cell 42: 129-138. Additional
methods for antisense regulation are known in the art. Antisense
regulation has been used to reduce or inhibit expression of plant
genes in, for example in European Patent Publication No. 271988.
Antisense RNA may be used to reduce gene expression to produce a
visible or biochemical phenotypic change in a plant (Smith et al.
(1988) Nature, 334: 724-726; Smith et al. (1990) Plant Mol. Biol.
14: 369-379). In general, sense or anti-sense sequences are
introduced into a cell, where they are optionally amplified, e.g.,
by transcription. Such sequences include both simple
oligonucleotide sequences and catalytic sequences such as
ribozymes.
[0478] For example, a reduction or elimination of expression (i.e.,
a "knock-out") of a transcription factor or transcription factor
homolog polypeptide in a transgenic plant, e.g., to modify a plant
trait, can be obtained by introducing an antisense construct
corresponding to the polypeptide of interest as a cDNA. For
antisense suppression, the transcription factor or homolog cDNA is
arranged in reverse orientation (with respect to the coding
sequence) relative to the promoter sequence in the expression
vector. The introduced sequence need not be the full length cDNA or
gene, and need not be identical to the cDNA or gene found in the
plant type to be transformed. Typically, the antisense sequence
need only be capable of hybridizing to the target gene or RNA of
interest. Thus, where the introduced sequence is of shorter length,
a higher degree of homology to the endogenous transcription factor
sequence will be needed for effective antisense suppression. While
antisense sequences of various lengths can be utilized, preferably,
the introduced antisense sequence in the vector will be at least 30
nucleotides in length, and improved antisense suppression will
typically be observed as the length of the antisense sequence
increases. Preferably, the length of the antisense sequence in the
vector will be greater than 100 nucleotides. Transcription of an
antisense construct as described results in the production of RNA
molecules that are the reverse complement of mRNA molecules
transcribed from the endogenous transcription factor gene in the
plant cell.
[0479] Suppression of endogenous transcription factor gene
expression can also be achieved using a ribozyme. Ribozymes are RNA
molecules that possess highly specific endoribonuclease activity.
The production and use of ribozymes are disclosed in U.S. Pat. No.
4,987,071 and U.S. Pat. No. 5,543,508. Synthetic ribozyme sequences
including antisense RNAs can be used to confer RNA cleaving
activity on the antisense RNA, such that endogenous mRNA molecules
that hybridize to the antisense RNA are cleaved, which in turn
leads to an enhanced antisense inhibition of endogenous gene
expression.
[0480] Vectors in which RNA encoded by a transcription factor or
transcription factor homolog cDNA is over-expressed can also be
used to obtain co-suppression of a corresponding endogenous gene,
e.g., in the manner described in U.S. Pat. No. 5,231,020 to
Jorgensen. Such co-suppression (also termed sense suppression) does
not require that the entire transcription factor cDNA be introduced
into the plant cells, nor does it require that the introduced
sequence be exactly identical to the endogenous transcription
factor gene of interest. However, as with antisense suppression,
the suppressive efficiency will be enhanced as specificity of
hybridization is increased, e.g., as the introduced sequence is
lengthened, and/or as the sequence similarity between the
introduced sequence and the endogenous transcription factor gene is
increased.
[0481] Vectors expressing an untranslatable form of the
transcription factor mRNA, e.g., sequences comprising one or more
stop codon, or nonsense mutation) can also be used to suppress
expression of an endogenous transcription factor, thereby reducing
or eliminating its activity and modifying one or more traits.
Methods for producing such constructs are described in U.S. Pat.
No. 5,583,021. Preferably, such constructs are made by introducing
a premature stop codon into the transcription factor gene.
Alternatively, a plant trait can be modified by gene silencing
using double-strand RNA (Sharp (1999) Genes and Development 13:
139-141). Another method for abolishing the expression of a gene is
by insertion mutagenesis using the T-DNA of Agrobacterium
tumefaciens. After generating the insertion mutants, the mutants
can be screened to identify those containing the insertion in a
transcription factor or transcription factor homolog gene. Plants
containing a single transgene insertion event at the desired gene
can be crossed to generate homozygous plants for the mutation. Such
methods are well known to those of skill in the art (See for
example Koncz et al. (1992) Methods in Arabidopsis Research, World
Scientific Publishing Co. Pte. Ltd., River Edge, N.J.).
[0482] Alternatively, a plant phenotype can be altered by
eliminating an endogenous gene, such as a transcription factor or
transcription factor homolog, e.g., by homologous recombination
(Kempin et al. (1997) Nature 389: 802-803).
[0483] A plant trait can also be modified by using the Cre-lox
system (for example, as described in U.S. Pat. No. 5,658,772). A
plant genome can be modified to include first and second lox sites
that are then contacted with a Cre recombinase. If the lox sites
are in the same orientation, the intervening DNA sequence between
the two sites is excised. If the lox sites are in the opposite
orientation, the intervening sequence is inverted.
[0484] The polynucleotides and polypeptides of this invention can
also be expressed in a plant in the absence of an expression
cassette by manipulating the activity or expression level of the
endogenous gene by other means, such as, for example, by
ectopically expressing a gene by T-DNA activation tagging (Ichikawa
et al. (1997) Nature 390 698-701; Kakimoto et al. (1996) Science
274: 982-985). This method entails transforming a plant with a gene
tag containing multiple transcriptional enhancers and once the tag
has inserted into the genome, expression of a flanking gene coding
sequence becomes deregulated. In another example, the
transcriptional machinery in a plant can be modified so as to
increase transcription levels of a polynucleotide of the invention
(See, e.g., PCT Publications WO 96/06166 and WO 98/53057 which
describe the modification of the DNA-binding specificity of zinc
finger proteins by changing particular amino acids in the
DNA-binding motif).
[0485] The transgenic plant can also include the machinery
necessary for expressing or altering the activity of a polypeptide
encoded by an endogenous gene, for example, by altering the
phosphorylation state of the polypeptide to maintain it in an
activated state.
[0486] Transgenic plants (or plant cells, or plant explants, or
plant tissues) incorporating the polynucleotides of the invention
and/or expressing the polypeptides of the invention can be produced
by a variety of well established techniques as described above.
Following construction of a vector, most typically an expression
cassette, including a polynucleotide, e.g., encoding a
transcription factor or transcription factor homolog, of the
invention, standard techniques can be used to introduce the
polynucleotide into a plant, a plant cell, a plant explant or a
plant tissue of interest. Optionally, the plant cell, explant or
tissue can be regenerated to produce a transgenic plant.
[0487] The plant can be any higher plant, including gymnosperms,
monocotyledonous and dicotyledenous plants. Suitable protocols are
available for Leguminosae (alfalfa, soybean, clover, etc.),
Umbelliferae (carrot, celery, parsnip), Cruciferae (cabbage,
radish, rapeseed, broccoli, etc.), Curcurbitaceae (melons and
cucumber), Gramineae (wheat, corn, rice, barley, millet, etc.),
Solanaceae (potato, tomato, tobacco, peppers, etc.), and various
other crops. See protocols described in Ammirato et al., Eds.,
(1984) Handbook of Plant Cell Culture--Crop Species, Macmillan
Publ. Co., New York, N.Y.; Shimamoto et al. (1989) Nature 338:
274-276; Fromm et al. (1990) Bio/Technol. 8: 833-839; and Vasil et
al. (1990) Bio/Technol. 8: 429-434.
[0488] Transformation and regeneration of both monocotyledonous and
dicotyledonous plant cells is now routine, and the selection of the
most appropriate transformation technique will be determined by the
practitioner. The choice of method will vary with the type of plant
to be transformed; those skilled in the art will recognize the
suitability of particular methods for given plant types. Suitable
methods can include, but are not limited to: electroporation of
plant protoplasts; liposome-mediated transformation; polyethylene
glycol (PEG) mediated transformation; transformation using viruses;
micro-injection of plant cells; micro-projectile bombardment of
plant cells; vacuum infiltration; and Agrobacterium tumefaciens
mediated transformation. Transformation means introducing a
nucleotide sequence into a plant in a manner to cause stable or
transient expression of the sequence.
[0489] Successful examples of the modification of plant
characteristics by transformation with cloned sequences which serve
to illustrate the current knowledge in this field of technology,
and which are herein incorporated by reference, include: U.S. Pat.
Nos. 5,571,706; 5,677,175; 5,510,471; 5,750,386; 5,597,945;
5,589,615; 5,750,871; 5,268,526; 5,780,708; 5,538,880; 5,773,269;
5,736,369 and 5,610,042.
[0490] Following transformation, plants are preferably selected
using a dominant selectable marker incorporated into the
transformation vector. Typically, such a marker will confer
antibiotic or herbicide resistance on the transformed plants, and
selection of transformants can be accomplished by exposing the
plants to appropriate concentrations of the antibiotic or
herbicide.
[0491] After transformed plants are selected and grown to maturity,
those plants showing a modified trait are identified. The modified
trait can be any of those traits described above. Additionally, to
confirm that the modified trait is due to changes in expression
levels or activity of the polypeptide or polynucleotide of the
invention can be determined by analyzing mRNA expression using
Northern blots, RT-PCR or microarrays, or protein expression using
immunoblots or Western blots or gel shift assays.
Integrated Systems--Sequence Identity
[0492] Additionally, the present invention may be an integrated
system, computer or computer readable medium that comprises an
instruction set for determining the identity of one or more
sequences in a database. In addition, the instruction set can be
used to generate or identify sequences that meet any specified
criteria. Furthermore, the instruction set may be used to associate
or link certain functional benefits, such improved characteristics,
with one or more identified sequence.
[0493] For example, the instruction set can include, e.g., a
sequence comparison or other alignment program, e.g., an available
program such as, for example, the Wisconsin Package Version 10.0,
such as BLAST, FASTA, PILEUP, FINDPATTERNS or the like (GCG,
Madison, Wis.). Public sequence databases such as GenBank, EMBL,
Swiss-Prot and PIR or private sequence databases such as PHYTOSEQ
sequence database (Incyte Genomics, Palo Alto, Calif.) can be
searched.
[0494] Alignment of sequences for comparison can be conducted by
the local homology algorithm of Smith and Waterman (1981) Adv.
Appl. Math. 2: 482-489, by the homology alignment algorithm of
Needleman and Wunsch (1970) J. Mol. Biol. 48: 443-453, by the
search for similarity method of Pearson and Lipman (1988) Proc.
Natl. Acad. Sci. 85: 2444-2448, by computerized implementations of
these algorithms After alignment, sequence comparisons between two
(or more) polynucleotides or polypeptides are typically performed
by comparing sequences of the two sequences over a comparison
window to identify and compare local regions of sequence
similarity. The comparison window can be a segment of at least
about 20 contiguous positions, usually about 50 to about 200, more
usually about 100 to about 150 contiguous positions. A description
of the method is provided in Ausubel et al. supra.
[0495] A variety of methods for determining sequence relationships
can be used, including manual alignment and computer assisted
sequence alignment and analysis. This later approach is a preferred
approach in the present invention, due to the increased throughput
afforded by computer assisted methods. As noted above, a variety of
computer programs for performing sequence alignment are available,
or can be produced by one of skill.
[0496] One example algorithm that is suitable for determining
percent sequence identity and sequence similarity is the BLAST
algorithm, which is described in Altschul et al. (1990) J. Mol.
Biol. 215: 403-410. Software for performing BLAST analyses is
publicly available, e.g., through the National Library of
Medicine's National Center for Biotechnology Information
(ncbi.nlm.nih; see at world wide web (www) National Institutes of
Health US government (gov) website). This algorithm involves first
identifying high scoring sequence pairs (HSPs) by identifying short
words of length W in the query sequence, which either match or
satisfy some positive-valued threshold score T when aligned with a
word of the same length in a database sequence. T is referred to as
the neighborhood word score threshold (Altschul et al. supra).
These initial neighborhood word hits act as seeds for initiating
searches to find longer HSPs containing them. The word hits are
then extended in both directions along each sequence for as far as
the cumulative alignment score can be increased. Cumulative scores
are calculated using, for nucleotide sequences, the parameters M
(reward score for a pair of matching residues; always >0) and N
(penalty score for mismatching residues; always <0). For amino
acid sequences, a scoring matrix is used to calculate the
cumulative score. Extension of the word hits in each direction are
halted when: the cumulative alignment score falls off by the
quantity X from its maximum achieved value; the cumulative score
goes to zero or below, due to the accumulation of one or more
negative-scoring residue alignments; or the end of either sequence
is reached. The BLAST algorithm parameters W, T, and X determine
the sensitivity and speed of the alignment. The BLASTN program (for
nucleotide sequences) uses as defaults a wordlength (W) of 11, an
expectation (E) of 10, a cutoff of 100, M=5, N=-4, and a comparison
of both strands. For amino acid sequences, the BLASTP program uses
as defaults a wordlength (W) of 3, an expectation (E) of 10, and
the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1992) Proc.
Natl. Acad. Sci. 89: 10915-10919). Unless otherwise indicated,
"sequence identity" here refers to the % sequence identity
generated from a tblastx using the NCBI version of the algorithm at
the default settings using gapped alignments with the filter "off"
(see, for example, NIH NLM NCBI website at ncbi.nlm.nih,
supra).
[0497] In addition to calculating percent sequence identity, the
BLAST algorithm also performs a statistical analysis of the
similarity between two sequences (see, e.g. Karlin and Altschul
(1993) Proc. Natl. Acad. Sci. 90: 5873-5787). One measure of
similarity provided by the BLAST algorithm is the smallest sum
probability (P(N)), which provides an indication of the probability
by which a match between two nucleotide or amino acid sequences
would occur by chance. For example, a nucleic acid is considered
similar to a reference sequence (and, therefore, in this context,
homologous) if the smallest sum probability in a comparison of the
test nucleic acid to the reference nucleic acid is less than about
0.1, or less than about 0.01, and or even less than about 0.001. An
additional example of a useful sequence alignment algorithm is
PILEUP. PILEUP creates a multiple sequence alignment from a group
of related sequences using progressive, pairwise alignments. The
program can align, e.g., up to 300 sequences of a maximum length of
5,000 letters.
[0498] The integrated system, or computer typically includes a user
input interface allowing a user to selectively view one or more
sequence records corresponding to the one or more character
strings, as well as an instruction set which aligns the one or more
character strings with each other or with an additional character
string to identify one or more region of sequence similarity. The
system may include a link of one or more character strings with a
particular phenotype or gene function. Typically, the system
includes a user readable output element that displays an alignment
produced by the alignment instruction set.
[0499] The methods of this invention can be implemented in a
localized or distributed computing environment. In a distributed
environment, the methods may implemented on a single computer
comprising multiple processors or on a multiplicity of computers.
The computers can be linked, e.g. through a common bus, but more
preferably the computer(s) are nodes on a network. The network can
be a generalized or a dedicated local or wide-area network and, in
certain preferred embodiments, the computers may be components of
an intra-net or an internet.
[0500] Thus, the invention provides methods for identifying a
sequence similar or homologous to one or more polynucleotides as
noted herein, or one or more target polypeptides encoded by the
polynucleotides, or otherwise noted herein and may include linking
or associating a given plant phenotype or gene function with a
sequence. In the methods, a sequence database is provided (locally
or across an inter or intra net) and a query is made against the
sequence database using the relevant sequences herein and
associated plant phenotypes or gene functions.
[0501] Any sequence herein can be entered into the database, before
or after querying the database. This provides for both expansion of
the database and, if done before the querying step, for insertion
of control sequences into the database. The control sequences can
be detected by the query to ensure the general integrity of both
the database and the query. As noted, the query can be performed
using a web browser based interface. For example, the database can
be a centralized public database such as those noted herein, and
the querying can be done from a remote terminal or computer across
an internet or intranet.
[0502] Any sequence herein can be used to identify a similar,
homologous, paralogous, or orthologous sequence in another plant.
This provides means for identifying endogenous sequences in other
plants that may be useful to alter a trait of progeny plants, which
results from crossing two plants of different strain. For example,
sequences that encode an ortholog of any of the sequences herein
that naturally occur in a plant with a desired trait can be
identified using the sequences disclosed herein. The plant is then
crossed with a second plant of the same species but which does not
have the desired trait to produce progeny which can then be used in
further crossing experiments to produce the desired trait in the
second plant. Therefore the resulting progeny plant contains no
transgenes; expression of the endogenous sequence may also be
regulated by treatment with a particular chemical or other means,
such as EMR. Some examples of such compounds well known in the art
include: ethylene; cytokinins; phenolic compounds, which stimulate
the transcription of the genes needed for infection; specific
monosaccharides and acidic environments which potentiate vir gene
induction; acidic polysaccharides which induce one or more
chromosomal genes; and opines; other mechanisms include light or
dark treatment (for a review of examples of such treatments, see,
Winans (1992) Microbiol. Rev. 56: 12-31; Eyal et al. (1992) Plant
Mol. Biol. 19: 589-599; Chrispeels et al. (2000) Plant Mol. Biol.
42: 279-290; Piazza et al. (2002) Plant Physiol. 128:
1077-1086).
[0503] Table 7 lists sequences discovered to be orthologous to a
number of representative transcription factors of the present
invention. The column headings include the transcription factors
listed by SEQ ID NO; corresponding Gene ID (GID) numbers; the
species from which the orthologs to the transcription factors are
derived; the type of sequence (i.e., DNA or protein) discovered to
be orthologous to the transcription factors; and the SEQ ID NO of
the orthologs, the latter corresponding to the ortholog SEQ ID NOs
listed in the Sequence Listing.
TABLE-US-00008 TABLE 7 Orthologs of Representative Arabidopsis
Transcription Factor Genes SEQ ID NO: of GID NO of SEQ ID NO: of
Ortholog or Sequence type Orthologous Nucleotide Encoding
Nucleotide Species from used for Arabidopsis Orthologous Encoding
Which Ortholog determination Transcription Arabidopsis Ortholog is
Derived (DNA or Protein) Factor Transcription Factor 961 Glycine
max DNA G8 11 962 Glycine max DNA G8 11 963 Glycine max DNA G8 11
964 Glycine max DNA G8 11 965 Oryza sativa DNA G8 11 966 Oryza
sativa DNA G8 11 967 Zea mays DNA G8 11 968 Zea mays DNA G8 11 969
Zea mays DNA G8 11 970 Glycine max DNA G19 21 971 Glycine max DNA
G19 21 972 Glycine max DNA G19 21 973 Glycine max DNA G19 21 974
Oryza sativa DNA G19 21 975 Oryza sativa DNA G19 21 976 Oryza
sativa DNA G19 21 977 Zea mays DNA G19 21 978 Zea mays DNA G19 21
979 Glycine max DNA G22 27 980 Glycine max DNA G22 27 981 Glycine
max DNA G24 29 982 Glycine max DNA G24 29 983 Glycine max DNA G24
29 984 Glycine max DNA G24 29 985 Glycine max DNA G24 29 986
Glycine max DNA G24 29 987 Glycine max DNA G24 29 988 Oryza sativa
DNA G24 29 989 Oryza sativa PRT G24 29 990 Oryza sativa PRT G24 29
991 Oryza sativa PRT G24 29 992 Zea mays DNA G24 29 993 Glycine max
DNA G28 37 994 Glycine max DNA G28 37 995 Glycine max DNA G28 37
996 Glycine max DNA G28 37 997 Glycine max DNA G28 37 998 Glycine
max DNA G28 37 999 Glycine max DNA G28 37 1000 Glycine max DNA G28
37 1001 Oryza sativa PRT G28 37 1002 Oryza sativa PRT G28 37 1003
Zea mays DNA G28 37 1004 Glycine max DNA G46 53 1005 Glycine max
DNA G46 53 1006 Glycine max DNA G46 53 1007 Glycine max DNA G46 53
1008 Glycine max DNA G46 53 1009 Glycine max DNA G46 53 1010
Glycine max DNA G46 53 1011 Glycine max DNA G46 53 1012 Oryza
sativa PRT G46 53 1013 Zea mays DNA G46 53 1014 Glycine max DNA
G157 69 Glycine max DNA G1842 943 Glycine max DNA G1843 945 Glycine
max DNA G859 567 1015 Glycine max DNA G180 87 1016 Glycine max DNA
G180 87 1017 Oryza sativa DNA G180 87 1018 Oryza sativa PRT G180 87
1019 Zea mays DNA G180 87 1020 Glycine max DNA G188 97 1021 Oryza
sativa PRT G188 97 1022 Oryza sativa PRT G188 97 1023 Zea mays DNA
G188 97 1024 Glycine max DNA G192 101 1025 Oryza sativa PRT G192
101 1026 Glycine max DNA G196 105 1027 Oryza sativa PRT G196 105
1028 Oryza sativa PRT G196 105 1029 Oryza sativa PRT G196 105 1030
Zea mays DNA G196 105 1031 Zea mays DNA G196 105 1032 Glycine max
DNA G211 121 1033 Oryza sativa DNA G211 121 1034 Oryza sativa PRT
G211 121 1035 Glycine max DNA G214 127 Glycine max DNA G680 463
1036 Glycine max DNA G214 127 Glycine max DNA G680 463 1037 Glycine
max DNA G214 127 Glycine max DNA G680 463 1038 Glycine max DNA G214
127 Glycine max DNA G680 463 1039 Oryza sativa DNA G214 127 Oryza
sativa DNA G680 463 1040 Oryza sativa DNA G214 127 Oryza sativa DNA
G680 463 1041 Zea mays DNA G214 127 Zea mays DNA G680 463 1042 Zea
mays DNA G214 127 Zea mays DNA G680 463 1043 Zea mays DNA G214 127
Zea mays DNA G680 463 1044 Glycine max DNA G226 141 Glycine max DNA
G682 467 Glycine max DNA G1816 939 Glycine max DNA G2718 959 1045
Glycine max DNA G226 141 Glycine max DNA G1816 939 Glycine max DNA
G2718 959 1046 Glycine max DNA G226 141 Glycine max DNA G682 467
Glycine max DNA G1816 939 Glycine max DNA G2718 959 1047 Glycine
max DNA G226 141 Glycine max DNA G682 467 Glycine max DNA G1816 939
Glycine max DNA G2718 959 1048 Glycine max DNA G226 141 Glycine max
DNA G682 467 Glycine max DNA G1816 939 Glycine max DNA G2718 959
1049 Oryza sativa DNA G226 141 Oryza sativa DNA G682 467 Oryza
sativa DNA G1816 939 Oryza sativa DNA G2718 959 1050 Oryza sativa
PRT G226 141 Oryza sativa PRT G682 467 Oryza sativa PRT G1816 939
Oryza sativa PRT G2718 959 1051 Oryza sativa PRT G226 141 Oryza
sativa PRT G682 467 Oryza sativa PRT G1816 939 Oryza sativa PRT
G2718 959 1052 Zea mays DNA G226 141 Zea mays DNA G682 467 Zea mays
DNA G1816 939 Zea mays DNA G2718 959 1053 Zea mays DNA G226 141 Zea
mays DNA G682 467 Zea mays DNA G1816 939 Zea mays DNA G2718 959
1054 Glycine max DNA G241 163 1055 Glycine max DNA G241 163 1056
Glycine max DNA G241 163 1057 Oryza sativa DNA G241 163 1058 Zea
mays DNA G241 163 1059 Zea mays DNA G241 163 1060 Zea mays DNA G241
163 1061 Zea mays DNA G241 163 1062 Zea mays DNA G241 163 1063
Glycine max DNA G254 179 1064 Glycine max DNA G256 183 1065 Glycine
max DNA G256 183 1066 Glycine max DNA G256 183 1067 Glycine max DNA
G256 183 1068 Glycine max DNA G256 183 1069 Glycine max DNA G256
183 1070 Glycine max DNA G256 183 1071 Oryza sativa DNA G256 183
1072 Oryza sativa PRT G256 183 1073 Oryza sativa PRT G256 183 1074
Oryza sativa PRT G256 183 1075 Oryza sativa PRT G256 183 1076 Oryza
sativa PRT G256 183 1077 Zea mays DNA G256 183 1078 Zea mays DNA
G256 183 1079 Zea mays DNA G256 183 1080 Zea mays DNA G256 183 1081
Zea mays DNA G256 183 1082 Zea mays DNA G256 183 1083 Glycine max
DNA G325 223 1084 Zea mays DNA G325 223 1085 Glycine max DNA G361
237 1086 Glycine max DNA G361 237 1087 Glycine max DNA G361 237
1088 Glycine max DNA G361 237 1089 Glycine max DNA G361 237 1090
Oryza sativa DNA G361 237 1091 Oryza sativa PRT G361 237 1092 Oryza
sativa PRT G361 237 1093 Oryza sativa PRT G361 237 1094 Oryza
sativa PRT G361 237 1095 Oryza sativa PRT G361 237 1096 Zea mays
DNA G361 237 1097 Zea mays DNA G361 237 1098 Glycine max DNA G390
249 Glycine max DNA G438 283 1099 Glycine max DNA G390 249 Glycine
max DNA G438 283 1100 Glycine max DNA G390 249 Glycine max DNA G438
283 1101 Glycine max DNA G390 249 Glycine max DNA G438 283 1102
Glycine max DNA G390 249 Glycine max DNA G438 283 1103 Glycine max
DNA G390 249 Glycine max DNA G438 283 1104 Glycine max DNA G390 249
Glycine max DNA G438 283 1105 Glycine max DNA G390 249 1106 Glycine
max DNA G390 249 Glycine max DNA G438 283 1107 Glycine max DNA G390
249 Glycine max DNA G438 283 1108 Oryza sativa DNA G390 249 1109
Oryza sativa PRT G390 249 Oryza sativa PRT G438 283 1110 Oryza
sativa PRT G390 249 Oryza sativa PRT G438 283 1111 Oryza sativa PRT
G390 249 Oryza sativa PRT G438 283 1112 Oryza sativa PRT G390 249
Oryza sativa PRT G438 283 1113 Oryza sativa DNA G390 249 Oryza
sativa DNA G438 283 1114 Zea mays DNA G390 249 Zea mays DNA G438
283 1115 Zea mays DNA G390 249 Zea mays DNA G438 283 1116 Zea mays
DNA G390 249 Zea mays DNA G438 283 1117 Zea mays DNA G390 249 1118
Zea mays DNA G390 249 Zea mays DNA G438 283 1119 Zea mays DNA G390
249 Zea mays DNA G438 283 1120 Zea mays DNA G390 249 Zea mays DNA
G438 283 1121 Zea mays DNA G390 249 Zea mays DNA G438 283 1122 Zea
mays DNA G390 249 Zea mays DNA G438 283 1123 Zea mays DNA G390 249
Zea mays DNA G438 283 1124 Glycine max DNA G409 261 1125 Glycine
max DNA G409 261 1126 Glycine max DNA G409 261 1127 Glycine max DNA
G409 261 1128 Glycine max DNA G409 261 1129 Glycine max DNA G409
261 1130 Glycine max DNA G409 261 1131 Glycine max DNA G409 261
1132 Oryza sativa DNA G409 261 1133 Oryza sativa DNA G409 261 1134
Oryza sativa DNA G409 261 1135 Zea mays DNA G409 261 1136 Zea mays
DNA G409 261 1137 Zea mays DNA G409 261
1138 Zea mays DNA G409 261 1139 Zea mays DNA G409 261 1140 Zea mays
DNA G409 261 1141 Zea mays DNA G409 261 1142 Glycine max DNA G438
283 1143 Oryza sativa DNA G438 283 1144 Oryza sativa DNA G438 283
1145 Oryza sativa DNA G438 283 1146 Oryza sativa DNA G438 283 1147
Oryza sativa DNA G438 283 1148 Zea mays DNA G438 283 1149 Oryza
sativa DNA G464 291 1150 Oryza sativa PRT G464 291 1151 Zea mays
DNA G464 291 1152 Glycine max DNA G470 295 1153 Oryza sativa DNA
G470 295 1154 Oryza sativa DNA G470 295 1155 Glycine max DNA G475
301 1156 Glycine max DNA G482 305 1157 Glycine max DNA G482 305
1158 Glycine max DNA G482 305 1159 Glycine max DNA G482 305 1160
Glycine max DNA G482 305 1161 Glycine max DNA G482 305 1162 Glycine
max DNA G482 305 1163 Glycine max DNA G482 305 1164 Glycine max DNA
G482 305 1165 Oryza sativa PRT G482 305 1166 Oryza sativa PRT G482
305 1167 Oryza sativa PRT G482 305 1168 Oryza sativa PRT G482 305
1169 Oryza sativa PRT G482 305 1170 Oryza sativa DNA G482 305 1171
Zea mays DNA G482 305 1172 Zea mays DNA G482 305 1173 Zea mays DNA
G482 305 1174 Zea mays DNA G482 305 1175 Zea mays DNA G482 305 1176
Zea mays DNA G482 305 1177 Zea mays DNA G482 305 1178 Zea mays DNA
G482 305 1179 Zea mays DNA G482 305 1180 Glycine max DNA G489 309
1181 Glycine max DNA G489 309 1182 Glycine max DNA G489 309 1183
Glycine max DNA G489 309 1184 Glycine max DNA G489 309 1185 Glycine
max DNA G489 309 1186 Glycine max DNA G489 309 1187 Oryza sativa
DNA G489 309 1188 Oryza sativa DNA G489 309 1189 Oryza sativa PRT
G489 309 1190 Oryza sativa PRT G489 309 1191 Oryza sativa PRT G489
309 1192 Zea mays DNA G489 309 1193 Glycine max DNA G509 317 1194
Glycine max DNA G509 317 1195 Glycine max DNA G509 317 1196 Oryza
sativa DNA G509 317 1197 Oryza sativa PRT G509 317 1198 Oryza
sativa PRT G509 317 1199 Oryza sativa PRT G509 317 1200 Oryza
sativa DNA G509 317 1201 Zea mays DNA G509 317 1202 Zea mays DNA
G509 317 1203 Zea mays DNA G509 317 1204 Zea mays DNA G509 317 1205
Glycine max DNA G545 345 1206 Glycine max DNA G545 345 1207 Glycine
max DNA G545 345 1208 Glycine max DNA G545 345 1209 Glycine max DNA
G545 345 1210 Glycine max DNA G545 345 1211 Glycine max DNA G545
345 1212 Oryza sativa DNA G545 345 1213 Oryza sativa PRT G545 345
1214 Oryza sativa PRT G545 345 1215 Oryza sativa PRT G545 345 1216
Oryza sativa PRT G545 345 1217 Zea mays DNA G545 345 1218 Zea mays
DNA G545 345 1219 Zea mays DNA G545 345 1220 Zea mays DNA G561 359
1221 Glycine max DNA G562 361 1222 Glycine max DNA G562 361 1223
Glycine max DNA G562 361 1224 Glycine max DNA G562 361 1225 Glycine
max DNA G562 361 1226 Oryza sativa PRT G562 361 1227 Oryza sativa
PRT G562 361 1228 Zea mays DNA G562 361 1229 Zea mays DNA G562 361
1230 Zea mays DNA G562 361 1231 Glycine max DNA G567 369 1232 Oryza
sativa DNA G567 369 1233 Oryza sativa PRT G567 369 1234 Glycine max
DNA G584 385 1235 Glycine max DNA G584 385 1236 Glycine max DNA
G584 385 1237 Glycine max DNA G584 385 1238 Glycine max DNA G584
385 1239 Oryza sativa PRT G584 385 1240 Zea mays DNA G584 385 1241
Zea mays DNA G584 385 1242 Zea mays DNA G584 385 1243 Glycine max
DNA G590 387 1244 Glycine max DNA G590 387 1245 Glycine max DNA
G590 387 1246 Oryza sativa PRT G590 387 1247 Oryza sativa PRT G590
387 1248 Oryza sativa DNA G590 387 1249 Zea mays DNA G590 387 1250
Glycine max DNA G592 391 1251 Glycine max DNA G592 391 1252 Glycine
max DNA G592 391 1253 Glycine max DNA G592 391 1254 Glycine max DNA
G592 391 1255 Oryza sativa DNA G592 391 1256 Oryza sativa DNA G592
391 1257 Oryza sativa DNA G592 391 1258 Oryza sativa PRT G592 391
1259 Oryza sativa PRT G592 391 1260 Oryza sativa DNA G592 391 1261
Zea mays DNA G592 391 1262 Zea mays DNA G592 391 1263 Zea mays DNA
G592 391 1264 Zea mays DNA G592 391 1265 Glycine max DNA G627 405
1266 Glycine max DNA G627 405 1267 Oryza sativa DNA G627 405 1268
Oryza sativa DNA G634 415 1269 Oryza sativa PRT G634 415 1270 Oryza
sativa DNA G634 415 1271 Oryza sativa DNA G634 415 1272 Zea mays
DNA G634 415 1273 Zea mays DNA G634 415 1274 Zea mays DNA G634 415
1275 Glycine max DNA G636 417 1276 Glycine max DNA G636 417 1277
Glycine max DNA G636 417 1278 Glycine max DNA G636 417 1279 Glycine
max DNA G636 417 1280 Glycine max DNA G636 417 1281 Glycine max DNA
G636 417 1282 Glycine max DNA G636 417 1283 Oryza sativa DNA G636
417 1284 Oryza sativa DNA G636 417 1285 Oryza sativa DNA G636 417
1286 Oryza sativa DNA G636 417 1287 Zea mays DNA G636 417 1288 Zea
mays DNA G636 417 1289 Zea mays DNA G636 417 1290 Zea mays DNA G636
417 1291 Glycine max DNA G638 419 1292 Glycine max DNA G638 419
1293 Glycine max DNA G638 419 1294 Glycine max DNA G638 419 1295
Glycine max DNA G663 435 1296 Glycine max DNA G664 437 1297 Glycine
max DNA G664 437 1298 Glycine max DNA G664 437 1299 Glycine max DNA
G664 437 1300 Glycine max DNA G664 437 1301 Glycine max DNA G664
437 1302 Glycine max DNA G664 437 1303 Oryza sativa DNA G664 437
1304 Oryza sativa DNA G664 437 1305 Oryza sativa DNA G664 437 1306
Oryza sativa DNA G664 437 1307 Oryza sativa PRT G664 437 1308 Oryza
sativa PRT G664 437 1309 Oryza sativa PRT G664 437 1310 Oryza
sativa PRT G664 437 1311 Zea mays DNA G664 437 1312 Zea mays DNA
G664 437 1313 Zea mays DNA G664 437 1314 Zea mays DNA G664 437 1315
Zea mays DNA G664 437 1316 Zea mays DNA G664 437 1317 Zea mays DNA
G664 437 1318 Zea mays DNA G664 437 1319 Oryza sativa DNA G680 463
1320 Zea mays DNA G680 463 1321 Glycine max DNA G736 487 1322
Glycine max DNA G736 487 1323 Oryza sativa PRT G736 487 1324
Glycine max DNA G748 497 1325 Glycine max DNA G748 497 1326 Glycine
max DNA G748 497 1327 Oryza sativa DNA G748 497 1328 Oryza sativa
DNA G748 497 1329 Oryza sativa PRT G748 497 1330 Oryza sativa PRT
G748 497 1331 Oryza sativa PRT G748 497 1332 Oryza sativa PRT G748
497 1333 Zea mays DNA G748 497 1334 Glycine max DNA G789 539 1335
Glycine max DNA G789 539 1336 Oryza sativa DNA G789 539 1337 Oryza
sativa DNA G789 539 1338 Oryza sativa PRT G789 539 1339 Oryza
sativa PRT G789 539 1340 Oryza sativa PRT G789 539 1341 Zea mays
DNA G789 539 1342 Glycine max DNA G801 549 1343 Glycine max DNA
G801 549 1344 Zea mays DNA G801 549 1345 Glycine max DNA G849 565
1346 Glycine max DNA G849 565 1347 Glycine max DNA G849 565 1348
Glycine max DNA G849 565 1349 Glycine max DNA G849 565 1350 Glycine
max DNA G849 565 1351 Zea mays DNA G849 565 1352 Zea mays DNA G849
565 1353 Zea mays DNA G849 565 1354 Glycine max DNA G864 573 1355
Glycine max DNA G864 573 1356 Glycine max DNA G864 573 1357 Glycine
max DNA G864 573 1358 Glycine max DNA G864 573 1359 Glycine max DNA
G864 573 1360 Oryza sativa DNA G864 573 1361 Oryza sativa PRT G864
573 1362 Oryza sativa PRT G864 573 1363 Zea mays DNA G864 573 1364
Zea mays DNA G864 573 1365 Zea mays DNA G864 573 1366 Glycine max
DNA G867 579 1367 Glycine max DNA G867 579 1368 Glycine max DNA
G867 579 1369 Glycine max DNA G867 579 1370 Glycine max DNA G867
579 1371 Glycine max DNA G867 579 1372 Oryza sativa DNA G867 579
1373 Oryza sativa PRT G867 579 1374 Oryza sativa PRT G867 579 1375
Oryza sativa PRT G867 579 1376 Oryza sativa DNA G867 579 1377 Zea
mays DNA G867 579 1378 Zea mays DNA G867 579 1379 Zea mays DNA G867
579 1380 Zea mays DNA G867 579 1381 Glycine max DNA G869 581 1382
Glycine max DNA G869 581 1383 Oryza sativa DNA G869 581 1384 Oryza
sativa PRT G869 581 1385 Zea mays DNA G869 581 1386 Glycine max DNA
G877 583 1387 Oryza sativa DNA G877 583 1388 Oryza sativa DNA G877
583
1389 Oryza sativa PRT G877 583 1390 Oryza sativa PRT G877 583 1391
Oryza sativa PRT G877 583 1392 Zea mays DNA G877 583 1393 Zea mays
DNA G877 583 1394 Zea mays DNA G877 583 1395 Glycine max DNA G881
587 1396 Oryza sativa PRT G881 587 1397 Oryza sativa DNA G881 587
1398 Oryza sativa DNA G881 587 1399 Zea mays DNA G881 587 1400 Zea
mays DNA G881 587 1401 Zea mays DNA G881 587 1402 Zea mays DNA G881
587 1403 Glycine max DNA G912 615 1404 Glycine max DNA G912 615
1405 Glycine max DNA G912 615 1406 Glycine max DNA G912 615 1407
Glycine max DNA G912 615 1408 Glycine max DNA G912 615 1409 Glycine
max DNA G912 615 1410 Oryza sativa DNA G912 615 1411 Oryza sativa
PRT G912 615 1412 Oryza sativa PRT G912 615 1413 Oryza sativa PRT
G912 615 1414 Oryza sativa PRT G912 615 1415 Oryza sativa DNA G912
615 1416 Zea mays DNA G912 615 1417 Zea mays DNA G912 615 1418 Zea
mays DNA G912 615 1419 Zea mays DNA G912 615 1420 Zea mays DNA G912
615 1421 Glycine max DNA G961 633 1422 Glycine max DNA G961 633
1423 Oryza sativa DNA G961 633 1424 Oryza sativa PRT G961 633 1425
Zea mays DNA G961 633 1426 Zea mays DNA G961 633 1427 Zea mays DNA
G961 633 1428 Glycine max DNA G974 641 1429 Glycine max DNA G974
641 1430 Glycine max DNA G974 641 1431 Glycine max DNA G974 641
1432 Glycine max DNA G974 641 1433 Glycine max DNA G974 641 1434
Oryza sativa DNA G974 641 1435 Oryza sativa PRT G974 641 1436 Oryza
sativa PRT G974 641 1437 Oryza sativa PRT G974 641 1438 Zea mays
DNA G974 641 1439 Zea mays DNA G974 641 1440 Zea mays DNA G974 641
1441 Zea mays DNA G974 641 1442 Glycine max DNA G975 643 1443
Glycine max DNA G975 643 1444 Glycine max DNA G975 643 1445 Glycine
max DNA G975 643 1446 Glycine max DNA G975 643 1447 Oryza sativa
DNA G975 643 1448 Oryza sativa PRT G975 643 1449 Oryza sativa DNA
G975 643 1450 Zea mays DNA G975 643 1451 Zea mays DNA G975 643 1452
Glycine max DNA G979 649 1453 Glycine max DNA G979 649 1454 Glycine
max DNA G979 649 1455 Oryza sativa DNA G979 649 1456 Oryza sativa
PRT G979 649 1457 Oryza sativa PRT G979 649 1458 Oryza sativa PRT
G979 649 1459 Oryza sativa PRT G979 649 1460 Oryza sativa PRT G979
649 1461 Zea mays DNA G979 649 1462 Zea mays DNA G979 649 1463 Zea
mays DNA G979 649 1464 Glycine max DNA G987 653 1465 Glycine max
DNA G987 653 1466 Glycine max DNA G987 653 1467 Glycine max DNA
G987 653 1468 Glycine max DNA G987 653 1469 Glycine max DNA G987
653 1470 Oryza sativa DNA G987 653 1471 Oryza sativa DNA G987 653
1472 Oryza sativa PRT G987 653 1473 Zea mays DNA G987 653 1474
Glycine max DNA G1052 699 1475 Glycine max DNA G1052 699 1476
Glycine max DNA G1052 699 1477 Glycine max DNA G1052 699 1478
Glycine max DNA G1052 699 1479 Glycine max DNA G1052 699 1480
Glycine max DNA G1052 699 1481 Oryza sativa DNA G1052 699 1482
Oryza sativa DNA G1052 699 1483 Oryza sativa PRT G1052 699 1484
Oryza sativa PRT G1052 699 1485 Zea mays DNA G1052 699 1486 Zea
mays DNA G1052 699 1487 Zea mays DNA G1052 699 1488 Zea mays DNA
G1052 699 1489 Zea mays DNA G1052 699 1490 Zea mays DNA G1052 699
1491 Zea mays DNA G1052 699 1492 Zea mays DNA G1052 699 1493 Zea
mays DNA G1052 699 1494 Glycine max DNA G1062 713 1495 Glycine max
DNA G1062 713 1496 Glycine max DNA G1062 713 1497 Glycine max DNA
G1062 713 1498 Oryza sativa DNA G1062 713 1499 Oryza sativa DNA
G1062 713 1500 Oryza sativa PRT G1062 713 1501 Zea mays DNA G1062
713 1502 Zea mays DNA G1062 713 1503 Zea mays DNA G1062 713 1504
Zea mays DNA G1062 713 1505 Zea mays DNA G1062 713 1506 Glycine max
DNA G1069 721 1507 Glycine max DNA G1069 721 1508 Oryza sativa PRT
G1069 721 1509 Zea mays DNA G1069 721 1510 Oryza sativa PRT G1073
723 1511 Oryza sativa PRT G1073 723 1512 Glycine max DNA G1075 725
1513 Glycine max DNA G1075 725 1514 Glycine max DNA G1075 725 1515
Glycine max DNA G1075 725 1516 Glycine max DNA G1075 725 1517 Oryza
sativa DNA G1075 725 1518 Oryza sativa DNA G1075 725 1519 Oryza
sativa DNA G1075 725 1520 Oryza sativa PRT G1089 731 1521 Oryza
sativa DNA G1089 731 1522 Zea mays DNA G1089 731 1523 Zea mays DNA
G1089 731 1524 Zea mays DNA G1089 731 1525 Zea mays DNA G1089 731
1526 Zea mays DNA G1089 731 1527 Glycine max DNA G1134 741 1528
Glycine max DNA G1134 741 1529 Oryza sativa DNA G1134 741 1530
Glycine max DNA G1145 749 1531 Glycine max DNA G1145 749 1532
Glycine max DNA G1145 749 1533 Glycine max DNA G1145 749 1534
Glycine max DNA G1145 749 1535 Glycine max DNA G1145 749 1536
Glycine max DNA G1145 749 1537 Glycine max DNA G1145 749 1538 Oryza
sativa PRT G1145 749 1539 Oryza sativa PRT G1145 749 1540 Oryza
sativa PRT G1145 749 1541 Oryza sativa PRT G1145 749 1542 Oryza
sativa PRT G1145 749 1543 Oryza sativa PRT G1145 749 1544 Oryza
sativa DNA G1145 749 1545 Zea mays DNA G1145 749 1546 Zea mays DNA
G1145 749 1547 Zea mays DNA G1145 749 1548 Zea mays DNA G1145 749
1549 Zea mays DNA G1145 749 1550 Glycine max DNA G1198 763 1551
Glycine max DNA G1198 763 1552 Glycine max DNA G1198 763 1553
Glycine max DNA G1198 763 1554 Glycine max DNA G1198 763 1555
Glycine max DNA G1198 763 1556 Glycine max DNA G1198 763 1557
Glycine max DNA G1198 763 1558 Oryza sativa DNA G1198 763 1559
Oryza sativa DNA G1198 763 1560 Oryza sativa DNA G1198 763 1561
Oryza sativa DNA G1198 763 1562 Oryza sativa DNA G1198 763 1563
Oryza sativa PRT G1198 763 1564 Oryza sativa PRT G1198 763 1565
Oryza sativa PRT G1198 763 1566 Oryza sativa PRT G1198 763 1567
Oryza sativa PRT G1198 763 1568 Oryza sativa PRT G1198 763 1569
Oryza sativa PRT G1198 763 1570 Zea mays DNA G1198 763 1571 Zea
mays DNA G1198 763 1572 Zea mays DNA G1198 763 1573 Zea mays DNA
G1198 763 1574 Zea mays DNA G1198 763 1575 Zea mays DNA G1198 763
1576 Zea mays DNA G1198 763 1577 Zea mays DNA G1198 763 1578 Zea
mays DNA G1198 763 1579 Zea mays DNA G1198 763 1580 Glycine max DNA
G1242 787 1581 Oryza sativa DNA G1242 787 1582 Oryza sativa PRT
G1242 787 1583 Oryza sativa PRT G1242 787 1584 Zea mays DNA G1242
787 1585 Zea mays DNA G1242 787 1586 Glycine max DNA G1255 793 1587
Glycine max DNA G1255 793 1588 Glycine max DNA G1255 793 1589
Glycine max DNA G1255 793 1590 Glycine max DNA G1255 793 1591
Glycine max DNA G1255 793 1592 Glycine max DNA G1255 793 1593 Oryza
sativa DNA G1255 793 1594 Oryza sativa PRT G1255 793 1595 Oryza
sativa DNA G1255 793 1596 Oryza sativa DNA G1255 793 1597 Oryza
sativa DNA G1255 793 1598 Zea mays DNA G1255 793 1599 Zea mays DNA
G1255 793 1600 Zea mays DNA G1255 793 1601 Zea mays DNA G1255 793
1602 Zea mays DNA G1255 793 1603 Zea mays DNA G1255 793 1604
Glycine max DNA G1266 799 1605 Glycine max DNA G1266 799 1606
Glycine max DNA G1266 799 1607 Glycine max DNA G1266 799 1608 Oryza
sativa DNA G1266 799 1609 Glycine max DNA G1274 805 1610 Glycine
max DNA G1274 805 1611 Oryza sativa PRT G1274 805 1612 Oryza sativa
PRT G1274 805 1613 Zea mays DNA G1274 805 1614 Zea mays DNA G1274
805 1615 Zea mays DNA G1274 805 1616 Zea mays DNA G1274 805 1617
Oryza sativa DNA G1275 807 1618 Oryza sativa PRT G1275 807 1619
Oryza sativa PRT G1275 807 1620 Oryza sativa PRT G1275 807 1621 Zea
mays DNA G1275 807 1622 Zea mays DNA G1275 807 1623 Zea mays DNA
G1275 807 1624 Glycine max DNA G1313 829 1625 Oryza sativa DNA
G1313 829 1626 Oryza sativa PRT G1313 829 1627 Oryza sativa PRT
G1313 829 1628 Zea mays DNA G1313 829 1629 Zea mays DNA G1313 829
1630 Zea mays DNA G1313 829 1631 Glycine max DNA G1322 841 1632
Glycine max DNA G1322 841 1633 Glycine max DNA G1322 841 1634 Oryza
sativa DNA G1322 841 1635 Oryza sativa PRT G1322 841 1636 Oryza
sativa PRT G1322 841 1637 Zea mays DNA G1323 843 1638 Zea mays DNA
G1323 843 1639 Glycine max DNA G1417 881
1640 Oryza sativa PRT G1417 881 1641 Oryza sativa PRT G1417 881
1642 Glycine max DNA G1449 891 1643 Glycine max DNA G1449 891 1644
Oryza sativa DNA G1449 891 1645 Oryza sativa DNA G1449 891 1646 Zea
mays DNA G1449 891 1647 Zea mays DNA G1449 891 1648 Zea mays DNA
G1449 891 1649 Zea mays DNA G1449 891 1650 Glycine max DNA G1451
893 1651 Glycine max DNA G1451 893 1652 Oryza sativa DNA G1451 893
1653 Oryza sativa DNA G1451 893 1654 Oryza sativa DNA G1451 893
1655 Oryza sativa PRT G1451 893 1656 Oryza sativa PRT G1451 893
1657 Oryza sativa PRT G1451 893 1658 Oryza sativa PRT G1451 893
1659 Zea mays DNA G1451 893 1660 Zea mays DNA G1451 893 1661 Zea
mays DNA G1451 893 1662 Zea mays DNA G1451 893 1663 Glycine max DNA
G1482 905 1664 Glycine max DNA G1482 905 1665 Glycine max DNA G1482
905 1666 Glycine max DNA G1482 905 1667 Glycine max DNA G1482 905
1668 Oryza sativa DNA G1482 905 1669 Oryza sativa DNA G1482 905
1670 Oryza sativa DNA G1482 905 1671 Oryza sativa DNA G1482 905
1672 Oryza sativa PRT G1482 905 1673 Oryza sativa PRT G1482 905
1674 Zea mays DNA G1482 905 1675 Zea mays DNA G1482 905 1676 Zea
mays DNA G1482 905 1677 Zea mays DNA G1482 905 1678 Zea mays DNA
G1482 905 1679 Zea mays DNA G1482 905 1680 Oryza sativa PRT G1499
913 1681 Glycine max DNA G1540 919 1682 Oryza sativa PRT G1540 919
1683 Glycine max DNA G1560 925 1684 Glycine max DNA G1560 925 1685
Oryza sativa DNA G1560 925 1686 Oryza sativa PRT G1560 925 1687
Oryza sativa PRT G1560 925 1688 Oryza sativa PRT G1560 925 1689
Oryza sativa PRT G1560 925 1690 Zea mays DNA G1560 925 1691 Zea
mays DNA G1560 925 1692 Zea mays DNA G1560 925 1693 Zea mays DNA
G1560 925 1694 Zea mays DNA G1560 925 1695 Zea mays DNA G1560 925
1696 Oryza sativa PRT G1645 929 1697 Zea mays DNA G1645 929 1698
Zea mays DNA G1645 929 1699 Zea mays DNA G1645 929 1700 Glycine max
DNA G1760 937 1701 Glycine max DNA G1760 937 1702 Oryza sativa PRT
G1760 937 1703 Oryza sativa PRT G1760 937 1704 Zea mays DNA G1760
937 1705 Zea mays DNA G1760 937 1706 Zea mays DNA G1760 937 1707
Oryza sativa DNA G1816 939 1708 Glycine max DNA G2010 951 Glycine
max DNA G2347 957 1709 Oryza sativa DNA G2010 951 Oryza sativa DNA
G2347 957 1710 Zea mays DNA G2010 951 1711 Zea mays DNA G2010 951
Zea mays DNA G2347 957 1970 Glycine max DNA G859 567 Glycine max
DNA G1842 943 Glycine max DNA G1843 945 Glycine max DNA G1844 947
1971 Glycine max PRT G859 568 Glycine max PRT G1842 944 Glycine max
PRT G1843 946 Glycine max PRT G1844 948 1972 Glycine max DNA G859
567 Glycine max DNA G1842 943 Glycine max DNA G1843 945 Glycine max
DNA G1844 947 1973 Glycine max PRT G859 568 Glycine max PRT G1842
944 Glycine max PRT G1843 946 Glycine max PRT G1844 948
[0504] Table 8 lists a summary of homologous sequences identified
using BLAST (tblastx program). The first column shows the
polynucleotide sequence identifier (SEQ ID NO:), the second column
shows the corresponding cDNA identifier (Gene ID or GID), the third
column shows the orthologous or homologous polynucleotide GenBank
Accession Number (Test Sequence ID), the fourth column shows the
calculated probability value that the sequence identity is due to
chance (Smallest Sum Probability), the fifth column shows the plant
species from which the test sequence was isolated (Test Sequence
Species), and the sixth column shows the orthologous or homologous
test sequence GenBank annotation (Test Sequence GenBank
Annotation).
[0505] Table 9 lists sequences discovered to be paralogous to a
number of transcription factors of the present invention. The
columns headings include, from left to right, the Arabidopsis SEQ
ID NO; corresponding Arabidopsis Gene ID (GID) numbers; the GID
numbers of the paralogs discovered in a database search; and the
SEQ ID NOs of the paralogs.
TABLE-US-00009 TABLE 9 Arabidopsis Transcription Factors and
Paralogs Paralog Paralog SEQ ID NO: GID NO. SEQ ID NO: GID No. 30
G24 1717 G12 810 G1277 1859 G1379 38 G28 670 G1006 54 G46 666 G1004
1863 G1419 1719 G29 50 G43 70 G157 1875 G1759 944 G1842 946 G1843
948 G1844 568 G859 106 G196 1739 G182 128 G214 464 G680 142 G226
940 G1816 140 G225 960 G2718 468 G682 164 G241 156 G233 172 G248
1877 G1785 180 G254 146 G228 184 G256 1803 G666 444 G668 628 G932
210 G291 766 G1211 224 G325 1897 G1998 238 G361 1895 G1995 1935
G2826 1937 G2838 1767 G362 1769 G370 250 G390 1869 G1548 1773 G391
1775 G392 284 G438 284 G438 1869 G1548 250 G390 1773 G391 1775 G392
292 G464 1781 G463 306 G482 1857 G1364 1911 G2345 1783 G481 1785
G485 310 G489 1811 G714 346 G545 1763 G350 1765 G351 386 G584 746
G1136 406 G627 1729 G149 436 G663 1853 G1329 1915 G2421 1917 G2422
438 G664 108 G197 182 G255 458 G676 124 G212 170 G247 464 G680 G214
468 G682 940 G1816 140 G225 142 G226 960 G2718 488 G736 1921 G2432
540 G789 1867 G1494 566 G849 398 G610 568 G859 70 G157 1875 G1759
944 G1842 946 G1843 948 G1844 574 G864 1873 G1750 1779 G440 580
G867 1893 G1930 14 G9 1829 G993 584 G877 1737 G175 588 G881 652
G986 596 G896 1855 G1349 1889 G1887 616 G912 1903 G2107 1923 G2513
44 G40 46 G41 48 G42 634 G961 1925 G2535 1823 G957 640 G971 1819
G914 642 G974 6 G5 644 G975 1861 G1387 1929 G2583 650 G979 1901
G2106 1905 G2131 654 G987 1933 G3010 700 G996 1835 G1051 714 G1062
934 G1664 722 G1069 1907 G2153 724 G1073 718 G1067 1909 G2156 726
G1075 728 G1076 742 G1134 1927 G2555 750 G1145 706 G1056 764 G1198
1879 G1806 352 G554 354 G555 1791 G556 356 G558 788 G1242 790 G1243
794 G1255 1865 G1484 830 G1313 848 G1325 842 G1322 1747 G221 174
G249 844 G1323 432 G659 894 G1451 1827 G990 906 G1482 1891 G1888
928 G1634 1932 G2701 930 G1645 1919 G2424 938 G1760 64 G152 66 G153
570 G860 940 G1816 140 G225 142 G226 960 G2718 468 G682 944 G1842
70 G157 1875 G1759 946 G1843 948 G1844 568 G859 946 G1843 70 G157
1875 G1759 944 G1842 948 G1844 568 G859 952 G2010 958 G2347 958
G2347 952 G2010 960 G2718 940 G1816 140 G225 142 G226 468 G682
[0506] Table 10 lists the gene identification number (GID) and
homologous relationships found using analyses according to Example
IX for the sequences of the Sequence Listing.
