U.S. patent application number 14/036989 was filed with the patent office on 2014-03-27 for screening methods using g-protein coupled receptors and related compositions.
This patent application is currently assigned to Chugai Pharmaceutical Co., Ltd.. The applicant listed for this patent is Chugai Pharmaceutical Co., Ltd., The General Hospital Corporation. Invention is credited to Thomas J. GARDELLA, Fumihiko Ichikawa, Harald Juppner, Makoto Okazaki, John T. Potts, JR., Masaru Shimizu.
Application Number | 20140086842 14/036989 |
Document ID | / |
Family ID | 40305140 |
Filed Date | 2014-03-27 |
United States Patent
Application |
20140086842 |
Kind Code |
A1 |
GARDELLA; Thomas J. ; et
al. |
March 27, 2014 |
SCREENING METHODS USING G-PROTEIN COUPLED RECEPTORS AND RELATED
COMPOSITIONS
Abstract
The present invention provides screening methods for GPCRs based
on the discovery that the affinity of a receptor agonist for a GPCR
(such as the parathyroid hormone receptor) when not bound to a
G-protein is correlated with the length of time over which the
agonist is effective, independently of its pharmacokinetic
properties. The invention also provides PTH- and PTHrP-derived
polypeptides.
Inventors: |
GARDELLA; Thomas J.;
(Needham, MA) ; Potts, JR.; John T.; (Newton,
MA) ; Shimizu; Masaru; (Shizuoka, JP) ;
Ichikawa; Fumihiko; (Tokyo, JP) ; Juppner;
Harald; (Lexington, MA) ; Okazaki; Makoto;
(Shizuoka, JP) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Chugai Pharmaceutical Co., Ltd.
The General Hospital Corporation |
Tokyo
Boston |
MA |
JP
US |
|
|
Assignee: |
Chugai Pharmaceutical Co.,
Ltd.
Tokyo
MA
The General Hospital Corporation
Boston
|
Family ID: |
40305140 |
Appl. No.: |
14/036989 |
Filed: |
September 25, 2013 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12671429 |
Nov 8, 2010 |
8568737 |
|
|
PCT/US08/09288 |
Aug 1, 2008 |
|
|
|
14036989 |
|
|
|
|
60963117 |
Aug 1, 2007 |
|
|
|
60963082 |
Aug 2, 2007 |
|
|
|
60963867 |
Aug 6, 2007 |
|
|
|
Current U.S.
Class: |
424/9.2 ;
435/7.21 |
Current CPC
Class: |
G01N 2333/645 20130101;
A61P 17/00 20180101; A61P 7/00 20180101; A61P 13/12 20180101; A61P
3/12 20180101; C07K 14/635 20130101; A61P 5/18 20180101; G01N
2333/726 20130101; A61P 19/02 20180101; C07K 14/723 20130101; A61P
19/08 20180101; A61P 43/00 20180101; A61P 19/10 20180101; A61P 7/04
20180101; A61K 38/00 20130101; A61P 19/00 20180101; G01N 33/56966
20130101; G01N 33/74 20130101; A61K 49/00 20130101; A61P 3/00
20180101 |
Class at
Publication: |
424/9.2 ;
435/7.21 |
International
Class: |
G01N 33/569 20060101
G01N033/569; A61K 49/00 20060101 A61K049/00 |
Goverment Interests
STATEMENT AS TO FEDERALLY FUNDED RESEARCH
[0002] This invention was made with United States Government
support under Grant DK 11794 awarded by the National Institute of
Health. The Government has certain rights to this invention.
Claims
1. A method for determining whether a candidate compound is a
long-acting agonist of a G protein coupled receptor (GPCR), said
method comprising: (a) contacting said GPCR with said compound,
wherein said GPCR is in the RG form; (b) measuring the affinity of
said compound for the RG form of said GPCR; (c) contacting said
GPCR with said compound, wherein said GPCR is in the R.sup.0 form;
and (d) measuring the affinity of said compound for the R.sup.0
form of said GPCR, wherein a compound that (i) that has an affinity
for the RG form of said GPCR that is at least 10% of an endogenous
agonist for said GPCR, and (ii) has a greater affinity for the
R.sup.0 form of said GPCR than said endogenous agonist is
identified as a long-acting agonist of said GPCR.