TABLE-US-00010 TABLE 10 Homologous relationships found within the
Sequence Listing DNA or Species from Which SEQ ID Protein
Homologous NO: GID No. (PRT) Sequence is Derived Relationship of
SEQ ID NO: to Other Genes 961 DNA Glycine max Predicted polypeptide
sequence is orthologous to G8 962 DNA Glycine max Predicted
polypeptide sequence is orthologous to G8 963 DNA Glycine max
Predicted polypeptide sequence is orthologous to G8 964 DNA Glycine
max Predicted polypeptide sequence is orthologous to G8 965 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G8
967 DNA Zea mays Predicted polypeptide sequence is orthologous to
G8 968 DNA Zea mays Predicted polypeptide sequence is orthologous
to G8 969 DNA Zea mays Predicted polypeptide sequence is
orthologous to G8 970 DNA Glycine max Predicted polypeptide
sequence is orthologous to G19 971 DNA Glycine max Predicted
polypeptide sequence is orthologous to G19 972 DNA Glycine max
Predicted polypeptide sequence is orthologous to G19 973 DNA
Glycine max Predicted polypeptide sequence is orthologous to G19
974 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G19 975 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G19 976 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G19 977 DNA Zea mays Predicted
polypeptide sequence is orthologous to G19 978 DNA Zea mays
Predicted polypeptide sequence is orthologous to G19 979 DNA
Glycine max Predicted polypeptide sequence is orthologous to G22
980 DNA Glycine max Predicted polypeptide sequence is orthologous
to G22 981 DNA Glycine max Predicted polypeptide sequence is
orthologous to G24 982 DNA Glycine max Predicted polypeptide
sequence is orthologous to G24 983 DNA Glycine max Predicted
polypeptide sequence is orthologous to G24 984 DNA Glycine max
Predicted polypeptide sequence is orthologous to G24 985 DNA
Glycine max Predicted polypeptide sequence is orthologous to G24
986 DNA Glycine max Predicted polypeptide sequence is orthologous
to G24 987 DNA Glycine max Predicted polypeptide sequence is
orthologous to G24 988 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G24 989 PRT Oryza sativa Orthologous to
G24 990 PRT Oryza sativa Orthologous to G24 991 PRT Oryza sativa
Orthologous to G24 992 DNA Zea mays Predicted polypeptide sequence
is orthologous to G24 993 DNA Glycine max Predicted polypeptide
sequence is orthologous to G28 994 DNA Glycine max Predicted
polypeptide sequence is orthologous to G28 995 DNA Glycine max
Predicted polypeptide sequence is orthologous to G28 996 DNA
Glycine max Predicted polypeptide sequence is orthologous to G28
997 DNA Glycine max Predicted polypeptide sequence is orthologous
to G28 998 DNA Glycine max Predicted polypeptide sequence is
orthologous to G28 999 DNA Glycine max Predicted polypeptide
sequence is orthologous to G28 1000 DNA Glycine max Predicted
polypeptide sequence is orthologous to G28 1001 PRT Oryza sativa
Orthologous to G28 1002 PRT Oryza sativa Orthologous to G28 1003
DNA Zea mays Predicted polypeptide sequence is orthologous to G28
1004 DNA Glycine max Predicted polypeptide sequence is orthologous
to G46 1005 DNA Glycine max Predicted polypeptide sequence is
orthologous to G46 1006 DNA Glycine max Predicted polypeptide
sequence is orthologous to G46 1007 DNA Glycine max Predicted
polypeptide sequence is orthologous to G46 1008 DNA Glycine max
Predicted polypeptide sequence is orthologous to G46 1009 DNA
Glycine max Predicted polypeptide sequence is orthologous to G46
1010 DNA Glycine max Predicted polypeptide sequence is orthologous
to G46 1011 DNA Glycine max Predicted polypeptide sequence is
orthologous to G46 1012 PRT Oryza sativa Orthologous to G46 1013
DNA Zea mays Predicted polypeptide sequence is orthologous to G46
1014 DNA Glycine max Predicted polypeptide sequence is orthologous
to G157, G859, G1842, G1843 1015 DNA Glycine max Predicted
polypeptide sequence is orthologous to G180 1016 DNA Glycine max
Predicted polypeptide sequence is orthologous to G180 1017 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G180
1018 PRT Oryza sativa Orthologous to G180 1019 DNA Zea mays
Predicted polypeptide sequence is orthologous to G180 1020 DNA
Glycine max Predicted polypeptide sequence is orthologous to G188
1021 PRT Oryza sativa Orthologous to G188 1022 PRT Oryza sativa
Orthologous to G188 1023 DNA Zea mays Predicted polypeptide
sequence is orthologous to G188 1024 DNA Glycine max Predicted
polypeptide sequence is orthologous to G192 1025 PRT Oryza sativa
Orthologous to G192 1026 DNA Glycine max Predicted polypeptide
sequence is orthologous to G196 1027 PRT Oryza sativa Orthologous
to G196 1028 PRT Oryza sativa Orthologous to G196 1029 PRT Oryza
sativa Orthologous to G196 1030 DNA Zea mays Predicted polypeptide
sequence is orthologous to G196 1031 DNA Zea mays Predicted
polypeptide sequence is orthologous to G196 1032 DNA Glycine max
Predicted polypeptide sequence is orthologous to G211 1033 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G211
1034 PRT Oryza sativa Orthologous to G211 1035 DNA Glycine max
Predicted polypeptide sequence is orthologous to G214, G680 1036
DNA Glycine max Predicted polypeptide sequence is orthologous to
G214, G680 1037 DNA Glycine max Predicted polypeptide sequence is
orthologous to G214, G680 1038 DNA Glycine max Predicted
polypeptide sequence is orthologous to G214, G680 1039 DNA Oryza
sativa Predicted polypeptide sequence is orthologous to G214, G680
1040 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G214, G680 1041 DNA Zea mays Predicted polypeptide sequence is
orthologous to G214, G680 1042 DNA Zea mays Predicted polypeptide
sequence is orthologous to G214, G680 1043 DNA Zea mays Predicted
polypeptide sequence is orthologous to G214, G680 1044 DNA Glycine
max Predicted polypeptide sequence is orthologous to G226, G682,
G1816, G2718 1045 DNA Glycine max Predicted polypeptide sequence is
orthologous to G226, G1816, G2718 1046 DNA Glycine max Predicted
polypeptide sequence is orthologous to G226, G682, G1816, G2718
1047 DNA Glycine max Predicted polypeptide sequence is orthologous
to G226, G682, G1816, G2718 1048 DNA Glycine max Predicted
polypeptide sequence is orthologous to G226, G682, G1816, G2718
1049 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G226, G682, G1816, G2718 1050 PRT Oryza sativa Orthologous to
G226, G682, G1816, G2718 1051 PRT Oryza sativa Orthologous to G226,
G682, G1816, G2718 1052 DNA Zea mays Predicted polypeptide sequence
is orthologous to G226, G682, G1816, G2718 1053 DNA Zea mays
Predicted polypeptide sequence is orthologous to G226, G682, G1816,
G2718 1054 DNA Glycine max Predicted polypeptide sequence is
orthologous to G241 1055 DNA Glycine max Predicted polypeptide
sequence is orthologous to G241 1056 DNA Glycine max Predicted
polypeptide sequence is orthologous to G241 1057 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G241 1058 DNA Zea
mays Predicted polypeptide sequence is orthologous to G241 1059 DNA
Zea mays Predicted polypeptide sequence is orthologous to G241 1060
DNA Zea mays Predicted polypeptide sequence is orthologous to G241
1061 DNA Zea mays Predicted polypeptide sequence is orthologous to
G241 1062 DNA Zea mays Predicted polypeptide sequence is
orthologous to G241 1063 DNA Glycine max Predicted polypeptide
sequence is orthologous to G254 1064 DNA Glycine max Predicted
polypeptide sequence is orthologous to G256 1065 DNA Glycine max
Predicted polypeptide sequence is orthologous to G256 1066 DNA
Glycine max Predicted polypeptide sequence is orthologous to G256
1067 DNA Glycine max Predicted polypeptide sequence is orthologous
to G256 1068 DNA Glycine max Predicted polypeptide sequence is
orthologous to G256 1069 DNA Glycine max Predicted polypeptide
sequence is orthologous to G256 1070 DNA Glycine max Predicted
polypeptide sequence is orthologous to G256 1071 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G256 1072 PRT
Oryza sativa Orthologous to G256 1073 PRT Oryza sativa Orthologous
to G256 1074 PRT Oryza sativa Orthologous to G256 1075 PRT Oryza
sativa Orthologous to G256 1076 PRT Oryza sativa Orthologous to
G256 1077 DNA Zea mays Predicted polypeptide sequence is
orthologous to G256 1078 DNA Zea mays Predicted polypeptide
sequence is orthologous to G256 1079 DNA Zea mays Predicted
polypeptide sequence is orthologous to G256 1080 DNA Zea mays
Predicted polypeptide sequence is orthologous to G256 1081 DNA Zea
mays Predicted polypeptide sequence is orthologous to G256 1082 DNA
Zea mays Predicted polypeptide sequence is orthologous to G256 1083
DNA Glycine max Predicted polypeptide sequence is orthologous to
G325 1084 DNA Zea mays Predicted polypeptide sequence is
orthologous to G325 1085 DNA Glycine max Predicted polypeptide
sequence is orthologous to G361 1086 DNA Glycine max Predicted
polypeptide sequence is orthologous to G361 1087 DNA Glycine max
Predicted polypeptide sequence is orthologous to G361 1088 DNA
Glycine max Predicted polypeptide sequence is orthologous to G361
1089 DNA Glycine max Predicted polypeptide sequence is orthologous
to G361 1090 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G361 1091 PRT Oryza sativa Orthologous to G361 1092
PRT Oryza sativa Orthologous to G361 1093 PRT Oryza sativa
Orthologous to G361 1094 PRT Oryza sativa Orthologous to G361 1095
PRT Oryza sativa Orthologous to G361 1096 DNA Zea mays Predicted
polypeptide sequence is orthologous to G361 1097 DNA Zea mays
Predicted polypeptide sequence is orthologous to G361 1098 DNA
Glycine max Predicted polypeptide sequence is orthologous to G390,
G438 1099 DNA Glycine max Predicted polypeptide sequence is
orthologous to G390, G438 1100 DNA Glycine max Predicted
polypeptide sequence is orthologous to G390, G438 1101 DNA Glycine
max Predicted polypeptide sequence is orthologous to G390, G438
1102 DNA Glycine max Predicted polypeptide sequence is orthologous
to G390, G438 1103 DNA Glycine max Predicted polypeptide sequence
is orthologous to G390, G438 1104 DNA Glycine max Predicted
polypeptide sequence is orthologous to G390, G438 1105 DNA Glycine
max Predicted polypeptide sequence is orthologous to G390 1106 DNA
Glycine max Predicted polypeptide sequence is orthologous to G390,
G438 1107 DNA Glycine max Predicted polypeptide sequence is
orthologous to G390, G438 1108 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G390 1109 PRT Oryza sativa
Orthologous to G390, G438 1110 PRT Oryza sativa Orthologous to
G390, G438 1111 PRT Oryza sativa Orthologous to G390, G438
1112 PRT Oryza sativa Orthologous to G390, G438 1113 DNA Oryza
sativa Predicted polypeptide sequence is orthologous to G390, G438
1114 DNA Zea mays Predicted polypeptide sequence is orthologous to
G390, G438 1115 DNA Zea mays Predicted polypeptide sequence is
orthologous to G390, G438 1116 DNA Zea mays Predicted polypeptide
sequence is orthologous to G390, G438 1117 DNA Zea mays Predicted
polypeptide sequence is orthologous to G390 1118 DNA Zea mays
Predicted polypeptide sequence is orthologous to G390, G438 1119
DNA Zea mays Predicted polypeptide sequence is orthologous to G390,
G438 1120 DNA Zea mays Predicted polypeptide sequence is
orthologous to G390, G438 1121 DNA Zea mays Predicted polypeptide
sequence is orthologous to G390, G438 1122 DNA Zea mays Predicted
polypeptide sequence is orthologous to G390, G438 1123 DNA Zea mays
Predicted polypeptide sequence is orthologous to G390, G438 1124
DNA Glycine max Predicted polypeptide sequence is orthologous to
G409 1125 DNA Glycine max Predicted polypeptide sequence is
orthologous to G409 1126 DNA Glycine max Predicted polypeptide
sequence is orthologous to G409 1127 DNA Glycine max Predicted
polypeptide sequence is orthologous to G409 1128 DNA Glycine max
Predicted polypeptide sequence is orthologous to G409 1129 DNA
Glycine max Predicted polypeptide sequence is orthologous to G409
1130 DNA Glycine max Predicted polypeptide sequence is orthologous
to G409 1131 DNA Glycine max Predicted polypeptide sequence is
orthologous to G409 1132 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G409 1133 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G409 1134 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G409 1135 DNA Zea
mays Predicted polypeptide sequence is orthologous to G409 1136 DNA
Zea mays Predicted polypeptide sequence is orthologous to G409 1137
DNA Zea mays Predicted polypeptide sequence is orthologous to G409
1138 DNA Zea mays Predicted polypeptide sequence is orthologous to
G409 1139 DNA Zea mays Predicted polypeptide sequence is
orthologous to G409 1140 DNA Zea mays Predicted polypeptide
sequence is orthologous to G409 1141 DNA Zea mays Predicted
polypeptide sequence is orthologous to G409 1142 DNA Glycine max
Predicted polypeptide sequence is orthologous to G438 1143 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G438
1144 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G438 1145 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G438 1146 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G438 1147 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G438 1148 DNA Zea mays
Predicted polypeptide sequence is orthologous to G438 1149 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G464
1150 PRT Oryza sativa Orthologous to G464 1151 DNA Zea mays
Predicted polypeptide sequence is orthologous to G464 1152 DNA
Glycine max Predicted polypeptide sequence is orthologous to G470
1153 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G470 1154 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G470 1155 DNA Glycine max Predicted polypeptide
sequence is orthologous to G475 1156 DNA Glycine max Predicted
polypeptide sequence is orthologous to G482 1157 DNA Glycine max
Predicted polypeptide sequence is orthologous to G482 1158 DNA
Glycine max Predicted polypeptide sequence is orthologous to G482
1159 DNA Glycine max Predicted polypeptide sequence is orthologous
to G482 1160 DNA Glycine max Predicted polypeptide sequence is
orthologous to G482 1161 DNA Glycine max Predicted polypeptide
sequence is orthologous to G482 1162 DNA Glycine max Predicted
polypeptide sequence is orthologous to G482 1163 DNA Glycine max
Predicted polypeptide sequence is orthologous to G482 1164 DNA
Glycine max Predicted polypeptide sequence is orthologous to G482
1165 PRT Oryza sativa Orthologous to G482 1166 PRT Oryza sativa
Orthologous to G482 1167 PRT Oryza sativa Orthologous to G482 1168
PRT Oryza sativa Orthologous to G482 1169 PRT Oryza sativa
Orthologous to G482 1170 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G482 1171 DNA Zea mays Predicted
polypeptide sequence is orthologous to G482 1172 DNA Zea mays
Predicted polypeptide sequence is orthologous to G482 1173 DNA Zea
mays Predicted polypeptide sequence is orthologous to G482 1174 DNA
Zea mays Predicted polypeptide sequence is orthologous to G482 1175
DNA Zea mays Predicted polypeptide sequence is orthologous to G482
1176 DNA Zea mays Predicted polypeptide sequence is orthologous to
G482 1177 DNA Zea mays Predicted polypeptide sequence is
orthologous to G482 1178 DNA Zea mays Predicted polypeptide
sequence is orthologous to G482 1179 DNA Zea mays Predicted
polypeptide sequence is orthologous to G482 1180 DNA Glycine max
Predicted polypeptide sequence is orthologous to G489 1181 DNA
Glycine max Predicted polypeptide sequence is orthologous to G489
1182 DNA Glycine max Predicted polypeptide sequence is orthologous
to G489 1183 DNA Glycine max Predicted polypeptide sequence is
orthologous to G489 1184 DNA Glycine max Predicted polypeptide
sequence is orthologous to G489 1185 DNA Glycine max Predicted
polypeptide sequence is orthologous to G489 1186 DNA Glycine max
Predicted polypeptide sequence is orthologous to G489 1187 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G489
1188 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G489 1189 PRT Oryza sativa Orthologous to G489 1190 PRT Oryza
sativa Orthologous to G489 1191 PRT Oryza sativa Orthologous to
G489 1192 DNA Zea mays Predicted polypeptide sequence is
orthologous to G489 1193 DNA Glycine max Predicted polypeptide
sequence is orthologous to G509 1194 DNA Glycine max Predicted
polypeptide sequence is orthologous to G509 1195 DNA Glycine max
Predicted polypeptide sequence is orthologous to G509 1196 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G509
1197 PRT Oryza sativa Orthologous to G509 1198 PRT Oryza sativa
Orthologous to G509 1199 PRT Oryza sativa Orthologous to G509 1200
DNA Oryza sativa Predicted polypeptide sequence is orthologous to
G509 1201 DNA Zea mays Predicted polypeptide sequence is
orthologous to G509 1202 DNA Zea mays Predicted polypeptide
sequence is orthologous to G509 1203 DNA Zea mays Predicted
polypeptide sequence is orthologous to G509 1204 DNA Zea mays
Predicted polypeptide sequence is orthologous to G509 1205 DNA
Glycine max Predicted polypeptide sequence is orthologous to G545
1206 DNA Glycine max Predicted polypeptide sequence is orthologous
to G545 1207 DNA Glycine max Predicted polypeptide sequence is
orthologous to G545 1208 DNA Glycine max Predicted polypeptide
sequence is orthologous to G545 1209 DNA Glycine max Predicted
polypeptide sequence is orthologous to G545 1210 DNA Glycine max
Predicted polypeptide sequence is orthologous to G545 1211 DNA
Glycine max Predicted polypeptide sequence is orthologous to G545
1212 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G545 1213 PRT Oryza sativa Orthologous to G545 1214 PRT Oryza
sativa Orthologous to G545 1215 PRT Oryza sativa Orthologous to
G545 1216 PRT Oryza sativa Orthologous to G545 1217 DNA Zea mays
Predicted polypeptide sequence is orthologous to G545 1218 DNA Zea
mays Predicted polypeptide sequence is orthologous to G545 1219 DNA
Zea mays Predicted polypeptide sequence is orthologous to G545 1220
DNA Zea mays Predicted polypeptide sequence is orthologous to G561
1221 DNA Glycine max Predicted polypeptide sequence is orthologous
to G562 1222 DNA Glycine max Predicted polypeptide sequence is
orthologous to G562 1223 DNA Glycine max Predicted polypeptide
sequence is orthologous to G562 1224 DNA Glycine max Predicted
polypeptide sequence is orthologous to G562 1225 DNA Glycine max
Predicted polypeptide sequence is orthologous to G562 1226 PRT
Oryza sativa Orthologous to G562 1227 PRT Oryza sativa Orthologous
to G562 1228 DNA Zea mays Predicted polypeptide sequence is
orthologous to G562 1229 DNA Zea mays Predicted polypeptide
sequence is orthologous to G562 1230 DNA Zea mays Predicted
polypeptide sequence is orthologous to G562 1231 DNA Glycine max
Predicted polypeptide sequence is orthologous to G567 1232 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G567
1233 PRT Oryza sativa Orthologous to G567 1234 DNA Glycine max
Predicted polypeptide sequence is orthologous to G584 1235 DNA
Glycine max Predicted polypeptide sequence is orthologous to G584
1236 DNA Glycine max Predicted polypeptide sequence is orthologous
to G584 1237 DNA Glycine max Predicted polypeptide sequence is
orthologous to G584 1238 DNA Glycine max Predicted polypeptide
sequence is orthologous to G584 1239 PRT Oryza sativa Orthologous
to G584 1240 DNA Zea mays Predicted polypeptide sequence is
orthologous to G584 1241 DNA Zea mays Predicted polypeptide
sequence is orthologous to G584 1242 DNA Zea mays Predicted
polypeptide sequence is orthologous to G584 1243 DNA Glycine max
Predicted polypeptide sequence is orthologous to G590 1244 DNA
Glycine max Predicted polypeptide sequence is orthologous to G590
1245 DNA Glycine max Predicted polypeptide sequence is orthologous
to G590 1246 PRT Oryza sativa Orthologous to G590 1247 PRT Oryza
sativa Orthologous to G590 1248 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G590 1249 DNA Zea mays
Predicted polypeptide sequence is orthologous to G590 1250 DNA
Glycine max Predicted polypeptide sequence is orthologous to G592
1251 DNA Glycine max Predicted polypeptide sequence is orthologous
to G592 1252 DNA Glycine max Predicted polypeptide sequence is
orthologous to G592 1253 DNA Glycine max Predicted polypeptide
sequence is orthologous to G592 1254 DNA Glycine max Predicted
polypeptide sequence is orthologous to G592 1255 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G592 1256 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G592
1257 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G592 1258 PRT Oryza sativa Orthologous to G592 1259 PRT Oryza
sativa Orthologous to G592 1260 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G592 1261 DNA Zea mays
Predicted polypeptide sequence is orthologous to G592 1262 DNA Zea
mays Predicted polypeptide sequence is orthologous to G592 1263 DNA
Zea mays Predicted polypeptide sequence is orthologous to G592 1264
DNA Zea mays Predicted polypeptide sequence is orthologous to G592
1265 DNA Glycine max Predicted polypeptide sequence is orthologous
to G627 1266 DNA GLYCINE MAX Predicted polypeptide sequence is
orthologous to G627 1267 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G627 1268 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G634
1269 PRT Oryza sativa Orthologous to G634 1270 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G634 1271 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G634
1272 DNA Zea mays Predicted polypeptide sequence is orthologous to
G634 1273 DNA Zea mays Predicted polypeptide sequence is
orthologous to G634 1274 DNA Zea mays Predicted polypeptide
sequence is orthologous to G634 1275 DNA Glycine max Predicted
polypeptide sequence is orthologous to G636 1276 DNA Glycine max
Predicted polypeptide sequence is orthologous to G636 1277 DNA
Glycine max Predicted polypeptide sequence is orthologous to G636
1278 DNA Glycine max Predicted polypeptide sequence is orthologous
to G636 1279 DNA Glycine max Predicted polypeptide sequence is
orthologous to G636 1280 DNA Glycine max Predicted polypeptide
sequence is orthologous to G636 1281 DNA Glycine max Predicted
polypeptide sequence is orthologous to G636 1282 DNA Glycine max
Predicted polypeptide sequence is orthologous to G636 1283 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G636
1284 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G636 1285 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G636 1286 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G636 1287 DNA Zea mays Predicted
polypeptide sequence is orthologous to G636 1288 DNA Zea mays
Predicted polypeptide sequence is orthologous to G636 1289 DNA Zea
mays Predicted polypeptide sequence is orthologous to G636 1290 DNA
Zea mays Predicted polypeptide sequence is orthologous to G636 1291
DNA Glycine max Predicted polypeptide sequence is orthologous to
G638 1292 DNA Glycine max Predicted polypeptide sequence is
orthologous to G638 1293 DNA Glycine max Predicted polypeptide
sequence is orthologous to G638 1294 DNA Glycine max Predicted
polypeptide sequence is orthologous to G638 1295 DNA Glycine max
Predicted polypeptide sequence is orthologous to G663 1296 DNA
Glycine max Predicted polypeptide sequence is orthologous to G664
1297 DNA Glycine max Predicted polypeptide sequence is orthologous
to G664 1298 DNA Glycine max Predicted polypeptide sequence is
orthologous to G664 1299 DNA Glycine max Predicted polypeptide
sequence is orthologous to G664 1300 DNA Glycine max Predicted
polypeptide sequence is orthologous to G664 1301 DNA Glycine max
Predicted polypeptide sequence is orthologous to G664 1302 DNA
Glycine max Predicted polypeptide sequence is orthologous to G664
1303 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G664 1304 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G664 1305 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G664 1306 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G664 1307 PRT Oryza sativa
Orthologous to G664 1308 PRT Oryza sativa Orthologous to G664 1309
PRT Oryza sativa Orthologous to G664 1310 PRT Oryza sativa
Orthologous to G664 1311 DNA Zea mays Predicted polypeptide
sequence is orthologous to G664 1312 DNA Zea mays Predicted
polypeptide sequence is orthologous to G664 1313 DNA Zea mays
Predicted polypeptide sequence is orthologous to G664 1314 DNA Zea
mays Predicted polypeptide sequence is orthologous to G664 1315 DNA
Zea mays Predicted polypeptide sequence is orthologous to G664 1316
DNA Zea mays Predicted polypeptide sequence is orthologous to G664
1317 DNA Zea mays Predicted polypeptide sequence is orthologous to
G664 1318 DNA Zea mays Predicted polypeptide sequence is
orthologous to G664 1319 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G680 1320 DNA Zea mays Predicted
polypeptide sequence is orthologous to G680 1321 DNA Glycine max
Predicted polypeptide sequence is orthologous to G736 1322 DNA
Glycine max Predicted polypeptide sequence is orthologous to G736
1323 PRT Oryza sativa Orthologous to G736 1324 DNA Glycine max
Predicted polypeptide sequence is orthologous to G748 1325 DNA
Glycine max Predicted polypeptide sequence is orthologous to G748
1326 DNA Glycine max Predicted polypeptide sequence is orthologous
to G748 1327 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G748 1328 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G748 1329 PRT Oryza sativa Orthologous
to G748 1330 PRT Oryza sativa Orthologous to G748 1331 PRT Oryza
sativa Orthologous to G748 1332 PRT Oryza sativa Orthologous to
G748 1333 DNA Zea mays Predicted polypeptide sequence is
orthologous to G748 1334 DNA Glycine max Predicted polypeptide
sequence is orthologous to G789 1335 DNA Glycine max Predicted
polypeptide sequence is orthologous to G789 1336 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G789 1337 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G789
1338 PRT Oryza sativa Orthologous to G789 1339 PRT Oryza sativa
Orthologous to G789 1340 PRT Oryza sativa Orthologous to G789 1341
DNA Zea mays Predicted polypeptide sequence is orthologous to G789
1342 DNA Glycine max Predicted polypeptide sequence is orthologous
to G801 1343 DNA Glycine max Predicted polypeptide sequence is
orthologous to G801 1344 DNA Zea mays Predicted polypeptide
sequence is orthologous to G801 1345 DNA Glycine max Predicted
polypeptide sequence is orthologous to G849 1346 DNA Glycine max
Predicted polypeptide sequence is orthologous to G849 1347 DNA
Glycine max Predicted polypeptide sequence is orthologous to G849
1348 DNA Glycine max Predicted polypeptide sequence is orthologous
to G849 1349 DNA Glycine max Predicted polypeptide sequence is
orthologous to G849 1350 DNA Glycine max Predicted polypeptide
sequence is orthologous to G849 1351 DNA Zea mays Predicted
polypeptide sequence is orthologous to G849 1352 DNA Zea mays
Predicted polypeptide sequence is orthologous to G849 1353 DNA Zea
mays Predicted polypeptide sequence is orthologous to G849 1354 DNA
Glycine max Predicted polypeptide sequence is orthologous to G864
1355 DNA Glycine max Predicted polypeptide sequence is orthologous
to G864 1356 DNA Glycine max Predicted polypeptide sequence is
orthologous to G864 1357 DNA Glycine max Predicted polypeptide
sequence is orthologous to G864 1358 DNA Glycine max Predicted
polypeptide sequence is orthologous to G864 1359 DNA Glycine max
Predicted polypeptide sequence is orthologous to G864 1360 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G864
1361 PRT Oryza sativa Orthologous to G864 1362 PRT Oryza sativa
Orthologous to G864 1363 DNA Zea mays Predicted polypeptide
sequence is orthologous to G864 1364 DNA Zea mays Predicted
polypeptide sequence is orthologous to G864 1365 DNA Zea mays
Predicted polypeptide sequence is orthologous to G864 1366 DNA
Glycine max Predicted polypeptide sequence is orthologous to G867
1367 DNA Glycine max Predicted polypeptide sequence is orthologous
to G867 1368 DNA Glycine max Predicted polypeptide sequence is
orthologous to G867 1369 DNA Glycine max Predicted polypeptide
sequence is orthologous to G867 1370 DNA Glycine max Predicted
polypeptide sequence is orthologous to G867 1371 DNA Glycine max
Predicted polypeptide sequence is orthologous to G867 1372 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G867
1373 PRT Oryza sativa Orthologous to G867 1374 PRT Oryza sativa
Orthologous to G867 1375 PRT Oryza sativa Orthologous to G867 1376
DNA Oryza sativa Predicted polypeptide sequence is orthologous to
G867 1377 DNA Zea mays Predicted polypeptide sequence is
orthologous to G867 1378 DNA Zea mays Predicted polypeptide
sequence is orthologous to G867 1379 DNA Zea mays Predicted
polypeptide sequence is orthologous to G867 1380 DNA Zea mays
Predicted polypeptide sequence is orthologous to G867 1381 DNA
Glycine max Predicted polypeptide sequence is orthologous to G869
1382 DNA Glycine max Predicted polypeptide sequence is orthologous
to G869 1383 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G869 1384 PRT Oryza sativa Orthologous to G869 1385
DNA Zea mays Predicted polypeptide sequence is orthologous to G869
1386 DNA Glycine max Predicted polypeptide sequence is orthologous
to G877 1387 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G877 1388 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G877 1389 PRT Oryza sativa Orthologous
to G877 1390 PRT Oryza sativa Orthologous to G877 1391 PRT Oryza
sativa Orthologous to G877 1392 DNA Zea mays Predicted polypeptide
sequence is orthologous to G877 1393 DNA Zea mays Predicted
polypeptide sequence is orthologous to G877 1394 DNA Zea mays
Predicted polypeptide sequence is orthologous to G877 1395 DNA
Glycine max Predicted polypeptide sequence is orthologous to G881
1396 PRT Oryza sativa Orthologous to G881 1397 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G881 1398 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G881
1399 DNA Zea mays Predicted polypeptide sequence is orthologous to
G881 1400 DNA Zea mays Predicted polypeptide sequence is
orthologous to G881 1401 DNA Zea mays Predicted polypeptide
sequence is orthologous to G881 1402 DNA Zea mays Predicted
polypeptide sequence is orthologous to G881 1403 DNA Glycine max
Predicted polypeptide sequence is orthologous to G912 1404 DNA
Glycine max Predicted polypeptide sequence is orthologous to G912
1405 DNA Glycine max Predicted polypeptide sequence is orthologous
to G912 1406 DNA Glycine max Predicted polypeptide sequence is
orthologous to G912 1407 DNA Glycine max Predicted polypeptide
sequence is orthologous to G912 1408 DNA Glycine max Predicted
polypeptide sequence is orthologous to G912 1409 DNA Glycine max
Predicted polypeptide sequence is orthologous to G912 1410 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G912
1411 PRT Oryza sativa Orthologous to G912 1412 PRT Oryza sativa
Orthologous to G912 1413 PRT Oryza sativa Orthologous to G912 1414
PRT Oryza sativa Orthologous to G912 1415 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G912 1416 DNA Zea
mays Predicted polypeptide sequence is orthologous to G912 1417 DNA
Zea mays Predicted polypeptide sequence is orthologous to G912 1418
DNA Zea mays Predicted polypeptide sequence is orthologous to G912
1419 DNA Zea mays Predicted polypeptide sequence is orthologous to
G912 1420 DNA Zea mays Predicted polypeptide sequence is
orthologous to G912 1421 DNA Glycine max Predicted polypeptide
sequence is orthologous to G961 1422 DNA Glycine max Predicted
polypeptide sequence is orthologous to G961 1423 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G961 1424 PRT
Oryza sativa Orthologous to G961 1425 DNA Zea mays Predicted
polypeptide sequence is orthologous to G961 1426 DNA Zea mays
Predicted polypeptide sequence is orthologous to G961 1427 DNA Zea
mays Predicted polypeptide sequence is orthologous to G961 1428 DNA
Glycine max Predicted polypeptide sequence is orthologous to G974
1429 DNA Glycine max Predicted polypeptide sequence is orthologous
to G974 1430 DNA Glycine max Predicted polypeptide sequence is
orthologous to G974
1431 DNA Glycine max Predicted polypeptide sequence is orthologous
to G974 1432 DNA Glycine max Predicted polypeptide sequence is
orthologous to G974 1433 DNA Glycine max Predicted polypeptide
sequence is orthologous to G974 1434 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G974 1435 PRT Oryza sativa
Orthologous to G974 1436 PRT Oryza sativa Orthologous to G974 1437
PRT Oryza sativa Orthologous to G974 1438 DNA Zea mays Predicted
polypeptide sequence is orthologous to G974 1439 DNA Zea mays
Predicted polypeptide sequence is orthologous to G974 1440 DNA Zea
mays Predicted polypeptide sequence is orthologous to G974 1441 DNA
Zea mays Predicted polypeptide sequence is orthologous to G974 1442
DNA Glycine max Predicted polypeptide sequence is orthologous to
G975 1443 DNA Glycine max Predicted polypeptide sequence is
orthologous to G975 1444 DNA Glycine max Predicted polypeptide
sequence is orthologous to G975 1445 DNA Glycine max Predicted
polypeptide sequence is orthologous to G975 1446 DNA Glycine max
Predicted polypeptide sequence is orthologous to G975 1447 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G975
1448 PRT Oryza sativa Orthologous to G975 1449 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G975 1450 DNA Zea
mays Predicted polypeptide sequence is orthologous to G975 1451 DNA
Zea mays Predicted polypeptide sequence is orthologous to G975 1452
DNA Glycine max Predicted polypeptide sequence is orthologous to
G979 1453 DNA Glycine max Predicted polypeptide sequence is
orthologous to G979 1454 DNA Glycine max Predicted polypeptide
sequence is orthologous to G979 1455 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G979 1456 PRT Oryza sativa
Orthologous to G979 1457 PRT Oryza sativa Orthologous to G979 1458
PRT Oryza sativa Orthologous to G979 1459 PRT Oryza sativa
Orthologous to G979 1460 PRT Oryza sativa Orthologous to G979 1461
DNA Zea mays Predicted polypeptide sequence is orthologous to G979
1462 DNA Zea mays Predicted polypeptide sequence is orthologous to
G979 1463 DNA Zea mays Predicted polypeptide sequence is
orthologous to G979 1464 DNA Glycine max Predicted polypeptide
sequence is orthologous to G987 1465 DNA Glycine max Predicted
polypeptide sequence is orthologous to G987 1466 DNA Glycine max
Predicted polypeptide sequence is orthologous to G987 1467 DNA
Glycine max Predicted polypeptide sequence is orthologous to G987
1468 DNA Glycine max Predicted polypeptide sequence is orthologous
to G987 1469 DNA Glycine max Predicted polypeptide sequence is
orthologous to G987 1470 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G987 1471 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G987 1472 PRT Oryza sativa
Orthologous to G987 1473 DNA Zea mays Predicted polypeptide
sequence is orthologous to G987 1474 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1052 1475 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1052 1476 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1052
1477 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1052 1478 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1052 1479 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1052 1480 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1052 1481 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G1052 1482 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G1052
1483 PRT Oryza sativa Orthologous to G1052 1484 PRT Oryza sativa
Orthologous to G1052 1485 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1052 1486 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1052 1487 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1052 1488 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1052 1489
DNA Zea mays Predicted polypeptide sequence is orthologous to G1052
1490 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1052 1491 DNA Zea mays Predicted polypeptide sequence is
orthologous to G1052 1492 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1052 1493 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1052 1494 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1062 1495 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1062
1496 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1062 1497 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1062 1498 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1062 1499 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1062 1500 PRT Oryza sativa
Orthologous to G1062 1501 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1062 1502 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1062 1503 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1062 1504 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1062 1505
DNA Zea mays Predicted polypeptide sequence is orthologous to G1062
1506 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1069 1507 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1069 1508 PRT Oryza sativa Orthologous to G1069
1509 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1069 1510 PRT Oryza sativa Orthologous to G1073 1511 PRT Oryza
sativa Orthologous to G1073 1512 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1075 1513 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1075 1514 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1075
1515 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1075 1516 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1075 1517 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1075 1518 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1075 1519 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G1075 1520 PRT
Oryza sativa Orthologous to G1089 1521 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1089 1522 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1089 1523 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1089 1524
DNA Zea mays Predicted polypeptide sequence is orthologous to G1089
1525 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1089 1526 DNA Zea mays Predicted polypeptide sequence is
orthologous to G1089 1527 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1134 1528 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1134 1529 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G1134 1530 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1145
1531 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1145 1532 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1145 1533 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1145 1534 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1145 1535 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1145 1536 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1145
1537 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1145 1538 PRT Oryza sativa Orthologous to G1145 1539 PRT Oryza
sativa Orthologous to G1145 1540 PRT Oryza sativa Orthologous to
G1145 1541 PRT Oryza sativa Orthologous to G1145 1542 PRT Oryza
sativa Orthologous to G1145 1543 PRT Oryza sativa Orthologous to
G1145 1544 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1145 1545 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1145 1546 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1145 1547 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1145 1548 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1145 1549
DNA Zea mays Predicted polypeptide sequence is orthologous to G1145
1550 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1198 1551 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1198 1552 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1198 1553 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1198 1554 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1198 1555 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1198
1556 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1198 1557 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1198 1558 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1198 1559 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1198 1560 DNA Oryza sativa
Predicted polypeptide sequence is orthologous to G1198 1561 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G1198
1562 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1198 1563 PRT Oryza sativa Orthologous to G1198 1564 PRT Oryza
sativa Orthologous to G1198 1565 PRT Oryza sativa Orthologous to
G1198 1566 PRT Oryza sativa Orthologous to G1198 1567 PRT Oryza
sativa Orthologous to G1198 1568 PRT Oryza sativa Orthologous to
G1198 1569 PRT Oryza sativa Orthologous to G1198 1570 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1198 1571 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1198 1572
DNA Zea mays Predicted polypeptide sequence is orthologous to G1198
1573 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1198 1574 DNA Zea mays Predicted polypeptide sequence is
orthologous to G1198 1575 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1198 1576 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1198 1577 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1198 1578 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1198 1579
DNA Zea mays Predicted polypeptide sequence is orthologous to G1198
1580 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1242 1581 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1242 1582 PRT Oryza sativa Orthologous to G1242
1583 PRT Oryza sativa Orthologous to G1242 1584 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1242 1585 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1242 1586
DNA Glycine max Predicted polypeptide sequence is orthologous to
G1255 1587 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1255 1588 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1255 1589 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1255 1590 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1255 1591 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1255
1592 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1255 1593 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1255 1594 PRT Oryza sativa Orthologous to G1255
1595 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1255 1596 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to
G1255 1597 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1255 1598 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1255 1599 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1255 1600 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1255 1601 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1255 1602
DNA Zea mays Predicted polypeptide sequence is orthologous to G1255
1603 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1255 1604 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1266 1605 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1266 1606 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1266 1607 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1266 1608 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G1266
1609 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1274 1610 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1274 1611 PRT Oryza sativa Orthologous to G1274
1612 PRT Oryza sativa Orthologous to G1274 1613 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1274 1614 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1274 1615
DNA Zea mays Predicted polypeptide sequence is orthologous to G1274
1616 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1274 1617 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1275 1618 PRT Oryza sativa Orthologous to G1275
1619 PRT Oryza sativa Orthologous to G1275 1620 PRT Oryza sativa
Orthologous to G1275 1621 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1275 1622 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1275 1623 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1275 1624 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1313
1625 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1313 1626 PRT Oryza sativa Orthologous to G1313 1627 PRT Oryza
sativa Orthologous to G1313 1628 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1313 1629 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1313 1630 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1313 1631 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1322
1632 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1322 1633 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1322 1634 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1322 1635 PRT Oryza sativa Orthologous
to G1322 1636 PRT Oryza sativa Orthologous to G1322 1637 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1323 1638
DNA Zea mays Predicted polypeptide sequence is orthologous to G1323
1639 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1417 1640 PRT Oryza sativa Orthologous to G1417 1641 PRT Oryza
sativa Orthologous to G1417 1642 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1449 1643 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1449 1644 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G1449
1645 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1449 1646 DNA Zea mays Predicted polypeptide sequence is
orthologous to G1449 1647 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1449 1648 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1449 1649 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1449 1650 DNA
Glycine max Predicted polypeptide sequence is orthologous to G1451
1651 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1451 1652 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1451 1653 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1451 1654 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1451 1655 PRT Oryza sativa
Orthologous to G1451 1656 PRT Oryza sativa Orthologous to G1451
1657 PRT Oryza sativa Orthologous to G1451 1658 PRT Oryza sativa
Orthologous to G1451 1659 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1451 1660 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1451 1661 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1451 1662 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1451 1663
DNA Glycine max Predicted polypeptide sequence is orthologous to
G1482 1664 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1482 1665 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1482 1666 DNA Glycine max Predicted
polypeptide sequence is orthologous to G1482 1667 DNA Glycine max
Predicted polypeptide sequence is orthologous to G1482 1668 DNA
Oryza sativa Predicted polypeptide sequence is orthologous to G1482
1669 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1482 1670 DNA Oryza sativa Predicted polypeptide sequence is
orthologous to G1482 1671 DNA Oryza sativa Predicted polypeptide
sequence is orthologous to G1482 1672 PRT Oryza sativa Orthologous
to G1482 1673 PRT Oryza sativa Orthologous to G1482 1674 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1482 1675
DNA Zea mays Predicted polypeptide sequence is orthologous to G1482
1676 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1482 1677 DNA Zea mays Predicted polypeptide sequence is
orthologous to G1482 1678 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1482 1679 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1482 1680 PRT Oryza sativa
Orthologous to G1499 1681 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1540 1682 PRT Oryza sativa Orthologous
to G1540 1683 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1560 1684 DNA Glycine max Predicted polypeptide
sequence is orthologous to G1560 1685 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G1560 1686 PRT Oryza sativa
Orthologous to G1560 1687 PRT Oryza sativa Orthologous to G1560
1688 PRT Oryza sativa Orthologous to G1560 1689 PRT Oryza sativa
Orthologous to G1560 1690 DNA Zea mays Predicted polypeptide
sequence is orthologous to G1560 1691 DNA Zea mays Predicted
polypeptide sequence is orthologous to G1560 1692 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1560 1693 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1560 1694
DNA Zea mays Predicted polypeptide sequence is orthologous to G1560
1695 DNA Zea mays Predicted polypeptide sequence is orthologous to
G1560 1696 PRT Oryza sativa Orthologous to G1645 1697 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1645 1698 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1645 1699
DNA Zea mays Predicted polypeptide sequence is orthologous to G1645
1700 DNA Glycine max Predicted polypeptide sequence is orthologous
to G1760 1701 DNA Glycine max Predicted polypeptide sequence is
orthologous to G1760 1702 PRT Oryza sativa Orthologous to G1760
1703 PRT Oryza sativa Orthologous to G1760 1704 DNA Zea mays
Predicted polypeptide sequence is orthologous to G1760 1705 DNA Zea
mays Predicted polypeptide sequence is orthologous to G1760 1706
DNA Zea mays Predicted polypeptide sequence is orthologous to G1760
1707 DNA Oryza sativa Predicted polypeptide sequence is orthologous
to G1816 1708 DNA Glycine max Predicted polypeptide sequence is
orthologous to G2010, G2347 1709 DNA Oryza sativa Predicted
polypeptide sequence is orthologous to G2010, G2347 1710 DNA Zea
mays Predicted polypeptide sequence is orthologous to G2010 1711
DNA Zea mays Predicted polypeptide sequence is orthologous to
G2010, G2347 1712 G5 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G974 1713 G5 PRT Arabidopsis thaliana
Paralogous to G974 1714 G9 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G867 1715 G9 PRT Arabidopsis
thaliana Paralogous to G867 1716 G12 DNA Arabidopsis thaliana
Predicted polypeptide sequence is paralogous to G24 1717 G12 PRT
Arabidopsis thaliana Paralogous to G24 1718 G29 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G46 1719
G29 PRT Arabidopsis thaliana Paralogous to G46 1720 G40 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G912 1721 G40 PRT Arabidopsis thaliana Paralogous to G912 1722
G41 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G912 1723 G41 PRT Arabidopsis thaliana Paralogous to
G912 1724 G42 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G912 1725 G42 PRT Arabidopsis thaliana
Paralogous to G912 1726 G43 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G46 1727 G43 PRT Arabidopsis
thaliana Paralogous to G46 1728 G149 DNA Arabidopsis thaliana
Predicted polypeptide sequence is paralogous to G627 1729 G149 PRT
Arabidopsis thaliana Paralogous to G627 1730 G152 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1760 1731
G152 PRT Arabidopsis thaliana Paralogous to G1760 1732 G153 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1760 1733 G153 PRT Arabidopsis thaliana Paralogous to G1760
1734 G157 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G859, G1842, G1843 1735 G157 PRT Arabidopsis
thaliana Paralogous to G859, G1842, G1843 1736 G175 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G877 1737
G175 PRT Arabidopsis thaliana Paralogous to G877 1738 G182 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G196 1739 G182 PRT Arabidopsis thaliana Paralogous to G196 1740
G197 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G664 1741 G197 PRT Arabidopsis thaliana Paralogous to
G664 1742 G212 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G676 1743 G212 PRT Arabidopsis thaliana
Paralogous to G676 1744 G214 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G680 1745 G214 PRT
Arabidopsis thaliana Paralogous to G680 1746 G221 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1322 1747
G221 PRT Arabidopsis thaliana Paralogous to G1322 1748 G225 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G226, G682, G1816, G2718 1749 G225 PRT Arabidopsis thaliana
Paralogous to G226, G682, G1816, G2718 1750 G226 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G682,
G1816, G2718 1751 G226 PRT Arabidopsis thaliana Paralogous to G682,
G1816, G2718 1752 G228 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G254 1753 G228 PRT
Arabidopsis thaliana Paralogous to G254 1754 G233 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G241 1755
G233 PRT Arabidopsis thaliana Paralogous to G241 1756 G247 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G676 1757 G247 PRT Arabidopsis thaliana Paralogous to G676 1758
G249 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G1322 1759 G249 PRT Arabidopsis thaliana Paralogous
to G1322 1760 G255 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G664 1761 G255 PRT Arabidopsis thaliana
Paralogous to G664 1762 G350 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G545 1763 G350 PRT
Arabidopsis thaliana Paralogous to G545 1764 G351 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G545 1765
G351 PRT Arabidopsis thaliana Paralogous to G545 1766 G362 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G361 1767 G362 PRT Arabidopsis thaliana Paralogous to G361 1768
G370 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G361 1769 G370 PRT Arabidopsis thaliana Paralogous to
G361 1770 G390 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G438 1771 G390 PRT Arabidopsis thaliana
Paralogous to G438 1772 G391 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G390, G438 1773 G391 PRT
Arabidopsis thaliana Paralogous to G390, G438 1774 G392 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G390, G438 1775 G392 PRT Arabidopsis thaliana Paralogous to
G390, G438 1776 G438 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G390 1777 G438 PRT Arabidopsis thaliana
Paralogous to G390 1778 G440 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G864 1779 G440 PRT
Arabidopsis thaliana Paralogous to G864 1780 G463 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G464 1781
G463 PRT Arabidopsis thaliana Paralogous to G464 1782 G481 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G482 1783 G481 PRT Arabidopsis thaliana Paralogous to G482 1784
G485 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G482 1785 G485 PRT Arabidopsis thaliana Paralogous to
G482 1786 G554 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G1198 1787 G554 PRT Arabidopsis thaliana
Paralogous to G1198 1788 G555 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G1198 1789 G555 PRT
Arabidopsis thaliana Paralogous to G1198 1790 G556 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1198 1791
G556 PRT Arabidopsis thaliana Paralogous to G1198 1792 G558 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1198 1793 G558 PRT Arabidopsis thaliana Paralogous to G1198
1794 G578 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G1198 1795 G578 PRT Arabidopsis thaliana
Paralogous to G1198 1796 G610 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G849 1797 G610 PRT
Arabidopsis thaliana Paralogous to G849 1798 G629 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1198 1799
G629 PRT Arabidopsis thaliana Paralogous to G1198 1800 G659 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1323 1801 G659 PRT Arabidopsis thaliana Paralogous to G1323
1802 G666 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G256 1803 G666 PRT Arabidopsis thaliana Paralogous
to G256 1804 G668 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G256 1805 G668 PRT Arabidopsis thaliana
Paralogous to G256 1806 G680 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G214 1807 G680 PRT
Arabidopsis thaliana Paralogous to G214 1808 G682 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G226,
G1816, G2718 1809 G682 PRT Arabidopsis thaliana Paralogous to G226,
G1816, G2718 1810 G714 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G489 1811 G714 PRT
Arabidopsis thaliana Paralogous to G489 1812 G859 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G157,
G1842, G1843 1813 G859 PRT Arabidopsis thaliana Paralogous to G157,
G1842, G1843 1814 G860 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G1760 1815 G860 PRT
Arabidopsis thaliana Paralogous to G1760 1816 G913 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G912 1817
G913 PRT Arabidopsis thaliana Paralogous to G912 1818 G914 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G971 1819 G914 PRT Arabidopsis thaliana Paralogous to G971 1820
G932 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G256 1821 G932 PRT Arabidopsis thaliana Paralogous to
G256 1822 G957 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G961 1823 G957 PRT Arabidopsis thaliana
Paralogous to G961 1824 G986 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G881 1825 G986 PRT
Arabidopsis thaliana Paralogous to G881 1826 G990 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1451 1827
G990 PRT Arabidopsis thaliana Paralogous to G1451 1828 G993 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G867 1829 G993 PRT Arabidopsis thaliana Paralogous to G867 1830
G1004 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G46 1831 G1004 PRT Arabidopsis thaliana Paralogous to
G46 1832 G1006 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G28 1833 G1006 PRT Arabidopsis thaliana
Paralogous to G28 1834 G1051 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G1052 1835 G1051 PRT
Arabidopsis thaliana Paralogous to G1052 1836 G1056 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1145 1837
G1056 PRT Arabidopsis thaliana Paralogous to G1145 1838 G1067 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1073 1839 G1067 PRT Arabidopsis thaliana Paralogous to G1073
1840 G1076 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G1075 1841 G1076 PRT Arabidopsis thaliana
Paralogous to G1075 1842 G1136 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G584 1843 G1136 PRT
Arabidopsis thaliana Paralogous to G584 1844 G1211 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G291 1845
G1211 PRT Arabidopsis thaliana Paralogous to G291 1846 G1243 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1242 1847 G1243 PRT Arabidopsis thaliana Paralogous to G1242
1848 G1277 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G24 1849 G1277 PRT Arabidopsis thaliana Paralogous
to G24 1850 G1325 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G1313 1851 G1325 PRT Arabidopsis thaliana
Paralogous to G1313 1852 G1329 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G663 1853 G1329 PRT
Arabidopsis thaliana Paralogous to G663 1854 G1349 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G896 1855
G1349 PRT Arabidopsis thaliana Paralogous to G896 1856 G1364 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G482 1857 G1364 PRT Arabidopsis thaliana Paralogous to G482 1858
G1379 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G24 1859 G1379 PRT Arabidopsis thaliana Paralogous to
G24 1860 G1387 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G975 1861 G1387 PRT Arabidopsis thaliana
Paralogous to G975 1862 G1419 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G46 1863 G1419 PRT
Arabidopsis thaliana Paralogous to G46 1864 G1484 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G1255 1865
G1484 PRT Arabidopsis thaliana Paralogous to G1255 1866 G1494 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G789 1867 G1494 PRT Arabidopsis thaliana Paralogous to G789 1868
G1548 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G390, G438 1869 G1548 PRT Arabidopsis thaliana
Paralogous to G390, G438 1870 G1664 DNA Arabidopsis thaliana
Predicted polypeptide sequence is paralogous to G1062 1871 G1664
PRT Arabidopsis thaliana Paralogous to G1062 1872 G1750 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G864 1873 G1750 PRT Arabidopsis thaliana Paralogous to G864 1874
G1759 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G157, G859, G1842, G1843 1875 G1759 PRT Arabidopsis
thaliana Paralogous to G157, G859, G1842, G1843 1876 G1785 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G248 1877 G1785 PRT Arabidopsis thaliana Paralogous to G248 1878
G1806 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G1198 1879 G1806 PRT Arabidopsis thaliana Paralogous
to G1198 1880 G1816 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G226, G682, G2718 1881 G1816 PRT
Arabidopsis thaliana Paralogous to G226, G682, G2718 1882 G1842 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G157, G859, G1843 1883 G1842 PRT Arabidopsis thaliana Paralogous
to G157, G859, G1843 1884 G1843 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G157, G859, G1842 1885 G1843
PRT Arabidopsis thaliana Paralogous to G157, G859, G1842 1886 G1844
DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G157, G859, G1842, G1843 1887 G1844 PRT Arabidopsis
thaliana Paralogous to G157, G859, G1842, G1843 1888 G1887 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G896 1889 G1887 PRT Arabidopsis thaliana Paralogous to G896 1890
G1888 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G1482 1891 G1888 PRT Arabidopsis thaliana Paralogous
to G1482 1892 G1930 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G867 1893 G1930 PRT Arabidopsis thaliana
Paralogous to G867 1894 G1995 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G361 1895 G1995 PRT
Arabidopsis thaliana Paralogous to G361 1896 G1998 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G325 1897
G1998 PRT Arabidopsis thaliana Paralogous to G325 1898 G2010 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G2347 1899 G2010 PRT Arabidopsis thaliana Paralogous to G2347
1900 G2106 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G979 1901 G2106 PRT Arabidopsis thaliana
Paralogous to G979 1902 G2107 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G912 1903 G2107 PRT
Arabidopsis thaliana Paralogous to G912 1904 G2131 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G979 1905
G2131 PRT Arabidopsis thaliana Paralogous to G979 1906 G2153 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G1069 1907 G2153 PRT Arabidopsis thaliana Paralogous to G1069
1908 G2156 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G1073 1909 G2156 PRT Arabidopsis thaliana
Paralogous to G1073 1910 G2345 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G482 1911 G2345 PRT
Arabidopsis thaliana Paralogous to G482 1912 G2347 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G2010 1913
G2347 PRT Arabidopsis thaliana Paralogous to G2010 1914 G2421 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G663 1915 G2421 PRT Arabidopsis thaliana Paralogous to G663 1916
G2422 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G663 1917 G2422 PRT Arabidopsis thaliana Paralogous
to G663 1918 G2424 DNA Arabidopsis thaliana Predicted polypeptide
sequence is paralogous to G1645 1919 G2424 PRT Arabidopsis thaliana
Paralogous to G1645 1920 G2432 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G736 1921 G2432 PRT
Arabidopsis thaliana Paralogous to G736 1922 G2513 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G912 1923
G2513 PRT Arabidopsis thaliana Paralogous to G912 1924 G2535 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G961 1925 G2535 PRT Arabidopsis thaliana Paralogous to G961 1926
G2555 DNA Arabidopsis thaliana Predicted polypeptide sequence is
paralogous to G1134 1927 G2555 PRT Arabidopsis thaliana Paralogous
to G1134
1928 G2583 DNA Arabidopsis thaliana Predicted polypeptide sequence
is paralogous to G975 1929 G2583 PRT Arabidopsis thaliana
Paralogous to G975 1930 G2701 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G1634 1931 G2701 PRT
Arabidopsis thaliana Paralogous to G1634 1932 G2718 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G226,
G682, G1816 1933 G2718 PRT Arabidopsis thaliana Paralogous to G226,
G682, G1816 1934 G2826 DNA Arabidopsis thaliana Predicted
polypeptide sequence is paralogous to G361 1935 G2826 PRT
Arabidopsis thaliana Paralogous to G361 1936 G2838 DNA Arabidopsis
thaliana Predicted polypeptide sequence is paralogous to G361 1937
G2838 PRT Arabidopsis thaliana Paralogous to G361 1938 G3010 DNA
Arabidopsis thaliana Predicted polypeptide sequence is paralogous
to G987 1939 G3010 PRT Arabidopsis thaliana Paralogous to G987 1940
bnCBF1 DNA Brassica napus Predicted polypeptide sequence is
orthologous to G40, G41, G42, G912, G2107, G2513 1941 bnCBF1 PRT
Brassica napus Orthologous to G40, G41, G42, G912, G2107, G2513
1971 Soy PRT Glycine max Predicted polypeptide sequence is
orthologous to G157, MADS 1 G859, G1842, G1843 1973 Soy PRT Glycine
max Predicted polypeptide sequence is orthologous to G157, MADS 3
G859, G1842, G1843
Molecular Modeling
[0507] Another means that may be used to confirm the utility and
function of transcription factor sequences that are orthologous or
paralogous to presently disclosed transcription factors is through
the use of molecular modeling software. Molecular modeling is
routinely used to predict polypeptide structure, and a variety of
protein structure modeling programs, such as "Insight II"
(Accelrys, Inc.) are commercially available for this purpose.