2. The method of claim 1, further comprising the steps of: (e)
administering said candidate compound to an animal, and (f)
measuring at least one physiological response of said animal to
said compound.
3. The method of claim 1, wherein said receptor is a human
receptor.
4. The method of claim 1, wherein said GPCR is a secretin family
receptor.
5. The method of claim 4, wherein said receptor is a PTH/PTHrP
receptor.
6. The method of claim 5, wherein said PTH/PTHrP receptor is a
human receptor.
7. The method of claim 5, wherein said measuring step (b) is
performed by measuring intracellular or blood calcium levels.
8. The method of claim 1, wherein said measuring step (b) or step
(d) is performed using a competition binding assay.
9. The method of claim 8, wherein said competition binding assay
uses a ligand that is specific for the RG form or specific for the
R.sup.0 form of the GPCR.
10. The method of claim 1, wherein said measuring step (b) is
performed using a delayed cAMP assay.
11. The method of claim 1, wherein said R.sup.0 form of said GPCR
is enriched using a nonhydrolizable nucleotide analog.
12. The method of claim 11, wherein said nucleotide analog is
GTP.gamma.S.
13. The method of claim 1, wherein said RG form of said GPCR is
enriched using a dominant-negative G-protein.
14. The method of claim 1, wherein said receptor is on a cell or in
a membrane.
15. The method of claim 1, wherein said candidate compound
comprises a peptide.
16. The method of claim 1, wherein said candidate compound is from
a chemical library or natural product library.
17. A method for determining whether a candidate compound is a
short-acting agonist of a G protein coupled receptor (GPCR), said
method comprising: (a) contacting said GPCR with said compound,
wherein said GPCR is in the RG form; (b) measuring the affinity of
said compound for the RG form of said GPCR; (c) contacting said
GPCR with said compound, wherein said GPCR is in the R.sup.0 form;
and (d) measuring the affinity of said compound for the R.sup.0
form of said GPCR, wherein a compound that (i) that has an affinity
for the RG form of said GPCR that is at least 10% of an endogenous
agonist for said GPCR, and (ii) has a lower affinity for the
R.sup.0 form of said GPCR than said endogenous agonist is
identified as a short-acting agonist of said GPCR.
18. The method of claim 17, wherein said receptor is a human
receptor.
19. The method of claim 17, further comprising the steps of: (e)
administering said candidate compound to an animal, and (f)
measuring at least one physiological response of said animal to
said compound.
20. The method of claim 16, wherein said GPCR is a secretin family
receptor.
21. The method of claim 20, wherein said receptor is a PTH/PTHrP
receptor.
22. The method of claim 21, wherein said PTH/PTHrP receptor is a
human receptor.
23. The method of claim 21, wherein said measuring step (b) is
performed by measuring intracellular or blood calcium levels.
24. The method of claim 17, wherein said measuring step (b) or step
(d) is performed using a competition binding assay.
25. The method of claim 23, wherein said competition binding assay
uses a ligand that is specific for the RG form or specific for the
R.sup.0 form of the GPCR.
26. The method of claim 17, wherein said measuring step (b) is
performed using a delayed cAMP assay.
27. The method of claim 17, wherein said R.sup.0 form of said GPCR
is enriched using a nonhydrolizable nucleotide analog.
28. The method of claim 11, wherein said nucleotide analog is
GTP.gamma.S.
29. The method of claim 17, wherein said RG form of said GPCR is
enriched using a dominant-negative G-protein.
30. The method of claim 17, wherein said receptor is on a cell or
in a membrane.
31. The method of claim 17, wherein said candidate compound
comprises a peptide.
32. The method of claim 17, wherein said candidate compound is from
a chemical library or a natural product library.
Description
CROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application is a division of U.S. application Ser. No.