Modeling can thus be used to predict which residues of a
polypeptide can be changed without altering function (Crameri et
al. (2003) U.S. Pat. No. 6,521,453). Thus, polypeptides that are
sequentially similar can be shown to have a high likelihood of
similar function by their structural similarity, which may, for
example, be established by comparison of regions of superstructure.
The relative tendencies of amino acids to form regions of
superstructure (for example, helixes and .beta.-sheets) are well
established. For example, O'Neil et al. (1990) Science 250:
646-651) have discussed in detail the helix forming tendencies of
amino acids. Tables of relative structure forming activity for
amino acids can be used as substitution tables to predict which
residues can be functionally substituted in a given region, for
example, in DNA-binding domains of known transcription factors and
equivalogs. Homologs that are likely to be functionally similar can
then be identified.
[0508] Of particular interest is the structure of a transcription
factor in the region of its conserved domain, such as those
identified in Table 5. Structural analyses may be performed by
comparing the structure of the known transcription factor around
its conserved domain with those of orthologs and paralogs. Analysis
of a number of polypeptides within a transcription factor group or
clade, including the functionally or sequentially similar
polypeptides provided in the Sequence Listing, may also provide an
understanding of structural elements required to regulate
transcription within a given family.
EXAMPLES
[0509] The invention, now being generally described, will be more
readily understood by reference to the following examples, which
are included merely for purposes of illustration of certain aspects
and embodiments of the present invention and are not intended to
limit the invention. It will be recognized by one of skill in the
art that a transcription factor that is associated with a
particular first trait may also be associated with at least one
other, unrelated and inherent second trait which was not predicted
by the first trait.
[0510] The complete descriptions of the traits associated with each
polynucleotide of the invention are fully disclosed in Table 4 and
Table 6. The complete description of the transcription factor gene
family and identified conserved domains of the polypeptide encoded
by the polynucleotide is fully disclosed in Tables 5A and 5B.
Example I
Full Length Gene Identification and Cloning
[0511] Putative transcription factor sequences (genomic or ESTs)
related to known transcription factors were identified in the
Arabidopsis thaliana GenBank database using the tblastn sequence
analysis program using default parameters and a P-value cutoff
threshold of -4 or -5 or lower, depending on the length of the
query sequence. Putative transcription factor sequence hits were
then screened to identify those containing particular sequence
strings. If the sequence hits contained such sequence strings, the
sequences were confirmed as transcription factors.
[0512] Alternatively, Arabidopsis thaliana cDNA libraries derived
from different tissues or treatments, or genomic libraries were
screened to identify novel members of a transcription family using
a low stringency hybridization approach. Probes were synthesized
using gene specific primers in a standard PCR reaction (annealing
temperature 60.degree. C.) and labeled with .sup.32P dCTP using the
High Prime DNA Labeling Kit (Boehringer Mannheim Corp. (now Roche
Diagnostics Corp., Indianapolis, Ind.). Purified radiolabelled
probes were added to filters immersed in Church hybridization
medium (0.5 M NaPO.sub.4 pH 7.0, 7% SDS, 1% w/v bovine serum
albumin) and hybridized overnight at 60.degree. C. with shaking.
Filters were washed two times for 45 to 60 minutes with
1.times.SCC, 1% SDS at 60.degree. C.
[0513] To identify additional sequence 5' or 3' of a partial cDNA
sequence in a cDNA library, 5' and 3' rapid amplification of cDNA
ends (RACE) was performed using the MARATHON cDNA amplification kit
(Clontech, Palo Alto, Calif.). Generally, the method entailed first
isolating poly(A) mRNA, performing first and second strand cDNA
synthesis to generate double stranded cDNA, blunting cDNA ends,
followed by ligation of the MARATHON Adaptor to the cDNA to form a
library of adaptor-ligated ds cDNA.
[0514] Gene-specific primers were designed to be used along with
adaptor specific primers for both 5' and 3' RACE reactions. Nested
primers, rather than single primers, were used to increase PCR
specificity. Using 5' and 3' RACE reactions, 5' and 3' RACE
fragments were obtained, sequenced and cloned. The process can be
repeated until 5' and 3' ends of the full-length gene were
identified. Then the full-length cDNA was generated by PCR using
primers specific to 5' and 3' ends of the gene by end-to-end
PCR.
Example II
Construction of Expression Vectors
[0515] The sequence was amplified from a genomic or cDNA library
using primers specific to sequences upstream and downstream of the
coding region. The expression vector was pMEN20 or pMEN65, which
are both derived from pMON316 (Sanders et al. (1987) Nucleic Acids
Res. 15:1543-1558) and contain the CaMV 35S promoter to express
transgenes. To clone the sequence into the vector, both pMEN20 and
the amplified DNA fragment were digested separately with SalI and
NotI restriction enzymes at 37.degree. C. for 2 hours. The
digestion products were subject to electrophoresis in a 0.8%
agarose gel and visualized by ethidium bromide staining. The DNA
fragments containing the sequence and the linearized plasmid were
excised and purified by using a QIAQUICK gel extraction kit
(Qiagen, Valencia, Calif.). The fragments of interest were ligated
at a ratio of 3:1 (vector to insert). Ligation reactions using T4
DNA ligase (New England Biolabs, Beverly Mass.) were carried out at
16.degree. C. for 16 hours. The ligated DNAs were transformed into
competent cells of the E. coli strain DH5alpha by using the heat
shock method. The transformations were plated on LB plates
containing 50 mg/l kanamycin (Sigma Chemical Co. St. Louis Mo.).
Individual colonies were grown overnight in five milliliters of LB
broth containing 50 mg/l kanamycin at 37.degree. C. Plasmid DNA was
purified by using Qiaquick Mini Prep kits (Qiagen, Valencia
Calif.).
Example III
Transformation of Agrobacterium with the Expression Vector
[0516] After the plasmid vector containing the gene was
constructed, the vector was used to transform Agrobacterium
tumefaciens cells expressing the gene products. The stock of
Agrobacterium tumefaciens cells for transformation were made as
described by Nagel et al. (1990) FEMS Microbiol Letts. 67: 325-328.
Agrobacterium strain ABI was grown in 250 ml LB medium (Sigma)
overnight at 28.degree. C. with shaking until an absorbance over 1
cm at 600 nm (A.sub.600) of 0.5-1.0 was reached. Cells were
harvested by centrifugation at 4,000.times.g for 15 mM at 4.degree.
C. Cells were then resuspended in 250 .mu.l chilled buffer (1 mM
HEPES, pH adjusted to 7.0 with KOH). Cells were centrifuged again
as described above and resuspended in 125 .mu.l chilled buffer.
Cells were then centrifuged and resuspended two more times in the
same HEPES buffer as described above at a volume of 100 .mu.l and
750 .mu.l, respectively. Resuspended cells were then distributed
into 40 .mu.l aliquots, quickly frozen in liquid nitrogen, and
stored at -80.degree. C.
[0517] Agrobacterium cells were transformed with plasmids prepared
as described above following the protocol described by Nagel et al.
(supra). For each DNA construct to be transformed, 50-100 ng DNA
(generally resuspended in 10 mM Tris-HCl, 1 mM EDTA, pH 8.0) was
mixed with 40 .mu.l of Agrobacterium cells. The DNA/cell mixture
was then transferred to a chilled cuvette with a 2 mm electrode gap
and subject to a 2.5 kV charge dissipated at 25 .mu.F and 200 .mu.F
using a Gene Pulser II apparatus (Bio-Rad, Hercules, Calif.). After
electroporation, cells were immediately resuspended in 1.0 ml LB
and allowed to recover without antibiotic selection for 2-4 hours
at 28.degree. C. in a shaking incubator. After recovery, cells were
plated onto selective medium of LB broth containing 100 .mu.g/ml
spectinomycin (Sigma) and incubated for 24-48 hours at 28.degree.
C. Single colonies were then picked and inoculated in fresh medium.
The presence of the plasmid construct was verified by PCR
amplification and sequence analysis.
Example IV
Transformation of Arabidopsis Plants with Agrobacterium tumefaciens
with Expression Vector
[0518] After transformation of Agrobacterium tumefaciens with
plasmid vectors containing the gene, single Agrobacterium colonies
were identified, propagated, and used to transform Arabidopsis
plants. Briefly, 500 ml cultures of LB medium containing 50 mg/l
kanamycin were inoculated with the colonies and grown at 28.degree.
C. with shaking for 2 days until an optical absorbance at 600 nm
wavelength over 1 cm (A.sub.600) of >2.0 is reached. Cells were
then harvested by centrifugation at 4,000.times.g for 10 mM, and
resuspended in infiltration medium (1/2.times. Murashige and Skoog
salts (Sigma), 1.times. Gamborg's B-5 vitamins (Sigma), 5.0% (w/v)
sucrose (Sigma), 0.044 .mu.M benzylamino purine (Sigma), 200
.mu.l/l Silwet L-77 (Lehle Seeds) until an A.sub.600 of 0.8 was
reached.
[0519] Prior to transformation, Arabidopsis thaliana seeds (ecotype
Columbia) were sown at a density of .about.10 plants per 4'' pot
onto Pro-Mix BX potting medium (Hummert International) covered with
fiberglass mesh (18 mm.times.16 mm) Plants were grown under
continuous illumination (50-75 .mu.E/m.sup.2/sec) at 22-23.degree.
C. with 65-70% relative humidity. After about 4 weeks, primary
inflorescence stems (bolts) are cut off to encourage growth of
multiple secondary bolts. After flowering of the mature secondary
bolts, plants were prepared for transformation by removal of all
siliques and opened flowers.
[0520] The pots were then immersed upside down in the mixture of
Agrobacterium infiltration medium as described above for 30 sec,
and placed on their sides to allow draining into a 1'.times.2' flat
surface covered with plastic wrap. After 24 h, the plastic wrap was
removed and pots are turned upright. The immersion procedure was
repeated one week later, for a total of two immersions per pot.
Seeds were then collected from each transformation pot and analyzed
following the protocol described below.
Example V
Identification of Arabidopsis Primary Transformants
[0521] Seeds collected from the transformation pots were sterilized
essentially as follows. Seeds were dispersed into in a solution
containing 0.1% (v/v) Triton X-100 (Sigma) and sterile water and
washed by shaking the suspension for 20 min The wash solution was
then drained and replaced with fresh wash solution to wash the
seeds for 20 min with shaking. After removal of the
ethanol/detergent solution, a solution containing 0.1% (v/v) Triton
X-100 and 30% (v/v) bleach (CLOROX; Clorox Corp. Oakland Calif.)
was added to the seeds, and the suspension was shaken for 10 min.
After removal of the bleach/detergent solution, seeds were then
washed five times in sterile distilled water. The seeds were stored
in the last wash water at 4.degree. C. for 2 days in the dark
before being plated onto antibiotic selection medium (1.times.
Murashige and Skoog salts (pH adjusted to 5.7 with 1M KOH),
1.times. Gamborg's B-5 vitamins, 0.9% phytagar (Life Technologies),
and 50 mg/l kanamycin). Seeds were germinated under continuous
illumination (50-75 .mu.E/m.sup.2/sec) at 22-23.degree. C. After
7-10 days of growth under these conditions, kanamycin resistant
primary transformants (T.sub.1 generation) were visible and
obtained. These seedlings were transferred first to fresh selection
plates where the seedlings continued to grow for 3-5 more days, and
then to soil (Pro-Mix BX potting medium).
[0522] Primary transformants were crossed and progeny seeds
(T.sub.2) collected; kanamycin resistant seedlings were selected
and analyzed. The expression levels of the recombinant
polynucleotides in the transformants varies from about a 5%
expression level increase to a least a 100% expression level
increase. Similar observations are made with respect to polypeptide
level expression.
Example VI
Identification of Arabidopsis Plants with Transcription Factor Gene
Knockouts
[0523] The screening of insertion mutagenized Arabidopsis
collections for null mutants in a known target gene was essentially
as described in Krysan et al. (1999) Plant Cell 11: 2283-2290.
Briefly, gene-specific primers, nested by 5-250 base pairs to each
other, were designed from the 5' and 3' regions of a known target
gene. Similarly, nested sets of primers were also created specific
to each of the T-DNA or transposon ends (the "right" and "left"
borders). All possible combinations of gene specific and
T-DNA/transposon primers were used to detect by PCR an insertion
event within or close to the target gene. The amplified DNA
fragments were then sequenced which allows the precise
determination of the T-DNA/transposon insertion point relative to
the target gene. Insertion events within the coding or intervening
sequence of the genes were deconvoluted from a pool comprising a
plurality of insertion events to a single unique mutant plant for
functional characterization. The method is described in more detail
in Yu and Adam, U.S. application Ser. No. 09/177,733 filed Oct. 23,
1998.
Example VII
Identification of Modified Phenotypes in Overexpression or Gene
Knockout Plants
[0524] Experiments were performed to identify those transformants
or knockouts that exhibited modified biochemical characteristics.
Among the biochemicals that were assayed were insoluble sugars,
such as arabinose, fucose, galactose, mannose, rhamnose or xylose
or the like; prenyl lipids, such as lutein, .beta.-carotene,
xanthophyll-1, xanthophyll-2, chlorophylls A or B, or .alpha.-,
.beta.- or .gamma.-tocopherol or the like; fatty acids, such as
16:0 (palmitic acid), 16:1 (palmitoleic acid), 18:0 (stearic acid),
18:1 (oleic acid), 18:2 (linoleic acid), 20:0, 18:3 (linolenic
acid), 20:1 (eicosenoic acid), 20:2, 22:1 (erucic acid) or the
like; waxes, such as by altering the levels of C29, C31, or C33
alkanes; sterols, such as brassicasterol, campesterol,
stigmasterol, sitosterol or stigmastanol or the like,
glucosinolates, protein or oil levels.
[0525] Fatty acids were measured using two methods depending on
whether the tissue was from leaves or seeds. For leaves, lipids
were extracted and esterified with hot methanolic H.sub.2SO.sub.4
and partitioned into hexane from methanolic brine. For seed fatty
acids, seeds were pulverized and extracted in
methanol:heptane:toluene:2,2-dimethoxypropane:H.sub.2SO.sub.4
(39:34:20:5:2) for 90 minutes at 80.degree. C. After cooling to
room temperature the upper phase, containing the seed fatty acid
esters, was subjected to GC analysis. Fatty acid esters from both
seed and leaf tissues were analyzed with a SUPELCO SP-2330 column
(Supelco, Bellefonte, Pa.).
[0526] Glucosinolates were purified from seeds or leaves by first
heating the tissue at 95.degree. C. for 10 minutes. Preheated
ethanol:water (50:50) is added and after heating at 95.degree. C.
for a further 10 minutes, the extraction solvent is applied to a
DEAE Sephadex column (Pharmacia) which had been previously
equilibrated with 0.5 M pyridine acetate. Desulfoglucosinolates
were eluted with 300 ul water and analyzed by reverse phase HPLC
monitoring at 226 nm.
[0527] For wax alkanes, samples were extracted using an identical
method as fatty acids and extracts were analyzed on a HP 5890 GC
coupled with a 5973 MSD. Samples were chromatographically isolated
on a J&W DB35 mass spectrometer (J&W Scientific Agilent
Technologies, Folsom, Calif.).
[0528] To measure prenyl lipid levels, seeds or leaves were
pulverized with 1 to 2% pyrogallol as an antioxidant. For seeds,
extracted samples were filtered and a portion removed for
tocopherol and carotenoid/chlorophyll analysis by HPLC. The
remaining material was saponified for sterol determination. For
leaves, an aliquot was removed and diluted with methanol and
chlorophyll A, chlorophyll B, and total carotenoids measured by
spectrophotometry by determining optical absorbance at 665.2 nm,
652.5 nm, and 470 nm. An aliquot was removed for tocopherol and
carotenoid/chlorophyll composition by HPLC using a Waters
.mu.Bondapak C18 column (4.6 mm.times.150 mm) The remaining
methanolic solution was saponified with 10% KOH at 80.degree. C.
for one hour. The samples were cooled and diluted with a mixture of
methanol and water. A solution of 2% methylene chloride in hexane
was mixed in and the samples were centrifuged. The aqueous methanol
phase was again re-extracted 2% methylene chloride in hexane and,
after centrifugation, the two upper phases were combined and
evaporated. 2% methylene chloride in hexane was added to the tubes
and the samples were then extracted with one ml of water. The upper
phase was removed, dried, and resuspended in 400 ul of 2% methylene
chloride in hexane and analyzed by gas chromatography using a 50 m
DB-5 ms (0.25 mm ID, 0.25 .mu.m phase, J&W Scientific).
[0529] Insoluble sugar levels were measured by the method
essentially described by Reiter et al. (1999), Plant J. 12:
335-345. This method analyzes the neutral sugar composition of cell
wall polymers found in Arabidopsis leaves. Soluble sugars were
separated from sugar polymers by extracting leaves with hot 70%
ethanol. The remaining residue containing the insoluble
polysaccharides was then acid hydrolyzed with allose added as an
internal standard. Sugar monomers generated by the hydrolysis were
then reduced to the corresponding alditols by treatment with NaBH4,
then were acetylated to generate the volatile alditol acetates
which were then analyzed by GC-FID. Identity of the peaks was
determined by comparing the retention times of known sugars
converted to the corresponding alditol acetates with the retention
times of peaks from wild-type plant extracts. Alditol acetates were
analyzed on a Supelco SP-2330 capillary column (30 m.times.250
.mu.m.times.0.2 .mu.m) using a temperature program beginning at
180.degree. C. for 2 minutes followed by an increase to 220.degree.
C. in 4 minutes. After holding at 220.degree. C. for 10 minutes,
the oven temperature is increased to 240.degree. C. in 2 minutes
and held at this temperature for 10 minutes and brought back to
room temperature.
[0530] To identify plants with alterations in total seed oil or
protein content, 150 mg of seeds from T2 progeny plants were
subjected to analysis by Near Infrared Reflectance Spectroscopy
(NIRS) using a Foss NirSystems Model 6500 with a spinning cup
transport system. NIRS is a non-destructive analytical method used
to determine seed oil and protein composition. Infrared is the
region of the electromagnetic spectrum located after the visible
region in the direction of longer wavelengths. `Near infrared` owns
its name for being the infrared region near to the visible region
of the electromagnetic spectrum. For practical purposes, near
infrared comprises wavelengths between 800 and 2500 nm. NIRS is
applied to organic compounds rich in O--H bonds (such as moisture,
carbohydrates, and fats), C--H bonds (such as organic compounds and
petroleum derivatives), and N--H bonds (such as proteins and amino
acids). The NIRS analytical instruments operate by statistically
correlating NIRS signals at several wavelengths with the
characteristic or property intended to be measured. All biological
substances contain thousands of C--H, O--H, and N--H bonds.
Therefore, the exposure to near infrared radiation of a biological
sample, such as a seed, results in a complex spectrum which
contains qualitative and quantitative information about the
physical and chemical composition of that sample.
[0531] The numerical value of a specific analyte in the sample,
such as protein content or oil content, is mediated by a
calibration approach known as chemometrics. Chemometrics applies
statistical methods such as multiple linear regression (MLR),
partial least squares (PLS), and principle component analysis (PCA)
to the spectral data and correlates them with a physical property
or other factor, that property or factor is directly determined
rather than the analyte concentration itself. The method first
provides "wet chemistry" data of the samples required to develop
the calibration.
[0532] Calibration of NIRS response was performed using data
obtained by wet chemical analysis of a population of Arabidopsis
ecotypes that were expected to represent diversity of oil and
protein levels.
[0533] The exact oil composition of each ecotype used in the
calibration experiment was performed using gravimetric analysis of
oils extracted from seed samples (0.5 g or 1.0 g) by the
accelerated solvent extraction method (ASE; Dionex Corp, Sunnyvale,
Calif.). The extraction method was validated against certified
canola samples (Community Bureau of Reference, Belgium). Seed
samples from each ecotype (0.5 g or 1 g) were subjected to
accelerated solvent extraction and the resulting extracted oil
weights compared to the weight of oil recovered from canola seed
that has been certified for oil content (Community Bureau of
Reference). The oil calibration equation was based on 57 samples
with a range of oil contents from 27.0% to 50.8%. To check the
validity of the calibration curve, an additional set of samples was
extracted by ASE and predicted using the oil calibration equation.
This validation set counted 46 samples, ranging from 27.9% to 47.5%
oil, and had a predicted standard error of performance of 0.63%.
The wet chemical method for protein was elemental analysis (%
N.times.6.0) using the average of 3 representative samples of 5 mg
each validated against certified ground corn (NIST). The
instrumentation was an Elementar Vario-EL III elemental analyzer
operated in CNS operating mode (Elementar Analysensysteme GmbH,
Hanau, Germany).
[0534] The protein calibration equation was based on a library of
63 samples with a range of protein contents from 17.4% to 31.2%. An
additional set of samples was analyzed for protein by elemental
analysis (n=57) and scanned by NIRS in order to validate the
protein prediction equation. The protein range of the validation
set was from 16.8% to 31.2% and the standard error of prediction
was 0.468%.
[0535] NIRS analysis of Arabidopsis seed was carried out on between
40-300 mg experimental sample. The oil and protein contents were
predicted using the respective calibration equations.
[0536] Data obtained from NIRS analysis was analyzed statistically
using a nearest-neighbor (N--N) analysis. The N--N analysis allows
removal of within-block spatial variability in a fairly flexible
fashion, which does not require prior knowledge of the pattern of
variability in the chamber. Ideally, all hybrids are grown under
identical experimental conditions within a block (rep). In reality,
even in many block designs, significant within-block variability
exists. Nearest-neighbor procedures are based on assumption that
environmental effect of a plot is closely related to that of its
neighbors. Nearest-neighbor methods use information from adjacent
plots to adjust for within-block heterogeneity and so provide more
precise estimates of treatment means and differences. If there is
within-plot heterogeneity on a spatial scale that is larger than a
single plot and smaller than the entire block, then yields from
adjacent plots will be positively correlated. Information from
neighboring plots can be used to reduce or remove the unwanted
effect of the spatial heterogeneity, and hence improve the estimate
of the treatment effect. Data from neighboring plots can also be
used to reduce the influence of competition between adjacent plots.
The Papadakis N--N analysis can be used with designs to remove
within-block variability that would not be removed with the
standard split plot analysis (Papadakis (1973) Inst. d'Amelior.
Plantes Thessaloniki (Greece) Bull. Scientif. No. 23; Papadakis
(1984) Proc. Acad. Athens 59: 326-342.
[0537] Experiments were performed to identify those transformants
or knockouts that exhibited modified sugar-sensing. For such
studies, seeds from transformants were germinated on media
containing 5% glucose or 9.4% sucrose which normally partially
restrict hypocotyl elongation. Plants with altered sugar sensing
may have either longer or shorter hypocotyls than normal plants
when grown on this media. Additionally, other plant traits may be
varied such as root mass.
[0538] Experiments may be performed to identify those transformants
or knockouts that exhibited an improved pathogen tolerance. For
such studies, the transformants are exposed to biotropic fungal
pathogens, such as Erysiphe orontii, and necrotropic fungal
pathogens, such as Fusarium oxysporum. Fusarium oxysporum isolates
cause vascular wilts and damping off of various annual vegetables,
perennials and weeds (Mauch-Mani and Slusarenko (1994) Molec
Plant-Microbe Interact. 7: 378-383). For Fusarium oxysporum
experiments, plants are grown on Petri dishes and sprayed with a
fresh spore suspension of F. oxysporum. The spore suspension is
prepared as follows: A plug of fungal hyphae from a plate culture
is placed on a fresh potato dextrose agar plate and allowed to
spread for one week. Five ml sterile water is then added to the
plate, swirled, and pipetted into 50 ml Armstrong Fusarium medium.
Spores are grown overnight in Fusarium medium and then sprayed onto
plants using a Preval paint sprayer. Plant tissue is harvested and
frozen in liquid nitrogen 48 hours post-infection.
[0539] Erysiphe orontii is a causal agent of powdery mildew. For
Erysiphe orontii experiments, plants are grown approximately 4
weeks in a greenhouse under 12 hour light (20.degree. C.,
.about.30% relative humidity (rh)). Individual leaves are infected
with E. orontii spores from infected plants using a camel's hair
brush, and the plants are transferred to a Percival growth chamber
(20.degree. C., 80% rh.). Plant tissue is harvested and frozen in
liquid nitrogen 7 days post-infection.
[0540] Botrytis cinerea is a necrotrophic pathogen. Botrytis
cinerea is grown on potato dextrose agar under 12 hour light
(20.degree. C., .about.30% relative humidity (rh)). A spore culture
is made by spreading 10 ml of sterile water on the fungus plate,
swirling and transferring spores to 10 ml of sterile water. The
spore inoculum (approx. 105 spores/ml) is then used to spray 10
day-old seedlings grown under sterile conditions on MS (minus
sucrose) media. Symptoms are evaluated every day up to
approximately 1 week.
[0541] Sclerotinia sclerotiorum hyphal cultures are grown in potato
dextrose broth. One gram of hyphae is ground, filtered, spun down
and resuspended in sterile water. A 1:10 dilution is used to spray
10 day-old seedlings grown aseptically under a 12 hour light/dark
regime on MS (minus sucrose) media. Symptoms are evaluated every
day up to approximately 1 week.
[0542] Pseudomonas syringae pv maculicola (Psm) strain 4326 and pv
maculicola strain 4326 was inoculated by hand at two doses. Two
inoculation doses allows the differentiation between plants with
enhanced susceptibility and plants with enhanced resistance to the
pathogen. Plants are grown for 3 weeks in the greenhouse, then
transferred to the growth chamber for the remainder of their
growth. Psm ES4326 may be hand inoculated with 1 ml syringe on 3
fully-expanded leaves per plant (41/2 wk old), using at least 9
plants per overexpressing line at two inoculation doses, OD=0.005
and OD=0.0005. Disease scoring is performed at day 3
post-inoculation with pictures of the plants and leaves taken in
parallel.
[0543] In some instances, expression patterns of the
pathogen-induced genes (such as defense genes) may be monitored by
microarray experiments. In these experiments, cDNAs are generated
by PCR and resuspended at a final concentration of .about.100
ng/.mu.l in 3.times.SSC or 150 mM Na-phosphate (Eisen and Brown
(1999) Methods Enzymol. 303: 179-205). The cDNAs are spotted on
microscope glass slides coated with polylysine. The prepared cDNAs
are aliquoted into 384 well plates and spotted on the slides using,
for example, an x-y-z gantry (OmniGrid) which may be purchased from
GeneMachines (Menlo Park, Calif.) outfitted with quill type pins
which may be purchased from Telechem International (Sunnyvale,
Calif.). After spotting, the arrays are cured for a minimum of one
week at room temperature, rehydrated and blocked following the
protocol recommended by Eisen and Brown (1999; supra).
[0544] Sample total RNA (10 .mu.g) samples are labeled using
fluorescent Cy3 and Cy5 dyes. Labeled samples are resuspended in
4.times.SSC/0.03% SDS/4 .mu.g salmon sperm DNA/2 .mu.g tRNA/50 mM
Na-pyrophosphate, heated for 95.degree. C. for 2.5 minutes, spun
down and placed on the array. The array is then covered with a
glass coverslip and placed in a sealed chamber. The chamber is then
kept in a water bath at 62.degree. C. overnight. The arrays are
washed as described in Eisen and Brown (1999, supra) and scanned on
a General Scanning 3000 laser scanner. The resulting files are
subsequently quantified using IMAGENE, software (BioDiscovery, Los
Angeles Calif.).
[0545] RT-PCR experiments may be performed to identify those genes
induced after exposure to biotropic fungal pathogens, such as
Erysiphe orontii, necrotropic fungal pathogens, such as Fusarium
oxysporum, bacteria, viruses and salicylic acid, the latter being
involved in a nonspecific resistance response in Arabidopsis
thaliana. Generally, the gene expression patterns from ground plant
leaf tissue is examined.
[0546] Reverse transcriptase PCR was conducted using gene specific
primers within the coding region for each sequence identified. The
primers were designed near the 3' region of each DNA binding
sequence initially identified.
[0547] Total RNA from these ground leaf tissues was isolated using
the CTAB extraction protocol. Once extracted total RNA was
normalized in concentration across all the tissue types to ensure
that the PCR reaction for each tissue received the same amount of
cDNA template using the 28S band as reference. Poly(A+) RNA was
purified using a modified protocol from the Qiagen OLIGOTEX
purification kit batch protocol. cDNA was synthesized using
standard protocols. After the first strand cDNA synthesis, primers
for Actin 2 were used to normalize the concentration of cDNA across
the tissue types. Actin 2 is found to be constitutively expressed
in fairly equal levels across the tissue types being
investigated.
[0548] For RT PCR, cDNA template was mixed with corresponding
primers and Taq DNA polymerase. Each reaction consisted of 0.2
.mu.l cDNA template, 2 .mu.l 10.times. Tricine buffer, 2 .mu.l
10.times. Tricine buffer and 16.8 .mu.l water, 0.05 .mu.l Primer 1,
0.05 .mu.l, Primer 2, 0.3 .mu.l Taq DNA polymerase and 8.6 .mu.l
water.
[0549] The 96 well plate is covered with microfilm and set in the
thermocycler to start the reaction cycle. By way of illustration,
the reaction cycle may comprise the following steps:
[0550] STEP 1: 93.degree. C. FOR 3 MIN;
[0551] Step 2: 93.degree. C. for 30 sec;
[0552] Step 3: 65.degree. C. for 1 min;
[0553] Step 4: 72.degree. C. for 2 min;
[0554] Steps 2, 3 and 4 are repeated for 28 cycles;
[0555] Step 5: 72.degree. C. for 5 min; and
[0556] Step 6 4.degree. C.
[0557] To amplify more products, for example, to identify genes
that have very low expression, additional steps may be performed:
The following method illustrates a method that may be used in this
regard. The PCR plate is placed back in the thermocycler for 8 more
cycles of steps 2-4.
[0558] Step 2 93.degree. C. for 30 sec;
[0559] Step 3 65.degree. C. for 1 min;
[0560] Step 4 72.degree. C. for 2 min, repeated for 8 cycles;
and
[0561] Step 5 4.degree. C.
[0562] Eight microliters of PCR product and 1.5 .mu.l of loading
dye are loaded on a 1.2% agarose gel for analysis after 28 cycles
and 36 cycles. Expression levels of specific transcripts are
considered low if they were only detectable after 36 cycles of PCR.
Expression levels are considered medium or high depending on the
levels of transcript compared with observed transcript levels for
an internal control such as actin2. Transcript levels are
determined in repeat experiments and compared to transcript levels
in control (e.g., non-transformed) plants.
[0563] Experiments were performed to identify those transformants
or knockouts that exhibited an improved environmental stress
tolerance. For such studies, the transformants were exposed to a
variety of environmental stresses. Plants were exposed to chilling
stress (6 hour exposure to 4-8.degree. C.), heat stress (6 hour
exposure to 32-37.degree. C.), high salt stress (6 hour exposure to
200 mM NaCl), drought stress (168 hours after removing water from
trays), osmotic stress (6 hour exposure to 3 M mannitol), or
nutrient limitation (nitrogen: all components of MS medium remained
constant except N was reduced to 20 mg/l of NH.sub.4NO.sub.3;
phosphate: all components of MS medium except KH2PO.sub.4, which
was replaced by K.sub.2SO.sub.4; potassium: all components of MS
medium except removal of KNO.sub.3 and KH.sub.2PO.sub.4, which were
replaced by NaH.sub.4PO.sub.4).
[0564] Experiments were performed to identify those transformants
or knockouts that exhibited a modified structure and development
characteristics. For such studies, the transformants were observed
by eye to identify novel structural or developmental
characteristics associated with the ectopic expression of the
polynucleotides or polypeptides of the invention.
[0565] Flowering time was measured by the number of rosette leaves
present when a visible inflorescence of approximately 3 cm is
apparent. Rosette and total leaf number on the progeny stem are
tightly correlated with the timing of flowering (Koornneef et al.
(1991) Mol. Gen. Genet. 229: 57-66). The vernalization response was
also measured. For vernalization treatments, seeds were sown to MS
agar plates, sealed with micropore tape, and placed in a 4.degree.
C. cold room with low light levels for 6-8 weeks. The plates were
then transferred to the growth rooms alongside plates containing
freshly sown non-vernalized controls. Rosette leaves were counted
when a visible inflorescence of approximately 3 cm was
apparent.
[0566] Modified phenotypes observed for particular overexpressor or
knockout plants are provided in Table 4. For a particular
overexpressor that shows a less beneficial characteristic, it may
be more useful to select a plant with a decreased expression of the
particular transcription factor. For a particular knockout that
shows a less beneficial characteristic, it may be more useful to
select a plant with an increased expression of the particular
transcription factor.
[0567] The sequences of the Sequence Listing or those in Tables
4-8, or those disclosed here, can be used to prepare transgenic
plants and plants with altered traits. The specific transgenic
plants listed below are produced from the sequences of the Sequence
Listing, as noted. Table 4 provides exemplary polynucleotide and
polypeptide sequences of the invention.
Example VIII
Examples of Genes that Confer Significant Improvements to
Plants
[0568] A number of genes and homologs that confer significant
improvements to knockout or overexpressing plants were noted below.
Experimental observations made with regard to specific genes whose
expression was modified in overexpressing or knockout plants, and
potential applications based on these observations, were also
presented.
G8 (SEQ ID NO: 11)
[0569] Published Information.
[0570] G8 corresponds to gene At2g28550 (AAD21489). The gene has
also been described as RAP2.7 (Okamuro et al. (1997) Proc. Natl.
Acad. Sci. U.S.A. 94: 7076-7081). No functional information is
available about G8. Experimental Observations
[0571] The function of G8 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
Overexpression of G8 caused alterations in plant development, the
most consistent one being a delay in flowering time.
[0572] This phenotype was observed in approximately 25% of the
primary transformants. These individuals showed a relatively strong
phenotype and typically made 30-50 leaves (versus 10-12 the
wild-type controls) prior to bolting under 24-hour light. This
phenotype was reproduced in some, but not all, of the T2 progeny
plants from each one of the lines. Additionally, a further T2
population was found to flower later than wild type in 12-hour
light conditions. Thus, late flowering was observed in both the T1
and T2 generations, and in different photoperiodic conditions. It
should also be noted that many 35S::G8 plants appeared smaller than
controls, particularly at early stages. Accordingly, in the T2
lines used for physiological analyses it was observed that
seedlings were smaller and showed reduced vigor when germinated on
MS plates. However, not all 35S::G8 lines showed these effects.
[0573] G8 was ubiquitously expressed, at higher levels in rosette
leaves, and did not appear to be induced by any of the conditions
tested. Utilities
[0574] G8 could potentially be used to alter flowering time.
G19 (SEQ ID NO: 21)
[0575] Published Information.
[0576] G19 belongs to the EREBP subfamily of transcription factors,
i.e., it contains only one AP2 domain. G19 corresponds to the
previously described gene RAP2.3 (Okamuro et al. (1997) Proc. Natl.
Acad. Sci. U.S.A. 94: 7076-7081). Close inspection of the
Arabidopsis cDNA sequences of RAP2.3 (AF003096; Okamuro et al.
(1997) supra), AtEBP (Y09942; Buttner and Singh (1997) Proc. Natl.
Acad. Sci. U.S.A 94: 5961-5966), and ATCADINP (Z37504) suggests
that they may correspond to the same gene (Riechmann and
Meyerowitz, (1998) Biol. Chem. 379: 633-646). G19/RAP2.3 is
ubiquitously expressed (Okamuro et al. (1997) supra). AtEBP was
isolated by virtue of the protein-protein interaction between AtEBP
and OBF4, a basic-region leucine zipper transcription factor
(Buttner and Singh (1997) supra). AtEBP expression levels in
seedlings were increased after treatment with ethylene (ethephon)
(Buttner and Singh (1997) supra). AtEBP was found to bind to
GCC-box containing sequences, like that of the PRB-1b promoter
(Buttner and Singh (1997) supra). It has been suggested that the
interaction between AtEBP and OBF4 reflects cross-coupling between
EREBP and bZIP transcription factors which might be important in
regulating gene expression during the plant defense response
(Buttner and Singh (1997) supra). Experimental Observations
[0577] Transgenic plants in which G19 was expressed under the
control of the 35S promoter were morphologically similar to control
plants. G19 was constitutively expressed in the different tissues
examined; however G19 expression was significantly repressed by
methyl jasmonate (MeJ) and induced by ACC (this latter result
correlates with the previously described increase in G19 expression
levels in seedlings after treatment with ethylene (ethephon);
Buttner and Singh (1997) supra). G19 was significantly induced upon
infection by the fungal pathogen Erysiphe orontii. In addition, G19
overexpressing plants were more tolerant to infection with a
moderate dose of Erysiphe orontii. Both the jasmonic acid and the
ethylene signal transduction pathways are involved in the
regulation of the defense response and the wound response, and the
two pathways have been found to interact synergistically. The
regulation of G19 expression by both hormones, its induction upon
Erysiphe orontii infection, as well as the preliminary data
indicating that increased tolerance to that pathogen is conferred
by G19 overexpression, suggested that G19 might play a role in the
control of the defense and/or wound response. Utilities
[0578] G19 can be used to manipulate the plant defense- wound- or
insect-response, as well as the jasmonic acid and ethylene signal
transduction pathways themselves.
G22 (SEQ ID NO: 27)
[0579] Published Information.
[0580] G22 has been identified in the sequence of BAC T13E15 (gene
T13E15.5) by The Institute of Genomic Research (TIGR) as a "TINY
transcription factor isolog". G22 belongs to the EREBP subfamily,
i.e., it contains only one AP2 domain, and phylogenetic analyses
place G22 relatively close to other EREBP subfamily genes, like
TINY and ATDL4400C (Riechmann and Meyerowitz (1998) Biol. Chem.
379: 633-646). No functional information is available about G22.
Experimental Observations
G22 was constitutively expressed at medium levels. There appeared
to be no phenotypic alteration on plant morphology upon G22
overexpression. Plants ectopically overexpressing G22 were more
tolerant to high NaCl-containing media in a root growth assay
compared to wild-type controls. Utilities
[0581] G22 could be used to increase plant tolerance to soil
salinity during germination, at the seedling stage, or throughout
the plant life cycle.
G24 (SEQ ID NO: 29)
[0582] Published Information.
[0583] G24 corresponds to gene At2g23340 (AAB87098). No information
is available about the function(s) of G24. Closely Related Genes
from Other Species
[0584] G24 is highly related to a Descurainia sophia AP2/EREBP gene
represented by cDNA clone: BG321374 (BG321374 Ds01.sub.--06d08_R
Ds01_AAFC_ECORC_cold_stressed_Flixweed_seedlings Descurainia sophia
cDNA clone Ds01.sub.--06d08, mRNA sequence). Experimental
Observations
[0585] The function of G24 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
Overexpression of G24 caused alterations in plant growth and
development. Most notably, 35S::G24 seedlings often developed black
necrotic tissue patches on cotyledons and leaves, and many died at
that stage. Some 35S::G24 seedlings exhibited a weaker phenotype,
and although necrotic patches were visible on the cotyledons, they
did not die. These seedlings developed into plants that were
usually small, slow growing, and poorly fertile in comparison to
wild type controls. The leaves of older 35S::G24 plants were also
observed to become yellow and senesce prematurely compared to wild
type. For those lines that could be assayed in biochemical and
physiological assays, no differences were observed with respect to
wild type controls.
[0586] G24 is ubiquitously expressed, at apparently lower levels in
germinating seedlings, and is not significantly induced by any of
the conditions tested.
The AP2 domain of G24 is nearly identical to that of other
Arabidopsis EREBP proteins, such as G12, G1379, and G1277. Whether
all these proteins share related functions remains to be determined
Utilities
[0587] G24 or its equivalogs can be used to trigger cell death and
influence or control processes in which cell death plays a role.
G24 can be used to block pathogen infection by triggering it in
infected cells and blocking spread of the disease.
G28 (SEQ ID NO: 37)
[0588] Published Information.
[0589] G28 corresponds to AtERF1 (GenBank accession number
AB008103) (Fujimoto et al. (2000) Plant Cell 12: 393-404). G28
appears as gene AT4g17500 in the annotated sequence of Arabidopsis
chromosome 4 (AL161546.2).
[0590] AtERF1 has been shown to have GCC-box binding activity [some
defense-related genes that were induced by ethylene were found to
contain a short cis-acting element known as the GCC-box: AGCCGCC
(Ohme et al. (1990) Plant Mol. Biol. 15: 941-946)]. Using transient
assays in Arabidopsis leaves, AtERF1 was found to be able to act as
a GCC-box sequence specific transactivator (Fujimoto et al. (2000)
supra).
[0591] AtERF1 expression has been described to be induced by
ethylene (two- to three-fold increase in AtERF1 transcript levels
12 h after ethylene treatment) (Fujimoto et al. (2000) supra). In
the ein2 mutant, the expression of AtERF1 was not induced by
ethylene, suggesting that the ethylene induction of AtERF1 is
regulated under the ethylene signaling pathway (Fujimoto et al.
(2000) supra). AtERF1 expression was also induced by wounding, but
not by other abiotic stresses (such as cold, salinity, or drought)
(Fujimoto et al. (2000) supra).
It has been suggested that AtERFs, in general, may act as
transcription factors for stress-responsive genes, and that the
GCC-box may act as a cis-regulatory element for biotic and abiotic
stress signal transduction in addition to its role as an ethylene
responsive element (ERE) (Fujimoto et al. (2000) supra), but there
is no data available on the physiological functions of AtERF1.
Experimental Observations
[0592] The function of G28 was analyzed using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. G28 overexpressing lines were more tolerant to infection
with a moderate dose of the fungal pathogen Erysiphe orontii. G28
overexpression did not seem to have detrimental effects on plant
growth or vigor, since plants from most of the lines were
morphologically wild-type. In addition, no difference was detected
between those lines and the corresponding wild-type controls in all
the biochemical assays that were performed.
G28 was ubiquitously expressed. G28 overexpressing lines were also
more tolerant to Sclerotinia sclerotiorum and Botrytis cinerea. In
a repeat experiment using individual lines, all three lines
analyzed showed tolerance to S. sclerotiorum, and two of the three
lines tested were more tolerant to B cinerea. Utilities
[0593] G28 transgenic plants had an altered response to fungal
pathogens, in that those plants were more tolerant to the
pathogens. Therefore, G28 or its equivalogs can be used to
manipulate the defense response in order to generate
pathogen-resistant plants.
G46 (SEQ ID NO: 53)
[0594] Published Information.
[0595] G46 was first identified in the sequence of P1 clone MBK20
(GenBank accession number AB010070, gene MBK20.1). No information
is available about the function(s) of G46. Experimental
Observations
[0596] RT-PCR experiments revealed that G46 is ubiquitously
expressed, but is apparently induced by stress conditions such as
auxin, heat, salt and Erysiphe.
[0597] The function of G46 was first studied by analyzing knockout
mutants with a line homozygous for a T-DNA insertion in the gene.
G46 knockout mutant plants were indistinguishable from wild-type in
all assays performed.
[0598] The function of G46 was also analyzed using transgenic
plants in which a cDNA clone of the gene was expressed under the
control of the 35S promoter. A small number of lines were larger
than wild-type plants, developed more rapidly, and yielded an
increased quantity of seed compared to wild-type controls.
In the physiological analysis, all three 35S::G46 lines tested
showed more resistance to severe water deprivation stress.
Seedlings are generally larger and greener than the control plants
exposed to the same conditions. Utilities
[0599] The increased size and growth rate seen in some of the
lines, indicates that the gene could be used to increase crop
productivity.
[0600] The reduced sensitivity of 35S::G46 lines in the dehydration
stress assay indicates that the gene may also be used to engineer
crops with increased tolerance to drought, salt, freezing and/or
chilling stress, or increased water use efficiency.
G153 (SEQ ID NO: 65)
[0601] Published Information.
[0602] G153 corresponds to the Arabidopsis ANR1 gene. This locus
was identified by Zhang and Forde ((1998) Science 279: 407-409) as
a MADS box gene that is rapidly induced in the roots of nitrogen
starved seedlings, following exposure to a nitrate source.
Additionally, it was shown that transgenic lines in which an
antisense clone of ANR1 is overexpressed, show an altered
sensitivity to nitrate and, unlike wild-type plants, do not exhibit
lateral root proliferation in response to nitrate treatments. From
these data, it was concluded that ANR1 is a key regulator of
nutrient-induced changes in root architecture (Zhang and Forde
(1998) supra).
[0603] However, Wang et al. ((2000) Plant Cell 12: 1491-1509) have
published data which contradicts the results of Zhang and Forde.
These authors found that ANR1 is actually repressed, rather than
induced, following treatment of nitrogen starved seedlings (grown
on 10 mM ammonium succinate as the sole nitrogen source) with 5 mM
nitrate.
[0604] A phylogenetic analysis of the Arabidopsis MADS box gene
family situated ANR1 in same clade as three other MADS box genes:
AGL16 (G860), AGL17 (G152) and AGL21 (G1760) (Alvarez-Buylla et al.
(2000) Proc Natl Acad Sci USA. 97: 5328-5333). Two of the genes,
AGL17 and AGL21 were recently shown to be expressed in specific
zones of the root, suggesting that different members of the ANR1
clade may play distinct regulatory roles during root development
(Burgeff et al. (2002) Planta 214: 365-372).
The ANR1 sequence (GenBank accession AX507709) has also been
included in a patent publication (WO0216655) as a stress-regulated
plant. Experimental Observations
[0605] RT-PCR experiments revealed that G153 was up-regulated in
leaves in response to heat and Fusarium treatments. Lower levels of
induction were also observed following auxin, ABA, and cold
treatments, indicating that G153 might have a role in a variety of
stress responses.
[0606] To further assess the function of the gene, 35S::G153 lines
were generated and subjected them to various assays. Around a third
of the lines showed a marked acceleration in the onset of
flowering, suggesting that the gene might impinge on genetic
pathways that regulate flowering time. In addition to the effects
on flowering, 35S::G153 lines displayed an enhanced performance in
an assay intended to reveal alterations in C:N sensing. 35S::G153
seedlings contained less anthocyanins (and in some cases were
larger) than wild-type controls grown on high sucrose/N- plates.
Seedlings were also larger and greener on high sucrose/N- plates
that had been supplemented with glutamine. Together, these data
indicated that overexpression of G153 alters the ability to
modulate carbon and/or nitrogen uptake and utilization.
A closely related gene, G1760 (SEQ ID NO: 937), was analyzed and
like 35S::G153 transformants, 35S::G1760 lines also exhibited early
flowering and RT-PCR studies showed G1760 to be predominantly
expressed in roots and to be stress responsive. Thus, G1760 and
G153 likely have similar and/or overlapping functions.
Utilities
[0607] The response of G153 expression to different physiological
treatments indicated that the gene or its equivalogs could be used
to improve resistance to a variety of different stresses. In
particular, the enhanced performance of 35S::G153 lines under low
nitrogen conditions indicated that G153 might be used to engineer
crops that could thrive in environments with reduced nitrogen
availability.
[0608] Given the early flowering seen in the 35S::G153
transformants, the gene or its equivalogs might also be applied to
manipulate the flowering time of commercial species. In particular,
G153 could be used to accelerate flowering, or eliminate any
requirement for vernalization. Conversely, it might be possible to
modify the activity of G153 or its equivalogs to delay flowering in
order to achieve an increase in biomass and yield.
G156 (SEQ ID NO: 67)
[0609] Published Information.
[0610] G156 corresponds to gene MKD15.12 (GenBank accession number
BAB11181.1). G156 has also been described as AGL32 (Alvarez-Buylla
et al. (2000) Proc. Natl. Acad. Sci. 97:5328-5333). Phylogenetic
analyses of the Arabidopsis MADS box gene family indicate that
G156/AGL32 is a Type II MADS-box gene, but it does not belong to
any of the well-characterized Type II MADS gene clades
(Alvarez-Buylla et al. 2000 supra). Experimental Observations
[0611] The complete cDNA sequence of G156 was determined. The
function of this gene was analyzed using both transgenic plants in
which G156 was expressed under the control of the 35S promoter and
a line homozygous for a T-DNA insertion in the gene. The T-DNA
insertion lies in the second intron, and was expected to result in
a strong loss-of-function or null mutation.
[0612] G156 knockout mutant plants produced yellow seed that showed
more variation in shape than wild type, implying a function (direct
or indirect) for G156 in seed development. G156 mutant plants were
otherwise normal at all other developmental stages. Expression of
G156 was determined to be specific to floral tissues. Although
expression was detected by RT-PCR in flowers, siliques, and
embryos, it could well be that G156 was specifically expressed in
embryo/seed during development, in light of the many MADS box genes
that have been shown to be expressed in specific floral organs or
cell types, and of the G156 knockout mutant phenotype. In situ RNA
hybridization experiments will determine more precisely G156
expression pattern.
[0613] The coloration phenotype of the G156 knockout mutant seed
resembles that of ttg1 and the transparent testa mutants. TTG1,
which is localized in Chromosome 5, but approximately 0.5 Mb away
from the clone that contains G156 (MKD15), codes for a WD40 repeat
protein (Walker et al. (1999) Plant Cell 11:1337-1350). The
transparent testa (tt) loci were identified in screens for
mutations that result in yellow or pale brown seeds (Koornneef
(1990) Arabidopsis Inf. Ser. 27:1-4). Many of the "TT" genes have
been mapped, and several of them have been cloned and shown to be
involved in the anthocyanin pathway (Debeaujon et al. (2001) Plant
Cell 13:853-872)
[0614] None of the TT genes corresponds to G156. TT3, TT4, TT5, and
TT7 code for dihydroflavol 4-reductase, chalcone synthase, chalcone
flavanone isomerase, and flavonoid 3'-hydroxylase, respectively
(Shirley et al. (1992) Plant Cell 4:333-347; Shirley et al. (1995)
Plant J. 8:659-671). TT12 encodes a multidrug secondary
transporter-like protein required for flavonoid sequestration in
vacuoles of the seed coat endothelium (Debeaujon et al. (2001)
supra). TT6 and TT9 map on Chromosome 3, and TT1 maps on Chromosome
1. TT2 and TT10 map on Chromosome 5, but far away from the position
of G156 (Shirley et al. (1995) supra). TT8 has also been cloned and
shown to encode a transcription factor of the basic
helix-loop-helix class (Nesi et al. (2000) Plant Cell
12:1863-1878), providing further evidence for the regulation of the
anthocyanin pathway at the transcriptional level.
[0615] The similarity of the G156 knockout and tt seed coloration
phenotypes, and the involvement of at least some of the TT genes in
the anthocyanin pathway, suggested that G156 is involved in its
regulation.
[0616] In addition to the seed coloration phenotype, the G156
knockout mutant showed a significant increase in the percentage of
seed 18:1 fatty acids.
[0617] G156 overexpressing plants showed a variety of morphological
alterations, largely uninformative. The most severely affected
transformants were extremely dwarfed, had aberrant branching, and
sometimes possessed terminal flowers. These phenotypic alterations
were frequently observed when MADS box genes that were involved in
flower development were overexpressed in Arabidopsis (for instance,
AG, AP1, and AP3+PI; Mizukami et al. (1992) Cell 71:119-131; Mandel
et al. (1995) Nature 377:522-524; Krizek et al. (1996) Development
122:11-22).
Both G156 knockout mutant plants and G156 overexpressing lines
behaved like the wild-type controls in the physiological assays
performed. Utilities
[0618] G156 or its equivalogs can be used to manipulate the
anthocyanin biosynthetic pathway, such as for altering seed
coloration. In addition, the promoter of G156 may be used to confer
seed-specific expression to genes of interest.
G157 (SEQ ID NO: 69)
Published Information
[0619] G157 was first identified in the sequence of BAC F22K20
(GenBank accession number AC002291; gene F22K20.15). Experimental
Observations
[0620] G157 was recognized as a gene highly related to Arabidopsis
FLOWERING LOCUS C (FLC; Michaels et al. (1999) Plant Cell
11:949-956; Sheldon et al. (1999) Plant Cell 11:445-458). FLC acts
as a repressor of flowering. Late flowering vernalization
responsive ecotypes and mutants have high steady state levels of
FLC transcript, which decrease during the promotion of flowering by
vernalization. FLC therefore has a central role in regulating the
response to vernalization (Michaels (1999) supra; Sheldon et al.
(1999) supra; Sheldon et al. (2000) Proc. Natl. Acad. Sci.
97:3753-3758).
[0621] The function of G157 was studied using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Over-expression of G157 modifies flowering time, and it
appears to do so in a quantitative manner: a modest level of
over-expression triggers early flowering, whereas a larger increase
delays flowering. G157 over-expression promoted flowering in the
Arabidopsis late-flowering vernalization-dependent ecotypes
Stockholm and Pitztal.
[0622] In contrast to FLC, G157 transcript levels showed no
correlation with the vernalization response, and over-expression of
G157 did not influence FLC transcript levels. Thus, G157 likely
acts downstream or independently of FLC transcription. In addition,
a cluster of four additional FLC-like and G157-like genes were
identified, raising the possibility that a whole sub-group of
proteins within the MADS family regulates flowering time.
[0623] G157 overexpressing plants did not show any other
morphological, physiological, or biochemical alteration in the
assays that were performed. Overexpression of G157 was not observed
to have deleterious effects: 35S::G157 plants were healthy and
attained a wild-type stature when mature.
[0624] For many crops, high yielding winter strains can only be
grown in regions where the growing season is sufficiently cold and
prolonged to elicit vernalization. A system that could trigger
flowering at higher temperatures would greatly expand the acreage
over which winter varieties can be cultivated. The finding that
G157 overexpression caused early flowering in Arabidopsis Stockholm
and Pitztal plants, indicated that the gene can overcome the high
level of FRIGIDA and FLC activity present in those late-ecotypes.
That the effects were similar to those caused by vernalization
implied that G157 might be applicable to winter strains of crop
species. To date, a substantial number of genes have been found to
promote flowering. Many, however, including those encoding the
transcription factors, APETALA1, LEAFY, and CONSTANS, produce
extreme dwarfing and/or shoot termination when over-expressed.
Overexpression of G157 was not observed to have deleterious
effects. 35S::G157 Arabidopsis plants were healthy and attained a
wild-type stature when mature. Irrespective of the mode of G157
action, and whether its true biological role is as an activator or
a repressor of flowering, the results suggested that G157 may
produce either early or late flowering, according to the level of
over-expression.
G162 (SEQ ID NO: 71)
Published Information
[0625] G162 corresponds to gene At2g34440 (AAC26702), and it has
also been referred to as AGL29.
Experimental Observations
[0626] The function of G162 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
35S::G162 plants were wild-type in morphology and development.
Overexpression of G162 resulted in a significant increase in oil
content in seeds, as measured by NIR. Utilities
[0627] G162 or its equivalogs may be used to increase seed oil
content and manipulate seed protein content in crop plants.
G180 (SEQ ID NO: 87)
Published Information
[0628] G180 was identified in the sequence of BAC F16B22 (GenBank
accession number AC003672). Experimental Observations
[0629] The complete sequence of G180 was determined G180 was not
annotated in the sequence of Arabidopsis thaliana chromosome II
section 239 of 255 of the complete sequence (AC003672.2), where it
resides between At2g44740 and At2g44750.
[0630] The function of G180 was analyzed using transgenic plants in
which this gene was expressed under the control of the 35S
promoter.
[0631] G180 overexpressing plants were early flowering, but did not
exhibit other major developmental alterations. A number of
Arabidopsis genes have already been shown to accelerate flowering
when constitutively expressed. These include LEAFY, APETALA1 and
CONSTANS. In these cases, however, the early flowering plants
showed undesirable side effects such as extreme dwarfing,
infertility, or premature termination of shoot meristem growth
(Mandel et al. (1995) Nature 377:522-524; Weigel et al. (1995) 377:
495-500; Simon et al. (1996) Nature 384:59-62). It appeared that
G180 induced flowering without these toxic pleiotropic effects.
G180 overexpressing lines also showed a decrease in seed oil
content. That decrease was accompanied increased seed protein
content in one of the three lines analyzed. Utilities
[0632] G180 overexpression appeared to alter flowering time by
accelerating the transition from vegetative to reproductive state.
Therefore, G180 or its equivalogs may be used to manipulate
flowering time in plants. In addition, G180 or its equivalogs can
also have utility in modifying seed traits, particularly in
modifying seed oil and protein levels in crop plants.
G188 (SEQ ID NO: 97)
[0633] Published Information.
[0634] G188 corresponds to gene MXC20.3, first identified in the
sequence of clone MXC20 (released by the Arabidopsis Genome
Initiative; GenBank accession number AB009055). No published
information is available about the function(s) of G188.
Experimental Observations
[0635] The annotation of G188 in BAC AB009055 was experimentally
confirmed. G188 appeared to be expressed in all tissues and under
all conditions examined
A line homozygous for a T-DNA insertion in G188 was initially used
to characterize the function of this gene. The T-DNA insertion in
G188 was localized in the second intron of the gene, which is
located in the middle of the conserved WRKY box. This insertion
resulted in a null mutation. G188 mutant plants displayed several
phenotypic alterations in physiological assays. G188 knockout
mutant seed germinated slightly better than wild-type controls
under several kinds of osmotic stress. G188 knockout plants also
showed higher susceptibility to the necrotroph fungal pathogen
Fusarium oxysporum compared to control plants; more disease spread
after infection. No significant morphological changes were observed
in G188 knockout plants. Utilities
[0636] G188 or its equivalogs can be used to enhance seed
germination under adverse osmotic conditions. G188 or equivalogs
may also be used to manipulate a plant's response to Fusarium
oxysporum, and perhaps other pathogens.
G192 (SEQ ID NO: 101)
[0637] Published Information.
[0638] G192 corresponds to gene A_IGOO2N01.6, first identified in
the sequence of BAC clone A_IGOO2N01 (released by the Arabidopsis
Genome Initiative; GenBank accession number AF007269). Experimental
Observations
[0639] The annotation of G192 in BAC AF007269 was experimentally
confirmed. G192 was expressed in all plant tissues and under all
conditions examined. Its expression was induced upon infection by
Fusarium.
[0640] The function of G192 was analyzed using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. G192 overexpressors were late flowering under 12 hour
light and had more leaves than control plants. This phenotype was
manifested in the three T2 lines analyzed. In addition, one line
showed a decrease in seed oil content. No other differences between
G192 overexpressing lines and control plants were noted in the
assays performed.
A decrease in seed oil observed previously in one transgenic line
was replicated in an independent experiment. Utilities
[0641] G192 overexpression delayed flowering. A wide variety of
applications exist for genes or their equivalogs that either
lengthen or shorten the time to flowering, or for systems of
inducible flowering time control. In particular, in species where
the vegetative parts of the plants constitute the crop and the
reproductive tissues were discarded, it would be advantageous to
delay or prevent flowering. Extending vegetative development may
bring about large increases in yields.
G192 or its equivalogs can be used to manipulate seed oil content,
which might be of nutritional value.
G196 (SEQ ID NO: 105)
[0642] Published Information.
[0643] G196 corresponds to gene At2g34830 (AAC12823). Experimental
Observations
[0644] The function of G196 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
35S::G196 plants show more tolerance to salt stress in a
germination assay. Overexpression of G196 also produced a range of
effects on plant morphology including a reduction in overall size,
lowered fertility and changes in leaf shape. T1 seedlings were
typically small, often had abnormal shaped cotyledons, and the
rosette leaves produced by these plants were often undersized,
contorted and darker green compared with wild type. Later in
development, during the reproductive stage, the plants formed thin
inflorescences bearing poorly fertile flowers with underdeveloped
organs. 35S::G196 primary transformants were obtained at a
relatively low frequency, suggesting that the gene might have
lethal effects if overexpressed at very high levels.
[0645] 35S::G196 plants were wild-type in the biochemical analyses
that were performed. G196 was ubiquitously expressed (and different
levels among the various tissues). Utilities
[0646] G196 or its equivalogs may be used to improve plant
performance under conditions of salt stress. Evaporation from the
soil surface causes upward water movement and salt accumulation in
the upper soil layer where the seeds were placed. Thus, germination
normally takes place at a salt concentration that is higher than
the mean salt concentration in the whole soil profile. Increased
salt tolerance during the germination stage of a crop plant may
impact survivability and yield.
G211 (SEQ ID NO: 121)
[0647] Published Information.
[0648] G211 corresponds to Atmyb5 (U26935; Li et al. (1996) FEBS
Lett 379:117-121). Arabidopsis plants transgenic for a chimeric
Atmyb5 promoter/GUS gene expressed the enzyme in developing leaf
trichomes, stipules, epidermal cells on the margins of young
rosette and cauline leaves, and in immature seeds. In immature
seeds, Atmyb5 expression occurs between fertilization and the 16
cell stage of embryo development and persists beyond the heart
stage.
Experimental Observations
[0649] The function of G211 was investigated using a homozygous
mutant line in which a T-DNA was inserted into the coding region of
the gene as well as using transgenic lines in which G211 is
expressed under the control of the 35S promoter. The phenotype of
the G211 knockout mutant plants was wild-type in all respects.
Overexpression of G211, however, had marked effects on leaf and
inflorescence development. 35S::G211 plants were generally small,
slow developing, and produced rounded, slightly serrated leaves,
with very short petioles. Additionally these plants were dark green
in coloration, and in some cases, appeared to have reduced trichome
density. Following the switch to reproductive growth, 35S::G211
inflorescences had short internodes and showed a general reduction
in apical dominance, leading to a bushy appearance. In many cases,
due to the small size, seed yield was reduced compared with
wild-type controls. These effects were highly penetrant and were
apparent in the majority of T1 lines and, to some extent, in each
of the three T2 populations. An increase in leaf xylose in two
lines was also observed in the T2 35S::G211 transgenics.
As determined by RT-PCR, expression of G211 was found primarily in
embryos and siliques. G211 expression in leaf tissue was unaffected
by any environmental stress-related condition tested. Utilities
[0650] G211 overexpression resulted in plants with altered leaf
insoluble sugar content. Transcription factors such as G211 or
their equivalogs that alter plant cell wall composition have
several potential applications including altering food
digestibility, plant tensile strength, wood quality, pathogen
resistance and in pulp production.
[0651] In particular, hemicellulose is not desirable in paper pulps
because of its lack of strength compared with cellulose. Thus,
modulating the amounts of cellulose vs. hemicellulose in the plant
cell wall is desirable for the paper/lumber industry. Increasing
the insoluble carbohydrate content in various fruits, vegetables,
and other edible consumer products will result in enhanced fiber
content. Increased fiber content would not only provide health
benefits in food products, but might also increase digestibility of
forage crops. In addition, the hemicellulose and pectin content of
fruits and berries affects the quality of jam and catsup made from
them. Changes in hemicellulose and pectin content could result in a
superior consumer product.
G214 (SEQ ID NO: 127)
[0652] Published Information.
[0653] G214 (CCA1) was published by Wang et al. (1997) Plant Cell
9: 491-507. CCA1 is involved in phytochrome induction of CAB genes.
The transcript is transiently induced by phytochrome and oscillates
with a circadian rhythm. It feedback-regulates its own expression
at the transcriptional level. Overexpressing CCA1 abolished
circadian rhythm of several genes and results in plants that were
late flowering, and have elongated hypocotyls. Experimental
Observations
G214 overexpressing lines were late bolting, show larger biomass
(increased leaf number and size), and were darker green in
vegetative and reproductive tissues due to a higher chlorophyll
content in the later stages of development. In these later stages,
the overexpressors also have higher insoluble sugar, leaf fatty
acid, and carotenoid content per unit area. One line also showed a
significant, repeatable increase in lutein levels in seeds.
Microarray data was consistent with the morphological and
biochemical data in that the genes that were highly induced
included chloroplast localized enzymes, and light regulated genes
such as Rubisco, carbonic anhydrase, and the photosystem 1 reaction
center subunit precursor. A chlorophyll biosynthetic enzyme was
also highly induced, consistent with the dark green color of the
adult leaves and perhaps a higher photosynthetic rate. A
measurement of leaf fatty acid in the older overexpressors
suggested that the overall levels were higher than wild-type levels
(except for the percent composition of 16:3 in one line). Percent
composition of 16:1 and 16:3 fatty acids (found primarily in
plastids) is similar to wild type arguing against an increase in
chloroplast number as an explanation for increase chlorophyll
content in the leaves. Three G214-overexpressing lines were
sensitive to germination on high glucose showing less cotyledon
expansion and hypocotyl elongation suggesting the late bolting and
dark green phenotype could be tied into carbon sensing which has
been shown to regulate phytochrome A signaling (Dijkwel et al.
(1997) Plant Cell 9:583-595; Van Oosten et al. (1997) Plant J.
12:1011-1020). Sugars are key regulatory molecules that affect
diverse processes in higher plants including germination, growth,
flowering, senescence, sugar metabolism and photosynthesis.
Glucose-specific hexose-sensing has also been described in plants
and implicated in cell division and the repression of famine genes
(photosynthetic or glyoxylate cycles). Utilities
[0654] Potential utilities of this gene or its equivalogs include
increasing chlorophyll content allowing more growth and
productivity in conditions of low light. With a potentially higher
photosynthetic rate, fruits can have higher sugar content.
Increased carotenoid content may be used as a nutraceutical to
produce foods with greater antioxidant capability. G214 or its
equivalogs can also be used to manipulate seed composition, which
is very important for the nutritional value and production of
various food products.
[0655] G214 overexpression delayed flowering time in transgenic
plants, and thus this gene or its equivalogs would be useful in
modifying flowering time. In a sizeable number of species, for
example, root crops, where the vegetative parts of the plants
constitute the crop and the reproductive tissues were discarded, it
is advantageous to identify and incorporate transcription factor
genes that delay or prevent flowering in order to prevent resources
being diverted into reproductive development. Extending vegetative
development can thus bring about large increases in yields.
G225 (SEQ ID NO: 139)
[0656] Published Information.
[0657] G225 is equivalent to the Arabidopsis gene CPC, or CAPRICE
(Wada et al. (1997) Science 277:1113-1116; U.S. Pat. No.
5,831,060). G225 or CAPRICE is involved in epidermal cell
differentiation. Mutations in the gene result in plants with very
few root hairs and the overexpression of the gene causes an
increase in the number of root hairs and a near trichome-less leaf
phenotype (Wada, (1997) supra). Experimental Observations
[0658] The function of G225 was analyzed through its ectopic
overexpression in plants. G225 overexpressors showed more root
growth and were larger than wild-type controls on nitrogen-limiting
media. In addition, the seedlings lacked anthocyanin production in
response to several stress treatments. G225 overexpressors were
glabrous and produced ectopic root hairs. The overexpressors also
had more root hairs than wild-type controls on MS media (without
treatment), but under conditions of low nitrogen these
overexpressors produced even more root hairs. In addition, G225
overexpressors germinated better at 32.degree. C. under heat
stress. It is possible that better germination in the heat could be
related to tolerance to water deficiency or drought tolerance. The
nitrogen and heat tolerant phenotypes have not been reported for
this gene.
Consistent with the tolerance to low nitrogen, this line showed an
ammonium transporter induced 3.3-fold as well as a nitrate
transporter (CHL1) 2.2-fold over wild-type. It is possible that the
greater number of root hairs could account for the increase in
transcript levels of these two genes and could also account for the
phenotype we observe. The nitrate transporter is localized to root
hairs (Huang et al. (1999) Plant Cell 11:1381-1392. Utilities
[0659] G225 may be used to produce plants that are more tolerant to
conditions of low nitrogen and heat.
G226 (SEQ ID NO: 141)
[0660] Published Information.
[0661] G226 was identified from the Arabidopsis BAC sequence,
AC002338, based on its sequence similarity within the conserved
domain to other Myb family members in Arabidopsis. To date, there
is no published information regarding the function of this
gene.
[0662] Experimental Observations.
[0663] The function of G226 was analyzed through its ectopic
overexpression in plants. G226 overexpressors were more tolerant to
low nitrogen and high salt stress. They showed more root growth and
possibly more root hairs under conditions of nitrogen limitation
compared with wild-type controls. Many plants were glabrous and
lacked anthocyanin production when under stress such as growth
conditions of low nitrogen and high salt. Several G226
overexpressors were glabrous and produce less anthocyanin under
stress; these effects might be due to binding site competition with
other Myb family transcription factors involved in these functions
and not directly related to the primary function of this gene.
[0664] Results from the biochemical analysis of G226 overexpressors
suggested that one line had higher amounts of seed protein, which
could have been a result of increased nitrogen uptake by these
plants.
[0665] A microarray experiment was done on a separate G226
overexpressing line. The G226 sequence itself was overexpressed
16-fold above wild type, however, very few changes in other gene
expression were observed in this line. On the array, a
chlorate/nitrate transporter DNA sequence was induced 2.7-fold over
wild type, which could explain the low nitrogen tolerant phenotype
of the plants and the increased amounts of seed protein in one of
the lines. The same DNA sequence was present several times on the
array and in all cases the DNA sequence showed induction, adding
more validity to the data. Five other genes/DNA sequences induced
but had unknown function. A methyltransferase, a pollen-specific
protein, and a zinc binding peroxisomal membrane protein encoding
sequences were also induced, however their role in regard to the
phenotype of the plants is not known.
[0666] Utilities.
[0667] The utilities of a gene or its equivalogs conferring
tolerance to conditions of low nitrogen include: (1) Cost savings
to the farmer by reducing the amounts of fertilizer needed; (2)
Environmental benefits of reduced fertilizer runoff; (3) Improved
yield and stress tolerance. In addition, G226 can be used to
increase seed protein amounts and/or composition, which may impact
yield as well as the nutritional value and production of various
food products.
[0668] G226 or its equivalogs can be used to alter trichome number
and distribution in plants. Trichome glands on the surface of many
higher plants produce and secrete exudates, which give protection
from the elements and pests such as insects, microbes and
herbivores. These exudates may physically immobilize insects and
spores, may be insecticidal or antimicrobial or they may allergens
or irritants to protect against herbivores. It has also been
suggested that trichomes may decrease transpiration by decreasing
leaf surface airflow, and by exuding chemicals that protect the
leaf from the sun.
G241 (SEQ ID NO: 163)
[0669] Published Information.
[0670] G241 is equivalent to Y19 (X90384), a putative light
regulated Myb that was identified by Quaedvlieg et al. (1996) Plant
Mol. Biol. 32:987-993. The Myb Consortium renamed this gene MYB 15
and found that it was constitutively expressed at a low level with
expression higher in etiolated seedlings (Kranz et al. (1998) Plant
J. 16:263-276).
[0671] Experimental Observations.
[0672] The function of G241 was analyzed through its ectopic
overexpression in plants as well as through the analysis of a line
homozygous for a knockout mutation in G241. The knockout mutant
plants were wild-type in all assays performed. G241 overexpressors
had a glucose germination phenotype suggesting these plants could
be involved in glucose-specific sugar sensing.
[0673] Results from the biochemical analysis of G241 knockouts
showed that a lower amount of seed oil and an increase in seed
protein.
[0674] RT-PCR analysis of the endogenous levels of G241 showed the
gene is expressed in all tissue types tested.
[0675] Results from an array experiment using a G241 overexpressor
line were consistent with expression in seeds. Several gene
sequences were induced that could be involved in osmotic stress
tolerance or desiccation tolerance, which are important for
germinating seeds. In this experiment, the G241 DNA sequence itself
was induced 38-fold. Many of the induced genes were transcription
factors with unknown function. Both CBF1 and CBF2 (involved in
freezing tolerance) were up-regulated. As mentioned above, several
genes indicative of osmotic stress tolerance were also
up-regulated. These same gene sequences were up-regulated on arrays
of plants treated with mannitol as an osmotic stress, in a CBF2
overexpressor, and in cold-acclimated plants. A glucose transporter
sequence was also up-regulated, however, this gene sequence is not
up-regulated in any of the other arrays mentioned above. The
phenotype of the overexpressor was reduced seedling growth on high
glucose. It is possible that the plants were taking up more
glucose. In such a scenario, the gene is not likely to be involved
in sugar sensing but rather the high glucose condition is
inhibiting their growth. The G241 overexpressors were tested for
osmotic stress tolerance using mannitol. It is possible the glucose
transporter is increasing mannitol uptake and increasing its
toxicity to the plant as well. Polyethylene glycol (PEG) is an
alternative osmoticum that can be tested at various
concentrations.
[0676] Utilities.
[0677] One potential utility of this gene or its equivalogs can be
to engineer plants that are tolerant to stress. This can greatly
impact yield. Alternatively, if this gene is involved in sugar
sensing, the potential utility of a gene involved in
glucose-specific sugar sensing is to alter energy balance,
photosynthetic rate, biomass production, and senescence. Sugars are
key regulatory molecules that affect diverse processes in higher
plants including germination, growth, stress responses, flowering,
senescence, sugar metabolism and photosynthesis. Glucose-specific
hexose-sensing has been described in plants and implicated in cell
division, and repression of famine genes (photosynthetic or
glyoxylate cycles). This gene may also be used to alter oil and
protein production in seeds, which may be very important for the
nutritional quality and caloric content of foods.
G248 (SEQ ID NO: 171)
[0678] Published Information.
[0679] G248 was identified at Mendel Biotechnology. Kranz et al.
((1998) Plant J. 16:263-276) published a cDNA sequence
corresponding to G248, naming it MYB22.
[0680] Experimental Observations.
[0681] The function of G248 was analyzed using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
The phenotype of these transgenic plants was wild-type with respect
to their morphology. However, overexpression of G248 in Arabidopsis
was found to confer greater sensitivity to disease, particularly
following infection by Botrytis cinerea. All three lines show the
susceptible phenotype.
[0682] As determined by RT-PCR, G248 appears to be expressed at low
levels in embryo and silique tissue. No expression was detected in
other tissues. G248 appears to be induced in response to salicylic
acid (SA) treatment. It is well know that both synergistic and
antagonistic crosstalk between growth regulator controlled defense
pathways occurs in response to disease.
[0683] Utilities.
[0684] Since G248 transgenic plants had an altered response to the
fungal pathogen Botrytis cinerea, G248 or its equivalogs can be
used to manipulate the defense response in order to generate
pathogen-resistant plants.
G254 (SEQ ID NO: 179)
[0685] Published Information.
[0686] G254 was identified from the Arabidopsis BAC sequence,
AF007269, based on its sequence similarity within the conserved Myb
domain to other Myb family members in Arabidopsis.
[0687] Experimental Observations.
[0688] The function of G254 was analyzed through the ectopic
overexpression of the gene in plants. Overexpression of G254
resulted in a reduction of germination and reduced seedling growth
on glucose containing media. G254 may be involved in sugar
sensing.
[0689] RT-PCR analysis of the endogenous levels of G254 indicated
that this gene was expressed in all tissues tested. A cDNA
microarray experiment supported the tissue distribution data by
RT-PCR. There was no induction of G254 above its basal level in
response to environmental stress treatments. G254 was
constitutively expressed.
[0690] Utilities.
[0691] The potential utility of G254 or its equivalogs is to alter
source-sink relationships in the plant. Sugars are key regulatory
molecules that affect diverse processes in higher plants including
germination, growth, flowering, senescence, sugar metabolism, and
photosynthesis. Sucrose is the major transport form of
photosynthate and its flux through cells has been shown to affect
gene expression and alter storage compound accumulation in seeds
(source-sink relationships). The potential utilities of a gene
involved in glucose-specific sugar sensing are to alter energy
balance, photosynthetic rate, carbohydrate accumulation, biomass
production, source-sink relationships, and senescence.
Glucose-specific hexose-sensing has been described in plants and
implicated in cell division and the repression of `famine` genes
(photosynthetic or glyoxylate cycles).
G256 (SEQ ID NO: 183)
[0692] Published Information.
[0693] G256 is equivalent to Y13, a gene that was identified by
Quaedvlieg et al. ((1996) Plant Mol. Biol. 32:987-093) as being
induced in etiolated seedlings one hour after being exposed to
light. The Myb consortium has renamed this gene MYB31. Quaedvlieg
et al. (1996, supra) found a low level of expression in stem and
silique tissue with no induction in etiolated seedlings after being
exposed to light. However, there was also a slight induction of
G256 following cold treatment.
[0694] Experimental Observations.
[0695] The function of G256 was analyzed through its ectopic
overexpression in plants. G256 overexpressors had enhanced seedling
vigor during cold germination. These overexpressing lines were more
tolerant to chilling conditions compared to wild-type controls, as
seen in 12-day-old seedlings that were transferred to cold
temperatures (8.degree. C.).
[0696] There was no difference in germination rate under normal
growth conditions. The chilling tolerant phenotype is most
noticeable with respect to enhanced root growth although the
cotyledons show less anthocyanin production than wild-type
controls.
[0697] Plants overexpressing G256 were also small and early
bolting. In the T2, one line lacked the waxy surface on the bolts.
Three lines were tolerant to cold germination and therefore
co-suppression was not a likely cause of the morphological change
observed in one line. An array experiment was performed on this
G256 overexpressing line. The gene itself was induced 3.5-fold over
wild-type levels. Very few additional gene sequences were
significantly induced in response to G256 overexpression. Induced
genes included four gene sequences of unknown function, a sugar
carrier sequence, a cell wall degrading enzyme (BGL2) sequence,
pectinesterase sequence, and a proteasome subunit protein sequence.
Expression of gene sequences such as allene oxidase sequence (which
could mean down-regulation of the associated jasmonate synthesis
pathway), and endochitinase were repressed.
[0698] RT-PCR analysis of the endogenous levels of G256 indicated
that this gene sequence was expressed primarily in shoots, flowers,
and siliques. A cDNA microarray experiment confirmed this tissue
distribution data by RT-PCR. There was no induction of G256 in
leaves or in seedlings in response to environmental stress
treatments.
[0699] Utilities.
[0700] The potential utility of this gene or its equivalogs is to
confer better germination and growth in the cold. The germination
of many crops is very sensitive to cold temperatures. A gene that
would allow germination and seedling vigor in the cold would have
tremendous utility in allowing seeds to be planted earlier in the
season with a high rate of survivability.
G291 (SEQ ID NO: 209)
[0701] Published Information.
[0702] G291 is referred to in the public literature as the
Arabidopsis AJH1, a plant homolog of the c-Jun coactivator. AJH1
was isolated by peptide sequencing of a subunit of the COP9
complex, an important component in light-mediated signal
transduction in Arabidopsis. It is postulated that the COP9 complex
may modulate the activities of transcription factors in response to
environmental stimuli. Localization experiment reveals that AJH1
was present in monomeric form, which suggested a possible
involvement in other developmentally regulated processes (Kwok et
al. (1998) Plant Cell 10:1779-1790). G291 is found in the sequence
of the chromosome 1 BAC F19G10 (GenBank accession AF000657.1
GI:2098816), released by the Arabidopsis Genome Initiative. The
start and stop codons were correctly predicted.
[0703] Experimental Observations.
[0704] The expression profile of G291 revealed a low, but
constitutive, expression of G291 transcripts in all tissues
examined. G291 transcript levels were similar to the wild-type
controls in all the physiological treatments examined as determined
by RT-PCR analysis.
[0705] G291 overexpressors produced significantly more seed oil
than wild-type plants.
Utilities.
[0706] G291 or its equivalogs can be used to increase seed oil
content, which may be of nutritional value for food for human
consumption as well as animal feeds.
G325 (SEQ ID NO: 223)
[0707] Published Information.
[0708] G325 was identified as a gene in the sequence of chromosome
4, ESSA I FCA contig fragment No. 3 (GenBank Accession number
Z97338), released by the European Union Arabidopsis Sequencing
Project.
[0709] Experimental Observations.
[0710] The function of G325 was analyzed using transgenic plants in
which G325 was expressed under the control of the 35S promoter.
G325 overexpressing plants had more tolerance to osmotic stress in
a germination assay in three separate experiments. They had more
seedling vigor than wild-type control when germinated on plates
containing high salt and high sucrose. No altered morphological
phenotypes or altered phenotypes in the biochemical assays were
observed.
[0711] G325 was expressed at high levels in flowers and cauline
leaves, and at lower levels in shoots, rosette leaves, and
seedlings. G325 was induced by auxin, cold- and heat-stress. The
expression of G325 also was reduced in response to Fusarium
infection or salicylic acid treatment.
[0712] Utilities.
[0713] G325 or its equivalogs may be useful for enhancing seed
germination under high salt conditions or other conditions of
osmotic stress. Evaporation from the soil surface causes upward
water movement and salt accumulation in the upper soil layer where
the seeds are placed. Thus, germination normally takes place at a
salt concentration much higher than the mean salt concentration in
the whole soil profile. Increased salt tolerance during the
germination stage of a crop plant would impact survivability and
yield.
[0714] G325 or its equivalogs can also be used to engineer plants
with enhanced tolerance to drought, salt stress, and freezing, at
later stages.
G361 (SEQ ID NO: 237)
[0715] Published Information.
[0716] G361 was first isolated by Tague et al. ((1995) Plant Mol.
Biol. 28:267-279) in an effort to study the sequence and the
expression pattern of C2H2 zinc finger protein encoding genes in
Arabidopsis (Takatsuji (1998) Cell. Mol. Life. Sci. 54:582-596).
The latter study showed that G361 (ZFP6) was mostly expressed in
roots and shoots based on Northern analysis.
[0717] Experimental Observations.
[0718] A full-length cDNA was isolated and used to transform
plants. G361 overexpressors were small and very late bolting. The
plants did not show any physiological phenotype. G361
overexpressing plants had increased levels of polyunsaturated fatty
acids. The phenotype could be related to the darker green color of
the plants and their possible higher chlorophyll content (repeat of
analysis also in progress). Higher 16:3 fatty acid content, in
particular, could be a reflection of a higher chloroplast number or
more chloroplast membranes. RT-PCR data showed that the gene was
expressed mostly in shoots and in roots at low levels.
[0719] Utilities.
[0720] The late-flowering phenotype of G361 or its equivalogs is
useful in that late flowering is desirable in crops where the
vegetative portion of the plant is harvested (often vegetative
growth stops when plants make the transition to flowering). In this
case, it can be advantageous to prevent or delay flowering in order
to increase yield. Also, prevention of flowering can be useful in
these same crops in order to prevent the spread of transgenic
pollen and/or to prevent seed set. In any case, the overexpressors
were clearly smaller, an undesirable phenotype which has to be
corrected before overexpression of the gene can lead to any useful
crop product.
G390 (SEQ ID NO: 249)
[0721] Published Information.
[0722] G390 was isolated by Ruzza et al. (GenBank Accession:
CAD29544, gi:20069421) using degenerate oligonucleotides
corresponding to a conserved 6 amino acid sequence from the helix-3
region of athb-1 and athb-2. It was named athb-9. The published
Northern blot showed slightly higher level of expression in stems,
and lower levels in leaves, flowers, roots, and siliques. The G390
protein shares very extensive amino acid identity with other HD-ZIP
class III proteins that exist in Arabidopsis (for example, G391 and
G438). HD-ZIP class III proteins are known to have complex roles in
determining meristem development, vascular tissue formation, and
stem lignification (Baima et al. (1995) Development 12:4171-4182;
Baima et al. (2001) Plant Physiol. 126:643-655; Talbert et al.
(1995) Development 121:2723-2735; Zhong et al. (1997) Plant Cell
9:2159-2170; Sessa et al. (1998) Plant Mol. Biol. 38:609-622; Zhong
et al. (1999) Plant Cell 11:2139-2152; Ratcliffe et al. (2000)
Plant Cell 12:315-317; and Otsuga et al. (2001) Plant J.
25:223-236).
[0723] Experimental Observations.
[0724] Fourteen 35S::G390 T1 lines were obtained which displayed a
consistent morphological phenotype; the majority of these plants
were slightly small, had abnormal phyllotaxy, and exhibited stem
bifurcations in which shoot meristems split to form two or three
separate shoots. Additionally, a significant number of these extra
T1 lines flowered earlier than controls. Comparable effects were
obtained by overexpression of G391.
[0725] Utilities.
[0726] The overexpression data suggest that G390 or its equivalogs
has utility in the manipulation of shoot architecture.
Additionally, since a number of the 35S::G390 lines flowered early,
this gene or its equivalogs can be used to manipulate flowering
time.
G409 (SEQ ID NO: 261)
[0727] Published Information.
[0728] G409, also named Athb-1, was one of the earliest plant
homeodomain leucine (HD-ZIP) zipper genes cloned. It was isolated
from a cDNA library by highly degenerate oligonucleotides
corresponding to a conserved eight amino acid sequence from the
helix-3 region of the homeodomain. The protein was found to
transactivate a promoter linked to a specific DNA binding site
(CAATTATTG) by transient expression assays. Overexpression of
Athb-1 affected the development of palisade parenchyma under normal
growth conditions, resulting in light green sectors in leaves and
cotyledons, whereas other organs in the transgenic plants remained
normal.
[0729] Experimental Observations.
[0730] G409 was induced by drought and repressed by NaCl. Plants
overexpressing G409 were more tolerant to infection by the fungal
pathogen Erysiphe orontii. In addition to the Erysiphe tolerant
phenotype, the overexpressors were slightly early flowering.
Utilities.
[0731] The expression of transcription factors such as G409 or its
equivalogs involved in plant/pathogen interaction can be modulated
to manipulate the plant defense- wound- or insect-response in order
to generate pathogen resistant plants.
G438 (SEQ ID NO: 283)
[0732] Published Information.
[0733] G438 was identified as a homeobox gene (MUP 24.4) within P1
clone MUP 24 (GenBank accession number AB005246). G438 was
identified as the Arabidopsis REVOLUTA (REV) gene (Ratcliffe et al.
(2000) Plant Cell 12:315-317). Based on its mutant phenotype, REV
had previously been identified as having a key role in regulating
the relative growth of apical versus non-apical (cambial) meristems
(Alvarez (1994) in Arabidopsis: An Atlas of Morphology and
Development (ed. J. Bowman), pp. 188-189, New York, N.Y.:
Springer-Verlag; Talbert et al. (1995) Development 121:2723-2735).
The revoluta phenotype was highly pleiotropic but was characterized
by a failure in development of all types of apical meristem:
lateral shoot meristems in the axils of cauline and rosette leaves
were often completely absent, or replaced by a solitary leaf. These
effects were most evident in higher order shoots, but in some
cases, the primary shoot meristem also failed and terminated growth
in a cluster of filamentous structures. Rev floral meristems often
failed to complete normal development and form incomplete or
abortive filamentous structures. In contrast to apical meristems,
structures formed by non-apical meristems, such as leaves, stems,
and floral organs often became abnormally large and contorted in
the rev mutant.
[0734] The features of rev mutants were similar to those of the
interfascicular fiberless1 (ifl1) mutant. Ifl1 was isolated during
screens for mutants lacking normal stem fiber differentiation
(Zhong et al. (1997) Plant Cell 9:2159-2170). Wild-type Arabidopsis
plants form interfascicular fibers which became lignified and added
support to the inflorescence stem (Aloni (1987) Annu. Rev. Plant
Physiol. 38:179-204); Zhong et al. (1997) supra; Zhong et al.
(1999) Plant Cell 11:2139-2152). In the ifl1 mutant, normal
interfascicular fibers were absent and the differentiation of both
xylary fibers and vessel elements was disrupted. In addition to
these internal features, ifl1 mutants had secondary morphological
features very similar to those of rev. Recently the IFL1 gene was
cloned by Zhong et al. (1999 supra). It was found that the IFL1
sequence and map position were identical to those of the REV gene
cloned, demonstrating that REV and IFL1 are the same gene.
(Ratcliffe et al. (2000) supra).
[0735] It had been suggested that REV promotes the growth of apical
meristems (including floral meristems) at the expense of non-apical
meristems (Talbert et al. (1995) supra). It is not yet clear,
however, whether expression data support such a role: strong
expression of REV has been detected in interfascicular regions and
developing vascular tissue, but in-situ expression analysis of
apical meristems has not yet been reported. (Zhong et al. (1999)
supra). REV is a group III HD-ZIP protein and shares high sequence
similarity (and organization) with the proteins encoded by three
other Arabidopsis genes: Athb8, Athb9, and Athb14 (Sessa et al.
(1998) Plant Mol. Biol. 38:609-622). It is possible, therefore,
that these genes act together in the same developmental process.
Supporting this suggestion, Athb8 had a similar expression pattern
to REV and was transcribed in the procambial regions of vascular
bundles (Baima et al. (1995) Development 12:4171-4182).
Experimental Observations (Knockout)
[0736] G438 was initially identified as MUP24.4, a novel putative
homeobox gene within P1 clone MUP24 (GenBank Accession AB005246).
Annotation was confirmed by isolation of the G438 cDNA: the cDNA
had an in-frame stop codon immediately 5' to the predicted start
codon and comprised 18 exons that had been predicted within the
genomic sequence.
[0737] Plants homozygous for a T-DNA insertion in the G438 sequence
were obtained by PCR based screening of DNA pools from the Jack
Collection of insertional mutants (Campisi et al. (1999) Plant
Journal 17:699-707). The T-DNA insertion was located 466 bp
downstream of the putative start codon, and was predicted to create
a null mutation. The mutation was recessive and produced a revoluta
phenotype. Complementation crosses and sequencing of a known
revoluta allele demonstrated that G438 was REVOLUTA.
[0738] RT-PCR analyses detected G438 expression at medium to high
levels in all tissues and conditions tested. Further expression
analysis was possible since the T-DNA insertion contained an
enhancer trap construct (Campisi et al. (1999) supra). GUS staining
could therefore be used to reveal the expression pattern of genes
within which insertions occurred. GUS staining of seedlings
homozygous and heterozygous for the G438 T-DNA insertion revealed
very strong expression within axillary shoots. This expression data
correlates with the marked effects of the rev mutation on outgrowth
of higher order shoots.
Experimental Observations (Overexpressor)
[0739] A full-length clone was amplified from cDNA derived from
mixed tissue samples, and 35S::G438 transformants were generated.
These lines appeared wild-type in the physiological assays, but
showed differences in morphology compared with control plants. At
early stages, a small number of T1 plants displayed aberrant
phyllotaxy and were rather dwarfed, but these effects were
inconsistent, and the majority of lines appeared wild-type. At
later stages, however, around half of the primary transformants,
from two of the three T1 sowings, developed slightly larger flatter
leaves than wild type at late stages. The progeny of four lines
that had shown these phenotypes were examined in the T2 generation.
At late stages, plants from two of these T2 populations again
displayed slightly broad flat leaves, but plants from the other two
T2 populations appeared wild-type at all stages.
[0740] A single T1 plant line out of a total of 37 lines had highly
aberrant shoot meristem development. At the early seedling stage,
it appeared as though the primary shoot apex of this individual had
developed into a terminal leaf-like structure. Subsequent growth
then continued from an axillary shoot meristem that initiated from
the base of a cotyledon petiole. However, this effect became
silenced between generations and was not observed in the T2 progeny
from one line. Given that this effect was observed in only a single
line, it could have been the result of an activation tagged locus
at the T-DNA insertion site, rather than due to G438 expression.
However, the phenotype would fit with a role for REV in regulating
apical meristem development.
[0741] Utilities.
[0742] The mutant phenotypes indicated that REV/IFL1 or its
equivalogs have an important role in determining overall plant
architecture and the distribution of lignified fiber cells within
the stem. A number of utilities can be envisaged based upon these
functions.
[0743] Modifying the activity of REVOLUTA orthologs from tree
species can offer the potential for modulating lignin content. This
can allow the quality of wood used for furniture or construction to
be improved. Lignin is energy rich; increasing lignin composition
could therefore be valuable in raising the energy content of wood
used for fuel. Conversely, the pulp and paper industries seek wood
with a reduced lignin content. Currently, lignin must be removed in
a costly process that involves the use of many polluting chemicals.
Consequently, lignin is a serious barrier to efficient pulp and
paper production (Tzira et al. (1998) TIBTECH 16:439-446; Robinson
(1999) Nature Biotechnology 17:27-30). In addition to forest
biotechnology applications, changing lignin content might increase
the palatability of various fruits and vegetables.
[0744] In Arabidopsis, reduced REV activity results in a reduction
of higher-order shoot development. Reducing activity of REV
orthologs may generate trees that lack side branches, and have
fewer knots in the wood. Altering branching patterns can also have
applications amongst ornamental and agricultural crops. For
example, applications might exist in any species where secondary
shoots currently have to be removed manually, or where changes in
branching pattern could increase yield or facilitate more efficient
harvesting.
G464 (SEQ ID NO: 291)
[0745] Published Information.
[0746] G464 is IAA12, a member of the Aux/IAA class of small,
short-lived nuclear proteins that contain four conserved domains.
IAA12 was found as one of a group of Arabidopsis IAA genes that was
isolated based on homology to early auxin-induced genes of pea.
IAA12 transcripts were modestly (2 to 4-fold) induced by auxin,
with optimal induction at 10 .mu.M auxin (Abel et al. (1995) J.
Mol. Biol. 251:533-549).
[0747] Experimental Observations.
[0748] G464 overexpressing Arabidopsis lines showed enhanced
germination in high heat conditions. In addition, one Arabidopsis
line overexpressing G464 showed an increase in total seed protein
and a decrease in total seed oil by NIR in one assay.
[0749] Utilities.
[0750] G464 or its equivalogs in native or altered form is useful
to produce plants that germinate better in hot conditions.
G470 (SEQ ID NO: 295)
[0751] Published Information.
[0752] A partial cDNA clone corresponding to G470 was isolated in a
two-hybrid screen for proteins that interact with ARF1, a
transcription factor that binds to auxin response elements, and
this clone was named ARF1 Binding Protein (Ulmasov et al. (1997)
Science 276:1865-1868). A full-length clone was later isolated, and
the gene was renamed ARF2 (Ulmasov et al. (1999a) Proc. Natl. Acad.
Sci. 96:5844-5849). ARF2 was shown to bind to an auxin response
element (Ulmasov et al. (1999b) Plant J. 19:309-319).
[0753] Co-transfection of ARF2 and a reporter construct with an
auxin response element into carrot protoplasts did not result in
either activation or repression of transcription of the reporter
gene (Ulmasov et al. (1999a) supra). ARF2 binding to palindromic
auxin response elements is thought to be facilitated by
dimerization mediated by the carboxy-terminal domain of ARF2
(Ulmasov et al. (1999b) supra). It is possible that ARF2 regulates
gene expression through heterodimerization with other ARF proteins
or with IAA proteins. ARF2 was found to be expressed uniformly in
roots, rosette leaves, cauline leaves, flowers, and siliques
(Ulmasov et al. (1999b) supra).
[0754] Experimental Observations.
[0755] Expression of a truncated G470 clone in the antisense
orientation under the 35S promoter caused infertility in
Arabidopsis. In primary transformants expressing the G470 clone,
the stamens failed to elongate properly. Pollen was produced, but
was not deposited on the stigma. The transformants appeared
otherwise morphologically normal. Because of the infertility of the
primary transformants, no material was available for biochemical
and physiological analyses. The truncated clone corresponds to the
carboxy-terminal portion of the ARF2 protein, and lacks the DNA
binding domain.
[0756] Utilities.
[0757] G470 or its equivalogs are useful in engineering infertility
in self-pollinating plants.
G475 (SEQ ID NO: 301)
[0758] Published Information.
[0759] G475 was identified from an Arabidopsis thaliana cDNA
library using two cDNAs from Antirrhinum majus, SPB1 and SPB2, as
probes (Cardon et al. (1997) Plant J. 12: 367-377). The Arabidopsis
cDNA, SPL3, which corresponds to G475, is the presumed ortholog of
SPB1. In Antirrhinum majus, SPB1 was identified as a transcription
factor that binds to the promoter of the floral meristem identity
gene, SQUAMOSA and is therefore implicated in a plant's transition
to flowering. The over-expression of SPL3 (G475) in Arabidopsis
resulted in plants that were early bolting, with fewer leaves, and
plants that often an extra bract subtending the first flower
(Cardon et al. (1997) supra). SPL3 antisense plants produced by
these authors had no phenotypic differences from wild type.
[0760] Closely Related Genes from Other Species.
[0761] The closest relative to G475 is its homolog in A. majus,
SPPB1.
[0762] Experimental Observations.
[0763] The function of G475 was analyzed through its ectopic
overexpression in plants. The morphological phenotype of the G475
overexpressors confirmed the published phenotype.
An array experiment was performed on a G475 overexpressing line.
The gene itself was overexpressed six-fold on this array. G475
overexpressors had a flowering phenotype: they were early bolting
and had an abnormal inflorescence structure. There were two genes
induced on the array that were consistent with this flowering
phenotype. One was AGL8, a gene expressed in the inflorescence
meristem, stem, cauline leaves and developing fruits (Mandel et al.
(1995) Plant Cell. 7:1763-1771), whose function appears to be in
fruit development (Gu et al. (1998) Development 125:1509-1517). The
other gene that was consistent with the abnormal inflorescence
structure phenotype was a gene MFP2 (fatty acid multi-functional
protein) that is involved in 0-oxidation of fatty acids.
Alterations in the MPF2 protein have been reported to cause
alterations in inflorescence development in plants.
[0764] Utilities.
[0765] The potential utility of plants with an early bolting
phenotype includes: (1) early flowering could accelerate many
conventional breeding programs, (2) early flowering without an
impact on yield could shorten generation time and allow for
multiple harvests per season, and (3) an inducible system that
would allow rapid triggering of flowering would allow
synchronization of flowering time, which is important in the
horticulture industry as well as for any crop that is mechanically
harvested.
G477 (SEQ ID NO: 303)
[0766] Published Information.
[0767] G477 corresponds to SPL6 (A1011643, Cardon et al. (1999)
Gene 237:91-104), a member of the SBP family of transcription
factors. G477 is expressed constitutively throughout the
development of Arabidopsis. Outside the SBP-domain, G477 has a
putative myc-like helix-loop-helix dimerization domain (Cardon et
al. (1999) supra).
[0768] Experimental Observations.
[0769] The complete sequence of G477 was determined The function of
this gene was analyzed using transgenic plants in which G477 was
expressed under the control of the 35S promoter. The phenotype of
these transgenic plants was wild-type in all morphological and
biochemical assays performed.
[0770] Plants overexpressing G477 were slightly more sensitive to
the herbicides glyphosate and acifluorfen and to oxidative stress
caused by rose bengal compared with wild-type controls. Plants
overexpressing G477 also develop more disease symptoms following
inoculation with a moderate dose of Sclerotinia sclerotiorum
compared with control plants. It is well known that oxidative
stress is a component of a plant defense response to pathogen and
therefore the disease susceptibility phenotype could be related to
a general sensitivity to oxidative stress.
[0771] G477 was expressed in all tissues and under all conditions
tested in RT-PCR and cDNA microarray experiments.
[0772] Utilities.
[0773] G477 activity was shown to affect the response of transgenic
plants to the fungal pathogen Sclerotinia sclerotiorum and
oxidative stress tolerance. Therefore, G477 or its equivalogs can
be used to manipulate the defense response in order to generate
pathogen-resistant plants.
G482 (SEQ ID NO: 305)
[0774] Published Information.
[0775] G482 is equivalent to AtHAP3b which was identified by
Edwards et al. ((1998) Plant Physiol. 117:1015-1022) as an EST with
homology to the yeast gene HAP3b. Edwards' northern blot data
suggests that AtHAP3b is expressed primarily in roots. No other
functional information regarding G482 is publicly available.
[0776] Experimental Observations.
[0777] G482 function was analyzed through its ectopic
overexpression in plants under the control of a 35S promoter. G482
overexpressors were more tolerant to high NaCl in a germination
assay.
[0778] RT-PCR analysis of endogenous levels of G482 transcripts
indicated that this gene was expressed constitutively in all
tissues tested. A cDNA array experiment supported the RT-PCR
derived tissue distribution data. G482 was not induced above basal
levels in response to any environmental stress treatments
tested.
[0779] Utilities.
[0780] The utilities of this gene or its equivalogs include the
ability to confer salt tolerance during the germination stage of a
crop plant. This would most likely impact survivability and yield.
Evaporation of water from the soil surface causes upward water
movement and salt accumulation in the upper soil layer, where the
seeds were placed. Thus, germination normally takes place at a salt
concentration much higher than the mean salt concentration in the
whole soil profile.
G489 (SEQ ID NO: 309)
[0781] Published Information.
[0782] G489 was identified from a BAC sequence that showed high
sequence homology to AtHAP5-like transcription factors in
Arabidopsis. No published information is available regarding the
function of this gene.
[0783] Experimental Observations.
[0784] The function of G489 was analyzed through its ectopic
overexpression in plants. G489 overexpressors were more tolerant to
high NaCl stress, showing more root growth and leaf expansion
compared with the controls in culture. Two well characterized ways
in which NaCl toxicity is manifested in the plant is through
general osmotic stress and potassium deficiency due to the
inhibition of its transport. These G489 overexpressor lines were
more tolerant to osmotic stress in general, showing more root
growth on mannitol containing media.
[0785] RT-PCR analysis of endogenous levels of G489 transcripts
indicated that this gene was expressed constitutively in all
tissues tested. A cDNA array experiment confirmed the RT-PCR
derived tissue distribution data. G489 was not induced above basal
levels in response to the stress treatments tested.
[0786] Utilities.
[0787] The utilities of this gene or its equivalogs include the
ability to confer salt tolerance during the growth and
developmental stages of a crop plant. This would impact yield and
or biomass.
G509 (SEQ ID NO: 317)
[0788] Published Information.
[0789] G509 was identified in the sequence of BAC F20O9, GenBank
accession number AL021749, released by the Arabidopsis Genome
Initiative.
[0790] Experimental Observations.
[0791] The function of G509 was analyzed using transgenic plants in
which G509 was expressed under the control of the 35S promoter, as
well as using a line homozygous for a T-DNA insertion in G509. The
T-DNA insertion of G509 at nucleotide position +1583 with respect
to the start ATG codon was approximately half way into the coding
sequence of the gene and therefore was likely to result in a null
mutation. G509 primary transformants showed no significant
morphological differences from control plants, though one T2 line
was noted to be small and sickly at the seedling and rosette
stages, and pale and late flowering at the flowering stage.
Knockout plants showed no consistent morphological differences from
controls. G509 knockout plants may be more susceptible to infection
with a moderate dose of the fungal pathogen Erysiphe orontii; 8 out
of 8 plants tested showed more fungal growth compared with the
wild-type controls. G509 lines had significantly higher levels of
chlorophyll a, and lower levels of chlorophyll b in seeds.
[0792] G509 knockout mutants produced more seed oil and more seed
protein than wild-type control plants.
[0793] Endogenous G509 was expressed constitutively in all tissues
tested, with the highest levels of expression in shoots, roots,
flowers and siliques.
[0794] Utilities.
[0795] G509 or its equivalogs can be used to produce plants with
altered seed oil and seed protein content.
[0796] G509 or its equivalogs can be used to manipulate the defense
response in order to generate pathogen-resistant plants.
[0797] In addition, G509 or its equivalogs can be used to regulate
the levels of chlorophyll in seeds.
G545 (SEQ ID NO: 345)
[0798] Published Information.
[0799] G545 was discovered independently by two groups. Lippuner et
al. (1996) J. Biol. Chem. 271:12859-12866) identified G545 as an
Arabidopsis cDNA (STZ), which increases the tolerance of yeast to
Li+ and Na+. They found that STZ expression is most abundant in
leaves and roots, and that its level of expression increases
slightly upon exposure of the plant to salt. The second group
(Meissner et al (1997) Plant Mol. Biol. 33:615-624), identified
G545 (ZAT10) in a group of Arabidopsis C2H2 zinc finger
protein-encoding cDNAs that they isolated by degenerate PCR.
According to their data, ZAT10 is expressed in roots, shoots and
stems. Closely Related Genes from Other Species
[0800] A closely related non-Arabidopsis sequence is a cDNA from
the nitrogen-fixing species Datisca glomerata (AF119050). The
similarity of this sequence with G545 extends beyond the conserved
domain.
[0801] Experimental Observations.
[0802] Plants overexpressing G545 flowered early, and in extreme
cases were infertile. G545 overexpression conferred tolerance of
transgenic plants to phosphate deficiency. This could be the result
of insensitivity to phosphate, higher rates of phosphate
assimilation or larger stores of phosphate. G545 overexpressors
also appeared to be more sensitive to NaCl than wild-type plants.
This result was unexpected, since yeast cells overexpressing G545
are more tolerant to salt stress than control cells. There may be a
dominant negative effect in plants, triggered by the
over-accumulation of the G545 protein, which does not exist in
yeast.
[0803] G545 overexpressing plants appeared to be significantly more
susceptible to pathogens than control plants. This implied a role
for the G545 in the control of defense mechanisms.
[0804] Utilities.
[0805] G545 or equivalog overexpression may result in tolerance to
phosphate deficiency. Young plants have a rapid intake of
phosphorous, so it is important that seed beds have high enough
content in phosphate to sustain their growth. Also, root crops such
as carrot, potato and parsnip will all decrease in yield if there
is insufficient phosphate available. Phosphate costs represent a
relatively small but significant portion of farmers' operating
costs (3-4% of total costs to a corn farmer in the US, higher to a
vegetable grower). Plants that are tolerant to phosphate deficiency
can represent a cost saving for farmers, especially in areas where
soils are very poor in phosphate.
[0806] Another desirable phenotype, salt tolerance, may arise from
G545 or equivalog silencing rather than overexpression.
Additionally, G545 appeared to be induced by cold, drought, salt
and osmotic stresses, which was in agreement with a potential role
of the genes in protecting the plant in such adverse environmental
conditions.
[0807] G545 also appears to be involved in the control of defense
processes. However, overexpression of G545 made Arabidopsis plants
more susceptible to disease. This negative effect will have to be
corrected before G545 can be used in a crop to induce tolerance to
low phosphate, such as by restricting overexpression of G545 or its
equivalogs to roots.
G561 (SEQ ID NO: 359)
[0808] Published Information.
[0809] G561 is the Arabidopsis gene GBF2 (Schindler et al (1992)
EMBO J. 11:1261-1273), which was cloned by hybridization to GBF1.
GBF2 is constitutive in both light and dark grown leaves, expressed
in roots, and the nuclear import of GBF1 may be light regulated
(Terzaghi et al (1997) Plant J. 11: 967-982).
[0810] Closely Related Genes from Other Species.
[0811] Close relatives of G561 include a G-box binding protein from
Sinapis alba (Y16953; unpublished) and a G-Box binding protein from
Raphanus sativus (X92102, unpublished).
[0812] Experimental Observations.