12/671,429, filed Nov. 8, 2010, which is the national stage of
International Application No. PCT/US2008/009288, filed Aug. 1,
2008, which claims the benefit of U.S. Application Nos. 60/963,117,
filed Aug. 1, 2007; 60/963,082, filed Aug. 2, 2007; and 60/963,867,
filed Aug. 6, 2007, each of which is hereby incorporated by
reference.
REFERENCE TO A SEQUENCE LISTING
[0003] A sequence listing is provided in this patent document as a
.txt file entitled "00786.533005 Sequence Listing ST25.txt,"
created Sep. 3, 2013 (size 91.6 kB). The content of this file is
hereby incorporated by reference.
BACKGROUND OF THE INVENTION
[0004] In general, the invention relates to a screening method for
agonists of G-protein coupled receptors (GPCRs) with prolonged or
short-lived activity. More specifically, the invention is related
to parathyroid (PTH) hormone or PTH-related protein (PTHrP) ligand
analogs that have either more prolonged or shorter-lived activity
on the PTH receptor (PTHR) than does PTH(1-34). The invention also
relates PTHR ligands identified using the methods of the invention
and uses of such ligands in treating disease.
[0005] GPCRs are large group of membrane receptors which, in
response to activation by an agonist, activate G-proteins which
then, in turn, cause activation of at least one signaling cascade,
such as the cyclic AMP/protein kinase A cascade. This large groups
of receptors is found in organisms ranging from bacteria to man,
and are involved in, for example, hormonal, neuronal, and olfactory
signal transduction.
[0006] The parathyroid hormone receptor (PTHR, SEQ ID NO:1 for
human and SEQ ID NO:2 for rat) is the endogenous receptor for both
PTH and PTH related protein (PTHrP), yet each ligand has a distinct
biological function. PTH regulates calcium and phosphate
homeostasis and acts as a gland-secreted endocrine hormone on
target cells in bone and kidney. PTH also reduces the reabsorption
of inorganic phosphate (P.sub.i) largely through its effects on
sodium-dependent phosphate transporters (NaP.sub.i-IIa and
NaP.sub.i-IIc) located in renal proximal tubule (PT) cells. PTHrP
regulates cell proliferation and differentiation programs in
developing tissues, and is secreted and acts in a paracrine fashion
within tissue primordia (Kronenberg, H. M. Ann. N.Y. Acad. Sci.
1068:1-13 (2006)).
[0007] PTH (SEQ ID NO:3) and PTHrP (SEQ ID NO:4) are most
homologous in their amino-terminal (residues 1-14) signaling
domains (eight amino acid identities), and show moderate homology
in their 14-34 binding domains (three identities). It has been
generally inferred that the fully active (residues 1-34) portions
of PTH and PTHrP interact with the PTHR via largely identical
mechanisms (Caulfield et al., Endocrinology 127:83-87 (1990);
Abou-Samra et al., Endocrinology 125:2215-2217 (1989)). This
mechanism is thought to consist of two principal components: an
interaction between the carboxy-terminal binding domain of the
ligand and the amino-terminal extracellular (N) domain of the
receptor, and an interaction between the amino-terminal signaling
domain of the ligand and the juxtamembrane (J) region of the
receptor, which contains the intracellular loops and seven
transmembrane helices (Hoare et al., J. Biol. Chem. 276:7741-7753
(2001); Castro et al., Proc. Natl. Acad. Sci. USA 102:16084-16089
(2005); Witelsberger et al., Biochemistry 45:2027-2034 (2006);
Shimizu et al., J. Biol. Chem. 280:1797-1807 (2005); Gensure et
al., Biochem. Biophys. Res. Commun. 328:666-678 (2005)). However,
the extent, if any, to which the precise mechanisms of binding used
by the two ligands differ remains to be determined.