[0813] The function of G561 was analyzed using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Plants over-expressing G561 showed more root growth on
potassium free media. Expression of G561 also appears to be
constitutive, and may be preferentially expressed in siliques and
moderately inducible with heat stress.
[0814] An important aspect of the potassium root growth assay is
that plants were firstly germinated on media with potassium and
then transferred onto potassium-free media. G561 overexpressors may
have be able to somehow cope with less potassium, and it is also
possible that G561 overexpressors accumulated more potassium before
they were transferred, which allowed the roots to grow more
vigorously after transfer.
[0815] As measured by NIR, G561 overexpressors were found to have
increased seed oil content compared to wild-type plants.
[0816] Utilities. G561 or its equivalogs could be used to increase
seedling vigor or plant growth in soils that are low in potassium.
Potassium is a macronutrient required for a variety of basic plant
functions which is commonly added to soil as a fertilizer. The
ability to grow plants on low potassium soils may save the
ecological and material cost of soil fertilization.
[0817] G561 or its equivalogs may also be used to manipulate sterol
composition, and may be used to modify seed oil content in plants,
which may be very important for the nutritional value and
production of various food products.
G562 (SEQ ID NO: 361)
[0818] Published Information.
[0819] G562 is the published Arabidopsis transcription factor GBF3,
which was cloned through its hybridization with GBF1 (Schindler et
al. (1992) EMBO J. 11:1261-1273). GBF3, like GBF1 and GBF2, can
bind G-box elements as a homodimer, or as a heterodimer with other
bZIP family members. GBF3 appears to be highly expressed in roots
in comparison to leaves, and repressed by light. GBF3 binds to
G-box elements in the Arabidopsis ADH promoter in vitro, is induced
by ABA in suspension cultures, and is proposed to be the
transcription factor responsible for the ABA regulated ADH gene
expression (Lu et al. (1996) Plant Cell. 8:847-857).
[0820] Closely Related Genes from Other Species.
[0821] Similar genes to G562 include the B. napus proteins BnGBF1
and BnGBF2 (U27107 and U27108) which are strikingly similar to G562
for their entire lengths. An unpublished Catharanthus roseus G-box
binding protein 1 protein (AF084971) also has significant homology
to G562 outside of the conserved domain.
[0822] Experimental Observations.
[0823] G562 appeared to be preferentially expressed in root and
flower tissues by RT-PCR analysis, and expressed at lower levels in
other tissues of the plant. G562 was induced by heat, drought and
osmotic stress in seedlings. The function of G562 was analyzed
using transgenic plants in which G562 was expressed under the
control of the 35S promoter. Plants overexpressing G562 were
consistently and significantly later flowering, with more crinkled
leaves than wild-type plants.
[0824] Utilities.
[0825] G562 or its equivalogs could be used to manipulate flowering
time in plants.
G567 (SEQ ID NO: 369)
[0826] Published Information.
[0827] G567 was discovered as a bZIP gene in BAC T10P11, accession
number AC002330, released by the Arabidopsis genome initiative.
[0828] Closely Related Genes from Other Species.
[0829] G567 is similar to two bZIP factors from Petroselinum
crispum (1806261) and Glycine max (1905785) Similarity between
these two proteins and the protein encoded by G567 extends beyond
the conserved domains and thus they may have a function and utility
to G567.
[0830] Experimental Observations.
[0831] The annotation of G567 in BAC AC002330 was experimentally
confirmed and the function of G567 was analyzed using transgenic
plants in which G567 was expressed under the control of the 35S
promoter.
[0832] Seedlings overexpressing G567 had slowly opening cotyledons
and very short roots when grown on MS plates containing glucose.
G567 is thus likely to be involved in sugar sensing or metabolism
during germination.
[0833] As measured by NIR analysis, plants overexpressing G567 had
an increase in total combined seed oil and seed protein
content.
[0834] G567 appears to be constitutively expressed, and induced in
leaves in a variety of conditions.
[0835] Utilities.
[0836] G567 or its equivalogs may be useful in manipulating seed
oil and protein content.
[0837] G567 or its equivalogs may be used to modify sugar
sensing.
[0838] In addition to their important role as an energy source and
structural component of the plant cell, sugars are central
regulatory molecules that control several aspects of plant
physiology, metabolism and development. It is thought that this
control is achieved by regulating gene expression and, in higher
plants, sugars have been shown to repress or activate plant genes
involved in many essential processes such as photosynthesis,
glyoxylate metabolism, respiration, starch and sucrose synthesis
and degradation, pathogen response, wounding response, cell cycle
regulation, pigmentation, flowering and senescence.
[0839] Because sugars are important signaling molecules, the
ability to control either the concentration of a signaling sugar or
how the plant perceives or responds to a signaling sugar could be
used to control plant development, physiology or metabolism. For
example, the flux of sucrose (a disaccharide sugar used for
systemically transporting carbon and energy in most plants) has
been shown to affect gene expression and alter storage compound
accumulation in seeds. Manipulation of the sucrose signaling
pathway in seeds may therefore cause seeds to have more protein,
oil or carbohydrate, depending on the type of manipulation.
Similarly, in tubers, sucrose is converted to starch which is used
as an energy store. It is thought that sugar signaling pathways may
partially determine the levels of starch synthesized in the tubers.
The manipulation of sugar signaling in tubers could lead to tubers
with a higher starch content.
[0840] Thus, manipulating the sugar signal transduction pathway may
lead to altered gene expression to produce plants with desirable
traits. In particular, manipulation of sugar signal transduction
pathways could be used to alter source-sink relationships in seeds,
tubers, roots and other storage organs leading to increase in
yield.
G584 (SEQ ID NO: 385)
[0841] Published Information.
[0842] G584 was identified in chromosome IV BAC T6K21 sequence
(gene T6K21.10) by the EU Arabidopsis sequencing project as "bHLH
protein-like".
[0843] Closely Related Genes from Other Species.
[0844] A related gene to G584 is Phaseolus vulgaris phaseolin G-box
binding protein PG1 (U18348). Similarity between G584 and PG1
extends beyond the signature motif of the family. No functional
information is available for gene PG1 other than that the protein
binds to a G-box motif CACGTG of the bean seed storage protein
.beta.-phaseolin gene.
[0845] Experimental Observations.
[0846] The function of G584 was analyzed using transgenic plants in
which G584 was expressed under the control of the 35S promoter.
G584 transgenic plants seemed to produce seed of a larger size than
control plants. Analysis of G584 overexpressors revealed no
apparent physiological or biochemical changes when compared to
wild-type control plants. Analysis of the endogenous expression
level of G584, as determined by RT-PCR, revealed a moderate and
constitutive expression level in all Arabidopsis tissues examined.
G584 transcript level remained similar to wild-type controls in all
the treatments examined.
[0847] Utilities.
[0848] G584 or its equivalogs could be used to produce larger seed
size and/or altered seed morphology, which may positively influence
seed storage characteristics, appearance and yield.
G590 (SEQ ID NO: 387)
[0849] Published Information.
[0850] The sequence of G590 was obtained from the Arabidopsis
genome sequencing project, GenBank accession number Z99707, based
on its sequence similarity within the conserved domain to other
bHLH/Myc related proteins. A knockout mutant in G590, named as
SPATULA, has also been isolated and characterized (Heisler et al.
(2000) Development 128:1089-1098).
[0851] Experimental Observations.
[0852] The function of this gene was studied by knockout analysis
and by using transgenic plants in which G590 was expressed under
the control of the 35S promoter.
[0853] G590 knockout plants produced more seed oil than wild-type
controls.
[0854] Overexpression of G590 resulted in a reduction in flowering
time and a shorter generation time. Under continuous light
conditions, G590 overexpressing plants typically produced visible
flower buds approximately one week earlier than wild-type controls.
At the time of bolting, these plants had 4-8 rosette leaves
compared with 8-11 in wild type. Additionally, G590 overexpressor
had rather pointed leaves at early stages of development. The
plants also appeared slightly small, yellow, and later, had
elongated leaf petioles. No other physiological and biochemical
alterations were observed in the overexpression transgenic plants
when compared to wild-type controls.
[0855] Gene expression profiling using RT-PCR shows that G590 was
relatively expressed at higher levels in flowers, siliques and
roots. Its expression level was unaffected by any of the conditions
tested.
[0856] Utilities.
[0857] G590 or its equivalogs could be used to increase seed oil
content, which would be of nutritional value for food for human
consumption as well as animal feeds.
[0858] Based on the current analysis of G590 overexpressing plants,
G590 or its equivalogs could be used to manipulate flowering time.
A wide variety of applications exist for systems that shorten the
time to flowering.
G592 (SEQ ID NO: 391)
[0859] Published Information.
[0860] The genomic sequence of G592 has been determined as part of
the Arabidopsis Genome Initiative (BAC clone T24P15, gene
T24P15.19, GenBank accession number AC002561). There is no other
published information available regarding the function of G592.
[0861] Experimental Observations.
[0862] The function of G592 was analyzed using transgenic plants in
which G592 was expressed under the control of the 35S promoter.
Plants overexpressing G592 were marginally early flowering. Many of
the T1 plants were smaller than wild-type controls. Analysis of
G592 overexpressors revealed no apparent physiological or
biochemical changes when compared to wild-type control plants.
Analysis of the endogenous expression levels of G592, as determined
by RT-PCR, revealed a moderate and constitutive expression level in
all Arabidopsis tissues examined, although expression in roots was
slightly higher. G592 expression appeared to be repressed by ABA,
cold and salt treatments.
[0863] Utilities.
[0864] Based on the current analysis of G592 overexpressing plants,
G592 could be used to manipulate flowering time.
G598 (SEQ ID NO: 393)
[0865] Published Information.
[0866] G598 was identified in chromosome II BAC T6D20 sequence
(gene T6D20.23) by The Institute for Genomic Research as an
"unknown protein".
[0867] Experimental Observations.
[0868] cDNAs representing two splice variants of G598 were
identified. These splice variants differ in the 3' end region and
would produce proteins with different C-termini The function of
G598 was analyzed using transgenic plants in which splice variant
number 1 of G598 was expressed under the control of the 35S
promoter. G598 overexpressors had higher seed oil content in all
three lines tested when measured by NIR. These three lines also
showed increased galactose levels when insoluble sugar composition
was determined Otherwise, G598 overexpressors behaved similarly to
wild-type controls in all biochemical assays performed. The
characterization of G598 overexpressors revealed no apparent
morphological or physiological changes when compared to wild-type
control plants. Analysis of the endogenous expression level of
G598, as determined by RT-PCR, revealed a moderate and constitutive
expression level in all tissues and conditions examined.
[0869] One transgenic line showed a reproducible increase in
galactose in leaves.
[0870] Utilities.
[0871] On the basis of the biochemical analyses performed to date,
G598 or its equivalogs may play a role in the accumulation or
regulation of leaf insoluble sugars. Insoluble sugars are among the
building blocks of plant cell walls. Transcription factors that
alter plant cell wall composition such as galactose have several
potential applications including altering food digestibility, plant
tensile strength, wood quality, pathogen resistance and in pulp
production. In particular, increasing the insoluble carbohydrate
content in various fruits, vegetables, and other edible consumer
products will result in enhanced fiber content. Increased fiber
content would not only provide health benefits in food products,
but might also increase digestibility of forage crops.
[0872] G598 or its equivalogs could be used to increase seed oil
content, which would be of nutritional value for food for human
consumption as well as animal feeds.
G624 (SEQ ID NO: 403)
[0873] Published Information.
[0874] G624 was identified in the sequence of BAC F18E5, GenBank
accession number AL022603, released by the Arabidopsis Genome
Initiative. No further public or published information is available
about the function of G624.
[0875] Experimental Observations.
[0876] Overexpression of G624 produced a moderate delay in the
onset of flowering (approximately one week under continuous light
conditions). A number of the late flowering 35S::G624 transformants
also displayed a marked increase in vegetative biomass compared to
controls. No altered phenotypes were detected in any of the
physiological assays.
[0877] Intriguingly, overexpression lines containing a truncated
form of the cDNA (see sequence comments) exhibited wild-type
morphology but displayed enhanced tolerance to both high sodium
chloride and low phosphate growth conditions. It is possible that
this effect represents a dominant negative phenotype.
[0878] Utilities.
[0879] The delayed flowering displayed by 35S::G624 transformants
suggests that the gene might be used to manipulate the flowering
time of commercial species. In particular, an extension of
vegetative growth or an increase in leaf size can significantly
increase biomass and result in substantial yield increases.
[0880] Based on the increased salt tolerance exhibited by the
35S::G624 lines in physiology assays, this gene might be used to
engineer salt tolerant crops and trees that can flourish in
salinified soils, or under drought conditions.
[0881] The response of 35S::G624 seedlings to low phosphate
conditions suggests that the gene could be used to manipulate
nutrient uptake, or the ability to grow in poor nutrient soils.
G627 (SEQ ID NO: 405)
[0882] Published Information.
[0883] G627 corresponds to AGAMOUS-LIKE 19 (AGL19) which was
isolated by Alvarez-Buylla et al. (2000) Plant J. 24, 457-466). No
genetic characterization of AGL19 has been reported, but it was
found to be specifically expressed in the outer layers of the root
meristem (lateral root cap and epidermis) and in the central
cylinder cells of mature roots (Alvarez-Buylla et al. (2000)
supra).
[0884] Experimental Observations.
[0885] RT-PCR expression studies failed to detect G627 in any of
the tissue types analyzed. This result partially agreed with the
data of Alvarez-Buylla et al. (2000) supra, who found that the gene
is expressed only in specific regions of the root. It is possible
that such regions were not sufficiently represented for G627
transcripts to be detected in the whole root samples analyzed in
our expression studies.
[0886] In later experiments, however, a G627 clone was isolated by
high cycle PCR from a cDNA sample derived from mixed tissues, and
transgenic lines were generated in which this clone was expressed
from a 35S promoter. A substantial proportion of the 35S::G627
lines flowered markedly earlier than control plants. Such effects
were observed in both the T1 and T2 generations and indicated that
the gene plays a role in the regulation of flowering time.
[0887] Utilities.
[0888] Given the early flowering seen amongst the 35S::G627
transformants, the gene might be used to manipulate the flowering
time of commercial species. In particular, G627 could be used to
accelerate flowering or eliminate any requirement for
vernalization. In some instances, a faster cycling time might allow
additional harvests of a crop to be made within a given growing
season. Shortening generation times could also help speed-up
breeding programs, particularly in species such as trees, which
typically grow for many years before flowering. Conversely, it
might be possible to modify the activity of G627 or its orthologs
to delay flowering in order to achieve an increase in biomass and
yield.
G634 (SEQ ID NO: 415)
[0889] Published Information.
[0890] G634 was initially identified as public partial cDNAs
sequences for GTL1 and GTL2 which are splice variants of the same
gene (Smalle et al (1998) Proc. Natl. Acad. Sci. USA 95:3318-3322).
The published expression pattern of GTL1 shows that G634 is highly
expressed in siliques and not expressed in leaves, stems, flowers
or roots.
[0891] Closely Related Genes from Other Species.
[0892] A close non-Arabidopsis relative of G634 is O. sativa the
gt-2 gene (2) which is proposed to bind and regulate the phyA
promoter. In addition, the pea DNA-binding protein DF1 (13786451)
shows strong homology to G634. The homology of these proteins to
G634 extends to outside of the conserved domains and thus these
genes are likely to be orthologs of G634.
[0893] Experimental Observations.
[0894] The boundaries of G634 were experimentally determined and
the function of G634 was investigated by constitutively expressing
G634 using the CaMV 35S promoter.
[0895] Three constructs were made for G634: P324, P1374 and P1717.
P324 was found to encode a truncated protein. P1374 and P1717
represent full length splice variants of G634; P1374, the shorter
of the two splice variants was used for the experiments described
here and the coding sequence of the P1374 clone is provided as the
cDNA sequence for G634 in the Sequence Listing. The longest
available cDNA (P1717), confirmed by RACE, had the same ATG and
stop codons as the genomic sequence. Only data for P1374 are
presented here.
[0896] Plants overexpressing G634 from construct P1374 had a
dramatic increase the density of trichomes, which were also larger
in size. The increase in trichome density was most noticeable on
later arising rosette leaves, cauline leaves, inflorescence stems
and sepals with the stem trichomes being more highly branched than
controls. Approximately half of the primary transformants and two
of three T2 lines showed the phenotype. Apart from slight
smallness, there did not appear to be any other clear phenotype
associated with the overexpression of G634. However, a reduction in
germination was observed in T2 seeds grown in culture.
[0897] RT PCR data showed that G634 was preferentially expressed in
flowers and germinating seedlings, and induced by auxin.
[0898] Utilities.
[0899] G634 or its equivalogs may be used to alter trichome
structure, function or density. Trichome glands on the surface of
many higher plants produce and secrete exudates that give
protection from the elements and pests such as insects, microbes
and herbivores. These exudates may physically immobilize insects
and spores, may be insecticidal or ant-microbial or they may
allergens or irritants to protect against herbivores. Trichomes
have also been suggested to decrease transpiration by decreasing
leaf surface air flow, and by exuding chemicals that protect the
leaf from the sun.
[0900] Depending on the plant species, varying amounts of diverse
secondary biochemicals (often lipophilic terpenes) are produced and
exuded or volatilized by trichomes. These exotic secondary
biochemicals, which are relatively easy to extract because they are
on the surface of the leaf, have been widely used in such products
as flavors and aromas, drugs, pesticides and cosmetics. One class
of secondary metabolites, the diterpenes, can effect several
biological systems such as tumor progression, prostaglandin
synthesis and tissue inflammation. In addition, diterpenes can act
as insect pheromones, termite allomones, and can exhibit
neurotoxic, cytotoxic and antimitotic activities. As a result of
this functional diversity, diterpenes have been the target of
research several pharmaceutical ventures. In most cases where the
metabolic pathways are impossible to engineer, increasing trichome
density or size on leaves may be the only way to increase plant
productivity.
[0901] Thus, the use of G634 and its homologs to increase trichome
density, size or type may therefore have profound utilities in so
called molecular farming practices (i.e. the use of trichomes as a
manufacturing system for complex secondary metabolites), and in
producing resistant insect and herbivore resistant plants.
G636 (SEQ ID NO: 417)
[0902] Published Information.
[0903] G636 was identified through partial EST AA395524, released
by Michigan State University. The entire sequence of G636 was later
identified in BAC F7012, accession number F7012, released by the
Arabidopsis genome initiative.
[0904] Closely Related Genes from Other Species.
[0905] G636 is closely related to the Pisum sativum DNA-binding
protein DF1, accession number AB052729, which may bind to light
regulatory elements.
[0906] Experimental Observations.
[0907] The 5' boundary of G636 was determined and the function of
G636 was analyzed by constitutively expressing the gene using the
CaMV 35S promoter. Overexpression of G636 resulted in premature
senescence of leaves and reduced plant size and fertility. No other
phenotypic alterations were noted as a result of physiological or
biochemical analyses.
[0908] G636 was constitutively expressed.
[0909] Utilities.
[0910] G636 or its equivalogs may be used to alter senescence
responses in plants. Although leaf senescence is thought to be an
evolutionary adaptation to recycle nutrients, the ability to
control senescence in an agricultural setting has significant
value. For example, a delay in leaf senescence in some maize
hybrids is associated with a significant increase in yields and a
delay of a few days in the senescence of soybean plants can have a
large impact on yield. Delayed flower senescence may also generate
plants that retain their blossoms longer and this may be of
potential interest to the ornamental horticulture industry.
G638 (SEQ ID NO: 419)
[0911] Published Information.
[0912] G638 was identified in the sequence of BAC F17C15, GenBank
accession number AL162506, released by the Arabidopsis Genome
Initiative. During the course of its functional analysis, G638 was
identified as the PETAL LOSS gene (Griffith et al. (1999)
Development: 126:5635-5644). The PETAL LOSS knockout mutant
displays a variety of flower phenotypes, most strikingly
characterized by a reduction in the number of petals. In addition
to flower organ number, organ identity, shape and orientation,
particularly of petals, is altered.
[0913] Closely Related Genes from Other Species.
[0914] A relative of G638 is a Medicago truncatula gene represented
by the EST BF646615, which was isolated from an elicited cell
culture cDNA library.
[0915] Experimental Observations.
[0916] The boundaries of G638 were experimentally determined and
the function of G638 was analyzed using transgenic plants in which
this gene was expressed under the control of the 35S promoter.
Expression of G638 causes severe alterations of plant development.
The most striking feature of these overexpressor plants was that
they have multipetallate flowers. In early flowers, some homeotic
conversion had occurred between some organs of the flower. In all
flowers made after these early flowers, petal number had been
altered. Up to eight petals were consistently observed on plants
that flowered, and as the plants grew older, the number of petals
on new flowers was reduced from eight to about five. This phenotype
was somewhat opposite to the phenotype observed with PETAL LOSS
knockout plants and confirms a role for G638 in counting or
maintaining petal number within the Arabidopsis flower. In addition
to the flower phenotype, G638 caused alterations in phyllotaxy,
leaf shape and caused plants to be sterile. G638 appears to be
constitutively expressed.
Utilities.
[0917] G638 or its equivalogs could be used to manipulate plant
architecture and leaf shape, in particular this gene could be used
to increase or decrease petal number in flowers. Overexpression of
G638 also causes sterility, indicating there may be some use for
this gene in engineering sterility into commercially relevant
species.
G663 (SEQ ID NO: 435)
[0918] Published Information.
[0919] G663 was identified from the Arabidopsis EST sequence,
H76020, based on its sequence similarity within the conserved
domain to other Myb family members in Arabidopsis. This gene was
named MYB90 (Kranz et al. (1998) Plant J. 16:263-276). Reverse
Northern data suggested G663 is expressed highly in leaves,
siliques, and flowers and is induced by ethylene treatment.
[0920] Experimental Observations.
[0921] The function of G663 was analyzed by its ectopic
overexpression in plants. G663 overexpressors had constitutive
anthocyanin production in seeds and roots. One line had higher
anthocyanin production in leaf tissue as well. In other
overexpressing lines, constitutive anthocyanin production was noted
in trichomes and leaf margins. The overproduction of pigment in
select tissues suggests there may be another transcription factor
with which G663 interacts to activate the pathway. Using the corn
system as a model, the interacting protein may be a bZIP like
transcription factor.
[0922] RT-PCR analysis of the endogenous levels of G663 indicated
that this gene was expressed primarily in siliques and seedlings.
Array data confirmed the high levels in silique and also detected
high levels of G663 in germinating seed tissue. G663 transcripts
were also induced above basal levels by all stress treatments
tested except by infection with Erysiphe orontii. These data were
consistent with G663 being involved in the anthocyanin biosynthetic
pathway, which is part of a common multi-stress response
pathway.
Utilities.
[0923] The potential utilities of this gene or its equivalogs
includes alterations in pigment production for horticultural
purposes, and possibly increasing stress resistance in combination
with another transcription factor. Flavonoids have antimicrobial
activity and could be used to engineer pathogen resistance. Several
flavonoid compounds have health promoting effects such as the
inhibition of tumor growth and cancer, prevention of bone loss and
the prevention of the oxidation of lipids. Increasing levels of
condensed tannins, whose biosynthetic pathway is shared with
anthocyanin biosynthesis, in forage legumes is an important
agronomic trait because they prevent pasture bloat by collapsing
protein foams within the rumen. For a review on the utilities of
flavonoids and their derivatives, refer to Dixon et al. ((1999)
Trends Plant Sci. 10: 394-400).
G664 (SEQ ID NO: 437)
[0924] Published Information.
[0925] G664 was identified from the Arabidopsis EST sequence,
N38154, based on its sequence similarity within the conserved
domain to other Myb family members in Arabidopsis. The Myb
consortium named this gene MYB4 (Kranz et al. (1998) Plant J. 16:
263-276). Reverse Northern data suggested G664 is expressed highly
in silique tissue with a low level of expression detected in all
other tissues.
[0926] Closely Related Genes from Other Species.
[0927] G664 shows extensive homology to the tomato gene THM27
(X95296) and the barley gene (X70877).
[0928] Experimental Observations.
[0929] The function of G664 was analyzed through its ectopic
overexpression in plants. G664 overexpressors germinated better and
then developed more rapidly in cold conditions (8.degree. C.) than
wild-type controls. No differences in germination rates were
observed on control MS media or in response to any other stress.
Array data indicated that G664 was normally expressed primarily in
root, shoot and silique.
[0930] Utilities.
[0931] The potential utility of this gene or its equivalogs is to
confer improved cold germination and/or growth. The germination of
many crops like cotton is very sensitive to cold temperatures, a
gene that would allow germination and seedling vigor in the cold
would have tremendous utility in allowing seeds to be planted
earlier in the season with a high rate of survivability.
G676 (SEQ ID NO: 457)
[0932] Published Information.
[0933] G676 was identified from an Arabidopsis EST, N96391, based
on its sequence similarity to other members of the Myb family
within the conserved domain. The Myb consortium named this gene
MYB66 (Kranz H D, et al. (1998) Plant J. 16:263-276) and in a
report by Lee et al ((1999) Cell 1999 24; 99:473-483) a detailed
functional analysis of G676, or "werewolf", is described. Werewolf
(WER) is involved in position-dependent patterning of epidermal
cell types. Transcripts were localized to root epidermal cells that
will develop into non-hair cells. WER was shown to regulate the
position-dependent expression of GLABRA2, to interact with the
maize R gene, and to act as an antagonist to the myb protein
CAPRICE (G225). These authors do not report altered trichome
positioning in their 35S:wer overexpressors.
[0934] Experimental Observations.
[0935] The function of G676 was analyzed through its ectopic
overexpression in plants. Morphologically, the plants are small,
and partially glabrous on the upper surface of the leaf. Ectopic
trichomes developed on the underside of the leaf in one line. Lee
et al (1999) Cell 99: 473-483) fail to report altered trichome
phenotypes in the leaves of the 35S:were overexpression lines. The
present lines showed a higher degree of overexpression, which could
explain the small stature of the plants as well.
[0936] RT-PCR analysis of the endogenous levels of G676 indicated
that this gene was expressed primarily in roots with a low level of
expression in siliques and seedlings. G676 transcripts were not
induced significantly above basal levels by any stress-related
treatments tested. In disease-related treatments where whole
seedlings were harvested, transcripts were detectable but not above
basal levels. This may be related to the gene's root expression.
G676 transcripts were not found in Fusarium oxysporum treated
seedlings; it is possible this treatment represses G676 expression
in the roots.
[0937] Utilities.
[0938] The potential utility of G676 or its equivalogs is the
production of ectopic trichomes on the surface of the leaf. It
would be of significant agronomic value to have plants that exhibit
greater numbers of glandular trichomes producing essential oils for
the pharmaceutical and food industries, as well as oils that
protect plants against insect and pathogen attack.
G680 (SEQ ID NO: 463)
[0939] Published Information.
[0940] G680 or LHY (late elongated hypocotyl) is an unusual Myb
transcription factor in that it contains a single Myb repeat
instead of the two repeat sequences found in the majority of plant
Myb genes (R2R3Mybs). There are over 30 members of this single
repeat Myb-related subfamily in the Arabidopsis genome. Both
signature repeats in R2R3Myb domain are required for sequence
specific DNA binding. However, the Myb-related subfamily with a
single repeat domain are also able to bind to DNA in a
sequence-specific manner (Baranowskij et al. (1994) EMBO J. 13:
5383-5392; Feldbrugge et al. (1997) Plant J. 11: 1079-1093) and are
therefore thought to function as transcription factors.
[0941] G680 or LHY overexpression affects many processes associated
with the circadian clock including, the rythmicity in both leaf
movement, and the expression of CAB and CCR2 genes, as well as
photoperiodic control of flowering time (Schaffer et al. (1998)
Cell 93: 1219-1229). Other reported pleiotropic effects include
elongated hypocotyls, elongated petioles, and pale leaves (Schaffer
et al. (1998) Cell 93: 1219-1229). All of these phenotypes could
potentially be explained by the impairment of circadian clock
function. LHY shows a high degree of homology to CCA1, another
protein implicated in circadian clock function (Wang et al. (1997)
Plant Cell 9: 491-507).
[0942] Experimental Observations.
[0943] The function of G680 was analyzed through its ectopic
overexpression in plants. G680 overexpressors were late flowering
under both short and long day conditions, however, the late
flowering phenotype appeared more consistently under short day
conditions. The overexpressors were darker green in color compared
to the wild-type controls at later stages of development. This was
inconsistent with the published phenotype, which indicates the
plants have less chlorophyll, and are pale in color (Schaffer et
al. (1998) Cell 93: 1219-1229). Preliminary data indicated that a
vernalization treatment applied to germinating seedlings partially
overcame the delay in flowering in the G680 overexpressors.
Vernalized plants showed an approximate 35% reduction in leaf
number on average compared to non-vernalized controls.
Overexpression of G680 in plants also resulted in sensitivity to
media containing high glucose in a germination assay, indicating a
potential role for G680 in sugar sensing.
[0944] As determined by RT-PCR, G680 was uniformly expressed in all
tissues tested. RT-PCR data also indicated a moderate induction of
G680 transcripts accumulation upon drought treatment, and Erysiphe
treatment could repress the expression of this gene.
[0945] Utilities.
[0946] G680 or its equivalogs may be used to alter sugar sensing in
plants. Sugars are key regulatory molecules that affect diverse
processes in higher plants including germination, growth,
flowering, senescence, sugar metabolism and photosynthesis. Sucrose
is the major transport form of photosynthate and its flux through
cells has been shown to affect gene expression and alter storage
compound accumulation in seeds (source-sink relationships).
Glucose-specific hexose-sensing has been described in plants and
implicated in cell division and repression of `famine` genes
(photosynthetic or glyoxylate cycles). The potential utilities of a
gene involved in glucose-specific sugar sensing are to alter energy
balance, photosynthetic rate, carbohydrate accumulation, biomass
production, source-sink relationships, and senescence.
[0947] Potential utilities of G680 or its equivalogs also include
the regulation of flowering time. An area in which late flowering
might be useful include crops where the vegetative portion of the
plant is the marketable portion. In this case, it would be
advantageous to prevent or delay flowering in order to increase
yield. Prevention of flowering would also be useful in these same
crops in order to prevent the spread of transgenic pollen and/or to
prevent seed set.
A vernalization treatment applied to germinating G680 seedlings
will partially overcome the delay in flowering in the G680
overexpressors. Vernalized plants showed an approximate 35%
reduction in leaf number on average compared to non-vernalized
controls. Various late flowering mutants are partially rescued by
GA applications (Chandler et al. (1994) J. Exp. Bot. 45: 1279
1288). Thus it is possible that G680 could be used to increase the
vegetative phases of development in order to increase yield and
then triggered to flower via a cold treatment or a gibberellic acid
application.
G682 (SEQ ID NO: 467)
[0948] Published Information.
[0949] G682 was identified from the Arabidopsis BAC, AF007269,
based on sequence similarity to other members of the Myb family
within the conserved domain.
[0950] Experimental Observations.
[0951] The function of G682 was analyzed through its ectopic
overexpression in plants. G682 overexpressors were glabrous, had
tufts of more root hairs and germinated better under heat stress
conditions. Older plants were not more tolerant to heat stress
compared to wild-type controls.
[0952] RT-PCR analysis of the endogenous levels of G682 transcripts
indicated that this gene was expressed in all tissues tested,
however, a very low level of transcript was detected in roots and
shoots. Array tissue print data indicated that G682 was expressed
primarily, but not exclusively, in flower tissue.
[0953] An array experiment was performed on one G682 overexpressing
line. The data from this one experiment indicated that this gene
could be a negative regulator of chloroplast development and/or
light dependent development because the gene Albino3 and many
chloroplast genes are repressed. Albino3 functions to regulate
chloroplast development (Sundberg et al (1997) Plant Cell
9:717-730). The gene G682 was itself induced 20-fold. Other than a
few additional transcription factors, very few genes are induced as
a result of the ectopic expression of G682.
[0954] A number of plants transformed with G682 lacked
trichomes.
[0955] Plants overexpressing paralogs of G682, including G225,
G226, G1816, and G2718, transcription factors within the same
clade, have similar traits as plants that overexpress G682. When
any of these five transcription factors are overexpressed in
plants, the plants show phenotypes related to glabrousness and
abiotic stress tolerance, including:
[0956] (a) a reduced number or lack of trichomes by overexpressing
G682, G225, G226, G1816, and G2718;
[0957] (b) increased root hairs, the latter indicating improved
resistance to osmotic stress by overexpressing G682, G225, G226,
G1816, and G2718;
[0958] (c) increased tolerance to nitrogen-limiting conditions by
overexpressing G682, G225, G226, G1816 and G2718;
[0959] (d) increased heat tolerance by overexpressing G682 and
G225;
[0960] (e) increased tolerance to salt, by overexpressing G226;
[0961] (f) altered sugar sensing, by plants overexpressing
G1816;
[0962] (g) altered sugar sensing by plants overexpressing G1816 and
G2718; and
[0963] (h) improved root growth, by plants overexpressing
G2718.
[0964] MYB transcription factors can be subdivided into two classes
based on polynucleotide sequence characteristics. The sequences of
representative Class I transcription factors (CITFs) and Class II
transcription factors (CIITFs), the latter group being the one in
which G682 is found, are shown in Table 11. The coordinates for the
conserved domains of the transcription factors used to prepare
Table 12b may be found in Table 5, and appear as the underlined
regions in Table 11.
TABLE-US-00011 TABLE 11 Class I transcription factors G247
MRMTRDGKEHEYKKGLWTVEEDKILMDYVRTHGQGHWNRIAKKTGLKRCGKSCRLRWMNYL
SPNVNRGNFTDQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGLGDHSTAV
KAACGVESPPSMALITTTSSSHQEISGGKNSTLRFDTLVDESKLKPKSKLVHATPTDVEVAATVPN
LFDTFWVLEDDFELSSLTMMDFTNGYCL G212
MRIRRRDEKENQEYKKGLWTVEEDNILMDYVLNHGTGQWNRIVRKTGLKRCGKSCRLRWMNY
LSPNVNKGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLVGDYSSAV
KTTGEDDDSPPSLFITAATPSSCHHQQENIYENIAKSFNGVVSASYEDKPKQELAQKDVLMATTN
DPSHYYGNNALWVHDDDFELSSLVMMNFASGDVEYCL G676
MRKKVSSSGDEGNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRW
MNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQ
KTKQSNGDIVYQINLPNPTETSEETKISNIVDNNNILGDEIQEDHQGSNYLSSLWVHEDEFELSTLT
NMMDFIDGHCF G1332
MECKREEGKSYVKRGLWKPEEDMILKSYVETHGEGNWADISRRSGLKRGGKSCRLRWKNYLRP
NIKRGSMSPQEQDLIIRMHKLLGNRWSLIAGRLPGRTDNEVKNYWNTHLNKKPNSRKQNAPESI
VGATPFTDKPVMSTELRRSHGEGGEEESNTWMEETNHFGYDVHVGSPLPLISHYPDNTLVFDPCF
SFTDFFPLL Class II transcription factors G225
MFRSDKAEKMDKRRRRQSKAKASCSEEVSSIEWEAVKMSEEEEDLISRMYKLVGDRWELIAGRI
PGRTPEEIERYWLMKHGVVFANRRRDFFRK G226
MDNTNRLRLRRGPSLRQTKFTRSRYDSEEVSSIEWEFISMTEQEEDLISRMYRLVGNRWDLIAGR
VVGRKANEIERYWIMRNSDYFSHKRRRLNNSPFFSTSPLNLQENLKL G682
MDNHRRTKQPKTNSIVTSSSEEVSSLEWEVVNMSQEEEDLVSRMHKLVGDRWELIAGRIPGRTA
GEIERFWVMKN G1816
MDNTDRRRRRKQHKIALHDSEVSSIEWEFINMTEQEEDLIFRMYRLVGDRWDLIAGRVPGRQPE
EIERYWIMRNSEGFADKRRQLHSSSHKHTKPHRPRFSIYPS G2718
MNTQRKSKHLKTNPTIVASSSEEVSSLEWEEIAMAQEEEDLICRMYKLVGERWDLIAGRIPGRTA
EEIERFWVMKNHRRSQLR
[0965] Table 12a shows the percent identity in the MYB conserved
domains for the sequences included in the Sequence Listing, as
originally calculated in U.S. patent application Ser. No.
09/489,376. Table 12b shows the percent identity in the conserved
domains for the sequences included in the Sequence Listing, as
calculated using revised amino acid residue coordinates for the
conserved domains (Table 5, and below) of the respective
polypeptides, and also includes percent identity comparisons with
G1816 and G2718.
TABLE-US-00012 TABLE 12a GID No. SEQ ID NO: G212 G247 G676 G1332
G682 G226 G225 G212 124 100% 42% 41% 31% 36% 40% 36% G247 170 42%
100% 92% 74% 16% 17% 15% G676 458 41% 92% 100% 68% 15% 17% 15%
G1332 856 31% 74% 68% 100% 18% 18% 18% G682 468 36% 16% 15% 18%
100% 56% 81% G226 142 40% 17% 17% 18% 56% 100% 65% G225 140 36% 15%
15% 18% 81% 65% 100%
TABLE-US-00013 TABLE 12b GID No. SEQ ID NO: G212 G247 G676 G1332
G682 G226 G225 G1816 G2718 G212 124 100% 91% 91% 69% 52% 60% 57%
60% 54% G247 170 91% 100% 95% 70% 52% 57% 55% 57% 55% G676 458 91%
95% 100% 70% 52% 60% 57% 60% 54% G1332 856 69% 70% 70% 100% 60% 62%
64% 57% 57% G682 468 52% 52% 52% 60% 100% 63% 82% 65% 78% G226 142
60% 57% 60% 62% 63% 100% 70% 82% 70% G225 140 57% 55% 57% 64% 82%
70% 100% 78% 78% G1816 940 60% 57% 60% 57% 65% 82% 78% 100% 73%
G2718 960 54% 55% 54% 57% 78% 70% 78% 73% 100%
[0966] Based on the analyses using the conserved domains shown in
Table 11, the CITFs G212, G247, G676, and G1332 show a high degree
of sequence identity in the MYB domain with each other (Table 12b;
in the range of 69-95%), and CIITFs G682, G225, G226, G1816 and
G2718 share a high degree of sequence identity with each other
(Table 12b; in the range of 63% to 82%). Comparisons between CITFs
and CIITFs reveals a generally lower degree of identity between
transcription factors in the different groups (Table 12b; 52% to
64%).
[0967] Utilities.
[0968] The potential utility of this gene or its equivalogs is to
confer heat tolerance to germinating seeds.
[0969] G682 or its equivalogs could be used to alter trichome
number and distribution in plants. Trichome glands on the surface
of many higher plants produce and secrete exudates, which give
protection from the elements and pests such as insects, microbes
and herbivores. These exudates may physically immobilize insects
and spores, may be insecticidal or ant-microbial or they may
allergens or irritants to protect against herbivores. Trichomes
have also been suggested to decrease transpiration by decreasing
leaf surface air flow, and by exuding chemicals that protect the
leaf from the sun.
G736 (SEQ ID NO: 487)
[0970] Published Information.
[0971] G736 was discovered as a full length EST clone. It was
subsequently localized to BAC AC002341.
[0972] Experimental Observations.
[0973] RT-PCR analysis of the endogenous levels of G736 indicated
that this gene was expressed at low to medium levels in all tissues
tested. In addition, there was no induction of G736 above its basal
level in response to environmental stress treatments.
[0974] Two out of three G736 overexpressing lines exhibited a
severe late flowering phenotype in both the T1 and T2 generation,
the third line was late flowering in the T1 generation but the
phenotype was lost in the subsequent generation, most likely due to
silencing of the transgene. All three lines exhibited elongated
petioles in both generations, and in two of the T1 lines, failure
of the siliques to elongate was also observed. This phenotype was
lost in the subsequent generation.
[0975] Utilities.
[0976] Overexpression of G736 and its equivalog may be used to
substantially delay flowering. A wide variety of applications exist
for genes that either lengthen or shorten the time to flowering, or
for systems of inducible flowering time control. In particular, in
species where the vegetative parts of the plants constitute the
crop and the reproductive tissues are discarded, it would be
advantageous to delay or prevent flowering. Extending vegetative
development could bring about large increases in yields.
Additionally, a major concern is the escape of transgenic pollen
from GMOs to wild species or so-called organic crops. Systems that
prevent vegetative transgenic crops from flowering would eliminate
this worry.
G748 (SEQ ID NO: 497)
Published Information
[0977] A cDNA sequence for G748 was deposited in GenBank by
Abbaraju and Oliver on Aug. 4, 1998. G748 encodes a protein
containing a D of zinc-finger domain that was found to bind the
H-protein promoter. The H protein is a component of the glycine
decarboxylase multienzyme complex, that comprises over one-third of
the soluble proteins in mitochondria isolated from the leaves of C3
plants (Oliver et al. (1995) Bioenerg. Biomembr. 27: 407-414). A
published function for G748 is a putative regulatory role in
H-protein gene expression, suggested by the promoter-binding
data.
[0978] Closely Related Genes from Other Species.
[0979] Close relatives to G748 include a rice gene (GB accession
#BAA88190) and a pumpkin gene (GB accession #D45066). In both
cases, the similarity extends beyond the conserved DNA-binding
domain, which suggests the genes could be orthologs of G748. The
pumpkin gene encodes an ascorbate oxidase promoter-binding protein,
suggesting that the product of G748 could also bind that
promoter.
[0980] Experimental Observations.
[0981] A cDNA sequence was isolated and used to produce transgenic
plants overexpressing G748. Overexpression of G748 resulted in a
late flowering phenotype. Transgenic plants were generally large
and dark green with more rosette leaves. Stems were thicker and
more vascular bundles were noticeable in transverse sections. G748
overexpressors also produced more lutein in seeds (consistently
observed in three lines). The high lutein phenotype was confirmed
in a repeat experiment. The physiology of the plant was similar to
that of the controls. In wild-type plants, G748 was constitutively
expressed, although at lower levels at the seedling stage.
Expression levels were lower upon infection with E. orontii and
Fusarium.
[0982] Utilities.
[0983] Experimental data showed that G748 or its equivalogs can be
used to delay flowering in transgenic plants.
[0984] Arabidopsis plants overexpressing G748 produced more lutein
in seeds.
[0985] Plants transformed with G748 had modified stem morphology
and vascular bundles and may be used to affect overall plant
architecture.
G779 (SEQ ID NO: 525)
[0986] Published Information.
[0987] G779 has been previously identified; fruits from a ind1
knockout mutant plants do not show cell differentiation in the
dehiscence zone (Liljegren et al. (2000) Abstracts 11 th Intl.
Conf. Arabidopsis Res., Madison, Wis., pp. 179). These results
suggest that G779 may mediate cell differentiation during
Arabidopsis fruit development.
[0988] Closely Related Genes from Other Species.
[0989] G779 is closely related to a Brassica rapa subsp. Pekinensis
cDNA isolated from flower bud (acc#AT002234).
[0990] Experimental Observations.
[0991] The function of G779 was analyzed using transgenic plants in
which G779 was expressed under the control of the 35S promoter.
Morphological analysis of overexpressors indicated that primary
transformants of G779 had high levels of anthocyanin in seedlings,
produced small plants with disorganized rosettes and short
internodes, and many had flower abnormalities. The transformants
with flower abnormalities showed conversion of sepals to carpels.
The most severely affected had full conversion of sepals to carpels
with ovules, stigmatic tissue on petals and stamens, and in some
cases showed organ fusions. In the severe case of one T1 line, some
inflorescences showed no flowers at all. Plants with a weak
phenotype showed only small patches of stigmatic tissue on sepals.
The floral phenotypes decreased acropetally. The plants showing the
strongest phenotypes were essentially sterile, and did not produce
T2 progeny for further analysis.
[0992] The phenotype produced by overexpressing G779 and G1499 was
similar in the aspects of flower structures. Cluster analysis using
basic helix-loop-helix motif revealed that both proteins of G779
and G1499 are closely related. The fact that expression of G779 was
induced by auxin treatment in the rosette leaves indicates that
G779 may play some kind of role in the auxin signal transduction
pathway.
[0993] Utilities.
[0994] G779 or its equivalogs could be used to modify plant
architecture and development, including flower structure. If
expressed under a flower-specific promoter, it might also be useful
for engineering male sterility. Because expression of G779 is
flower, embryo and silique specific, its promoter could be useful
for targeted gene expression in these organs.
G789 (SEQ ID NO: 539)
[0995] Published Information.
[0996] A partial sequence of G789 was identified from an EST clone
(GenBank accession number T41998).
[0997] Experimental Observations.
[0998] G789 was initially identified as a public EST (GenBank
accession number T41998) and subsequently a full length library
clone was identified. The function of G789 was analyzed using
transgenic plants in which G789 was expressed under the control of
the 35S promoter.
[0999] Overexpression of G789 reduced the time to flowering under
continuous light conditions; this phenotype was most prevalent in
the T2 generation and was noted in all three of the lines
analyzed.
[1000] Transgenic plants overexpressing G789 were more sensitive to
the herbicides glyphosate and acifluorfen and to oxidative stress
caused by rose bengal compared to wild-type controls. Furthermore,
G789 overexpressing lines were more susceptible to infection with
Sclerotinia sclerotiorum when tested as mixed lines in two repeat
experiments. This disease susceptibility phenotype did not repeat
when individual lines were tested. It is well known that oxidative
stress is a component of a plant defense response to pathogen and
therefore, the disease susceptibility phenotype could thus be
related to a general sensitivity to oxidative stress.
[1001] Based on the RT-PCR analysis, G789 was constitutively
expressed in all tissues; its expression level was unaffected by
any of the conditions tested.
[1002] Utilities.
[1003] Based on the current analysis of G789 overexpressing plants,
G789 or its equivalogs could be used to manipulate flowering
time.
Since G789 activity has been shown to be required for the
protection of Arabidopsis plants against oxidative stress, G789 or
its equivalogs could be used to manipulate defenses against abiotic
and biotic stresses such as disease, UV-B radiation, ozone
pollution and herbicide application.
G801 (SEQ ID NO: 549)
[1004] Published Information.
[1005] A partial sequence for G801 was identified from EST clones
(GenBank accession numbers N97289, H36373 and Z32574).
[1006] Experimental Observations.
[1007] G801 is a proprietary sequence initially identified as three
partial public ESTs (GenBank accession numbers N97289, H36373 and
Z32574). Subsequently, a full length library clone was identified.
The function of G801 was analyzed using transgenic plants in which
G801 was expressed under the control of the 35S promoter.
Morphological analysis revealed that a minority of primary
transformants of G801 were dark green and late flowering. However,
T2 lines derived from three late-flowering lines showed no
flowering time differences from control plants. Plant
overexpressing G801 showed more seedling vigor when germinated on
media containing high salt compared to wild-type control plants.
All three overexpressing lines showed similar degrees of tolerance.
In addition, overexpression of G801 in Arabidopsis resulted in an
increase in seed oil content. This phenotype was observed in a
single line.
[1008] Utilities.
[1009] The potential utilities of this gene or its equivalogs
include the ability to confer salt tolerance during the germination
stage of a crop plant. This would most likely impact survivability
and yield. Evaporation of water from the soil surface causes upward
water movement and salt accumulation in the upper soil layer, where
the seeds are placed. Thus, germination normally takes place at a
salt concentration much higher than the mean salt concentration in
the whole soil profile.
[1010] In addition, G801 or its equivalogs may be used to increase
seed oil in crop plants.
G849 (SEQ ID NO: 565)
[1011] Published Information.
[1012] The transcription factor G849 is an Arabidopsis homolog of
parsley BPF-1, a pathogen inducible DNA-binding protein. BPF-1,
Box-P Binding Factor 1, was reported by da Costa e Silva et al.
((1993) Plant Journal 4:125-135) to bind specifically to the P-box
sequence motif of the phenylalanine ammonia lyase promoter, a key
enzyme of the phenylpropanoid metabolism. G849 is found in the
sequence of chromosome 3, BAC T2E22 (GenBank AC069474.4
GI:12321944), released by the Arabidopsis Genome Initiative. The
start and stop codons were correctly predicted.
[1013] Experimental Observations.
[1014] NIR analyses performed on G849 knockout plants revealed
increased total combined seed oil and protein content.
[1015] RT-PCR analysis of the endogenous level of G849 transcripts
revealed high constitutive expression in all tissues examined, with
the exception of germinated seed. A detectable but low level of
G849 transcripts was observed in germinated seeds. G849 transcript
level increased significantly upon auxin, ABA, cold, heat and salt
treatment, as well as seven days post-inoculation with Erysiphe
orontii.
[1016] Utilities.
[1017] Based on the knockout analyses, G849 or its equivalogs may
be used to modify seed oil and protein content.
[1018] The null mutant of G849 had altered seed phytosterol
composition, a decease in .beta.-sitosterol, as well as changes in
leaf insoluble sugars. Phytosterols are an important source of
precursors for the manufacture of human steroid hormones by
semisynthesis. Sitosterols and stigmasterols, not campesterol, are
the preferred sources from seed crops. Phytosterols and their
hydrogenated derivatives phytostanols also have proven
cholesterol-lowering properties.
G859 (SEQ ID NO: 567)
[1019] Published Information.
[1020] G859 corresponds to MXK3.30 (BAB10332). The high level of
sequence similarity between G859 and FLOWERING LOCUS C (FLC;
Michaels et al. (1999) Plant Cell 11, 949-956; Sheldon et al.,
(1999) Plant Cell 11, 445-458) has been described previously
(Ratcliffe et al. (2001) Plant Physiol. 126:122-132). G859 has also
been referred to as AGL31 (Alvarez-Buylla et al. (2000) Plant J.
24:457-466).
[1021] Experimental Observations.
[1022] G859 was recognized as a gene highly related to Arabidopsis
FLC, and to MADS AFFECTING FLOWERING 1. FLC acts as a repressor of
flowering (Michaels (1999) Plant Cell 11, 949-956; Sheldon et al.
(1999) Plant Cell 11, 445-458). Similarly, G157/MAF1 can cause a
delay in flowering time when overexpressed (Ratcliffe et al. (2001)
Plant Physiol. 126:122-132).
[1023] The function of G859 was studied using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Overexpression of G859 modified the timing of flowering,
with very high levels of G859 activity delaying the floral
transition in the Columbia ecotype. No alterations were detected in
35S::G859 plants in the physiological and biochemical analyses that
were performed.
[1024] Under continuous light conditions, the majority of 35S::G859
primary transformants (overexpressing a construct containing a
full-length cDNA, P1688) were earlier flowering than wild-type
controls. This result was observed in multiple independent batches
of T1 plants and in either continuous or 12 hour light conditions.
However, in each selection of primary transformants, a small number
of lines were late flowering. RT-PCR analyses demonstrated that all
T1 plants overexpressed the transgene, but that the highest levels
of expression were found in the late flowering transformants.
Comparable results were also obtained when plants were transformed
with a construct (P376) containing a shorter splice-variant of
G859. The effects on flowering time caused by overexpression of
G859, and the dependence of those effects on the transgene
expression levels, mirror results previously obtained for G157/MAF1
(Ratcliffe et al. (2001) Plant Physiol. 126:122-132).
[1025] Seed was taken for T2 analyses from two late flowering
primary transformants, and a T1 plant that had been early
flowering. The progeny of the former two lines all appeared
markedly late flowering, while the T2 plants from the third line
were marginally late flowering. No convincing early flowering was
observed in any the three T2 populations. Thus, in the second
generation, the predominant effect of G859 activity was delayed
flowering. In a follow-up experiment it was found that late
flowering 35S::G859 T2 plants were photoperiod responsive, and were
not sensitive to extensive vernalization treatments.
Utilities
[1026] G859 or its equivalogs could be used to alter flowering
time.
G864 (SEQ ID NO: 573)
[1027] Published Information.
[1028] G864 was identified in an Arabidopsis EST (H37693). G864
appears as gene AT4g23750 in the annotated sequence of Arabidopsis
chromosome 4 (AL161560).
[1029] Experimental Observations.
[1030] G864 was discovered and initially identified as a public
Arabidopsis EST.
[1031] The complete sequence of G864 was determined, and G864 was
found to be related to two additional Arabidopsis AP2/EREBP genes,
G1421 and G1755. The function of G864 was analyzed using transgenic
plants in which this gene was expressed under the control of the
35S promoter. G864 overexpressing plants exhibited a variety of
phenotypic alterations. They were smaller than wild-type plants,
and those with the strongest phenotypes were classified as dwarf.
However, G864 overexpressing lines showed more seedling vigor in a
heat stress tolerance germination assay compared to wild-type
controls. Conversely, G864 overexpressing lines were also somewhat
more sensitive to chilling. One of the three T2 lines analyzed
showed significant increase in fucose and arabinose levels in
leaves.
[1032] G864 was ubiquitously expressed, and was not significantly
induced under any of the conditions tested.
[1033] Utilities.
[1034] The germination of many crops is very sensitive to
temperature. A gene that would enhance germination in hot
conditions such as G864 or its equivalogs would be useful for crops
that are planted late in the season or in hot climates.
G867 (SEQ ID NO: 579)
[1035] Published Information.
[1036] G867 corresponds to RAV1 (Kagaya et al. (1999) Nucleic Acids
Res. 27: 470-478). G867/RAV1 belongs to a small subgroup within the
AP2/EREBP family of transcription factors, whose distinguishing
characteristic is that its members contain a second DNA-binding
domain, in addition to the conserved AP2 domain, that is related to
the B3 domain of VP1/ABI3 (Kagaya et al. (1999) supra). It has been
shown that the two DNA-binding domains of RAV1 can separately
recognize each of two motifs that constitute a bipartite binding
sequence and together cooperatively enhance its DNA-binding
affinity and specificity (Kagaya et al. (1999) supra).
[1037] Experimental Observations.
[1038] G867 was discovered and initially identified as a public
Arabidopsis EST. G867 appeared to be constitutively expressed at
medium levels.
[1039] G867 was first characterized using a line that contained a
T-DNA insertion in the gene. The insertion in that line resided
immediately downstream of the conserved AP2 domain, and would
therefore be expected to result in a severe or null mutation. G867
knockout mutant plants did not show significant changes in overall
plant morphology, significant differences between these plants and
control plants have not been detected in any of the assays that
have been performed so far.
[1040] Subsequently, the function of G867 was analyzed using
transgenic plants in which this gene was expressed under the
control of the 35S promoter. G867 overexpressing lines were
morphologically wild-type and no phenotypic alterations in G867
overexpressing lines were detected in the biochemical assays that
were performed. However, G867 overexpressing lines showed increased
seedling vigor (manifested by increased expansion of the
cotyledons) in germination assays on both high salt and high
sucrose containing media, compared to wild-type controls.
[1041] The Arabidopsis paralogs G1930 (SEQ ID NO: 1893) and G9 (SEQ
ID NO: 14) also showed stress related phenotypes. G9 exhibited
increased root biomass, and thus could be used to produce better
plant growth under adverse osmotic conditions. Genetic and
physiological evidence indicates that roots subjected to various
stresses, including water deficit, alter the export of specific
compounds, such as ACC and ABA, to the shoot, via the xylem
Bradford et al. (1980) Plant Physiol. 65: 322-326; Schurr et al.
(1992) Plant Cell Environ. 15, 561-567).
[1042] G1930 plants responded to high NaCl and high sucrose on
plates with more seedling vigor, and root biomass compared to
wild-type control plants; this phenotype was identical to that seen
in 35S::G867 lines. These results indicate a general involvement of
this clade in abiotic stress responses:
[1043] The polypeptide sequences of G1930 and G9 share 72% (249/345
residues) and 64% (233/364 residues) with G867, respectively. The
conserved domains of G1930 and G9 are 86% (56/65 residues) and 86%
(56/65 residues) identical with the conserved domain of G867,
respectively.
[1044] Utilities.
[1045] G867 or its equivalogs could be used to increase or
facilitate seed germination and seedling growth under adverse
environmental conditions, in particular salt stress.
[1046] G867 or its equivalogs may also be used to modify sugar
sensing.
G869 (SEQ ID NO: 581)
[1047] Published Information.
[1048] A partial cDNA sequence of G869 is available as public ESTs
N65486. The sequence of G869 later appeared among the Arabidopsis
sequences released by the Arabidopsis Genome Initiative, in BAC
T26J14 (GenBank accession number AC011915).
[1049] Experimental Observations.
[1050] The complete cDNA sequence of G869 was determined The
function of this gene was analyzed using transgenic plants in which
G869 was expressed under the control of the 35S promoter. Plants
overexpressing G869 were small with spindly bolts. G869 transgenic
plants showed alterations in leaf and seed fatty acid composition.
In leaves, 16:0 levels decreased and 16:3 levels increased. These
changes likely reflected alterations in the desaturation state of
chloroplast membranes. In seeds, 18:1 levels increased
significantly. The increase in the seed 18:1 fatty acid in two
lines was observed in a repeat experiment. A decrease in 18:3 and
20:0 was also noted in these lines.
[1051] Alterations in the levels of leaf insoluble sugars were also
detected, with the increase in fucose determined to be significant.
In addition, G869 overexpressors were more tolerant to infection
with a moderate dose of the fungal pathogen Erysiphe orontii. The
increase in resistance phenotype co-segregated with the dwarf
phenotype. G869 plants showed additional morphological alterations,
including poor fertility due to underdeveloped anthers.
[1052] Utilities.
[1053] G869 or its equivalogs could be useful to manipulate the
saturation levels of lipids in seeds. Alteration in seed lipid
saturation could be used to improve the heat stability of oils or
to improve the nutritional quality of seed oil.
As G869 transgenic plants have an altered response to the fungal
pathogen Erysiphe orontii, G869 or its equivalogs could be used to
manipulate the defense response in order to generate
pathogen-resistant plants.
G877 (SEQ ID NO: 583)
[1054] Published Information.
[1055] G877 was identified in an Arabidopsis EST (N37131). G877 is
contained in P1 clone MXK23 (GenBank accession number
AB026656).
[1056] Closely Related Genes from Other Species.
[1057] A non-Arabidopsis gene closely related to G877 is the
tobacco gene NtWRKY4 (GenBank accession number AB026890) Similarity
between these two genes extends beyond the conserved WRKY
domain.
[1058] Experimental Observations.
[1059] G877 was first discovered and identified as a public
Arabidopsis EST. The complete sequence of G877 was determined.
[1060] A line was identified that contains a T-DNA insertion in the
coding sequence of G877. The insertion likely resulted in a null
mutation, since it resided upstream of the conserved WRKY domain
sequence. Plants that were hemizygous for that insertion segregate
3 viable: 1 nonviable seeds in the silique, and homozygous G877
knockout mutant plants were never obtained. Therefore, a (null)
mutation in G877 results in embryo lethality.
[1061] G877 was ubiquitously expressed. G877 is likely to be
involved in controlling some essential process(es) required for
growth rather than specific aspects of embryo patterning and
development. Alternatively, G877 might play different roles
throughout the plant life cycle.
[1062] Utilities.
[1063] The embryo lethal phenotype of a G877 mutation indicates
that the gene is involved in the control of some essential aspect
of growth and development. G877 or its equivalogs could therefore
constitute an herbicide target, either by itself or by allowing the
identification of other genes or processes essential for plant
growth.
G881 (SEQ ID NO: 587)
[1064] Published Information.
[1065] G881 corresponds to gene F28M20.10, first identified in the
sequence of BAC clone F28M20 (released by the Arabidopsis Genome
Initiative; GenBank accession number AL031004).
[1066] Experimental Observations.
[1067] The complete cDNA sequence for G881 was determined The
annotation in GenBank for this gene (BAC AL031004) was found to be
inaccurate. G881 was ubiquitously expressed, but appeared to be
significantly induced in response to salicylic acid treatment. The
function of this gene was analyzed using transgenic plants in which
G881 was expressed under the control of the 35S promoter. G881
overexpressors appeared to be more susceptible to infection with a
moderate dose of the fungal pathogen Erysiphe orontii. Increased
susceptibility to Erysiphe orontii was confirmed in repeat
experiment. The induction of G881 expression by SA also implicated
G881 in the disease response.
[1068] Utilities.
[1069] Since G881 transgenic plants appear to have an altered
response to the fungal pathogen Erysiphe orontii, G881 or its
equivalogs could be used to manipulate the defense response in
order to generate pathogen-resistant plants.
G896 (SEQ ID NO: 595)
[1070] Published Information.
[1071] G896 was identified in the sequence of BAC T7123, GenBank
accession number U89959, released by the Arabidopsis Genome
Initiative. Part of the G896 sequence was first identified as an
MSU EST (T45249). There is no other published or public information
about G896
[1072] Closely Related Genes from Other Species.
[1073] G896 is very similar to a peppermint EST (AW255156). Since
the homology extends beyond the conserved domain, G896 and the mint
gene are likely orthologs.
[1074] Experimental Observations.
[1075] A knock-out mutant was isolated, which contains a T-DNA
insertion 40 base pairs downstream of the start codon. G896
knock-out plants were more susceptible to Fusarium oxysporum. In
addition, G896 knockout plants had lower levels of lutein in seeds
as compared to wild-type control plants. Otherwise, the knock-out
plants had a wild-type morphological phenotype.
[1076] In wild-type plants, G896 was mostly expressed in roots.
Changes in environmental conditions did not affect its
expression.
[1077] Utilities.
[1078] Since G896 transgenic plants have an altered response to the
fungal pathogen Fusarium oxysporum, the gene or its equivalogs
could be used to manipulate the defense response in order to
generate pathogen-resistant plants.
G911 (SEQ ID NO: 613) Closely Related Genes from Other Species
[1079] An EST (GenBank accession AI352907) induced in the defense
response of Brassica napus to Leptosphaeria macularis has extremely
high homology both within and external to the conserved RING H2
domain.
[1080] Experimental Observations.
[1081] The function of G911 was analyzed through its ectopic
overexpression in Arabidopsis. RT-PCR of endogenous levels of G911
indicated this gene was expressed in all tissues tested. A cDNA
array experiment confirmed this tissue distribution data by RT-PCR.
Microarray data confirmed that G911 was overexpressed 23 fold.
Other genes that were induced when G911 was overexpressed included
RHA1b (another RING C2H3C2 transcription factor), pistilata, and a
proline rich protein isolog. Plants overexpressing G911 looked
healthier and had longer roots when grown on media lacking
potassium compared to wild-type plants.
[1082] Utilities.
[1083] Plants overexpressing G911 or its equivalogs may be able to
be grown with fertilizer lacking or containing low potassium.
G912 (SEQ ID NO: 615)
[1084] Published Information.
[1085] G912 was identified in the sequence of P1 clone MSG15
(GenBank accession number AB015478; gene MSG15.6).
[1086] Closely Related Genes from Other Species.
[1087] G912 is closely related to CBF1, CBF2, and CBF3, and also
closely related to the members of the CBF-like subgroup of
AP2/EREBP proteins from other plants, like AF084185 Brassica napus
dehydration responsive element binding protein.
[1088] Experimental Observations.
[1089] G912 was recognized as the AP2/EREBP gene most closely
related to Arabidopsis CBF1, CBF2, and CBF3 (Stockinger et al
(1997) Proc. Natl. Acad. Sci. USA 94:1035-1040; Gilmour et al.
(1998) Plant J. 16:433-442). In fact, G912 is the only other
AP2/EREBP transcription factor for which sequence similarity with
CBF1, CBF 2, and CBF3 extends beyond the conserved AP2 domain.
[1090] The function of G912 was studied using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Plants overexpressing G912 were more freezing and drought
tolerant than the wild-type controls, but were also small, dark
green, and late flowering. There was a positive correlation between
the degree of growth impairment and the freezing tolerance. In
addition, G912 expression appeared to be induced by cold, drought,
and osmotic stress.
[1091] These results mirror the extensive body of work that has
shown that CBF1, CBF2, and CBF3 are involved in the control of the
low-temperature response in Arabidopsis, and that those genes can
be used to improve freezing, drought, and salt tolerance in plants
(Stockinger et al., (1997) Proc. Natl. Acad. Sci. USA 94:1035-1040;
Gilmour et al. (1998) Plant J. 16:433-442; Jaglo-Ottosen et al.
(1998) Science. 280:104-106; Liu et al. (1998) Plant Cell.
10:1391-1406, Kasuga et al. (1999) Nat. Biotechnol.
17:287-291).
[1092] The polypeptide sequences of G40, G41, and G42 share 71%
(140 of 195 residues), 68% (144 of 211 residues), and 65% (147 of
224 residues) identity with G912, respectively. The conserved
domains of G40, G41, and G42 share 94% (64 of 68 residues), 92% (63
of 68 residues), and 94% (64 of 68 residues) identity with G912,
respectively
[1093] In addition, G912 overexpressing plants also exhibited a
sugar sensing phenotype: reduced seedling vigor and cotyledon
expansion upon germination on high glucose media.
[1094] Utilities.
[1095] G912 or its equivalogs could be used to improve plant
tolerance to cold, freezing, drought, and salt stress.
G961 (SEQ ID NO: 633)
[1096] Published Information.
[1097] G961 was first identified in the sequence of the BAC clone
F19D11, GenBank accession number AC005310, released by the
Arabidopsis Genome Initiative.
[1098] Closely Related Genes from Other Species.
[1099] The most related gene to G961 is a rice gene in accession
number BAA84803.
[1100] Experimental Observations.
[1101] The full length sequence of G961 was experimentally
confirmed. The function of this gene was analyzed by knockout
analysis. Plants homozygous for a T-DNA insertion in G961 were
wild-type for all assays performed.
[1102] Gene expression profiling by RT-PCR showed that G961 was
primarily expressed in shoots, embryos and siliques at medium
levels, and at low levels in flowers. RT-PCR data also indicated an
induction of G961 transcripts accumulation upon heat treatment.
[1103] G961 knockout mutants were found to have altered seed oil
content as compared to wild-type plants.
[1104] Utilities.
[1105] G961 or its equivalog knockout mutants may be used to alter
seed oil content in plants, which may be very important for the
nutritional value and production of various food products.
G971 (SEQ ID NO: 639)
[1106] Published Information.
[1107] G971 corresponds to gene F28P10.30 (CAB41085).
[1108] Experimental Observations.
[1109] The function of G971 was studied using transgenic plants in
which the gene was expressed under the control of the 35S
promoter.
[1110] Overexpression of G971 produced a marked delay in the
transition to flowering. The effect was noted, to varying extents,
in approximately half of the 35S::G971 primary transformants. These
plants flowered between one and three weeks later than controls
under continuous light conditions. At later stages, most of the
plants also appeared darker green and developed larger leaves than
controls. Two of the three T2 populations selected for further
study displayed a comparable, but rather more extreme late
flowering phenotype to that seen in the parental plants. At early
stages, seedlings from these two lines were relatively small, but
recovered as development progressed, and eventually became larger
than wild type. No alterations were detected in 35S::G971 plants in
the physiological and biochemical analyses that were performed.
[1111] G971 was ubiquitously expressed and does not appear to be
significantly induced by any of the conditions tested.
[1112] Utilities.
[1113] G971 or its equivalogs could be used to modify flowering
time characteristics. A wide variety of applications exist for
systems that either lengthen or shorten the time to flowering.
[1114] In species such as sugarbeet where the vegetative parts of
the plants constitute the crop and the reproductive tissues are
discarded, it would be advantageous to delay or prevent flowering.
Extending vegetative development could bring about large increases
in yields.
G974 (SEQ ID NO: 641)
[1115] Published Information.
[1116] G974 was first identified in a BAC-end sequence (B28553;
partial G974 sequence). G974 corresponds to gene F16L1.8 (BAC
F16L1, AC024228).
[1117] Closely Related Genes from Other Species.
[1118] Several AP2 proteins from a variety of species (Atriplex
hortensis, Lycopersicon esculentum, Glycine max, Populus
balsamifera, Medicago truncatula) exhibited sequence similarity
with G974 outside of the signature AP2 domain sequence, and bear
nearly identical AP2 domains. These proteins may be related.
[1119] Experimental Observations.
[1120] The complete sequence of G974 was obtained and G974 was
studied using transgenic plants in which G974 was expressed under
the control of the 35S promoter. Constitutive expression of G974
produced deleterious effects: the majority of 35S::G974 primary
transformants showed a reduction in overall size and developed
rather slowly compared to wild-type controls. These phenotypic
alterations were not observed in the T2 generation, perhaps
indicating silencing of the transgene. The T2 plants were wild-type
in the physiological and biochemical analyses performed. G974 was
ubiquitously expressed.
[1121] 35S::G974 overexpressors had altered seed oil content.
[1122] Utilities.
[1123] G974 or its equivalogs may be used to alter seed oil content
in plants, which may be very important for the nutritional value
and production of various food products.
G975 (SEQ ID NO: 643)
[1124] Published Information.
[1125] G975 has appeared in the sequences released by the
Arabidopsis Genome Initiative (BAC F9L1, GenBank accession number
AC007591).
[1126] Closely Related Genes from Other Species.
[1127] The non-Arabidopsis gene most highly related to G975 is
represented by L46408 BNAF1258 Mustard flower buds Brassica rapa
cDNA clone F1258. The similarity between G975 and the Brassica rapa
gene represented by EST L46408 extends beyond the conserved AP2
domain that characterizes the AP2/EREBP family. This Brassica rapa
gene appeared to be more closely related to G975 than Arabidopsis
G1387, indicating that EST L46408 may represent a true G975
ortholog. The similarity between G975 and Arabidopsis G1387 also
extends beyond the conserved AP2 domain.
[1128] Experimental Observations.
[1129] G975 was identified as a new member of the AP2/EREBP family
(EREBP subfamily) of transcription factors. G975 was expressed in
flowers and, at lower levels, in shoots, leaves, and siliques.
GC-FID and GC-MS analyses of leaves from G975 overexpressing plants
showed that the levels of C29, C31, and C33 alkanes were
substantially increased (up to ten-fold) compared with control
plants. A number of additional compounds of similar molecular
weight, presumably also wax components, also accumulated to
significantly higher levels in G975 overexpressing plants. C29
alkanes constituted close to 50% of the wax content in wild-type
plants (Millar et al. (1998) Plant Cell 11:1889-1902), suggesting
that a major increase in total wax content occurred in the G975
transgenic plants. However, the transgenic plants had an almost
normal phenotype (although small morphological differences were
detected in leaf appearance), indicating that overexpression of
G975 was not deleterious to the plant. Overexpression of G975 did
not cause the dramatic alterations in plant morphology that had
been reported for Arabidopsis plants in which the FATTY ACID
ELONGATION1 gene was overexpressed (Millar et al. 1998, Plant Cell
11:1889-1902). G975 may regulate the expression of some of the
genes involved in wax metabolism. One Arabidopsis AP2 sequence
(G1387) that is significantly more closely related to G975 than the
rest of the members of the AP2/EREBP family is predicted to have a
function and a use related to that of G975.
[1130] Utilities.
[1131] G975 or its equivalogs can be used to manipulate wax
composition, amount, or distribution, which in turn can modify
plant tolerance to drought and/or low humidity or resistance to
insects, as well as plant appearance (shiny leaves).
[1132] G975 or its equivalogs can also be used to specifically
alter wax composition, amount, or distribution in those plants and
crops from which wax is a valuable product.
G979 (SEQ ID NO: 649)
[1133] Published Information.
[1134] G979 was first identified in a BAC-end sequence (B25031;
partial G979 sequence). G979 corresponds to gene T12E18.sub.--20
(BAC T12E18, AL132971). No information is available about the
function(s) of G979.
[1135] Experimental Observations.
[1136] The complete sequence of G979 was obtained. The function of
this gene was studied using both transgenic plants in which G979
was expressed under the control of the 35S promoter (April 2001),
and a line with a T-DNA insertion in the gene. G979 codes for an
AP2 protein of the AP2 subfamily, i.e., it contains two AP2
domains. The T-DNA insertion of the KO line lies in an intron,
located in between the exons coding for the second AP2 domain of
the protein, and is thus expected to result in a strong or null
mutation. Whereas constitutive expression of G979 produced
deleterious effects, the analysis of G979 KO mutant plants proved
informative about the function of the gene. It was suggested that
proteins of the AP2 subfamily were more likely to be involved in
developmental processes (Riechmann et al. (1998). Biol. Chem. 379:
633-646). Fittingly, seeds homozygous for a T-DNA insertion within
G979 showed delayed ripening, slow germination, and developed into
small, poorly fertile plants, indicating that G979 is involved in
seed development processes.
[1137] The difficulty in initially isolating, from heterozygous
plants, progeny that was homozygous for the T-DNA insertion raised
the possibility that homozygosity for that allele was lethal.
Siliques of heterozygous plants were examined for seed
abnormalities. Approximately 25% of the seeds contained in young
green siliques were pale in coloration. In older, brown siliques,
approximately 25% of the seeds were green and appeared slow
ripening, whereas the remaining seeds were brown. Thus, it seemed
likely that the seeds with altered development were homozygous for
the T-DNA insertion, whereas the normal seeds were wild-type and
heterozygous segregants.
[1138] Furthermore, it was observed that approximately 25% of the
seed from G979 knockout heterozygous plants showed impaired
(delayed) germination. Upon germination, these seeds produced
extremely tiny seedlings that often did not survive
transplantation. A few small and sickly looking homozygous plants
could be grown, which produced siliques that contained seeds that
were small and wrinkled compared to wild type.
[1139] A second, different, T-DNA insertion allele for G979 was
identified as part of a TAIL PCR screen. Progeny of the
heterozygous plant carrying that T-DNA insertion was either
wild-type or heterozygous for the mutation, providing additional
evidence for the disruption of G979 being the cause of the
phenotypic alterations detected.
[1140] The initial analysis of the gene was performed using
overexpressing lines. 35S::G979 transformants were generally
smaller than wild type and developed spindly inflorescences that
carried abnormal flowers with compromised fertility.
[1141] G979 expression was ubiquitous and not induced under any of
the conditions tested.
[1142] Utilities.
[1143] On the basis of the results obtained with G979 knockout
mutant lines, it is possible that G979 or its equivalogs could be
used to alter or modify seed germination, ripening and development
properties and performance.
G987 (SEQ ID NO: 653)
[1144] Published Information.
[1145] The genomic sequence of G987 is located on the Arabidopsis
BAC clone T914 (gene T914.14) (GenBank accession number
AC005315).
[1146] Experimental Observations.
[1147] As determined by RT-PCR analysis, G987 was constitutively
expressed in all tissues tested. A line homozygous for a T-DNA
insertion in G987 was used to determine the function of this gene.
The T-DNA insertion in G987 was approximately 4% into the coding
sequence of the gene, and therefore is likely to result in a null
mutation. G987 mutant plants could only be grown on
sucrose-containing medium. Biochemical analyses of leaves from G987
mutants grown on sucrose-containing medium indicate that the
mutants had reduced amounts of 16:3 fatty acids, the presence of
two xanthophylls which were not present in wild-type leaves, the
presence of .gamma.-tocopherol (which normally accumulates in seed
tissue), and reduced levels of chlorophyll a and chlorophyll b.
[1148] Utilities.
[1149] The low amount of 16:3 and dramatic reduction in chlorophyll
indicated that the gene controls some aspect of thylakoid membrane
development. G987 or its equivalogs may control proplastid to
chloroplast development. This could be tested by measuring the
expression of some of the genes (e.g. LHCP) that are associated
with the transition from proplastid to chloroplast. If this were
the case, the gene or its equivalogs may be useful for controlling
the transition from proplastid to chromoplast in fruits and
vegetables. There may also be some applications where it would be
desirable to change the expression of the gene or its equivalogs
(e.g., prevent cotyledon greening in Brassica napus or campestris
to avoid green oil due to early frost).
G1052 (SEQ ID NO: 699)
[1150] Published Information.
[1151] G1052 was identified in the sequence of BAC F9D24, GenBank
accession number AL137081, released by the Arabidopsis Genome
Initiative.
[1152] Closely Related Genes from Other Species.
[1153] G1052 is similar to a rice gene BAA96162. Homology between
G1052 and the rice gene extends beyond the conserved domain, thus
the two genes may be orthologous.
[1154] Experimental Observations.
[1155] The boundaries of G1052 in BAC AL137081 were experimentally
determined and the function of G1052 was analyzed using transgenic
plants in which this gene was expressed under the control of the
35S promoter. Plants overexpressing G1052 exhibited a delay in
flowering and typically produced flower buds about one week later
than controls in continuous light conditions. Additionally, these
plants had larger leaves and were generally more sturdy than wild
type.
[1156] A line homozygous for a T-DNA insertion in G1052 was also
used to determine the function of this gene. The T-DNA insertion of
G1052 was approximately one third of the way into the coding
sequence of the gene and therefore is likely to result in a null
mutation. A decrease in the percentage of lutein and increase in
the xanthophyll 1 fraction was detected in one line in two
experiments.
[1157] Utilities.
[1158] The flowering time phenotype associated with G1052
over-expression indicates a utility for G1052 or its equivalogs as
genes that can be used to manipulate flowering time in commercial
plants. In addition, if the G1052 can not be transmitted through
pollen, G1052 or its equivalogs may be used as a tool for
preventing transgenes from escaping from transgenic plants through
pollen dispersal.
[1159] G1052 or its equivalogs could be used to manipulate seed
prenyl lipid composition. Lutein is an important nutraceutical,
since lutein-rich diets have been shown to help prevent age-related
macular degeneration (ARMD), which is the leading cause of
blindness in people over the age of 65. In particular, consumption
of dark green leafy vegetables has been shown in clinical studies
to reduce the risk of ARMD. In addition, lutein, like other
xanthophylls such as zeaxanthin and violaxanthin, is an essential
component in the protection of the plant against the damaging
effects of excessive light. Specifically, lutein contributes,
directly or indirectly, to the rapid rise of nonphotochemical
quenching in plants exposed to high light. Crop plants engineered
to contain higher levels of lutein could therefore have improved
photoprotection, possibly leading to less oxidative damage and
better growth under high light.
G1062 (SEQ ID NO: 713)
[1160] Published Information.
[1161] G1062 corresponds to gene MLJ15.14 (BAB01738.1).
[1162] Closely Related Genes from Other Species.
[1163] G1062 protein shares extensive homology in the basic helix
loop helix region with a cDNA from developing stem Medicago
truncatula (AW691174) as well as a tomato shoot/meristem
Lycopersicon esculentum cDNA (BG123327).
[1164] Experimental Observations.
[1165] G1062 is a proprietary sequence initially identified from a
library clone. The function of G1062 was analyzed by knockout
analysis. The T-DNA insertion of G1062 was approximately 75% into
the coding sequence of the gene and therefore is likely to result
in a null mutation.
[1166] Homozygotes for a T-DNA insertion in G1062 showed slow
growth and produced abnormal seeds. Knockout.G1062 plants displayed
a longer leaf plastochron than wild type. Both generated flower
buds at the same time, but wild-type plants had produced 9-11
rosette leaves at that point, compared to only 5-9 rosette leaves
in the mutant (24 hour light). Following bolting, KO.G1062
inflorescences developed more slowly and were shorter than wild
type. Knockout G1062 seeds appeared twisted and wrinkled in
comparison to wild-type seed.
[1167] Physiological assays revealed that seedlings from a G1062
knockout mutant line have a light grown phenotype in the dark and
were more severely stunted in an ethylene insensitivity assay when
compared to the wild-type controls. This result indicated that
G1062 may be involved in the ethylene triple response pathway. It
is well known that ethylene is involved in the seed ripening
process and therefore, the abnormal seed phenotype could be related
to a general sensitivity to ethylene signal transduction
pathway.
[1168] RT-PCR analysis indicated that the transcripts of G1062 were
predominantly accumulated in the reproductive tissues. Its
expression level appeared to be not affected by any treatments
tested.
[1169] Utilities.
[1170] G1062 or its equivalogs that alter seed shape are likely to
provide ornamental applications.
[1171] Since G1062 is involved in the ethylene triple response
pathway, G1062 could be used to manipulate seed or fruit ripening
process, and to improve seed or fruit quality.
G1069 (SEQ ID NO: 721)
[1172] Published Information.
[1173] The sequence of G1069 was obtained from EU Arabidopsis
sequencing project, GenBank accession number Z97336, based on its
sequence similarity within the conserved domain to other AT-Hook
related proteins in Arabidopsis.
[1174] Closely Related Genes from Other Species.
[1175] G1069 protein shares a significant homology to a cDNA
isolated from Lotus japonicus nodule library. Similarity between
G1069 and the Lotus cDNA extends beyond the signature motif of the
family to a level that would suggest the genes are orthologous.
Therefore the gene represented by EST AW720668 may have a function
and/or utility similar to that of G1069.
[1176] Experimental Observations.
[1177] The sequence of G1069 was experimentally determined and the
function of G1069 was analyzed using transgenic plants in which
G1069 was expressed under the control of the 35S promoter.
[1178] Plants overexpressing G1069 showed changes in leaf
architecture, reduced overall plant size, and retarded progression
through the life cycle. This is a common phenomenon for most
transgenic plants in which AT-HOOK proteins are overexpressed if
the gene is predominantly expressed in root in the wild-type
background. G1069 was predominantly expressed in roots, based on
analysis of RT-PCR results. To minimize these detrimental effects,
G1069 may be overexpressed under a tissue specific promoter such as
root- or leaf-specific promoter or under inducible promoter.
[1179] One of G1069 overexpressing lines showed more tolerance to
osmotic stress when they were germinated in high sucrose plates.
This line also showed insensitivity to ABA in a germination
assay.
[1180] Utilities.
[1181] The osmotic stress results indicate that G1069 could be used
to alter a plant's response to water deficit conditions and,
therefore, the gene or its equivalogs could be used to engineer
plants with enhanced tolerance to drought, salt stress, and
freezing.
[1182] G1069 affects ABA sensitivity, and thus when transformed
into a plant the gene or its equivalogs may diminish cold, drought,
oxidative and other stress sensitivities, and also be used to alter
plant architecture, and yield.
G1073 (SEQ ID NO: 723)
[1183] Published Information.
[1184] G1073 has been identified in the sequence of a BAC clone
from chromosome 4 (BAC clone F23E12, gene F23E12.50, GenBank
accession number AL022604), released by EU Arabidopsis Sequencing
Project.
[1185] Closely Related Genes from Other Species.
[1186] G1073 has similarity to Medicago truncatula cDNA clones
(GenBank accession number AW574000 and AW560824) and Glycine max
cDNA clones (AW349284 and AI736668) in the database.
[1187] Experimental Observations.
[1188] The function of G1073 was analyzed using transgenic plants
in which G1073 was expressed under the control of the 35S promoter.
Transgenic plants overexpressing G1073 were substantially larger
than wild-type controls, with at least a 60% increase in biomass.
The increased mass of 35S::G1073 transgenic plants was attributed
to enlargement of multiple organ types including leaves, stems,
roots and floral organs. Petal size in the 35S::G1073 lines was
increased by 40-50% compared to wild type controls. Petal epidermal
cells in those same lines were approximately 25-30% larger than
those of the control plants. Furthermore, 15-20% more epidermal
cells per petal were produced compared to wild type. Thus, at least
in petals, the increase in size was associated with an increase in
cell size as well as in cell number. Additionally, images from the
stem cross-sections of 35S::G1073 plants revealed that cortical
cells are large and that vascular bundles contained more cells in
the phloem and xylem relative to wild type
[1189] Seed yield was increased compared to control plants.
55::G1073 lines showed an increase of at least 70% in seed yield.
This increased seed production was associated with an increased
number of siliques per plant, rather than seeds per silique.
[1190] Flowering of G1073 overexpressing plants was delayed. Leaves
of G1073 overexpressing plants were generally more serrated than
those of wild-type plants. Improved drought tolerance was observed
in 35S::G1073 transgenic lines.
[1191] Utilities.
[1192] Transgenic plants overexpressing G1073 are large and late
flowering with serrated leaves. Large size and late flowering
produced as a result of G1073 or equivalog overexpression would be
extremely useful in crops where the vegetative portion of the plant
is the marketable portion (often vegetative growth stops when
plants make the transition to flowering). In this case, it would be
advantageous to prevent or delay flowering with the use of this
gene or its equivalogs in order to increase yield (biomass).
Prevention of flowering by this gene or its equivalogs would be
useful in these same crops in order to prevent the spread of
transgenic pollen and/or to prevent seed set. This gene or its
equivalogs could also be used to manipulate leaf shape.
G1075 (SEQ ID NO: 725)
[1193] Published Information.
[1194] The sequence of G1075 was obtained from the Arabidopsis
genome sequencing project, GenBank accession number AC004667, based
on its sequence similarity within the conserved domain to other
AT-Hook related proteins in Arabidopsis.
[1195] Closely Related Genes from Other Species.
[1196] G1075 is homologous to a Medicago truncatula cDNA clone
(acc#AW574000
[1197] Experimental Observations.
[1198] The function of G1075 was analyzed using transgenic plants
in which G1075 was expressed under the control of the 35S promoter.
Overexpression of G1075 produced very small, sterile plants.
Pointed leaves were noted in some seedlings, and twisted or curled
leaves and abnormal leaf serrations were noted in rosette stage
plants. Bolts were short and thin with short internodes. Flowers
from severely affected plants had reduced or absent petals and
stamen filaments that partially or completely fail to elongate.
Because of the severe phenotypes of these T1 plants, no T2 seed was
produced for physiological and biochemical analysis.
[1199] RT-PCR analysis indicated that G1075 transcripts are found
primarily in roots. The expression of G1075 appeared to be induced
by cold and heat stresses.
[1200] Utilities.
[1201] G1075 or its equivalogs could be used to modify plant
architecture and development, including flower structure. If
expressed under a flower-specific promoter, the gene or its
equivalogs might also be useful for engineering male sterility.
Because expression of G1075 is root specific, its promoter could be
useful for targeted gene expression in this tissue.
G1089 (SEQ ID NO: 731)
[1202] Published Information.
[1203] G1089 was initially identified as a gene represented by
Arabidopsis EST H37430. Subsequently, the entire sequence of G1089
was identified in BAC F19K6, GenBank accession number AC037424,
released by the Arabidopsis genome initiative.
[1204] Closely Related Genes from Other Species.
[1205] The most related gene to G1089 is a rice gene represented by
NCBI entry g13124871 Similarity between G1089 and the rice gene
extends beyond the signature motif of the family to a level that
would suggest the genes are orthologous. Therefore the gene
represented by the rice gene may have a function and/or utility
similar to that of G1089
[1206] Experimental Observations.
[1207] The boundaries of G1089 were experimentally determined and
the function of G1089 was analyzed using transgenic plants in which
this gene was expressed under the control of the 35S promoter.
G1089 overexpressing plants had reduced seedling vigor and were
characterized as being small, yellow and sickly looking. In
addition, a T-DNA knockout of G1089 was isolated. G1089 knockout
mutant plants showed more tolerance to osmotic stress in a
germination assay in two separate experiments. They showed more
seedling vigor than wild-type control when germinated on plates
containing high sucrose. G1089 appeared to be constitutively
expressed.
[1208] Utilities.
[1209] The osmotic stress results indicate that G1089 or its
equivalogs could be used to alter a plant's response to water
deficit conditions and, therefore, may be used to engineer plants
with enhanced tolerance to drought, salt stress, and freezing.
G1134 (SEQ ID NO: 741)
[1210] Published Information.
[1211] A partial sequence of G1134 was identified from an EST clone
(GenBank accession number AI099951).
[1212] Experimental Observations.
[1213] A partial sequence of G1134 was identified from an EST clone
(GenBank accession number AI099951). The 5' end of the G1134 coding
sequence was determined by RACE. The function of G1134 was analyzed
using transgenic plants in which G1134 was expressed under the
control of the 35S promoter. Primary transformants of G1134 were
small with strongly curled leaves. In the T2 generation, two lines
had narrow, somewhat curled leaves and siliques with altered shape.
A third line segregated for small size. Additionally, plants
overexpressing G1134 showed an altered response to the growth
hormone ethylene. Seeds that were germinated on ACC plates in the
dark had longer hypocotyls than the corresponding controls and
occasionally lacked the apical hook that is part of a typical
ethylene triple response. In addition, seeds from all lines
germinated in the dark have a partial light grown phenotype in that
their cotyledons are open and the hypocotyl is straight instead of
curled.
[1214] The results from morphological and physiological analysis
indicated that G1134 protein may play important roles in the
regulation of ethylene biosynthesis, ethylene signal transduction
pathways, or photomorphogenesis. Analysis of G1134 overexpressors
revealed no apparent biochemical changes when compared to wild-type
control plants. Analysis of the endogenous expression level of
G1134, as determined by RT-PCR, revealed that G1134 was
predominantly expressed in flower tissues. Expression of G1134 was
not induced by any of the environmental conditions or pathogens
tested.
[1215] Utilities.
[1216] G1134 or its equivalogs could be used to alter how plants
respond to ethylene and/or light. For example, it could be used to
manipulate fruit ripening.
G1198 (SEQ ID NO: 763)
[1217] Published Information.
[1218] The entire sequence of G1198 was reported in BAC T23G18,
accession number AC011438, released by the Arabidopsis genome
initiative.
[1219] Closely Related Genes from Other Species.
[1220] G1198 is very similar to the tobacco bZIP transcription
factor TGA2.2 (accession number AF031487) Similarity extends well
beyond the conserved domain, suggesting that G1198 and TGA2.2 have
similar functions.
[1221] Experimental Observations.
[1222] The boundaries of G1198 were experimentally determined and
the function of G1198 was analyzed using transgenic plants in which
this gene was expressed under the control of the 35S promoter.
G1198 overexpressing plants were reduced in size with smaller,
narrower leaves and had significantly increased levels of a
glucosinolate as compared to wild type. G1198 did not appear to be
expressed in rosette leaves, but was expressed in other
tissues.
[1223] G1198 overexpressing plants were found to have increased
seed oil content, as compared to wild-type plants.
[1224] Utilities.
[1225] G1198 or equivalog overexpression maybe used to alter seed
oil content in plants, which may be very important for the
nutritional value and production of various food products.
G1242 (SEQ ID NO: 787)
[1226] Published Information.
[1227] The transcription regulator G1242 was identified by amino
acid sequence similarity to proteins of the SWI/SNF family of
chromatin remodeling factor. G1242 is found in the sequence of the
chromosome 5, BAC clone T1A4 (GenBank accession number AC051627.4;
nid=8027925), released by the Arabidopsis Genome Initiative. No
additional public information related to the functional
characterization of G1242 is available.
[1228] Closely Related Genes from Other Species.
[1229] Sequence comparison of G1242 with sequences available in
GenBank reveals strong similarity with plant proteins of several
species, including Oryza sativa, Glycine max, Gossypium hirsutum,
Sorghum bicolor, Zea mays, Solanum tuberosum and Hordeum
vulgare.
[1230] Experimental Observations.
[1231] The function of G1242 was analyzed using transgenic plants
in which this gene was expressed under the control of the 35S
promoter. Morphological characterization of the G1242
overexpressing lines revealed a reduction in flowering time in
continuous light conditions. This phenotype was of low penetrance
and was observed in a minority of lines.
[1232] RT-PCR analysis of the endogenous level of G1242 transcripts
showed that G1242 is expressed predominantly in Arabidopsis flowers
and embryos. A detectable, but low level of G1242 transcripts was
observed in all other tissues. G1242 expression increased
moderately upon SA treatment and may have been repressed by osmotic
and cold treatments.
[1233] Utilities.
[1234] G1242 overexpression appears to alter flowering time by
accelerating the transition from vegetative to reproductive state.
G1242 or its equivalogs could therefore be used to accelerate
flowering time. Most modern crop varieties are the result of
extensive breeding programs. Many generations of backcrossing may
be required to introduce desired traits. Systems that accelerate
flowering could have valuable applications in such programs since
they allow much faster generation times. Additionally, in some
instances, a faster generation time might allow additional harvests
of a crop to be made within a given growing season.
G1255 (SEQ ID NO: 793)
[1235] Published Information.
[1236] G1255 was identified as a gene in the sequence of BAC
AC079281, released by the Arabidopsis Genome Initiative.
[1237] Closely Related Genes from Other Species
[1238] G1255 showed strong homology to a putative rice zing finger
protein represented by sequence AC087181.sub.--3. Sequence identity
between these two proteins extends beyond the conserved domain, and
therefore, these genes can be orthologs.
[1239] Experimental Observations.
[1240] The sequence of G1255 was experimentally determined and
G1255 was analyzed using transgenic plants in which G1255 was
expressed under the control of the 35S promoter. Plants
overexpressing G1255 had alterations in leaf architecture, a
reduction in apical dominance, an increase in seed size, and showed
more disease symptoms following inoculation with a low dose of the
fungal pathogen Botrytis cinerea. G1255 was constitutively
expressed and not significantly induced by any conditions
tested
[1241] Utilities.
[1242] On the basis of the phenotypes produced by overexpression of
G1255, G1255 or its equivalogs can be used to manipulate the
plant's defense response to produce pathogen resistance, alter
plant architecture, or alter seed size.
G1266 (SEQ ID NO: 799)
[1243] Published Information.
[1244] G1266 corresponds to ERF1, `ethylene response factor 1`
(GenBank accession number AF076277) (Solano et al. (1998) Genes
Dev. 12: 3703-3714). ERF1 was isolated in a search for Arabidopsis
EREBP-like genes using a PCR-based approach. ERF1 expression was
shown to be rapidly induced by ethylene, and to be dependent on the
presence of functional EIN3 (ETHYLENE-INSENSITIVE3), as no
expression was detected in ein3-1 mutants (Solano et al. (1998)
supra). Furthermore, ERF1 mRNA showed constitutive high-level
expression in 35S::EIN3-expressing transgenic plants, and EIN3 was
shown to bind to sequences in the ERF1 promoter in a
sequence-specific manner (Solano et al. (1998) supra). All these
results indicated that ERF1 is downstream of EIN3 in the ethylene
signaling pathway, and that both proteins act sequentially in a
cascade of transcriptional regulation initiated by ethylene gas
(Solano et al. (1998) supra). ERF1 binds specifically to the GCC
element, which is a particular type of ethylene response element
that is found in the promoters of genes induced upon pathogen
attack (Solano et al., (1998) supra). 35S::ERF1-expressing
transgenic plants displayed phenotypes similar to those observed in
the constitutive ethylene response mutant ctrl or in wild-type
plants exposed to ethylene; however, expression of only a partial
seedling triple response in these lines indicated that ERF1
mediates only a subset of the ethylene responses (Solano et al.
(1998) supra). At the adult stage, 35S::ERF1-expressing transgenic
plants showed a dwarf phenotype, and some ethylene-inducible genes,
like basic-chitinase and PDF1.2 were constitutively activated in
those lines (Solan et al. (1998) supra). All these results showed
that ERF1 is a downstream ethylene signaling pathway gene.
Closely Related Genes from Other Species.
[1245] The sequences of Nicotiana tabacum S25-XP1 (GenBank
accession number AAB38748) and G1266 are very similar, with
similarity between the two proteins extending beyond the conserved
AP2 domain.
Experimental Observations
[1246] The function of G1266 was further analyzed using transgenic
plants in which this gene was expressed under the control of the
35S promoter. As expected from the previously published work, G1266
overexpressing plants showed a dwarf phenotype. In physiological
assays, it was shown that G1266 overexpressing plants were more
tolerant to infection with a moderate dose of the fungal pathogen
Erysiphe orontii. The resistance phenotype to the fungal pathogen
Erysiphe orontii has been repeated. This phenotype might be a
consequence of ERF1 being a downstream ethylene signaling pathway
gene. Constitutive expression of G1266 might accelerate leaf
senescence, which in turn might impair infection by Erysiphe
orontii.
[1247] In addition, when analyzed for leaf insoluble sugar
composition, three lines showed alterations in rhamnose, arabinose,
xylose, and mannose, and galactose when compared with wild-type
plants.
[1248] Utilities.
[1249] G1266 has been shown to be a downstream ethylene signaling
pathway gene, and experiments implicate this gene in the plant
response to the fungal pathogen Erysiphe orontii. G1266 or its
equivalogs could therefore be used to engineer plants with a
modulated response to that and other pathogens, for example, plants
showing increased resistance.
G1274 (SEQ ID NO: 805)
[1250] Published Information.
[1251] G1274 is a member of the WRKY family of transcription
factors. The gene corresponds to WRKY51 (At5g64810). No information
is available about the function(s) of G1274.
[1252] Experimental Observations.
[1253] RT-PCR analysis was used to determine the endogenous
expression pattern of G1274. Expression of G1274 was detected in
leaf, root and flower tissues. The biotic stress related
conditions, Erysiphe and SA induced expression of G1274 in leaf
tissue. The gene also appeared to be slightly induced by osmotic
and cold stress treatments and perhaps by auxin.
[1254] The function of G1274 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
G1274 overexpressing lines were more tolerant to growth on low
nitrogen containing media. In an assay intended to determine
whether the transgene expression could alter C:N sensing,
35S::G1274 seedlings contained less anthocyanins than wild-type
controls grown on high sucrose/N- and high sucrose/N/Gln plates.
These data together suggested that overexpression of G1274 may
alter a plant's ability to modulate carbon and/or nitrogen uptake
and utilization.
[1255] In addition, 35S::G1274 transgenics were more tolerant to
chilling compared to the wild-type controls in both germination as
well as seedling growth assays.
[1256] Overexpression of G1274 produced alterations in leaf
morphology and inflorescence architecture. Four out of eighteen
35S::G1274 primary transformants were slightly small and developed
inflorescences that were short, and showed reduced internode
elongation, leading to a bushier, more compact stature than in
wild-type.
[1257] In an experiment using T2 populations, it was observed that
the rosette leaves from many of the plants were distinctly broad
and appeared to have a greater rosette biomass than in wild
type.
[1258] Utilities.
[1259] The enhanced performance of 35S::G1274 seedlings under
chilling conditions suggested that the gene might be applied to
engineer crops that show better growth under cold conditions. In
particular, photo-inhibition of photosynthesis (disruption of
photosynthesis due to high light intensities) often occurs under
clear atmospheric conditions subsequent to cold late summer/autumn
nights Chilling may also lead to yield losses and lower product
quality due to poor pollination and delayed ripening. Given that
the growth of many crops is very sensitive to cool temperatures, a
gene that enhances growth under cool conditions could enhance
yields, extend the effective growth range of chilling sensitive
crop species, and reduce fertilizer and herbicide usage. Another
large impact of chilling occurs during post-harvest storage. For
example, some fruits and vegetables do not store well at low
temperatures (for example, bananas, avocados, melons, and
tomatoes). The normal ripening process of the tomato is impaired if
it is exposed to cool temperatures. Genes conferring resistance to
chilling temperatures may enhance tolerance during post-harvest
storage.
[1260] Chilling tolerance could also serve as a model for
understanding how plants adapt to water deficit. Both chilling and
water stress share similar sensory transduction pathways and
tolerance/adaptation mechanisms. For example, acclimation to
chilling temperatures can be induced by water stress or treatment
with abscisic acid. Genes induced by low temperature include
dehydrins (or LEA proteins). Dehydrins are also induced by
salinity, abscisic acid, water stress or during the late stages of
embryogenesis. Thus, genes that protect the plant against chilling
could also have a role in protection against water deficit
[1261] A secondary consequence of slow growth under cold conditions
is poor ground cover (of maize fields) in the spring; resulting in
soil erosion, increased occurrence of weeds, and reduced uptake of
nutrients. A retarded uptake of mineral nitrogen can then lead to
increased losses of nitrate into the ground water.
[1262] The enhanced performance of G1274 overexpression lines under
low nitrogen conditions indicated that the gene could be used to
engineer crops that could thrive under conditions of reduced
nitrogen availability. Such a trait would provide cost savings to
the farmer by reducing the amount of fertilizer needed provide the
environmental benefit of reduced fertilizer run-off into
watersheds, and improve stress tolerance and yield.
[1263] 35S::G1274 overexpressing lines made less anthocyanin on
high sucrose plus glutamine, indicating G1274 might be used to
modify carbon and nitrogen status, and hence assimilate
partitioning.
[1264] The morphological phenotype shown by 35S::G1274 lines
indicated that the gene might be used to alter inflorescence
architecture, to produce more compact dwarf forms that might afford
yield benefits.
[1265] The effects on leaf size that were observed as a result of
G1274 overexpression might also have commercial applications.
Increased leaf size or an extended period of leaf growth, could
increase photosynthetic capacity, and biomass, and thus have a
positive effect on yield.
G1275 (SEQ ID NO: 807)
[1266] Published Information.
[1267] G1275 was first identified in the sequence of BAC T19G15
(GenBank accession number AC005965).
[1268] Experimental Observations.
[1269] The cDNA sequence of G1275 was determined G1275 was
ubiquitously expressed, although expression levels differed among
tissues. It is possible that G1275 expression is induced by several
stimuli, including infection by Erysiphe, Fusarium, and SA
treatment.
[1270] The function(s) of G1275 were investigated using both
knock-out mutants and overexpressing plants in which this gene was
expressed under the control of the 35S promoter.
[1271] Primary transformants of G1275 were small with reduced
apical dominance. The inflorescence stems produced by these plants
did not elongate normally. The plants were fertile, but seed yield
was reduced because the plants were severely dwarfed.
[1272] In the knock-out mutant, the T-DNA insertion in G1275 was
localized in the second intron of the gene, which is located within
the conserved WRKY-box. Such insertion would result in a null
mutation (unless the large fragment of exogenous sequence is
perfectly spliced out from the transcribed G1275 pre-mRNA). G1275
knock-out mutant plants were indistinguishable from wild-type
controls in all assays performed.
[1273] Utilities.
[1274] G1275 or its equivalogs might be used to alter plant
development or architecture.
G1305 (SEQ ID NO: 819)
[1275] Published Information.
[1276] G1305 is a member of the (R1)R2R3 subfamily of myb
transcription factors. G1305 corresponds to the gene MYB10 (Kranz
et al. (1998) Plant J. 16: 263-276).
[1277] Experimental Observations.
[1278] The function of G1305 was analyzed using transgenic plants
in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1305 in Arabidopsis resulted in
seedlings that were more tolerant to heat in a germination assay.
Seedlings from G1305 overexpressing transgenics were greener than
the control seedlings under high temperature conditions. In a
repeat experiment, two lines showed the heat tolerant phenotype. In
addition, plants from two of the 35S::G1305 T2 lines flowered
several days earlier than wild type in each of two independent
sowings (24 hour light conditions). The plants had rather flat
leaves compared to controls and formed slightly thin inflorescences
in some cases.
[1279] According to RT-PCR, G1305 was expressed ubiquitously and
expression of the gene was unaltered in response to the
environmental stress-related conditions tested.
[1280] Utilities.
[1281] On the basis of the analyses performed to date, the
potential utility of G1305 or its equivalogs is to regulate a
plant's time to flower.
G1305 or its equivalogs may also be used to improve heat tolerance
at germination. The germination of many crops is very sensitive to
temperature. A gene that would enhance germination in hot
conditions may be useful for crops that are planted late in the
season or in hot climates.
G1313 (SEQ ID NO: 829)
[1282] Published Information.
[1283] G1313 (At5g06100) corresponds to AtMYB33. Gocal et al.
(2001) Plant Physiol. 127:1682-1693) showed that G1313 (AtMYB33)
could bind to the GA response element and activate the barley
.alpha.-amylase promoter in a transient assay in barley aleurone
cells. The gene is ubiquitously expressed in Arabidopsis. It was
hypothesized that the gene could regulate GA responsive pathways
that promote flowering in Arabidopsis. To test this hypothesis
Gocal et al. (2001) supra, analyzed whether AtMYB33 is capable of
binding to the LFY gene promoter. LFY is a floral meristem identity
gene that has a GA responsive element in its promoter. AtMYB33 was
found to bind to the LFY promoter suggesting that the action of GA
on flowering could be mediated through the activity of AtMYB33
(Gocal et al. (2001) supra).
[1284] Experimental Observations.
[1285] The complete sequence of G1313 was determined The function
of this gene was analyzed using transgenic plants in which G1313
was expressed under the control of the 35S promoter. 35S::G1313
transgenics were wild-type in response to all physiological stress
treatments performed.
[1286] Interestingly, overexpression of G1313 produced an apparent
increase in seedling vigor in some of the T1 plants at an early
seedling stage, under normal growth conditions, compared to the
wild-type controls. This effect was observed in single T2 line in
both the morphology and physiology assays. Given that GAs are known
to promote seed germination, the increased seedling vigor could be
related to a GA response in seeds. The lack on an effect of G1313
on flowering time could result from the fact that an additional
factor is required for the activity of the protein. It should be
noted that all the assays were performed under continuous light;
since GAs are known to be critical for the floral transition to
occur under SDs (8-hour light) in Arabidopsis, 35S::G1313 lines may
have an altered flowering time response under such conditions.
[1287] Utilities.
[1288] The increase in seedling vigor in G1313 transgenics plants
suggested this gene could be used to increased survivability and
vigor of small seedlings under field conditions potentially leading
to a greater yield in crops. Published results suggested that the
gene might also be used to modify flowering time in commercial
species.
G1322 (SEQ ID NO: 841)
[1289] Published Information.
[1290] G1322 is a member of the (R1)R2R3 subfamily of myb
transcription factors. G1322 corresponds to Myb57, a gene
identified by Kranz et al. ((1998) Plant J. 16: 263-276). The
authors used a reverse-Northern blot technique to study the
expression of this gene in a variety of tissues and under a variety
of environmental conditions. They were unable to detect the
expression of G1322 in any tissue or treatments tested (Kranz et
al. (1998) Plant J. 16: 263-276).
Closely Related Genes from Other Species
[1291] G1322 shows sequence similarity with known genes from other
plant species within the conserved Myb domain.
[1292] Experimental Observations.
[1293] G1322 was analyzed using transgenic plants in which the gene
was expressed under the control of the 35S promoter. 35S::G1322
transgenic plants were wild-type in phenotype with respect to the
biochemical analyses performed. Overexpression of G1322 produced
changes in overall plant size and leaf development. At all stages,
35S::G1322 plants were distinctly smaller than controls and
developed curled dark-green leaves. Following the switch to
flowering, the plants formed relatively thin inflorescence stems
and had a rather poor seed yield. In addition, overexpression of
G1322 resulted in plants with an altered etiolation response as
well as enhanced tolerance to germination under chilling
conditions. When germinated in the dark, G1322 overexpressing
transgenic plant lines had open, slightly green cotyledons. Under
chilling conditions, all three transgenic lines displayed a similar
germination response, seedlings were slightly larger and had longer
roots. In addition, an increase in the leaf glucosinolate M39480
was observed in all three T2 lines. According to RT-PCR analysis,
G1322 was expressed primarily in flower tissue.
[1294] Utilities.
[1295] The utilities of G1322 or its equivalogs include altering a
plant's chilling sensitivity and altering a plant's light response.
The germination of many crops is very sensitive to cold
temperatures. A gene that will enhance germination and seedling
vigor in the cold has tremendous utility in allowing seeds to be
planted earlier in the season with a higher survival rate.
[1296] G1322 or its equivalogs can also be useful for altering leaf
glucosinolate composition. Increases or decreases in specific
glucosinolates or total glucosinolate content are desirable
depending upon the particular application. Modification of
glucosinolate composition or quantity can therefore afford
increased protection from predators. Furthermore, in edible crops,
tissue specific promoters can be used to ensure that these
compounds accumulate specifically in tissues, such as the
epidermis, which are not taken for consumption.
G1323 (SEQ ID NO: 843)
[1297] Published Information.
[1298] Kranz et al. ((1998) Plant J. 16: 263-276) published a
partial cDNA sequence corresponding to G1323, naming it MYB58.
Reverse-Northern data indicates that this gene is expressed
primarily in leaf tissue.
[1299] Experimental Observations.
[1300] The complete sequence of G1323 was determined As determined
by RT-PCR, G1323 was highly expressed in embryos, and was expressed
at significantly lower levels in the other tissues tested. G1323
expression was not induced by any stress-related treatments. The
function of this gene was analyzed using transgenic plants in which
G1323 was expressed under the control of the 35S promoter. Primary
transformants of G1323 were uniformly small and dark green, and a
few were late flowering. According to the biochemical analysis of
G1323 overexpressors, two had higher seed protein. The higher seed
protein and lower seed oil content was observed in a repeated
experiment.
[1301] Utilities.
[1302] G1323 or its equivalogs could be used to alter seed protein
and oil amounts and/or composition, which is very important for the
nutritional value and production of various food products.
G1332 (SEQ ID NO: 855)
[1303] Published Information.
[1304] G1332 is a member of the (R1)R2R3 subfamily of myb
transcription factors. G1332 corresponds to the gene MYB82 (Kranz
et al. (1998) Plant J. 16: 263-276).
[1305] Experimental Observations.
[1306] The function of G1332 was analyzed using transgenic plants
in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1332 produced a reduction in trichome
density on leaf surfaces and inflorescence stems in Arabidopsis. No
other phenotypic alterations were observed in the G1332
overexpressors.
[1307] G1332 was expressed ubiquitously and may have been repressed
by Erysiphe infection.
[1308] Utilities.
[1309] The potential utility of this gene or its equivalogs is to
alter trichome initiation and number in a plant. It would be of
great agronomic value to have plants that produce greater numbers
of glandular trichomes that produce valuable essential oils for the
pharmaceutical and food industries, as well as oils that protect
plants against insect and pathogen attack.
G1412 (SEQ ID NO: 879)
[1310] Published Information.
[1311] G1412 is a member of the NAC family of transcription
factors. G1412 corresponds to gene At4g27410, annotated by the
Arabidopsis Genome Initiative. The gene corresponds to sequence
1543 from patent application WO0216655 A2 on stress-regulated
genes, transgenic plants and methods of use. In this publication,
G1412 was reported to be cold, osmotic and salt responsive in
microarray analysis. No information is available about the
function(s) of G1412.
[1312] Experimental Observations.
[1313] RT-PCR was used to analyze the endogenous expression pattern
of G1412. The gene appeared to be constitutively expressed in all
tissues tested. Furthermore, induction of G1412 in leaf tissue was
observed in response to ABA, heat, drought, and mannitol.
[1314] A T-DNA insertion mutant for G1412 was then analyzed. The
mutant displayed a wild-type morphology, and was wild-type in its
response to the physiological analyses that were performed.
[1315] G1412 overexpressing transformants displayed wild-type
morphology. However, the 35S::G1412 transgenics were insensitive to
ABA and were more tolerant to osmotic stress in a germination assay
on media containing high concentrations of sucrose.
[1316] Utilities.
[1317] The phenotypic effects of G1412 overexpression, such as the
increase in seedling vigor observed in a germination assay on high
sucrose media and insensitivity to germination on ABA media,
indicated that the gene could be used to engineer plants with
increased tolerance to abiotic stresses such as drought, salt, heat
or cold.
G1417 (SEQ ID NO: 881)
[1318] Published Information.
[1319] G1417 corresponds to gene AT4g01720 (CAB77742).
[1320] Closely Related Genes from Other Species.
[1321] G1417 shows sequence similarity, outside of the conserved
WRKY domain, with a rice protein (gi8467950).
[1322] Experimental Observations.
[1323] The function of G1417 was studied using a line homozygous
for a T-DNA insertion in the gene. The T-DNA insertion lies
immediately upstream of the conserved WRKY domain coding sequence,
and was expected to result in a null mutation. G1417 knockout
mutant plants showed reduced seedling vigor during germination. The
G1417 knockout showed alterations in seed fatty acid composition.
An increase in 18:2 fatty acid and a decrease in 18:3 fatty acid
were observed in two seed batches.
[1324] G1417 was ubiquitously expressed and did not appear to be
significantly induced by any of the conditions tested.
[1325] Utilities.
[1326] G1417 or its equivalogs could be useful to manipulate the
saturation levels of lipids in seeds. Alteration in seed lipid
saturation could be used to improve the heat stability of oils or
to improve the nutritional quality of seed oil.
G1449 (SEQ ID NO: 891)
[1327] Published Information.
[1328] G1449 is annotated in the sequence of genomic clone MKP6,
GenBank accession number AB022219, released by the Arabidopsis
Genome Initiative.
[1329] Experimental Observations.
[1330] A cDNA clone corresponding to G1449 was isolated from an
embryo cDNA library. It was later identified in the sequence of
genomic clone MKP6, GenBank accession number AB022219, released by
the Arabidopsis Genome Initiative.
[1331] G1449 was expressed at high levels in embryos and siliques,
and at significantly lower levels in roots and seedlings. It was
induced by auxin in leaf tissue. Plants overexpressing G1449 showed
floral abnormalities. Primary transformants showed changes in
floral organ number and identity. Large petals were noted in one
plant. Affected lines were also somewhat smaller than controls.
These plants produced little seed and it was necessary to bulk seed
for analysis. One T3 line produced flowers that were somewhat
larger than control flowers with petals that were more open. These
flowers often had extra petals. G1449 mutant plants did not show
any other phenotypic alterations in any of the physiological or
biochemical assays performed.
[1332] Utilities.
[1333] Because larger and more open petals are produced in some
G1449 overexpressing plants, G1449 or its equivalogs may be useful
for modifying flower form and size in ornamental plants. The
promoter of G1449 may also be useful to drive gene expression in
seeds and seed pods or fruits.
G1451 (SEQ ID NO: 893)
[1334] Published Information.
[1335] G1451 is ARF8, a member of the ARF class of proteins with a
VP1-like N-terminal domain and a C-terminal domain with homology to
Aux/IAA proteins. ARF8, like several other ARFs, contains a
glutamine-rich central domain that can function as a
transcriptional activation domain (1). ARF8 was shown to bind to an
auxin response element (2). It was also shown that a truncated
version of ARF8 lacking the DNA binding domain but containing the
activation domain and the C-terminal domain could activate
transcription on an auxin responsive promoter, presumably through
interactions with another factor bound to the auxin response
element (1). ARF8 is closely related in sequence to ARF6 (2).
[1336] Experimental Observations.
[1337] G1451 was expressed throughout the plant, with the highest
expression in flowers. Transcripts of G1451 were induced in leaves
by a variety of stress conditions. A line homozygous for a T-DNA
insertion in G1451 was used to determine the function of this gene.
The T-DNA insertion of G1451 is approximately one-fifth of the way
into the coding sequence of the gene and therefore is likely to
result in a null mutation.
[1338] As measured by NIR, G1451 knockout mutants had increased
total combined seed oil and seed protein content compared to
wild-type plants.
[1339] Utilities.
[1340] G1451 or its equivalogs may be used to alter seed oil and
protein content, which may be very important for the nutritional
value and production of various food products
[1341] G1451 or its equivalogs could also be used to increase plant
biomass. Large size is useful in crops where the vegetative portion
of the plant is the marketable portion since vegetative growth
often stops when plants make the transition to flowering.
G1468 (SEQ ID NO: 895)
[1342] Published Information.
[1343] The genomic sequence of G1468 is located on the Arabidopsis
BAC clone T7123 (GenBank accession number U89959). There is no
published information available regarding the function of
G1468.
[1344] Experimental Observations.
[1345] A T-DNA insertion mutant for G1468 behaved similarly to the
wild-type controls in all morphological and physiological assays
performed. G1468 was predominantly expressed in flowers and
embryos. Furthermore, its expression level was unaffected by any of
the conditions tested.
[1346] The function of G1468 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
Overexpression of G1468 produced plants that were rather dark in
coloration compared to wild type controls at early stages. Severely
affected individuals arrested growth early in vegetative
development. Plants that survived formed narrow, gray leaves and
showed a marked delay in onset of flowering. Many of the late
flowering plants had more axillary rosette leaves compared to
controls leading to an increase in vegetative biomass.
[1347] Utilities.
[1348] The alterations in leaf shape, size, and coloration shown by
35S::G1468 transformants indicated that the gene or its equivalogs
may be applied to modify plant architecture.
[1349] The delayed bolting suggests that gene might also be used to
manipulate flowering time in commercial species. In particular, an
extension of vegetative growth can significantly increase biomass
and result in substantial yield increases.
G1471 (SEQ ID NO: 897)
[1350] Published Information.
[1351] G1471 was identified in the sequence of P1 clone MDK4,
GenBank accession number AB010695, released by the Arabidopsis
Genome Initiative.
[1352] Experimental Observations.
[1353] The function of this gene was analyzed using transgenic
plants in which G1471 was expressed under the control of the 35S
promoter. All 35S::G1471 primary transformants were markedly small,
had narrow curled leaves and formed thin inflorescence stems.
Flowers from many T1 plants were extremely poorly developed, and
often had organs missing, reduced in size, or highly contorted. Due
to such defects, the fertility was very low, and approximately one
third of the lines were tiny and completely sterile. Plants from
one T2 generation line displayed wild-type morphology, indicating
that the transgene might have become silenced. Two lines, however,
were small, had narrow curled leaves and flowered marginally
earlier than controls. The phenotype of these transgenic plants was
wild-type in all other assays performed. G1471 appeared to be
expressed at medium levels in siliques and embryos.
[1354] G1471 overexpressing plants were found to have increased
seed oil content compared to wild-type plants.
[1355] Utilities.
[1356] G1471 or equivalog overexpression may be used to increase
seed oil content in plants.
[1357] Because expression of G1471 is embryo and silique specific,
its promoter could be useful for targeted gene expression in these
tissues.
G1482 (SEQ ID NO: 905)
[1358] Published Information.
[1359] G1482 was identified as a gene in the sequence of BAC
AC006434, released by the Arabidopsis Genome Initiative.
[1360] Experimental Observations.
[1361] The sequence of G1482 was experimentally determined. The
data presented for this gene are from plants homozygous for a T-DNA
insertion in G1482. The T-DNA insertion of G1482 is in coding
sequence and therefore this knockout mutant is likely to contain a
null allele. Homozygous plants harboring a T-DNA insertion in G1482
displayed significantly more root growth on MS control plates as
well as on different stresses in three separate experiments. G1482
was constitutively expressed and significantly induced by auxin,
ABA and osmotic stress.
[1362] The function of G1482 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
Plants overexpressing G1482 contained high levels of
anthocyanins.
[1363] Utilities.
[1364] Based on the phenotypes produced when this gene is knocked
out, G1482 or its equivalogs could be used to manipulate root
growth, particularly in response to environmental stresses such as
drought and low nutrients.
[1365] G1482 or its equivalogs could also be used to alter
anthocyanin production. The potential utilities of this gene
includes alterations in pigment production for horticultural
purposes, and possibly increasing stress resistance in combination
with another transcription factor. Flavonoids have antimicrobial
activity and could be used to engineer pathogen resistance. Several
flavonoid compounds have health promoting effects such as the
inhibition of tumor growth and cancer, prevention of bone loss and
the prevention of the oxidation of lipids. Increasing levels of
condensed tannins, whose biosynthetic pathway is shared with
anthocyanin biosynthesis, in forage legumes is an important
agronomic trait because they prevent pasture bloat by collapsing
protein foams within the rumen. For a review on the utilities of
flavonoids and their derivatives, see Dixon et al. (1999) Trends
Plant Sci. 10: 394-400.
G1499 (SEQ ID NO: 913)
[1366] Published Information.
[1367] The sequence of G1499 was obtained from the Arabidopsis
genome sequencing project, GenBank accession number AB020752, based
on its sequence similarity within the conserved domain to other
bHLH related proteins in Arabidopsis.
[1368] Closely Related Genes from Other Species.
[1369] The similarity between G1499 and Brassica rapa subsp.
pekinensis flower bud cDNA (acc#AT002234) is significant not only
in the conserved bHLH domains but also outside of the domains.
[1370] Experimental Observations.
[1371] The function of G1499 was analyzed using transgenic plants
in which G1499 was expressed under the control of the 35S promoter.
A range of phenotypes was observed in primary transformants of
G1499. The most severely affected plants were smaller than
controls, dark green, with strongly curled leaves, and produced
bolts that terminated without an inflorescence. In some cases,
flowers were replaced with filamentous structures or carpelloid
structures. Less severely affected lines produced flowers where
sepals were converted to carpelloid tissue. Petals and stamens were
absent or reduced in size and number. Mildly affected T1 plants
that were small in size but produced normal flowers were taken to
the T2 generation. Three T2 lines produced plants that were smaller
than controls, darker green, and had narrower leaves.
[1372] G1499 overexpressors were similar to their wild-type
counterparts in all physiological and biochemical assays.
[1373] G1499 was predominantly expressed in the reproductive
tissues such as flower, embryo and silique. Lower levels of
expression were also detected in roots and germinating seeds. It's
expression level was unaffected by any of the environmental
conditions tested.
[1374] Phenotypes produced by overexpressing G1499 and G779 were
similar in the aspects of flower structures. Cluster analysis using
basic helix-loop-helix motif revealed that both proteins of G1499
and G779 are closely related.
[1375] Utilities.
[1376] G1499 or its equivalogs could be used to modify plant
architecture and development, including flower structure. If
expressed under a flower-specific promoter, it might also be useful
for engineering male sterility. Because expression of G1499 is
flower and embryo specific, its promoter could be useful for
targeted gene expression in these tissues.
[1377] Potential utilities of this gene or its equivalogs also
include increasing chlorophyll content, allowing more growth and
productivity in conditions of low light. With a potentially higher
photosynthetic rate, fruits could have higher sugar content.
Increased carotenoid content could be used as a nutraceutical to
produce foods with greater antioxidant capability.
G1540 (SEQ ID NO: 919)
[1378] Published Information.
[1379] G1540 is the Arabidopsis WUSCHEL (WUS) gene and encodes a
novel subclass of homeodomain protein (Mayer et al. (1998) Cell
95:805-815).
[1380] WUS is a key developmental protein that has a core role in
regulating the fate of stem cells within Arabidopsis apical
meristems. The central zone of an apical meristem contains a pool
of undifferentiated pluripotent stems cells. These stem cells are
able to both maintain themselves and supply cells for incorporation
into new organs on the periphery of the meristem (shoot meristems
initiate leaves whereas flower meristems initiate whorls of floral
organs).
[1381] Defects are visible in the shoots and flowers of wus mutants
(Laux et al. (1996) Development 122: 87-96; Endrizzi et al. (1996)
Plant J. 10:967-979). Wus mutants fail to properly organize a shoot
meristem in the developing embryo. Post-embryonically, wus shoot
meristems become flattened and terminate growth prematurely. Leaf
primordia and secondary shoots often initiate ectopically across
the surface of these terminated structures. The leaf primordia
usually develop into a disorganized bunch and a secondary shoot
meristem takes over growth. This secondary meristem then terminates
and the developmental pattern is repeated, leading to a plant with
no clear main axis of growth and clusters of leaves at the tips of
shoots. Wus floral meristems exhibit a comparable phenotype to the
shoot meristem; development often ceases prematurely such that
flowers either lack the innermost whorls of organs, or possess a
single stamen in place of the inner whorls.
[1382] The mutant phenotype indicates that wus is required to
maintain the identity of the central zone within apical meristems
and prevent those cells from becoming differentiated. In situ
expression patterns of WUS RNA support such a conclusion; WUS is
first observed in the embryonic shoot meristem at the 16-cell
stage. Later, expression becomes confined to small groups of cells
(in shoot and floral meristems) at the base of the central zone
where it specifies the fate of overlying cells as stem cells. WUS
is thought to be expressed, and act, independently of another
homeobox gene, SHOOT MERISTEMLESS (STM), G431, which has a related
function (Long et al. (1996) Development 125:3027-3035). STM is
initially required for the establishment of the shoot meristem
during embryogenesis. Later S.TM. is expressed throughout the whole
meristem dome where, together with an antagonist, CLAVATA1, it
regulates transition of cells from the central zone towards
differentiation and organ formation at the meristem periphery
(Clarke et al. (1996) Development 122: 1565-1575; Endrizzi et al.
(1996) Plant J. 10:967-979). A current hypothesis is that WUS
specifies the identity of central stem cells whereas STM allows the
progeny of those cells to proliferate before being partitioned into
organ primordia (Mayer et al. (1998) Cell 95:805-815).
[1383] The effects of WUS over-expression have not yet been
published. However, based on the present model for WUS function,
its ectopic expression might be expected to induce formation of
ectopic meristematic stem cells.
[1384] Experimental Observations.
[1385] Over-expressers for G1540 (WUSCHEL) formed callus-like
structures on leaves, stems and floral organs. These observations
correlate with the proposed role of WUS in specifying stem cell
fate in meristems. In Ti over-expressers, cells took on
characteristics of stem cells at inappropriate locations,
indicating that WUS was sufficient to specify stem cell
identity.
[1386] Utilities.
[1387] The over-expression phenotype indicates that G1540 is
sufficient to confer stem cell identity on plant cells, and thereby
prevent them from differentiating. The gene or its equivalogs might
be of utility in the maintenance of plant cell lines grown in
vitro, where the differentiation of those lines creates
difficulties. The gene or its equivalogs might also be applied to
transformation systems for recalcitrant species, where generation
of callus is currently problematic but is required as part of the
transformation procedure.
G1560 (SEQ ID NO: 925)
[1388] Published Information.
[1389] The heat shock transcription factor G1560 is a member of the
class-A HSFs (Nover et al. (1996) Cell Stress & Chaperones
1:215-223) characterized by an extended HR-A/B oligomerization
domain. G1560 is found in the sequence of the chromosome 3, P1
clone: MWI23 (GenBank accession AB022223.1 GI:4159712), released by
the Arabidopsis Genome Initiative. The translational start and stop
codons were correctly predicted. No additional public information
related to the functional characterization of G1560 is
available.
[1390] Closely Related Genes from Other Species.
[1391] Amino acid sequence comparison with entries available from
GenBank shows strong similarity with plant HSFs of several species
(Oryza sativa, Lycopersicon peruvianum, Medicago truncatula,
Solanum tuberosum, Lycopersicon esculentum, Glycine max, Pisum
sativum, Hordeum vulgare subsp. Vulgare, Triticum aestivum and
Lotus japonicus; see accompanying BLAST reports).
[1392] Experimental Observations.
[1393] The function of G1560 was analyzed through its ectopic
overexpression in plants. Analysis of the endogenous level of G1560
transcripts by RT-PCR revealed that this gene was predominantly
expressed in shoots, flowers, embryo and siliques. G1560 expression
was induced strongly in response to heat shock treatment and
moderately after auxin, ABA, drought and osmotic treatment. The
inducibility of G1560 by heat shock treatment suggested that G1560
may play a central role in the regulation of the heat shock
response in plants. Physiological analysis of G1560 overexpressors
revealed no changes compared to wild type control upon either heat
shock or osmotic stress treatment.
[1394] Overexpression of G1560 resulted in transgenic T1 and T2
plants with altered morphological characteristics. Throughout
development, transgenic 35S::G1560 T1 and T2 plants were smaller
than wild-type plants and showed abnormalities in flower
development. In several independent lines floral organs, mainly
petals and stamens, were poorly developed or absent, and flower
buds were generally smaller and round-shaped. This phenotype
resulted in poor fertility and low seed yield. Current models
regarding the mode of action of chaperones (regulated by HSFs) are
insufficient to explain this phenotype at the molecular level, or
to suggest if the phenotype is a direct or indirect consequence of
the overexpression of HSF G1560.
[1395] Utilities.
[1396] The overexpression of G1560 resulted in plants of small size
and altered flower morphology. Alteration of G1560 expression could
potentially be used to modify plant development and fertility.
G1634 (SEQ ID NO: 927)
[1397] Published Information.
[1398] G1634 was identified in the sequence of BAC MJJ3, GenBank
accession number AB005237, released by the Arabidopsis Genome
Initiative.
[1399] Experimental Observations.
[1400] The complete sequence of G1634 was determined cDNA
microarray analyses of the endogenous levels of G1634 indicated
that this gene was primarily expressed in root and silique tissues.
In addition, G1634 expression was not altered significantly in
response to any of the stress-related treatments tested. The
function of this gene was analyzed using transgenic plants in which
G1634 was expressed under the control of the 35S promoter. The
phenotype of these transgenic plants was wild-type in all assays
performed.
[1401] G1634 overexpressors were found to have altered seed protein
content compared to wild-type plants.
[1402] Utilities.
[1403] G1634 or its equivalogs could be used to alter seed protein
amounts which is very important for the nutritional value and
production of various food products.
G1645 (SEQ ID NO: 929)
[1404] Published Information.
[1405] G1645 is a member of the (R1)R2R3 subfamily of MYB
transcription factors. G1645 was identified in the sequence of BAC
T24P13, GenBank accession number AC006535, released by the
Arabidopsis Genome Initiative.
[1406] Closely Related Genes from Other Species.
[1407] G1645 shows extensive sequence similarity to MYB proteins
from other plant species including tomato (AW624217), and alfalfa
(AQ917084).
[1408] Experimental Observations.
[1409] The function of G1645 was analyzed using transgenic plants
in which the gene was expressed under the control of the 35S
promoter. Overexpression of G1645 produced marked changes in
Arabidopsis leaf, flower and shoot development. These effects were
observed, to varying extents, in the majority of 35S::G1645 primary
transformants.
[1410] At early stages, many 35S::G1645 T1 lines appeared slightly
small and most had rather rounded leaves. However, later, as the
leaves expanded, in many cases they became misshapen and highly
contorted. Furthermore, some of the lines grew slowly and bolted
markedly later than control plants. Following the switch to
flowering, 35S::G1645 inflorescences often showed aberrant growth
patterns, and had a reduction in apical dominance. Additionally,
the flowers were frequently abnormal and had organs missing,
reduced in size, or contorted. Pollen production also appeared poor
in some instances. Due to these deficiencies, the fertility of many
of the 35S::G1645 lines was low and only small numbers of seeds
were produced.
[1411] Overexpression of G1645 resulted in a low germination
efficiency when germinated on the 32 C heat stress.
[1412] As determined by RT-PCR, G1645 was expressed in flowers,
embryos, germinating seeds and siliques. No expression of G1645 was
detected in the other tissues tested. G1645 expression appeared to
be repressed in rosette leaves infected with the phytopathogen
Erysiphe orontii.
[1413] Utilities.
[1414] G1645 or its equivalogs could be used to alter inflorescence
structure, which may have value in production of novel ornamental
plants.
G1645 or equivalog activity could be used to alter a plant's
response to heat stress.
G1760 (SEQ ID NO: 937)
[1415] Published Information.
[1416] G1760 was identified in the sequence of BAC clone F20D10
(gene AT4g37940/F20D10.60, GenBank accession number CAB80459).
G1760 also corresponds to AGL21. A phylogenetic analysis of the
Arabidopsis MADS box gene family situated G1760/AGL21 in the same
clade as ANR1 and AGL17, which are root-specific (Alvarez-Buylla et
al. (2000) Proc. Natl. Acad. Sci. USA. 97:5328-5333). No
information is available about the function(s) of G1760/AGL21.
[1417] Closely Related Genes from Other Species.
[1418] G1760 shows sequence similarity with a tomato gene
represented in GenBank by an EST: AW219962 EST302445 tomato root
during/after fruit set, Lycopersicon esculentum cDNA clone
cLEX6M17. Since similarity between the two genes extends beyond the
conserved MADS domain, and because of the fact the tomato gene
represented by EST AW219962 is also expressed in roots, both genes
might be related in function.
[1419] Experimental Observations.
[1420] The function of G1760 was studied using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Overexpression of G1760 consistently reduced the time to
flowering. G1760 overexpressing plants did not show any other
morphological or physiological alterations in the assays that were
performed. In fact, overexpression of G1760 was not observed to
have deleterious effects: 35S::G1760 plants were healthy and
attained a wild-type stature when mature. To date, a substantial
number of genes have been found to promote flowering. Many,
however, including those encoding the transcription factors,
APETALA1, LEAFY, and CONSTANS, produce extreme dwarfing and/or
shoot termination when over-expressed.
[1421] G1760 was specifically expressed in roots, in good agreement
with its position within the Arabidopsis MADS-box gene family
phylogenetic tree (Alvarez-Buylla et al. (2000) supra). The
expression of G1760 appeared to be ectopically induced by drought
stress.
[1422] Utilities.
[1423] G1760 could be used to modify a plant's flowering time
characteristics. In addition, its promoter could be used to confer
root specific gene expression, as well as to engineer
responsiveness to drought.
[1424] In general, a wide variety of applications exist for systems
that either lengthen or shorten the time to flowering.
G1816 (SEQ ID NO: 939)
[1425] Published Information.
[1426] G1816 is a member of the MYB-related class of transcription
factors. The gene corresponds to TRIPTYCHON (TRY), and has recently
been shown to be involved in the lateral inhibition during
epidermal cell specification in the leaf and root (Schellmann et
al. (2002) EMBO J. 21: 5036-5046). The model proposes that TRY
(G1816) and CPC (G225) function as repressors of trichome and
atrichoblast cell fate. TRY loss-of-function mutants form ectopic
trichomes on the leaf surface. TRY gain-of-function mutants are
glabrous and form ectopic root hairs.
[1427] Experimental Observations.
[1428] The complete sequence of G1816 was determined The function
of the gene was studied using transgenic plants in which G1816 was
expressed under the control of the 35S promoter. Consistent with
the morphological phenotypes published for the 35S::TRY
overexpressors, the transgenic plants were glabrous and formed
ectopic root hairs. These transgenic lines were also more tolerant
to growth under N limiting conditions, both in a germination assay
as well as a root growth assay on older seedlings. The N
germination assay looked for alterations in C:N sensing through the
increase or decrease in anthocyanin production of the transgenics
relative to the controls. 35S::G1816 transgenic lines produced less
anthocyanin than wild-type controls. However, in addition to the N
tolerance phenotypes observed in these transgenic lines, the
35S::G1816 plants were also insensitive to growth retardation
effects of germination on conditions of high glucose, suggesting
that this gene could play a role in sugar sensing responses in the
plant or osmotic stress tolerance. Genes for many sugar sensing
mutants are allelic to genes involved in ABA and ethylene signaling
(Rolland et al. (2002) Plant Cell 14 Suppl: S185-S205. Therefore,
G1816 could also be involved in hormone signaling pathways.
[1429] Utilities.
[1430] The phenotypic effects of G1816 overexpression, such as the
increase in root hair formation and the increase in seedling vigor
observed in a germination assay on high glucose media, indicated
that the gene could be used to engineer plants with increased
tolerance to abiotic stresses such as drought, salt, heat or
cold.
[1431] In addition, the enhanced performance of G1816
overexpression lines under low nitrogen conditions indicated that
the gene could be used to engineer crops that could thrive under
conditions of reduced nitrogen availability.
[1432] The effect of G1816 overexpression on insensitivity to
glucose in a germination assay, indicated that the gene could be
involved in sugar sensing responses in the plant. The potential
utilities of a gene involved in glucose-specific sugar sensing are
to alter energy balance, photosynthetic rate, carbohydrate
accumulation, biomass production, source-sink relationships, and
senescence.
[1433] G1816 could also be used to alter anthocyanin production and
trichome formation in leaves
G1820 (SEQ ID NO: 941)
[1434] Published Information.
[1435] G1820 is a member of the Hap5 subfamily of CCAAT-box-binding
transcription factors. G1820 was identified as part of the BAC
clone MBA10, accession number AB025619 released by the Arabidopsis
Genome sequencing project.
[1436] Closely Related Genes from Other Species.
[1437] G1820 is closely related to a soybean gene represented by
EST335784 isolated from leaves infected with Colletotrichum
trifolii. Similarity between G1820 and the soybean gene extends
beyond the signature motif of the family to a level that would
suggest the genes are orthologous. Therefore the gene represented
by EST335784 may have a function and/or utility similar to that of
G1820.
[1438] Experimental Observations.
[1439] The complete sequence of G1820 was determined The function
of this gene was analyzed using transgenic plants in which G1820
was expressed under the control of the 35S promoter. G1820
overexpressing lines showed more tolerance to salt stress in a
germination assay. They also showed insensitivity to ABA, with the
three lines analyzed showing the phenotype. The salt and ABA
phenotypes could be related to the plants increased tolerance to
osmotic stress because in a severe water deprivation assay, G1820
overexpressors are, again, more tolerant.
[1440] Interestingly, overexpression of G1820 also consistently
reduced the time to flowering. Under continuous light conditions at
20-25 C, the 35S::G1820 transformants displayed visible flower buds
several days earlier than control plants. The primary shoots of
these plants typically started flower initiation 1-4 leaf
plastochrons sooner than those of wild type. Such effects were
observed in all three T2 populations and in a substantial number of
primary transformants.
[1441] When biochemical assays were performed, some changes in leaf
frames were detected. In one line, an increase in the percentage of
18:3 and a decrease in 16:1 were observed. Otherwise, G1820
overexpressors behaved similarly to wild-type controls in all
biochemical assays performed. As determined by RT-PCR, G1820 was
highly expressed in embryos and siliques. No expression of G1820
was detected in the other tissues tested. G1820 expression appeared
to be induced in rosette leaves by cold and drought stress
treatments, and overexpressing lines showed tolerance to water
deficit and high salt conditions.
[1442] One possible explanation for the complexity of the G1820
overexpression phenotype is that the gene is somehow involved in
the cross talk between ABA and GA signal transduction pathways. It
is well known that seed dormancy and germination are regulated by
the plant hormones abscisic acid (ABA) and gibberellin (GA). These
two hormones act antagonistically with each other. ABA induces seed
dormancy in maturing embryos and inhibits germination of seeds. GA
breaks seed dormancy and promotes germination. It is conceivable
that the flowering time and ABA insensitive phenotypes observed in
the G1820 overexpressors are related to an enhanced sensitivity to
GA, or an increase in the level of GA, and that the phenotype of
the overexpressors is unrelated to ABA. In Arabidopsis, GA is
thought to be required to promote flowering in non-inductive
photoperiods. However, the drought and salt tolerant phenotypes
would indicate that ABA signal transduction is also perturbed in
these plants. It seems counterintuitive for a plant with salt and
drought tolerance to be ABA insensitive since ABA seems to activate
signal transduction pathways involved in tolerance to salt and
dehydration stresses. One explanation is that ABA levels in the
G1820 overexpressors are also high but that the plant is unable to
perceive or transduce the signal.
[1443] G1820 overexpressors also had decreased seed oil content and
increased seed protein content compared to wild-type plants
[1444] Utilities.
[1445] G1820 affects ABA sensitivity, and thus when transformed
into a plant this transcription factor or its equivalogs may
diminish cold, drought, oxidative and other stress sensitivities,
and also be used to alter plant architecture, and yield.
[1446] The osmotic stress results indicate that G1820 or its
equivalogs could be used to alter a plant's response to water
deficit conditions and can be used to engineer plants with enhanced
tolerance to drought, salt stress, and freezing. Evaporation from
the soil surface causes upward water movement and salt accumulation
in the upper soil layer where the seeds are placed. Thus,
germination normally takes place at a salt concentration much
higher than the mean salt concentration of in the whole soil
profile. Increased salt tolerance during the germination stage of a
crop plant would impact survivability and yield.
[1447] G1820 or its equivalogs could also be used to accelerate
flowering time.
[1448] G1820 or its equivalogs may be used to modify levels of
saturation in oils.
[1449] G1820 or its equivalogs may be used to seed protein
content.
[1450] The promoter of G1820 could be used to drive seed-specific
gene expression.
[1451] Utilities.
[1452] G1820 or equivalog overexpression may be used to alter seed
protein content, which may be very important for the nutritional
value and production of various food products
G1842 (SEQ ID NO: 943)
[1453] Published Information.
[1454] G1842 corresponds to F1505.2 (BAA97510). The high level of
sequence similarity between G1842 and FLOWERING LOCUS C (Michaels
and Amasino, 1999; Sheldon et al., 1999) has been previously
described (Ratcliffe et al. (2001) Plant Physiol. 126:122-132).
[1455] Experimental Observations.
[1456] G1842 was recognized as a gene highly related to Arabidopsis
FLOWERING LOCUS C (FLC; Michaels et al. (1999) Plant Cell 11,
949-956; Sheldon et al. (1999) Plant Cell 11, 445-458), and to MADS
AFFECTING FLOWERING 1 (Ratcliffe et al. (2001) Plant Physiol.
126:122-132). FLC acts as a repressor of flowering (Michaels et al.
(1999) Plant Cell 11, 949-956; Sheldon et al. (1999) Plant Cell 11,
445-458) Similarly, G157/MAF1 can cause a delay in flowering time
when overexpressed (Ratcliffe et al. (2001) Plant Physiol.
126:122-132.
[1457] The function of G1842 was studied using transgenic plants in
which this gene was expressed under the control of the 35S
promoter. Overexpression of G1842 reduced the time to flowering in
the Columbia background. No consistent alterations were detected in
35S::G1842 plants in the physiological and biochemical analyses
that were performed.
[1458] Early flowering was observed in 13/21 35S::G1842 primary
transformants: under continuous light conditions, these plants
produced flower buds approximately 1 week earlier than controls. A
comparable phenotype was also noted in the T2 populations from each
of the three lines examined. In a separate experiment, the
35S::G1842 transgene was transformed into Stockholm (a late
flowering, vernalization-sensitive ecotype). A comparable result
was observed to that seen for Columbia: approximately 50% of
35S::G1842 Stockholm plants flowered earlier than wild-type
controls.
[1459] Although G1842 is highly related in sequence to G157, G859,
and FLC, its overexpression reduced the time to flowering, whereas
overexpression of G157, G859, and FLC often caused a delay in
flowering. In other words, whereas the function of G157, G859, and
FLC appeared to repress flowering, G1842 was an activator of that
process.
[1460] Utilities.
[1461] G1842 or its equivalogs could be used to alter flowering
time.
G1843 (SEQ ID NO: 945)
[1462] Published Information.
[1463] G1843 corresponds to F1505.3 (BAA97511). There is no
literature published on G1843, except our own (Ratcliffe et al.
(2001) Plant Physiol. 126:122-132). G1843 belongs to a group of
five Arabidopsis MADS-box genes that are highly related to FLC
(G1759), a repressor of the floral transition, and that we have
called MADS AFFECTING FLOWERING 1-5 (Ratcliffe et al. (2001) Plant
Physiol. 126:122-132). The published report describes functional
data for only MAF1 (G157), but the sequence similarity among all
the members of the group is noted.
[1464] Experimental Observations.
[1465] The function of G1843 was studied using transgenic plants in
which the gene was expressed under the control of the 35S promoter.
Overexpression of G1843 caused alterations in plant growth and
development, in particular a severe reduction in overall plant
size, premature senescence, and early flowering. That G1843 caused
an effect in flowering time was expected because of its sequence
similarity to G1759 (FLC), G157 (MAF1), and G859, G1842, and G1844.
However, in contrast to all these other genes, which when
overexpressed can alter flowering time (either delay or accelerate,
depending on the gene) without severe side effects on the plant,
overexpression of G1843 was severely detrimental.
[1466] Primary transformants for 35S::G1843 were consistently
small, showed stunted growth, and formed poorly developed
inflorescences that yielded relatively few seeds. The most severely
affected of these plants were very small, and died at early stages
of development. Approximately 50% of the 35S::G1843 transformants
were also markedly early flowering and displayed visible flower
buds 1-7 days earlier than any of the wild-type controls. Most
notably, the leaves of 35S::G1843 transformants frequently senesced
prematurely. A total of six T2 lines were morphologically examined;
all exhibited (to varying extents) comparable phenotypes to those
observed in the T1 generation, showing premature senescence and
stunted growth. Due to these deleterious effects, however, an
accurate determination of flowering time was difficult to make in
the T2 generation.
[1467] The deleterious effects caused by G1843 overexpression were
also noted in the physiological analyses that were performed: in
general, the G1843 overexpressing lines showed reduced seedling
vigor and were pale compared to wild-type controls. 35S::G1843
plants behaved otherwise like wild-type controls in the
physiological assays.
[1468] No alterations were detected in 35S::G1843 plants in the
biochemical analyses that were performed.
[1469] G1843 was ubiquitously expressed and did not appear to be
significantly induced by any of the conditions tested.
G1947 (SEQ ID NO: 949)
[1470] Published Information.
[1471] The heat shock transcription factor G1947 is a member of the
class-A HSFs (Nover et al. (1996) Cell Stress Chaperones 1:
215-223) characterized by an extended HR-A/B oligomerization
domain. G1947 is found in the sequence of the chromosome 5 P1 clone
MQD19 (GenBank accession AB026651.1 GI:4757407), released by the
Arabidopsis Genome Initiative. The start codon was incorrectly
predicted in the public annotation.
[1472] Experimental Observations.
[1473] Analysis of the endogenous level of G1947 transcripts by
RT-PCR revealed a constitutive expression, with the highest
expression levels in rosette leaves and the lowest in shoots and
roots. G1947 expression appeared to be induced by a variety of
physiological or environmental conditions (auxin, ABA, heat,
drought and osmotic stress).
[1474] A line homozygous for a T-DNA insertion in G1947 was used to
analyze the function of this gene. The insertion point is 163
nucleotides downstream from the initiation codon of G1947, and
therefore should result in a null mutation.
[1475] G1947 mutant plants formed inflorescences that grew for an
extended period of time, and continued to generate flowers for
substantially longer than wild-type controls. In G1947 mutant
plants, silique development was generally poor: they were very
short and contained only a few irregularly shaped seeds. Thus, the
extended phase of flower production observed in G1947 knockout
mutant plants might have been the result of poor fertility, because
extended production of flowers and delayed floral organ abscission
is often seen in sterile Arabidopsis mutants. The basis for the
reduced fertility of G1947 knockout plants was not apparent from
the morphology of their flowers. In addition, some inconsistent
effects on seedling size were noted for G1947 knockout mutants. No
size differences were noted between rosette stage G1947 knockout
plants and controls, although at late stages the G1947 knockout
plants appeared bushier than controls, probably due to continued
growth of the inflorescence stems.
[1476] No altered phenotypes were observed for G1947 knockout
plants in any of the physiological or biochemical assays
performed.
[1477] Utilities.
[1478] G1947 or its equivalogs could be used to engineer
infertility in transgenic plants. G1947 may also have utility in
engineering plants with longer-lasting flowers for the horticulture
industry.
G2010 (SEQ ID NO: 951)
[1479] Published Information.
[1480] G2010 is a member of the SBP family of transcription factors
and corresponds to spl4 (Cardon et al., 1999). Expression of spl4
is up-regulated during development under both long day and short
day conditions and is highly expressed in the inflorescence tissue.
Expression of G2010 is localized to the rib meristem and
inter-primordial regions of the inflorescence apex (Cardon et al
(1999) Gene 237:91-104).
[1481] Closely Related Genes from Other Species.
[1482] A gene related to G2010 is squamosa-promoter binding protein
1 from Antirrhinum majus.
[1483] Experimental Observations.
[1484] The complete sequence of G2010 was determined. The function
of this gene was analyzed using transgenic plants in which G2010
was expressed under the control of the 35S promoter. Overexpression
of G2010 resulted in a clear reduction in time to flowering. Under
continuous light conditions, at 20-25.degree. C., three independent
T2 lines of 35S::G2010 plants flowered approximately one week
earlier than wild-type controls. The primary shoot of 35S::G2010
plants switched to reproductive growth after producing 5-6 rosette
leaves, compared with 8-10 rosette leaves in controls. Flower buds
were first visible 12-14 days after sowing in 35S::G2010 plants
compared with approximately 20 days for wild type. 35S::G2010
transformants were also observed to begin senescence sooner than
controls. Otherwise, plants overexpressing G2010 are wild-type in
phenotype.
[1485] Expression of G2010 was not detected by RT-PCR in any of the
tissues tested. G2010 was slightly induced in rosette leaves in
response to heat and cold stress treatments as well as salicylic
acid treatment. The expression profile for G2010 indicated that
this gene is involved in a plant's transition to flowering normally
and in response to stressful environmental conditions.
[1486] Utilities.
[1487] The potential utility of a gene such as G2010 or its
equivalogs is to accelerate flowering time.
G2347 (SEQ ID NO: 957)
[1488] Published Information.
[1489] G2347 is a member of the SBP family of transcription factors
and corresponds to spl5 (Cardon et al., 1999). Expression of spl5
is up-regulated in seedlings during development under both long day
and short day conditions and is highly expressed in the
inflorescence tissue. Expression of G2347 is specifically localized
in the inflorescence apical meristem and young flowers (Cardon et
al. (1999) Gene 237: 91-104).
Closely Related Genes from Other Species
[1490] The closest relative to G2347 is the Antirrhinum protein,
SBP2 (CAA63061). The similarity between these two proteins is
extensive enough to suggest they might have similar functions in a
plant.
[1491] Experimental Observations.
[1492] G2347 was analyzed using transgenic plants in which G2347
was expressed under the control of the 35S promoter. Overexpression
of G2347 markedly reduced the time to flowering in Arabidopsis.
This phenotype was apparent in the majority of primary
transformants and in all plants from two out of the three T2 lines
examined. Under continuous light conditions, 35S::G2347 plants
formed flower buds up a week earlier than wild type. Many of the
plants were rather small and spindly compared to controls. To
demonstrate that overexpression of G2347 could induce flowering
under less inductive photoperiods, two T2 lines were re-grown in 12
hour conditions; again, all plants from both lines bolted early,
with some initiating flower buds up to two weeks sooner than wild
type. As determined by RT-PCR, G2347 was highly expressed in
rosette leaves and flowers, and to much lower levels in embryos and
siliques. No expression of G2347 was detected in the other tissues
tested. G2347 expression was repressed by cold, and by auxin
treatments and by infection by Erysiphe. G2347 is also highly
similar to the Arabidopsis protein G2010. The level of homology
between these two proteins suggested they could have similar,
overlapping, or redundant functions in Arabidopsis. In support of
this hypothesis, overexpression of both G2010 and G2347 resulted in
early flowering phenotypes in transgenic plants.
[1493] Utilities.
[1494] G2347 or its equivalogs may be used to modify the time to
flowering in plants.
G2718 (SEQ ID NO: 959)
[1495] Published Information.
[1496] G2718 (AT1G01380) was identified in the BAC clone, F6F3
(GenBank accession AC023628). No published information on the
function(s) of G2718 is available, however, two highly related
genes, TRY and CPC have been implicated in epidermal cell
specification. The model proposes that TRY (G1816) and CPC (G225)
function as repressors of trichome and atrichoblast cell fate
(Schellmann et al. (2002) EMBO J. 21: 5036-5046).
[1497] Experimental Observations.
[1498] The function of G2718 was studied using plants in which the
gene was expressed under the control of the 35S promoter.
Overexpression of G2718 resulted in a glabrous phenotype. The
effect was highly penetrant, being observed in 17/17 primary
transformants and each of three independent T2 lines. All of the T1
lines showed a very strong phenotype and completely lacked
trichomes on leaves and stems. A comparably severe effect was
observed in one of the three T2 populations, whereas the other two
T2 populations each exhibited a weaker phenotype, suggesting that
the effect might have become partially silenced between the
generations. Trichomes were present in these weaker lines, but at a
much lower density than in wild type.
[1499] In addition to the effects on trichome density, 35S::G2718
transformants were also generally slightly smaller than wild type
controls.
[1500] The above phenotypic effects of G2718 overexpression are
consistent with the observed effects for all of the members of the
G2718 clade (G225, G226, G1826, and G682). In addition to the
morphological effects, the physiological effects are quite similar
to the other members of the clade as well. However, due to the
apparent silencing of the transgene in the T2 generation, only one
of the lines displayed a strong response. This line was clearly
glabrous, exhibited ectopic root hairs and was more tolerant to
growth under conditions of limited nitrogen.
[1501] Utilities.
[1502] The phenotypic effects of G2718 overexpression, such as the
increase in root hair formation and the increase in seedling vigor
observed in a root growth assay on N-limiting media, indicated that
the gene could be used to engineer plants with increased tolerance
to abiotic stresses such as nutrient limitation, drought, salt,
heat or cold.
[1503] The enhanced performance of G2718 overexpression lines under
low nitrogen conditions indicated that the gene could be used to
engineer crops that could thrive under conditions of reduced
nitrogen availability.
[1504] G2718 could also be used to alter anthocyanin production and
trichome formation in leaves.
Example IX
Identification of Homologous Sequences
[1505] This example describes identification of genes that are
orthologous to Arabidopsis thaliana transcription factors from a
computer homology search.
[1506] Homologous sequences, including those of paralogs and
orthologs from Arabidopsis and other plant species, were identified
using database sequence search tools, such as the Basic Local
Alignment Search Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol.
215: 403-410; and Altschul et al. (1997) Nucleic Acid Res. 25:
3389-3402). The tblastx sequence analysis programs were employed
using the BLOSUM-62 scoring matrix (Henikoff and Henikoff (1992)
Proc. Natl. Acad. Sci. 89: 10915-10919). The entire NCBI GenBank
database was filtered for sequences from all plants except
Arabidopsis thaliana by selecting all entries in the NCBI GenBank
database associated with NCBI taxonomic ID 33090 (Viridiplantae;
all plants) and excluding entries associated with taxonomic ID 3701
(Arabidopsis thaliana).
[1507] These sequences are compared to sequences representing
transcription factor genes presented in the Sequence Listing, using
the Washington University TBLASTX algorithm (version 2.0a19MP) at
the default settings using gapped alignments with the filter "off".
For each gene of SEQ ID NO: 2N-1, wherein N=1-480, individual
comparisons were ordered by probability score (P-value), where the
score reflects the probability that a particular alignment occurred
by chance. For example, a score of 3.6e-40 is 3.6.times.10-40. In
addition to P-values, comparisons were also scored by percentage
identity. Percentage identity reflects the degree to which two
segments of DNA or protein are identical over a particular length.
Examples of sequences so identified are presented in Table 7 and
Table 9. Paralogous or orthologous sequences were readily
identified and available in GenBank by Accession number (Table 7;
Test sequence ID). The percent sequence identity among these
sequences can be as low as 47%, or even lower sequence
identity.
[1508] Candidate paralogous sequences were identified among
Arabidopsis transcription factors through alignment, identity, and
phylogenic relationships. A list of paralogs is shown in Table 9.
Candidate orthologous sequences were identified from proprietary
unigene sets of plant gene sequences in Zea mays, Glycine max and
Oryza sativa based on significant homology to Arabidopsis
transcription factors. These candidates were reciprocally compared
to the set of Arabidopsis transcription factors. If the candidate
showed maximal similarity in the protein domain to the eliciting
transcription factor or to a paralog of the eliciting transcription
factor, then it was considered to be an ortholog. Identified
non-Arabidopsis sequences that were shown in this manner to be
orthologous to the Arabidopsis sequences are provided in Table
7.
Example X
Screen of Plant cDNA Library for Sequence Encoding a Transcription
Factor DNA Binding Domain that Binds to a Transcription Factor
Binding Promoter Element and Demonstration of Protein Transcription
Regulation Activity
[1509] The "one-hybrid" strategy (Li and Herskowitz (1993) Science
262: 1870-1874) is used to screen for plant cDNA clones encoding a
polypeptide comprising a transcription factor DNA binding domain, a
conserved domain. In brief, yeast strains are constructed that
contain a lacZ reporter gene with either wild-type or mutant
transcription factor binding promoter element sequences in place of
the normal UAS (upstream activator sequence) of the GALL promoter.
Yeast reporter strains are constructed that carry transcription
factor binding promoter element sequences as UAS elements are
operably linked upstream (5') of a lacZ reporter gene with a
minimal GAL1 promoter. The strains are transformed with a plant
expression library that contains random cDNA inserts fused to the
GAL4 activation domain (GAL4-ACT) and screened for blue colony
formation on X-gal-treated filters (X-gal:
5-bromo-4-chloro-3-indolyl-(3-D-galactoside; Invitrogen
Corporation, Carlsbad Calif.). Alternatively, the strains are
transformed with a cDNA polynucleotide encoding a known
transcription factor DNA binding domain polypeptide sequence.
[1510] Yeast strains carrying these reporter constructs produce low
levels of .beta.-galactosidase and form white colonies on filters
containing X-gal. The reporter strains carrying wild-type
transcription factor binding promoter element sequences are
transformed with a polynucleotide that encodes a polypeptide
comprising a plant transcription factor DNA binding domain operably
linked to the acidic activator domain of the yeast GAL4
transcription factor, "GAL4-ACT". The clones that contain a
polynucleotide encoding a transcription factor DNA binding domain
operably linked to GLA4-ACT can bind upstream of the lacZ reporter
genes carrying the wild-type transcription factor binding promoter
element sequence, activate transcription of the lacZ gene and
result in yeast forming blue colonies on X-gal-treated filters.
[1511] Upon screening about 2.times.10.sup.6 yeast transformants,
positive cDNA clones are isolated; i.e., clones that cause yeast
strains carrying lacZ reporters operably linked to wild-type
transcription factor binding promoter elements to form blue
colonies on X-gal-treated filters. The cDNA clones do not cause a
yeast strain carrying a mutant type transcription factor binding
promoter elements fused to LacZ to turn blue. Thus, a
polynucleotide encoding transcription factor DNA binding domain, a
conserved domain, is shown to activate transcription of a gene.
Example XI
Gel Shift Assays
[1512] The presence of a transcription factor comprising a DNA
binding domain which binds to a DNA transcription factor binding
element is evaluated using the following gel shift assay. The
transcription factor is recombinantly expressed and isolated from
E. coli or isolated from plant material. Total soluble protein,
including transcription factor, (40 ng) is incubated at room
temperature in 10 .mu.l of 1.times. binding buffer (15 mM HEPES (pH
7.9), 1 mM EDTA, 30 mM KCl, 5% glycerol, 5% bovine serum albumin, 1
mM DTT) plus 50 ng poly(dl-dC):poly(dl-dC) (Pharmacia, Piscataway
N.J.) with or without 100 ng competitor DNA. After 10 minutes
incubation, probe DNA comprising a DNA transcription factor binding
element (1 ng) that has been .sup.32P-labeled by end-filling
(Sambrook et al. (1989) supra) is added and the mixture incubated
for an additional 10 minutes. Samples are loaded onto
polyacrylamide gels (4% w/v) and fractionated by electrophoresis at
150V for 2 h (Sambrook et al. supra). The degree of transcription
factor-probe DNA binding is visualized using autoradiography.
Probes and competitor DNAs are prepared from oligonucleotide
inserts ligated into the BamHI site of pUC118 (Vieira et al. (1987)
Methods Enzymol. 153: 3-11). Orientation and concatenation number
of the inserts are determined by dideoxy DNA sequence analysis
(Sambrook et al. supra). Inserts are recovered after restriction
digestion with EcoRI and HindIII and fractionation on
polyacrylamide gels (12% w/v) (Sambrook et al. supra).
Example XII
Introduction of Polynucleotides into Dicotyledonous Plants
[1513] Transcription factor sequences listed in the Sequence
Listing recombined into pMEN20 or pMEN65 expression vectors are
transformed into a plant for the purpose of modifying plant traits.
The cloning vector may be introduced into a variety of cereal
plants by means well known in the art such as, for example, direct
DNA transfer or Agrobacterium tumefaciens-mediated transformation.
It is now routine to produce transgenic plants using most dicot
plants (see Weissbach and Weissbach, (1989) supra; Gelvin et al.
(1990) supra; Herrera-Estrella et al. (1983) supra; Bevan (1984)
supra; and Klee (1985) supra). Methods for analysis of traits are
routine in the art and examples are disclosed above.
Example XIII
Transformation of Cereal Plants with an Expression Vector
[1514] Cereal plants such as, but not limited to, corn, wheat,
rice, sorghum, or barley, may also be transformed with the present
polynucleotide sequences in pMEN20 or pMEN65 expression vectors for
the purpose of modifying plant traits. For example, pMEN020 may be
modified to replace the NptII coding region with the BAR gene of
Streptomyces hygroscopicus that confers resistance to
phosphinothricin. The KpnI and BglII sites of the Bar gene are
removed by site-directed mutagenesis with silent codon changes.
[1515] The cloning vector may be introduced into a variety of
cereal plants by means well known in the art such as, for example,
direct DNA transfer or Agrobacterium tumefaciens-mediated
transformation. It is now routine to produce transgenic plants of
most cereal crops (Vasil (1994) Plant Mol. Biol. 25: 925-937) such
as corn, wheat, rice, sorghum (Cassas et al. (1993) Proc. Natl.
Acad. Sci. 90: 11212-11216, and barley (Wan and Lemeaux (1994)
Plant Physiol. 104:37-48. DNA transfer methods such as the
microprojectile can be used for corn (Fromm et al. (1990)
Bio/Technol. 8: 833-839); Gordon-Kamm et al. (1990) Plant Cell 2:
603-618; Ishida (1990) Nature Biotechnol. 14:745-750), wheat (Vasil
et al. (1992) Bio/Technol. 10:667-674; Vasil et al. (1993)
Bio/Technol. 11:1553-1558; Weeks et al. (1993) Plant Physiol.
102:1077-1084), rice (Christou (1991) Bio/Technol. 9:957-962; Hiei
et al. (1994) Plant J. 6:271-282; Aldemita and Hodges (1996) Planta
199:612-617; and Hiei et al. (1997) Plant Mol. Biol. 35:205-218).
For most cereal plants, embryogenic cells derived from immature
scutellum tissues are the preferred cellular targets for
transformation (Hiei et al. (1997) Plant Mol. Biol. 35:205-218;
Vasil (1994) Plant Mol. Biol. 25: 925-937).
[1516] Vectors according to the present invention may be
transformed into corn embryogenic cells derived from immature
scutellar tissue by using microprojectile bombardment, with the
A188XB73 genotype as the preferred genotype (Fromm et al. (1990)
Bio/Technol. 8: 833-839; Gordon-Kamm et al. (1990) Plant Cell 2:
603-618). After microprojectile bombardment the tissues are
selected on phosphinothricin to identify the transgenic embryogenic
cells (Gordon-Kamm et al. (1990) Plant Cell 2: 603-618). Transgenic
plants are regenerated by standard corn regeneration techniques
(Fromm et al. (1990) Bio/Technol. 8: 833-839; Gordon-Kamm et al.
(1990) Plant Cell 2: 603-618).
[1517] The plasmids prepared as described above can also be used to
produce transgenic wheat and rice plants (Christou (1991)
Bio/Technol. 9:957-962; Hiei et al. (1994) Plant J. 6:271-282;
Aldemita and Hodges (1996) Planta 199:612-617; and Hiei et al.
(1997) Plant Mol. Biol. 35:205-218) that coordinately express genes
of interest by following standard transformation protocols known to
those skilled in the art for rice and wheat (Vasil et al. (1992)
Bio/Technol. 10:667-674; Vasil et al. (1993) Bio/Technol.
11:1553-1558; and Weeks et al. (1993) Plant Physiol.
102:1077-1084), where the bar gene is used as the selectable
marker.
Example XIV
Identification of Orthologous and Paralogous Sequences
[1518] Orthologs to Arabidopsis genes may identified by several
methods, including hybridization, amplification, or
bioinformatically. This example describes how one may identify
equivalogs to the Arabidopsis AP2 family transcription factor CBF1
(polynucleotide SEQ ID NO: 43, encoded polypeptide SEQ ID NO: 44),
which confers tolerance to abiotic stresses (Thomashow et al.
(2002) U.S. Pat. No. 6,417,428), and an example to confirm the
function of homologous sequences. In this example, orthologs to
CBF1 were found in canola (Brassica napus) using polymerase chain
reaction (PCR).
[1519] Degenerate primers were designed for regions of AP2 binding
domain and outside of the AP2 (carboxyl terminal domain):
[1520] Mol 368 (reverse) 5'-CAY CCN ATH TAY MGN GGN GT-3' (SEQ ID
NO: 1942)
[1521] Mol 378 (forward) 5'-GGN ARN ARC ATN CCY TCN GCC-3' (SEQ ID
NO: 1943)
[1522] (Y: C/T, N: A/C/G/T, H: A/C/T, M: A/C, R: A/G)
[1523] Primer Mol 368 is in the AP2 binding domain of CBF1 (amino
acid sequence: His-Pro-Ile-Tyr-Arg-Gly-Val) while primer Mol 378 is
outside the AP2 domain (carboxyl terminal domain) (amino acid
sequence: Met-Ala-Glu-Gly-Met-Leu-Leu-Pro).
[1524] The genomic DNA isolated from B. napus was PCR-amplified by
using these primers following these conditions: an initial
denaturation step of 2 min at 93.degree. C.; 35 cycles of
93.degree. C. for 1 min, 55.degree. C. for 1 min, and 72.degree. C.
for 1 min; and a final incubation of 7 min at 72.degree. C. at the
end of cycling.
[1525] The PCR products were separated by electrophoresis on a 1.2%
agarose gel and transferred to nylon membrane and hybridized with
the AT CBF1 probe prepared from Arabidopsis genomic DNA by PCR
amplification. The hybridized products were visualized by
colorimetric detection system (Boehringer Mannheim) and the
corresponding bands from a similar agarose gel were isolated using
the Qiagen Extraction Kit (Qiagen, Valencia Calif.). The DNA
fragments were ligated into the TA clone vector from TOPO TA
Cloning Kit (Invitrogen Corporation, Carlsbad Calif.) and
transformed into E. coli strain TOP10 (Invitrogen).
[1526] Seven colonies were picked and the inserts were sequenced on
an ABI 377 machine from both strands of sense and antisense after
plasmid DNA isolation. The DNA sequence was edited by sequencer and
aligned with the AtCBF1 by GCG software and NCBI blast
searching.
[1527] The nucleic acid sequence and amino acid sequence of one
canola ortholog found in this manner (bnCBF1; polynucleotide SEQ ID
NO: 1940 and polypeptide SEQ ID NO: 1941) identified by this
process is shown in the Sequence Listing.
[1528] The aligned amino acid sequences show that the bnCBF1 gene
has 88% identity with the Arabidopsis sequence in the AP2 domain
region and 85% identity with the Arabidopsis sequence outside the
AP2 domain when aligned for two insertion sequences that are
outside the AP2 domain.
[1529] Similarly, paralogous sequences to Arabidopsis genes, such
as CBF1, may also be identified.
[1530] Two paralogs of CBF1 from Arabidopsis thaliana: CBF2 and
CBF3. CBF2 and CBF3 have been cloned and sequenced as described
below. The sequences of the DNA SEQ ID NO: 45 and 47 and encoded
proteins SEQ ID NO: 46 and 48 are set forth in the Sequence
Listing.
[1531] A lambda cDNA library prepared from RNA isolated from
Arabidopsis thaliana ecotype Columbia (Lin and Thomashow (1992)
Plant Physiol. 99: 519-525) was screened for recombinant clones
that carried inserts related to the CBF1 gene (Stockinger et al.
(1997) Proc. Natl. Acad. Sci. 94:1035-1040). CBF1 was
.sup.32P-radiolabeled by random priming (Sambrook et al. supra) and
used to screen the library by the plaque-lift technique using
standard stringent hybridization and wash conditions (Hajela et al.
(1990) Plant Physiol. 93:1246-1252; Sambrook et al. supra)
6.times.SSPE buffer, 60.degree. C. for hybridization and
0.1.times.SSPE buffer and 60.degree. C. for washes). Twelve
positively hybridizing clones were obtained and the DNA sequences
of the cDNA inserts were determined The results indicated that the
clones fell into three classes. One class carried inserts
corresponding to CBF1. The two other classes carried sequences
corresponding to two different homologs of CBF1, designated CBF2
and CBF3. The nucleic acid sequences and predicted protein coding
sequences for Arabidopsis CBF1, CBF2 and CBF3 are listed in the
Sequence Listing (SEQ ID NOs: 43, 45, 47 and SEQ ID NOs: 44, 46,
48, respectively). The nucleic acid sequences and predicted protein
coding sequence for Brassica napus CBF ortholog is listed in the
Sequence Listing (SEQ ID NOs: 1940 and 1941, respectively).
[1532] A comparison of the nucleic acid sequences of Arabidopsis
CBF1, CBF2 and CBF3 indicate that they are 83 to 85% identical as
shown in Table 13.
TABLE-US-00014 TABLE 13 Percent identity.sup.a DNA.sup.b
Polypeptide cbf1/cbf2 85 86 cbf1/cbf3 83 84 cbf2/cbf3 84 85
.sup.aPercent identity was determined using the Clustal algorithm
from the Megalign program (DNASTAR, Inc.). .sup.bComparisons of the
nucleic acid sequences of the open reading frames are shown.
[1533] Similarly, the amino acid sequences of the three CBF
polypeptides range from 84 to 86% identity. An alignment of the
three amino acidic sequences reveals that most of the differences
in amino acid sequence occur in the acidic C-terminal half of the
polypeptide. This region of CBF1 serves as an activation domain in
both yeast and Arabidopsis (not shown).
[1534] Residues 47 to 106 of CBF1 correspond to the AP2 domain of
the protein, a DNA binding motif that to date, has only been found
in plant proteins. A comparison of the AP2 domains of CBF1, CBF2
and CBF3 indicates that there are a few differences in amino acid
sequence. These differences in amino acid sequence might have an
effect on DNA binding specificity.
Example XV
Transformation of Canola with a Plasmid Containing CBF1, CBF2, or
CBF3
[1535] After identifying homologous genes to CBF1, canola was
transformed with a plasmid containing the Arabidopsis CBF1, CBF2,
or CBF3 genes cloned into the vector pGA643 (An (1987) Methods
Enzymol. 253: 292). In these constructs the CBF genes were
expressed constitutively under the CaMV 35S promoter. In addition,
the CBF1 gene was cloned under the control of the Arabidopsis COR15
promoter in the same vector pGA643. Each construct was transformed
into Agrobacterium strain GV3101. Transformed Agrobacteria were
grown for 2 days in minimal AB medium containing appropriate
antibiotics.
[1536] Spring canola (B. napus cv. Westar) was transformed using
the protocol of Moloney et al. (1989) Plant Cell Reports 8: 238,
with some modifications as described. Briefly, seeds were
sterilized and plated on half strength MS medium, containing 1%
sucrose. Plates were incubated at 24.degree. C. under 60-80
.mu.E/m.sup.2s light using a16 hour light/8 hour dark photoperiod.
Cotyledons from 4-5 day old seedlings were collected, the petioles
cut and dipped into the Agrobacterium solution. The dipped
cotyledons were placed on co-cultivation medium at a density of 20
cotyledons/plate and incubated as described above for 3 days.
Explants were transferred to the same media, but containing 300
mg/l timentin (SmithKline Beecham, Pa.) and thinned to 10
cotyledons/plate. After 7 days explants were transferred to
Selection/Regeneration medium. Transfers were continued every 2-3
weeks (2 or 3 times) until shoots had developed. Shoots were
transferred to Shoot-Elongation medium every 2-3 weeks. Healthy
looking shoots were transferred to rooting medium. Once good roots
had developed, the plants were placed into moist potting soil.
[1537] The transformed plants were then analyzed for the presence
of the NPTII gene/kanamycin resistance by ELISA, using the ELISA
NPTII kit from 5Prime-3Prime Inc. (Boulder, Colo.). Approximately
70% of the screened plants were NPTII positive. Only those plants
were further analyzed.
[1538] From Northern blot analysis of the plants that were
transformed with the constitutively expressing constructs, showed
expression of the CBF genes and all CBF genes were capable of
inducing the Brassica napus cold-regulated gene BN115 (homolog of
the Arabidopsis COR15 gene). Most of the transgenic plants appear
to exhibit a normal growth phenotype. As expected, the transgenic
plants are more freezing tolerant than the wild-type plants. Using
the electrolyte leakage of leaves test, the control showed a 50%
leakage at -2 to -3.degree. C. Spring canola transformed with
either CBF1 or CBF2 showed a 50% leakage at -6 to -7.degree. C.
Spring canola transformed with CBF3 shows a 50% leakage at about
-10 to -15.degree. C. Winter canola transformed with CBF3 may show
a 50% leakage at about -16 to -20.degree. C. Furthermore, if the
spring or winter canola are cold acclimated the transformed plants
may exhibit a further increase in freezing tolerance of at least
-2.degree. C.
[1539] To test salinity tolerance of the transformed plants, plants
were watered with 150 mM NaCl. Plants overexpressing CBF1, CBF2, or
CBF3 grew better compared with plants that had not been transformed
with CBF1, CBF2, or CBF3.
[1540] These results demonstrate that equivalogs of Arabidopsis
transcription factors can be identified and shown to confer similar
functions in non-Arabidopsis plant species.
Example XVI
Cloning of Transcription Factor Promoters
[1541] Promoters are isolated from transcription factor genes that
have gene expression patterns useful for a range of applications,
as determined by methods well known in the art (including
transcript profile analysis with cDNA or oligonucleotide
microarrays, Northern blot analysis, semi-quantitative or
quantitative RT-PCR). Interesting gene expression profiles are
revealed by determining transcript abundance for a selected
transcription factor gene after exposure of plants to a range of
different experimental conditions, and in a range of different
tissue or organ types, or developmental stages. Experimental
conditions to which plants are exposed for this purpose includes
cold, heat, drought, osmotic challenge, varied hormone
concentrations (ABA, GA, auxin, cytokinin, salicylic acid,
brassinosteroid), pathogen and pest challenge. The tissue types and
developmental stages include stem, root, flower, rosette leaves,
cauline leaves, siliques, germinating seed, and meristematic
tissue. The set of expression levels provides a pattern that is
determined by the regulatory elements of the gene promoter.
[1542] Transcription factor promoters for the genes disclosed
herein are obtained by cloning 1.5 kb to 2.0 kb of genomic sequence
immediately upstream of the translation start codon for the coding
sequence of the encoded transcription factor protein. This region
includes the 5'-UTR of the transcription factor gene, which can
comprise regulatory elements. The 1.5 kb to 2.0 kb region is cloned
through PCR methods, using primers that include one in the 3'
direction located at the translation start codon (including
appropriate adaptor sequence), and one in the 5' direction located
from 1.5 kb to 2.0 kb upstream of the translation start codon
(including appropriate adaptor sequence). The desired fragments are
PCR-amplified from Arabidopsis Col-0 genomic DNA using
high-fidelity Taq DNA polymerase to minimize the incorporation of
point mutation(s). The cloning primers incorporate two rare
restriction sites, such as Not1 and Sfi1, found at low frequency
throughout the Arabidopsis genome. Additional restriction sites are
used in the instances where a Not1 or Sfi1 restriction site is
present within the promoter.
[1543] The 1.5-2.0 kb fragment upstream from the translation start
codon, including the 5'-untranslated region of the transcription
factor, is cloned in a binary transformation vector immediately
upstream of a suitable reporter gene, or a transactivator gene that
is capable of programming expression of a reporter gene in a second
gene construct. Reporter genes used include green fluorescent
protein (and related fluorescent protein color variants),
.beta.-glucuronidase, and luciferase. Suitable transactivator genes
include LexA-GAL4, along with a transactivatable reporter in a
second binary plasmid (as disclosed in U.S. patent application Ser.
No. 09/958,131, incorporated herein by reference). The binary
plasmid(s) is transferred into Agrobacterium and the structure of
the plasmid confirmed by PCR. These strains are introduced into
Arabidopsis plants as described in other examples, and gene
expression patterns determined according to standard methods know
to one skilled in the art for monitoring GFP fluorescence,
.beta.-glucuronidase activity, or luminescence.
Example XVII
Cloning and Transformation of MAF2 (SEQ ID NO: 567), MAF3 (SEQ ID
NO: 943), MAF4 (SEQ ID NO: 945), and MAF5 (SEQ ID NO: 947) into
Arabidopsis Plants
[1544] Experiments were performed using Arabidopsis of ecotype
Columbia (Col-0, Lot #199-014; Lehle Seeds, Round Rock Tex.) except
where otherwise indicated. Stockholm accession (CS6863) and Pitztal
accession (CS6832) lines were supplied by the Arabidopsis
Biological Resource Center (ABRC; Ohio State University, Columbus
Ohio). The fca-9 allele was in a Columbia background (Page et al.
(1999) Plant J. 17: 231-239). Transgenic 35S:FLC lines were
generated as described by Ratcliffe et al. (2001) supra.
[1545] Arabidopsis plants were transformed by the floral dip method
(Bechtold and Pelletier, 1998; Clough and Bent (1998) supra) using
Agrobacterium carrying a standard transformation vector, pMEN20 or
pMEN65 (Mendel Biotechnology, Inc., Hayward Calif.), which
contained a kanamycin resistance selectable marker system driven by
a nos promoter and MAF1-5 (SEQ ID NOs: 1734, 567, 943, 945, and
947, respectively) or FLC (SEQ ID NO: 1874) cDNA oriented 3' to a
CaMV 35S promoter.
[1546] In all experiments, seeds were sterilized by a 2 minute EtOH
treatment followed by 20 minutes in 30% bleach/0.01% Tween and five
washes in distilled water. Seeds were sown to MS agar in 0.1%
agarose and stratified for 3-5 days at 4.degree. C., before
transfer to growth rooms with a temperature of 20-25.degree. C. MS
media was supplemented with 50 mg/l kanamycin for selection of
transformed plants. Plants were transplanted to soil after 8 days
of growth on plates, when grown under continuous light, and after
10 days when grown under 8 or 12 hour photoperiods. For
vernalization treatments, seeds were sown to MS agar plates, sealed
with micropore tape, and placed in a 4.degree. C. cold room with
low light levels. The plates were then transferred to the growth
rooms alongside plates containing freshly sown non-vernalized
controls, which had received a short cold stratification of 3 days
(to synchronize germination). Time to flowering was measured as
days to flower a flower bud becoming visible and/or in terms of the
total number of leaf nodes formed by the primary shoot meristem.
Rosette leaves were counted when a visible inflorescence of
approximately three centimeters was apparent.
[1547] cDNAs for each of the FLC/MAF1-like (MAF) sequences were
identified either among clones in a library derived from leaf RNA,
or by a combination of RACE and RT-PCR performed on RNA derived
from mixed tissue samples of the Columbia accession. Alternative
transcripts were detected for each of the four genes. All these MAF
sequences are listed in Table 5B. At least four variants of
At5g65050 (MAF2; SEQ ID NO: 567) were identified; variant V (SEQ ID
NO: 1950) encodes a 171 amino acid protein (SEQ ID NO: 1951).
Variants II and III (SEQ ID NOs: 1944 and 1946) differ in their 3'
region but both generate a protein of 145 amino acids (SEQ ID NOs:
1945 and 1946), the last 20 residues of which are different from
the 196 amino acid full-length version. Variant IV (SEQ ID NO:
1948) comprises a truncated form of variant I, and would give rise
to a small polypeptide of 80 amino acids (SEQ ID NO: 1949).
[1548] At5g65060 (MAF3; SEQ ID NO: 943) and At5g65070 (MAF4; SEQ ID
NO: 945) both displayed at least 5 variants. The longest MAF3
product, encoded by variant I (SEQ ID NO: 943), is 196 amino acids
in length (SEQ ID NO: 944). MAF3 variants II and 111 (SEQ ID NOs:
1952 and 1954) encode 185 (SEQ ID NO: 1953) and 118 (SEQ ID NO:
1955) amino acid proteins respectively, whilst variants IV and V
(SEQ ID NO: 1956 and 1958) both generate products of 77 amino acids
in length (SEQ ID NOs: 1957 and 1959, but differ at in their 3'
regions. The longest MAF4 clone identified, variant I (SEQ ID NO:
945) encodes a protein of 200 amino acids (SEQ ID NO: 946). MAF4
variant II (SEQ ID NO: 1960) encodes a 136 amino acid product (SEQ
ID NO: 1961) whereas MAF4 variants III, IV, and V (SEQ ID NOs:
1962, 1964, and 1966) encode very short polypeptides of 63 (SEQ ID
NO: 1963), 66 (SEQ ID NO: 1965), and 69 (SEQ ID NO: 1967) amino
acids respectively.
[1549] Two alternative variants of At5g65080 (MAF2) (SEQ ID NO:
947) were identified (SEQ ID NOs: 947 and 1968) which encode
polypeptides of 198 (SEQ ID NO: 948) and 184 (SEQ ID NO: 1969)
amino acids, respectively. The significance of these alternative
transcripts is unclear; alternative splicing for MAF1 has been
described previously (Ratcliffe et al. (2001) supra; Scortecci et
al. (2001) supra), whereas for FLC (SEQ ID NO: 1874), it has not
been reported.
[1550] MAF2 variants II and 111 (SEQ ID NOs: 1944 and 1946) were
randomly isolated from an in-house library derived from Arabidopsis
leaf mRNA. All other MAF clones were isolated by RT-PCR on RNA
extracted from whole vegetative Columbia seedlings. RNA was
extracted from plant tissue using a CTAB based protocol (Jones et
al. (1995) supra), poly(A)+ RNA was purified using
oligo(dT)-cellulose (Life Technologies, Inc., Rockville Md.), and
first stand cDNA synthesis was performed using a SUPERSCRIPT kit
(Life Technologies).
[1551] To confirm the genes boundaries, 3' RACE was first performed
using a SMART RACE cDNA Amplification kit (Clontech, Palo Alto
Calif.) and two rounds of PCR (30 cycles and 25 cycles) were
performed using the following gene specific primers:
TABLE-US-00015 MAF2: first round, (SEQ ID NO: 1974)
AAGAAGCAAAAAACATTGTGGGTCTCCG, second round, (SEQ ID NO: 1975)
CGTCTCCGGCTCCGGAAAACTCTACAAG; MAF3: first round, (SEQ ID NO: 1976)
CTGTTGTCGCCGTCTCCGGTTCCGGAAA, second round, (SEQ ID NO: 1977)
ACTCTACGACTCTGCCTCCGGTGACAA: MAF4: first round, (SEQ ID NO: 1978)
ATCAAACGAATTGAGAACAAAAGCTCTC, second round, (SEQ ID NO: 1979)
CTTATCATCATCTCTGCCACCGGAAGAC; MAF5: first round, (SEQ ID NO: 1980)
GGGGATTAGATGTGTCGGAAGAGTGAAG, second round, (SEQ ID NO: 1981)
AACTCTACAACTCCTCCTCCGGCGACAG;
[1552] RACE products were then cloned to the pGEM-T Easy vector
(Promega, Madison Wis.) and sequenced. Following RACE analysis, MAF
cDNA clones were PCR-isolated from cDNA using the primers listed
below, and then ligated into the transformation vector, following
digestion with the restriction enzymes indicated below.
TABLE-US-00016 MAF2: (KpnI/NotI) (SEQ ID NO: 1982)
GAGGGGTACCACATTGTGGGTCTCCGGTGATTAGGATC and (SEQ ID NO: 1983)
GGGAAAGCGGCCGCAATCAGGCTGTAAGTTTAAGGTGAAAGC; MAF3: (KpnI/NotI) (SEQ
ID NO: 1984) GAGGGGTACCAGAAAAAAAGCAAACACATTTTGGGTCC and (SEQ ID NO:
1985) GGGAAAGCGGCCGCACAAGAACTCTGATATTTGTCTACTAAG; MAF4: (SalI/NotI)
(SEQ ID NO: 1986) GCACGCGTCGACCAAATTAGGTCAGAAGAATTAGTCGGAG and (SEQ
ID NO: 1987) GGGAAAGCGGCCGCTCTCCTTGGATGACTTTTCCGTAGCAGG; MAF5:
(SalI/NotI) (SEQ ID NO: 1988)
GCACGCGTCGACGGGGATTAGATGTGTCGGAAGAGTGAAG and (SEQ ID NO: 1989)
GGGAAAGCGGCCGCGATCCTGTCTTCCAAGGTAACACAAAGG.
For semi-quantitative RT-PCR expression studies, the following
primers were used:
TABLE-US-00017 FLC: (SEQ ID NO: 1990)
TTAGTATCTCCGGCGACTTGAACCCAAACC and (SEQ ID NO: 1991)
AGATTCTCAACAAGCTTCAACATGAGTTCG; MAF2: (SEQ ID NO: 1992)
ACATTGTGGGTCTCCGGTGATTAGGATC and (SEQ ID NO: 1993)
AATCAGGCTGTAAGTTTAAGGTGAAAGC; MAF3: (SEQ ID NO: 1994)
GAAGAAAAAAAGCAAACACATTTTGGGTCC and (SEQ ID NO: 1995)
AAGAACTCTGATATTTGTCTACTAAGGTAC; MAF4: (SEQ ID NO: 1996)
ATTAGGTCAGAAGAATTAGTCGGAGAAAAC and (SEQ ID NO: 1997)
CTTGGATGACTTTTCCGTAGCAGGGGGAAG; MAF5: (SEQ ID NO: 1998)
GGGGATTAGATGTGTCGGAAGAGTGAAG and (SEQ ID NO: 1999)
GATCCTGTCTTCCAAGGTAACACAAAGG: Actin: (SEQ ID NO: 2000)
AGAGATTCAGATGCCCAGAAGTCTTGTTCC and (SEQ ID NO: 2001)
AACGATTCCTGGACCTGCCTCATCATACTC; SOC1: (SEQ ID NO: 2002)
GGCATACTAAGGATCGAGTCAGCACCAAAC and (SEQ ID NO: 2003)
ACCCAATGAACAATTGCGTCTCTACTTCAG.
[1553] The T-DNA insertion event within MAF2 was initially detected
in a pooled collection of approximately 3,000 lines, and then
de-replicated to a single plant, by multiple rounds of PCR using
the following pairs of T-DNA left border (LB) and gene specific
(GS) primers:
TABLE-US-00018 First round (40 cycles): (SEQ ID NO: 2004) LB,
CTCATCTAAGCCCCCATTTGGACGTGAATG and (SEQ ID NO: 2005) GS,
CAGGCTGTAAGTTTAAGGTGAAAGCTCA. Second round (40 cycles): (SEQ ID NO:
2006) LB nested, TTGCTTTCGCCTATAAATACGACGGATCG and (SEQ ID NO:
2007) GS nested, TGATGATGGTGATTACTTGAGCAGCGGA.
[1554] The insertion position was confirmed by sequencing of the
PCR products. Homozygous plants for the MAF2 T-DNA insertion were
then identified by the absence of a band following 40 cycles of PCR
with the following pair of gene specific primers:
AAGACAGAACTAATGATGGGGGAAGTGAAGTCC (SEQ ID NO: 2008)
and TACGAAGGTACAATAAAGATCTACTATAGC (SEQ ID NO: 2009)
[1555] which resided on either side of the insertion locus.
Example XVIII
Examples of Genes that Confer Significant Improvements to
Plants
[1556] Examples of genes and homologs that confer significant
improvements to knockout or overexpressing plants are noted below.
Experimental observations made by us with regard to specific genes
whose expression has been modified in overexpressing or knock-out
plants, and potential applications based on these observations, are
also presented.
[1557] SEQ ID NOs: 567, 943, 945, 947, 1734, 1874, 1970, and 1972
(G859, G1842, G1843, G1844, G157, G1759, Soy1, and Soy3,
respectively) and the encoded polypeptides can be used to alter
flowering time.
[1558] SEQ ID NO: 1944, SEQ ID NO: 1946, SEQ ID NO: 1948, SEQ ID
NO: 1950, SEQ ID NO: 1952, SEQ ID NO: 1954, SEQ ID NO: 1956, SEQ ID
NO: 1958, SEQ ID NO: 1960, SEQ ID NO: 1962, SEQ ID NO: 1964, SEQ ID
NO: 1966, and SEQ ID NO: 1968, and the encoded polypeptides can be
used to alter flowering time.
[1559] Differences in flowering time displayed by 35S::G859,
35S::G1842, 35S::G1843, 35S::G1844, 35S::G157, and 35S::G1759
transformants indicates that the gene or its homologs can be used
to manipulate the flowering time of commercial species (see
"Detailed description of genes, traits and utilities that affect
plant characteristics; Flowering time: late flowering", above).
Example XIX
Identification of a T-DNA insertion mutant for MAF2 (SEQ ID NO:
567)
[1560] A single plant hemizygous for a T-DNA insertion within
At5g65050 was identified by PCR screening of an in-house collection
of random insertion lines. Sequencing from a primer matching the
left T-DNA border revealed that the T-DNA resided within the
predicted final intron of the gene (a position corresponding to
nucleotide 3443 of At5g65050 (SEQ ID NO: 567), within the final
intron of the putative full-length splice-variant). Self crossed
seed were collected from the individual containing the insertion,
and these progeny were examined in the next generation. The progeny
plants were genotyped using PRC, and four out of twenty individual
plants were identified as being homozygous for the T-DNA insertion.
These four individual plants all showed visible flower buds at 13
days under continuous light conditions, at least two days earlier
than any of the wild-type Columbia ecotype control plants, or any
of their hemizygous or wild-type siblings growing in the same flat.
Thus, it appeared that At5g65050 functioned as a repressor of the
floral transition. At5g65050 was therefore designated as MAF2 (MADS
AFFECTING FLOWERING 2; SEQ ID NO: 567). Homozygous seed was
collected from the four individual early flowering plants. To
examine the effects of the mutation on endogenous MAF2 expression,
RNA was extracted from pooled 10-day-old seedlings in the next
generation. Semi-quantitative RT-PCR was performed, using primers
specific to MAF2; endogenous MAF2 transcripts in the maf2 seedlings
were undetectable, but strong endogenous MAF2 expression was
detected in the wild-type controls, demonstrating that MAF2
activity had been substantially reduced or eliminated in the maf2
mutant (see FIG. 10).
[1561] FIG. 10 shows the effect of vernalization on the maf2
mutant: (A) the maf2 mutant is marginally earlier flowering than
wild type Columbia, in the absence of vernalization; plants are
shown after 50 days growth under a 12-hour photoperiod; imbibed
seeds were stratified for 3 days at 4.degree. C. before transfer to
the growth room; (B) the maf2 mutant is considerably earlier
flowering than wild type Columbia following a short vernalization
treatment; plants are shown after 45 days under a 12-hour
photoperiod; imbibed seeds were cold treated for 15 days at
4.degree. C. before transfer to the growth room; (C) the maf2
mutant responds prematurely to vernalization; chart in Table 15
depicts data from experiment 4; bars represent days to visible
flower bud under a 12-hour photoperiod, following 4.degree. C.
cold-treatments of 3, 6, 10, 15, 21, and 85 days on imbibed seeds;
error bars indicate standard errors to which 95% confidence limits
have been attached; note that a 10-day cold treatment significantly
reduced time to flowering in the maf2 mutant, but not in wild type
Columbia ecotype; (D) expression of FLC, MAF2 and SOC1 in maf2 and
wild type Columbia seedlings following cold treatments of 3, 6, 10,
15, 21, and 85 days on imbibed seeds; RNA was extracted from pools
of ten whole seedlings after 10 days growth under 12-hour light,
and expression monitored by reverse transcriptase PCR (FLC, 30
cycles; MAF2, 35 cycles; SOC1, 30 cycles; actin, 25 cycles). The
`forward slash` symbol (/) in FIG. 10 identifies a water control;
the premature vernalization response of maf2 seen in (C) does not
appear to be correlated with a premature decline in FLC levels, or
a premature increase of SOC1; note that MAF2 transcript is absent
from the maf2 seedlings, but is present at a constant level between
the 3, 6, 10, 15, and 21-day time points in wild type, then
declines by the 85 day sample; note that the MAF2 product is a
doublet corresponding to splice-variants II and I.
Example XX
MAF2 Functions as a Floral Repressor that Prevents Vernalization in
Response to Short Cold Periods
[1562] Populations of homozygous maf2 and wild-type plants were
grown under continuous light, a 12-hour photoperiod, and an 8-hour
photoperiod. In each case, the maf2 plants on average flowered
slightly earlier than the controls in terms of both days to visible
flower buds and total leaf number (see experiment 1, Table 15).
Thus, MAF2 acts as a floral repressor, but appears to play a
relatively minor role in determining flowering time under the
conditions of these experiments.
[1563] Null mutants for flc show a very much weaker response to
vernalization than wild type (Michaels and Amasino (2001) supra).
However, the fact that flc mutants can exhibit a vernalization
response demonstrates that other factors must contribute to
maintenance of a vernalization requirement. To test whether MAF2
could be one of those factors, batches of germinating wild type and
maf2 seedlings were subjected to an extensive cold treatment of 52
days. The seedlings were then grown alongside non-vernalized
controls under a 12-hour photoperiod (see experiment 2, Table 15).
In this experiment, non-vernalized maf2 plants produced flower buds
around 6 days sooner than non-vernalized wild type, confirming our
earlier observations. However, maf2 seedlings showed a similar
response to wild type. Vernalization of maf2 seedlings reduced the
time to bud emergence by 31% and the total leaf number by 47% (with
respect to non-vernalized maf2 plants). By comparison, in the
wild-type seedlings, vernalization produced a 34% (time to bud
emergence) and a 53% (total leaf number) reduction, respectively.
The vernalization response of the maf2 mutant contrasts with the
weaker response described for flc mutants (Michaels and Amasino
(2001) supra). Thus, although MAF2 acts as a floral repressor,
either it does not directly maintain a vernalization requirement in
the same manner as FLC, or has a more minor role in the maintenance
of a vernalization requirement.
[1564] An additional experiment was performed in which batches of
maf2 and wild-type seedlings were subjected to a cold treatment for
a period of only 10 days. Following this treatment, the maf2
population flowered proportionally much earlier than in any of our
previous experiments (see experiment 3, Table 15), with a mean
total leaf number of 11.1+/-0.7 versus 19.0+/-0.8 in wild-type. To
confirm this result, batches of maf2 and wild type plants were
given a range of different cold-treatments: 3, 6, 10, 15, 21, and
85 days (see FIG. 10 and Experiment 4, Table 15). maf2 plants given
intermediate cold-periods of 10, 15, 21 days (which time is not
sufficiently long to elicit a full vernalization in the wild-type)
showed a strong response and flowered disproportionately early.
Thus, a specific role of MAF2 appeared to be the repression of
premature vernalization in response to brief cold spells.
[1565] To test whether the observed acceleration of flowering in
the maf2 mutant was accompanied by a decline in FLC levels RNA was
extracted from whole seedlings at 10 days following the cold
treatments. RT-PCR experiments showed that FLC levels declined
progressively in relation to the duration of the cold treatment
(see FIG. 10) and which confirmed the results of Sheldon et al.
((2000) supra). However, for each of the time-points there were no
clear discernible differences in FLC levels between maf2 and the
wild-type controls (see FIG. 10). Thus, the premature vernalization
response in the maf2 seedlings was apparently induced independently
of changes in FLC transcription.
[1566] In both the maf2 and the wild-type samples, it was observed
that by 10 day cold time-point, FLC levels had already fallen very
substantially when compared to the 3 and 6 day time points (see
FIG. 10D). However, despite this decline in FLC levels, there was
very little difference in the flowering time of wild-type plants
that had received 10, 15, or 21 days of cold compared to those that
had been given 6 days of cold. A very marked reduction in flowering
time was seen only in the wild type plants that had been given the
extensive 85 day cold treatment. By contrast, in the maf2 mutant, a
10-day cold treatment substantially accelerated flowering, and a
21-day cold treatment produced an equivalent effect to that caused
by an 85 days of cold treatment. RT-PCR with MAF2 specific primers
was then performed. MAF2 transcript was absent from the maf2
mutant. However, in contrast to FLC, MAF2 levels in the wild type
were identical between the 3, 6, 10, 15, and 21-day time points.
However, MAF2 expression had declined in the 85 day cold treatment
sample, for which a pronounced reduction in flowering time was
observed. These data suggested that MAF2 expression compensated for
the apparent decline in FLC levels caused by the 10, 15, or 21 day
cold treatments, and thereby have maintained flowering at the same
time as for the 6 day cold treatment in wild type.
Example XXI
Overexpression of MAF2, MAF3, MAF4, or MAF5, Modifies Flowering
Time
[1567] To further investigate the role of MAF2 as a floral
repressor, and determine whether At5g65060, At5g65070, and
At5g65080 could also affect flowering time, transgenic Arabidopsis
lines containing the full-length cDNA of each of the genes
expressed from the 35SCaMV promoter were analyzed.
[1568] Overexpression lines for each of the FLC/MAF1 paralogs
(At5g65060, At5g65070, and At5g65080) displayed various alterations
in the timing of flowering compared to wild-type control plants
(see Tables 16 and 17). Flowering time was monitored in primary
transformants and/or in a number of independent lines in the second
generation, and the results are described in detail below.
Accordingly, the At5g65060, At5g65070, and At5g65080 loci were
designated as MADS AFFECTING FLOWERING 3, 4, and 5 (MAF3, (SEQ ID
NO: 943); MAF4, (SEQ ID NO: 945); and MAF5, (SEQ ID NO: 947)),
respectively.
Example XXII
Overexpression of MAF2 (SEQ ID NO: 567) Produces Similar Phenotypes
to Overexpression of FLC or MAF1 in the Columbia and Stockholm
Backgrounds
[1569] Two separate batches of primary 35S:MAF2 primary
transformants in the Columbia ecotype were examined under
conditions of continuous light. In the two experiments,
approximately half of lines flowered early, displaying visible
flower buds around a week earlier, and producing significantly
fewer leaves than control plants lacking the transgene (see Table
16). In batch 1 (see experiment 5) 3 of 20 T1 plants flowered
within the wild-type range; in batch 2 (see experiment 6) 10 of 19
T1 plants flowered within the wild-type range. However, in both
sets of plants, a small proportion of the lines flowered distinctly
later than wild type.
[1570] The progeny of two late flowering 35S:MAF2 lines and two
early flowering 35S:MAF2 Columbia lines were examined in the T2
generation (see experiment 8, Table 17). All individuals from the
two late lines (line T2-16 and line T2-24) also flowered markedly
later than wild-type controls in the T2 generation, under
conditions of either 24 or 12 hours light. In contrast, the
phenotype of the early flowering lines was less consistent between
generations. Under continuous light conditions, no significant
difference in flowering time was observed in terms of either days
to visible flower bud, or total leaf number. Under the less
inductive conditions of 12 hours light, however, a very marginal
acceleration of flowering was noted. Thus, the most consistent
effect of MAF2 overexpression, between generations, was a delay in
flowering, even though the majority of lines were early flowering
as primary transformants. Semi-quantitative RT-PCR studies
performed on rosette leaves from the T1 plants revealed that the
late flowering lines had higher levels of MAF2 overexpression than
the early flowering lines.
[1571] The effects of MAF2 (SEQ ID NO: 567) overexpression were
also tested using the late flowering Stockholm accession (which has
significantly higher levels of FLC than Columbia accession, Sheldon
et al. (1999) supra; Michaels and Amasino (1999) supra; Ratcliffe
et al. (2001) supra) Similar data were obtained to those from the
Columbia accession were obtained with the Stockholm lines: 6 of 13
lines flowered early, 6 of 13 lines flowered within the wild-type
range, and a single line flowered 2-3 weeks late (see experiment 7,
Table 16). Therefore, the effects of MAF2 overexpression were the
same irrespective of FLC levels, with a substantial number of lines
flowering early and a minority of lines flowering late.
[1572] The MAF2 overexpression data paralleled those that had been
described for FLC or MAF1. Although FLC and MAF1 had been
established to be repressors of flowering (Sheldon et al. (1999)
supra; Michaels and Amasino (1999) supra; Ratcliffe et al. (2001)
supra; Scortecci et al. (2001) supra), FLC and MAF1 induce
flowering in a high proportion of lines, when overexpressed in
accessions other than Landsberg. In the Landsberg accession, FLC or
MAF1 overexpression produced late flowering, but no early flowering
lines were noted (Michaels and Amasino (1999) supra; Ratcliffe et
al. (2001) supra; Scortecci et al. (2001) supra). Comparable data
were acquired when the 35S:MAF2 construct was transformed into the
Landsberg accession; only late flowering lines were obtained (see
experiment 11, Table 12). The MAF2 overexpression data, combined
with the acceleration of flowering observed in the maf2 mutant,
indicated that MAF2 is a repressor of flowering.
Example XXIII
MAF2 (SEQ ID NO: 567) Prevents Vernalization Independently of FLC
Transcription, but Represses SOC1 Expression
[1573] To examine whether MAF2 (SEQ ID NO: 567) could delay or
prevent vernalization, 35S:MAF2 seedlings were tested to evaluate
the response to extensive cold treatments (see FIG. 16 and Table
17, experiments 9 and 10). Two separate studies were performed; in
the first instance, batches of 35S:MAF2 (T2 from the late flowering
line 16; T1-16) and wild-type germinating seedlings were placed in
a cold room at 4.degree. C. for a period of 76 days, and then
transferred to a growth room (12-hour photoperiod, 20-25.degree.
C.) alongside a freshly sown non-treated batch. In the repeat
experiment, seedlings were cold-treated for 56 days and then
transferred to a second growth room (24 hours light, 20-25.degree.
C.). In both experiments, 35S:MAF2 plants were completely
unresponsive to the cold treatment and flowered as late as the
non-vernalized specimens grown alongside. The wild-type control
plants (and wild-type segregants from the 35S:MAF2 population)
verified the effectiveness of the vernalization treatment; in both
the experiments cold-treated wild-type plants flowered
significantly earlier than non-treated individuals.
[1574] To determine if this absence of a vernalization response was
due to MAF2 preventing a fall in FLC transcript levels following
cold-treatments, RT-PCR experiments were performed on cold treated
and non-treated 35S:MAF2 seedlings that had been harvested at 8
days following transfer into the growth room. Although the
cold-treated 35S:MAF2 seedlings were as late flowering as their
non-treated siblings, FLC transcript abundance was greatly reduced
to levels similar to those found in vernalized wild-type plants
(see FIG. 11).
[1575] FIG. 11 shows the effects of MAF2 (SEQ ID NO: 567)
overexpression in the Columbia accession.
[1576] FIG. 11A shows that 35S:MAF2 plants were late flowering and
did not respond to vernalization. Plants are shown after
approximately 50 days under a 12-hour photoperiod, following a 10
week 4.degree. C. cold-treatment on the imbibed seeds. FIG. 11B
shows expression of FLC, MAF2, and SOC1 in wild type Columbia,
35S:MAF2, and 35S:FLC seedlings. RNA was extracted from pools of
ten whole seedlings after 10 days growth under 12-hour light,
following either a 3-day cold stratification (-, non-vernalized) or
a 76-day vernalization treatment (+, vernalized). Expression was
monitored by RT-PCR (25 cycles). Note that no significant changes
in FLC levels are apparent in the 35S:MAF2 samples relative to the
wild-type control, and the SOC1 levels are repressed in the
35S:MAF2 plants in a comparable manner to the 35S:FLC samples.
[1577] Levels of FLC transcript in the non-vernalized 35S:MAF2
plants were also much lower than in 35S:FLC controls. Thus,
although MAF2 is capable of preventing a premature vernalization
response, it cannot inhibit the eventual depletion of FLC
transcript by long cold-treatments. Furthermore, the fact that
cold-treated 35S:MAF2 plants were late flowering, despite
containing undetectable levels of FLC, indicated that MAF2 could
repress flowering via pathways independent or downstream of
FLC.
[1578] A major target of repression by FLC is the MADS-box gene
SOC1 (Michaels and Amasino (2001) supra). To test whether the
mechanism by which MAF2 (SEQ ID NOs: 567 and 568) can also
influence downstream targets of the FLC repression pathway, SOC1
expression levels were examined in the 35S:MAF2 seedlings (see FIG.
11). SOC1 expression levels were extremely low, compared to wild
type Columbia plants, in both vernalized and non-vernalized
35S:MAF2 plants. Thus, MAF2 overexpression was sufficient to
maintain repression of SOC1, even when repression by FLC had been
reduced via extensive cold treatments.
Example XXIV
Effects of MAF3 (SEQ ID NO: 943), MAF4 (SEQ ID NO: 945), and MAF5
(SEQ ID NO: 947) Overexpression
[1579] Given that MAF2 (like FLC and MAF1) acts as a repressor of
flowering, the remaining three MAF transcription factors, MAF3 (SEQ
ID NO: 943), MAF4 (SEQ ID NO: 945), and MAF5 (SEQ ID NO: 947) were
tested to identify if there were similar repression effects on
flowering time when overexpressed in a transgenic plant.
1. Overexpression of the MAF3 (SEQ ID NO: 943) Accelerates
Flowering in the Columbia and Stockholm, but Delays Flowering in
the Landsberg Ecotype
[1580] In the case of MAF3, Columbia lines overexpressing MAF3 (SEQ
ID NO: 943) displayed accelerated flowering. In two separate
experiments, fourteen out of a total of eighteen 35S:MAF3 primary
transformants (Columbia accession) displayed flower buds several
earlier than wild-type plants under continuous light conditions
(see experiments 5 and 6, Table 16). In contrast, no late flowering
MAF3 overexpression lines were obtained in the Columbia accession,
and the remaining transformants flowered at a wild-type time. The
progeny of three early flowering MAF3 overexpression lines were
also examined and these also flowered sooner than wild-type
controls in the T2 generation (see experiment 8, Table 17).
Comparable results were obtained upon overexpression of MAF3 in the
Stockholm accession (see experiment 7, Table 16). Ten out of 20
lines (all primary transformants) flowered earlier than controls.
Of the remaining lines, seven flowered at a wild-type time and
three lines were scored as flowering marginally late. However, this
delay was not significantly different from wild type in terms of
total leaf number. Given that no substantially late flowering
overexpression lines were obtained in Columbia or Stockholm, MAF3
was observed to have contrasting effects to FLC, MAF1, and MAF2.
Nevertheless, a number of 35S:MAF3 Landsberg accession lines were
clearly late flowering, particularly under non-inductive
photoperiodic conditions of 12-hour light (see experiment 11, Table
17). Thus, either overexpression levels of MAF3 in the Columbia and
Stockholm accession lines were not sufficiently high enough to
cause severe repression, or MAF3 or MAF3 protein requires a partner
to act as a repressor in those accessions, but alone is sufficient
to act as a repressor in Landsberg accession.
2. Overexpression of MAF4 (SEQ ID NO: 945) Modifies Flowering Time
but Produces Deleterious Effects on Growth and Development
[1581] For unknown reasons, transcriptional overexpression of the
third gene in the Arabidopsis chromosomal cluster, MAF4 (SEQ ID NO:
945), produced many pleiotropic effects on growth and development.
35S:MAF4 lines were often very small, stunted, displayed a slow
growth rate, and formed poorly developed inflorescences that set
relatively few seeds. Additionally, some lines exhibited premature
senescence of rosette leaves, whilst others arrested growth during
the seedling stage and senesced without flowering. Despite these
deleterious effects however, alterations in flowering time could
still be observed. As described above, approximately half of the
MAF3 Columbia overexpression lines flowered earlier than controls
(see experiments 5 and 6, Table 16). In contrast, a single 35S:MAF4
Columbia T1 plant was late flowering. A number of late flowering
lines were also obtained in the Stockholm and Landsberg accessions,
showing that the gene can repress flowering (see experiment 7,
Table 16, and experiment 11, Table 17, respectively).
3. Effects of MAF5 (SEQ ID NO: 947) Overexpression
[1582] Overexpression of the fourth gene in the Arabidopsis
chromosomal cluster, MAF5 (SEQ ID NO: 947), produced somewhat
inconsistent effects on flowering time (see Tables 16 and 17). In a
first study (see experiment 5, Table 16), five of ten 35S:MAF5
Columbia transformants flowered significantly earlier than
wild-type controls, whereas the remainder flowered at a wild-type
time. In a second study (see experiment 6, Table 16), in which a
larger number of lines were examined, only three of nineteen lines
flowered early. Fifteen of the remaining lines showed a wild-type
flowering time whilst a single plant flowered slightly late, making
a slightly larger number of leaves than controls, but displaying
flower buds at the same date. The progeny of three early flowering
35S:MAF5 lines were examined in the T2 generation in both
continuous light and a 12 hour photoperiod, but neither showed a
consistent difference in flowering time from wild-type (see
experiment 8, Table 17). Thus, although MAF5 appeared to promote
flowering in Columbia accession, such effects varied between
experiments, generations and genetic backgrounds suggesting that
this result was conditional on unresolved variables.
[1583] The 35S:MAF5 transgene was also introduced into Stockholm
accession (see experiment 7, Table 16). In this experiment, all
except two of the lines flowered within the wild-type range. The
remaining two lines were observed to flower marginally later than
wild type (either a leaf or a day later). As with MAF2-4, delayed
flowering occurred when MAF5 was overexpressed in Landsberg
accession, however such effects were much less marked than for
MAF2-4. Thus, although the Landsberg results indicated that MAF5
could delay flowering, the floral repression activity of MAF5
appeared less extreme than for MAF2, MAF3 and MAF4.
Example XXV
Endogenous Expression of MAF3 (SEQ ID NO: 943) and MAF4 (SEQ ID NO:
945) Repressed by Vernalization; Endogenous Expression of MAF5 (SEQ
ID NO: 947) Up-Regulated by Vernalization
[1584] The mutant analysis of maf2 along with the overexpression
studies on MAF2-5 (SEQ ID NOs: 567, 943, 945, and 947,
respectively) demonstrated that each of the genes could influence
flowering time, and that MAF2 (SEQ ID NO: 567) prevents premature
vernalization. Using RT-PCR analysis, it was observed that all of
these genes were expressed across a wide range of tissue types
(data not shown) similarly to that which had been described for FLC
and MAF1 (Sheldon et al. (1999) supra; Michaels and Amasino (1999)
supra; Alvarez-Buylla (2000b) Plant J. 24: 457-466; Ratcliffe et
al. (2001) supra; Scortecci et al. (2001) supra). A key feature of
the mechanism by which FLC acts is that FLC transcript and protein
levels decrease in response to long cold treatments of 4-6 weeks,
thereby allowing the floral transition to occur (Sheldon et al.
(1999) supra; Michaels and Amasino (1999) supra; Sheldon et al.
(2000) supra; Rouse et al. (2002) supra). The expression levels of
MAF1 are also affected by vernalization in certain genetic
backgrounds (Ratcliffe et al. (2001) supra).
[1585] To examine whether expression levels of endogenous MAF2-5
(SEQ ID NOs: 567, 943, 945, and 947, respectively) were also
influenced by vernalization, expression of each of the genes were
compared between vernalized and non-vernalized seedlings by RT-PCR
using gene specific primers (see FIG. 8). FIG. 8 shows the effects
of vernalization on expression of MAF2-5 (SEQ ID NOs: 567, 943,
945, and 947, respectively) in different genetic (accession)
backgrounds.
[1586] RNA was extracted from pools of 10-20, 8-day old seedlings
grown under continuous light conditions. Expression was monitored
by RT-PCR (MAF1-5 (SEQ ID NOs: 9, 567, 943, 945, and 947,
respectively), and FLC (SEQ ID NO: 1874), 30 cycles; actin, 25
cycles). Vernalized (+) samples were cold-treated for 6 weeks at
4.degree. C., whereas non-vernalized (-) samples were stratified
for only 3 days at 4.degree. C. as imbibed seeds. Col=Columbia,
Pi-0=Pitztal, St-0=Stockholm, fca=fca-9 mutant. Note that FLC
levels are lower in vernalized than non-vernalized samples,
confirming the efficacy of the treatment. MAF2 (SEQ ID NO: 567)
levels are similar between vernalized and non-vernalized seedlings
from all backgrounds. MAF3 (SEQ ID NO: 943) and MAF4 (SEQ ID NO:
945) transcript levels are lower in vernalized compared to
non-vernalized samples for each of the different backgrounds. MAF5
(SEQ ID NO: 947) transcript levels, in contrast to MAF1-5 and FLC,
were elevated in vernalized compared to non-vernalized samples for
each of the different backgrounds.
[1587] Germinating seeds from a number of genetic backgrounds were
vernalized in a cold room for a period of 6 weeks and then
transferred to a growth chamber along with freshly sown
non-vernalized controls. After 8 days in continuous light
conditions, whole seedlings were harvested and RNA was extracted.
FLC transcript levels were substantially higher in non-vernalized
versus vernalized seedlings, in all of the backgrounds, confirming
the efficacy of the treatment. In this experiment, MAF2 (SEQ ID NO:
567) transcripts displayed no clear consistent differences in
expression level between non-vernalized plants and those given a 6
week cold treatment. However, in other experiments, MAF2 transcript
levels were eventually reduced following excessively long cold
treatments, of up to 10-12 weeks (see FIGS. 10 and 11). Both MAF3
(SEQ ID NO: 943) and MAF4 (SEQ ID NO: 945) appeared responsive to a
6-week vernalization, and their expression paralleled that of FLC;
transcript levels of MAF3 and MAF4 appeared somewhat elevated in
fca and Stockholm compared to Columbia seedlings; in all
backgrounds, transcript levels were markedly lower in vernalized
compared to non-vernalized samples.
[1588] MAF5 (SEQ ID NO: 947) showed an opposite endogenous
expression pattern compared with FLC. In all of the genetic
backgrounds, endogenous MAF5 transcript levels were low in
non-vernalized samples and became elevated in seedlings that had
been vernalized. Thus, although the MAF2-5 genes are arranged in a
very tight cluster on the Arabidopsis chromosome, their expression
appears to be under distinct modes of transcriptional regulation,
yet remain involved in the plant's response to cold treatment.
[1589] FIG. 9 is a schematic diagram summarizing the observed
responses of FLC and MAF1-5 (SEQ ID NOs: 1874, 1734, 567, 943, 945,
and 947, respectively) to vernalization and their potential effects
on the floral transition. Arrows indicate positive interactions,
blunt-ended lines denote inhibition.
Example XXVI
Identification of Homologous Sequences
[1590] This example describes identification of genes that are
orthologous to Arabidopsis thaliana MAF transcription factors from
a computer homology search.
[1591] Homologous sequences, including those of paralogs and
orthologs from Arabidopsis and other plant species, were identified
using database sequence search tools, such as the Basic Local
Alignment Search Tool (BLAST) (Altschul et al. (1990) J. Mol. Biol.
215:403-410; Altschul et al. (1997) Nucleic Acid Res. 25:
3389-3402). The tblastx sequence analysis programs were employed
using the BLOSUM-62 scoring matrix (Henikoff and Henikoff (1992)
Proc. Natl. Acad. Sci. 89: 10915-10919). The entire NCBI GenBank
database was filtered for sequences from all plants except
Arabidopsis thaliana by selecting all entries in the NCBI GenBank
database associated with NCBI taxonomic ID 33090 (Viridiplantae;
all plants) and excluding entries associated with taxonomic ID 3701
(Arabidopsis thaliana).
[1592] These sequences were compared to sequences representing
genes of SEQ IDs NOs: 568, 944, 946, 948, 1735, 1875, 1971, and
1973, using the Washington University TBLASTX algorithm (version
2.0a19MP) at the default settings using gapped alignments with the
filter "off". For each gene of SEQ IDs NOs: 568, 944, 946, 948,
1735, and 1875, individual comparisons were ordered by probability
score (P-value), where the score reflects the probability that a
particular alignment occurred by chance. For example, a score of
3.6e-40 is 3.6.times.10-40. In addition to P-values, comparisons
were also scored by percentage identity. Percentage identity
reflects the degree to which two segments of DNA or protein are
identical over a particular length. Examples of sequences so
identified are presented in Table 7 and Table 9. Paralogous or
orthologous sequences were readily identified and available in
GenBank by Accession number (Table 7; Test sequence ID). The
percent sequence identity among these sequences can be as low as
47%, or even lower sequence identity.
[1593] In addition, the sequences representing genes of SEQ IDs
NOs: 568, 944, 946, 948, 1735, and 1875, were compared using the
Washington University TBLASTX algorithm, as described above, to
sequences in a proprietary database comprising polynucleotide
sequences isolated from soy. In this manner, SEQ ID NOs: 1014,
1971, and 1973 from soy were identified as putative orthologs and
the soy sequences were then compared as queries with a proprietary
Arabidopsis transcription factor database using the Washington
University TBLASTX algorithm, as described above (reciprocal
BLAST). In each case, the subject sequence with the highest
probability score was one of SEQ IDs NOs: 568, 944, 946, 948, 1735,
and 1875, thereby confirming that SEQ ID NOs: 1014, 1971, and 1973
are, more likely than not, soy MAF transcription factor orthologs
of the Arabidopsis MAF transcription factors.
[1594] Candidate paralogous sequences were identified among
Arabidopsis MAF transcription factors through alignment, identity,
and phylogenic relationships. A list of paralogs is shown in Table
9. Candidate orthologous sequences were identified from proprietary
unigene sets of plant gene sequences in Zea mays, Glycine max, and
Oryza sativa based on significant homology to Arabidopsis MAF
transcription factors. These candidates were reciprocally compared
to the set of Arabidopsis MAF transcription factors. If the
candidate showed maximal similarity in the protein domain to the
eliciting MAF transcription factor or to a paralog of the eliciting
MAF transcription factor, then it was considered to be an ortholog.
Identified non-Arabidopsis sequences that were shown in this manner
to be orthologous to the Arabidopsis sequences are provided in
Table 7.
Example XXVII
Introduction of MAF Polynucleotides into Dicotyledonous Plants
[1595] SEQ ID NO: 567, SEQ ID NO: 943, SEQ ID NO: 945, SEQ ID NO:
947, SEQ ID NO: 1734, SEQ ID NO: 1874, SEQ ID NO: 1014, SEQ ID NO:
1970, SEQ ID NO: 1972, SEQ ID NO: 1944, SEQ ID NO: 1946, SEQ ID NO:
1948, SEQ ID NO: 1950, SEQ ID NO: 1952, SEQ ID NO: 1954, SEQ ID NO:
1956, SEQ ID NO: 1958, SEQ ID NO: 1960, SEQ ID NO: 1962, SEQ ID NO:
1964, SEQ ID NO: 1966, SEQ ID NO: 1968, SEQ ID NO: 1970, SEQ ID NO:
172, paralogous, orthologous, and homologous sequences recombined
into pMEN20 or pMEN65 expression vectors are transformed into a
plant for the purpose of modifying plant traits. The cloning vector
may be introduced into a variety of cereal plants by means
well-known in the art such as, for example, direct DNA transfer or
Agrobacterium tumefaciens-mediated transformation. It is now
routine to produce transgenic plants using most dicot plants (see
Weissbach and Weissbach (1989) supra; Gelvin et al. (1990) supra;
Herrera-Estrella et al. (1983) supra; Bevan (1984) supra; and Klee
(1985) supra). Methods for analysis of traits are routine in the
art and examples are disclosed above.
[1596] All references, publications, patent documents, web pages,
and other documents cited or mentioned herein are hereby
incorporated by reference in their entirety for all purposes.
Although the invention has been described with reference to
specific embodiments and examples, it should be understood that one
of ordinary skill can make various modifications without departing
from the spirit of the invention. The scope of the invention is not
limited to the specific embodiments and examples provided.
Sequence CWU 0 SQTB SEQUENCE LISTING The patent application
contains a lengthy "Sequence Listing" section. A copy of the
"Sequence Listing" is available in electronic form from the USPTO
web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140201864A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
0 SQTB SEQUENCE LISTING The patent application contains a lengthy
"Sequence Listing" section. A copy of the "Sequence Listing" is
available in electronic form from the USPTO web site
(http://seqdata.uspto.gov/?pageRequest=docDetail&DocID=US20140201864A1).
An electronic copy of the "Sequence Listing" will also be available
from the USPTO upon request and payment of the fee set forth in 37
CFR 1.19(b)(3).
* * * * *
References