[0008] In humans, PTH(1-34) (SEQ ID NO:5) has potent, bone-anabolic
effects, and induces marked increases in bone mineral density and
bone strength. Indeed, recombinant human PTH(1-34) is now
considered to be one of the most effective treatments for
osteoporosis (Tashjian and Gagel, J. Bone Miner. Res 21:354-365
(2006)). Importantly, hPTH(1-34) must be administered in a
pulsatile fashion (e.g., once daily subcutaneous injection) in
order for its bone-forming effects to be realized. With more
prolonged administrations, as with a sustained infusion pump
mechanism, PTH(1-34) exerts a net catabolic effect on bone, due to
a greater activation of the bone-resorptive responses mediated by
the osteoclasts, relative to the bone-forming responses mediated by
the osteoblasts. The duration of exposure of the PTH receptor in
bone to a PTH ligand is thus a key determinant of the overall
bone-formation response achieved by that ligand, and thus its
effectiveness as a treatment for osteoporosis.
[0009] Clinical studies have shown that PTHrP(1-36) (SEQ ID NO:6)
can also increase bone mineral density in humans, and can do so
approximately to the same extent as does PTH(1-34), although higher
doses are required (Horwitz et al., J. Endocrinol. Metab.
88:569-575 (2003). Importantly, even at such higher doses,
PTHrP(1-36) did not stimulate the adverse, bone resorptive and
hypercalcemic responses that would be expected for equivalent doses
of PTH(1-34) (Horwitz et al., J. Endocrinol. Metab. 88:569-575
(2003); Horwitz et al., J. Bone Miner. Res. 20:1792-1803 (2005);
Horwitz et al., Osteoporosis Int. 17:225-230 (2006)). The
difference in biological activity of the two peptides is not due
merely to a difference in pharamacokinetics. A direct comparison of
the two peptides using steady-state infusions methods showed that
PTHrP(1-36) is markedly less efficacious than PTH(1-34) for
stimulating the renal synthesis of 1,25-(OH).sub.2vitamin D3
(Horwitz et al., J. Bone. Mineral. Research. 20:1792-1803
(2005)).
[0010] In addition to osteoporosis, hPTH(1-34) (SEQ ID NO:5) has
been shown to be effective in treating conditions of PTH
deficiency, namely hypoparathyroidism. Thus, PTH(1-34) was shown to
be a safe and effective alternative to calcitriol therapy and was
able to maintain normal serum calcium levels without hypercalciuria
in patients with hypoparathyroidism (Winer et al., J. Clin.
Endocrinol. Metab. 88:4214-4220 (2003)). The peptide had to be
injected at least twice daily, and the authors recognized the need
in this disease for a long-acting PTH(1-34) analog (Winer et al.,
J. Clin. Endocrinol. Metab. 88:4214-4220 (2003).
[0011] Therefore, there exists a need in the art for PTH or PTHrP
analogs that have longer- or shorter-lived actions on the PTH
receptor than does PTH(1-34). There also exists a need for assays
that allow one to distinguish between PTH peptides that have
short-versus long-acting effects.
SUMMARY OF THE INVENTION
[0012] According to classical GPCR theory, two forms of a
G-protein-coupled receptor can be distinguished: a form (RG) that
is bound to a G-protein and a form (R) that is not bound to a
G-protein. GPCR signaling requires that the G-protein be directly
activated by the receptor, i.e., the RG state must form, and this
RG formation can be induced by binding of an agonist ligand.
Binding of an agonist ligand induces or stabilizes the RG state,
and reciprocally, the RG state stabilizes the high affinity binding
of an agonist. Upon binding GTP, or, a non-hydrolyzable GTP analog,
such as GTP.gamma.S, a receptor-coupled G protein will dissociate
from the receptor, causing the receptor to revert to a low affinity
state. It is now recognized that some GPCRs, like the PTHR, can
form a novel state (R.sup.0) that can bind certain agonist ligands
with high affinity even in the presence of GTP.gamma.S, and hence,
even when the receptor is presumably not bound by a G protein. In
general, the proportions of a GPCR in a cell that are in the, RG,
R, or R.sup.0 state may vary, depending on cell type and
conditions. For these reasons, prior work on assessing the binding
of ligands to a GPCR generally did not clearly distinguish between
the RG, R, or R.sup.0 states. The present inventors, studying the
PTH receptor, an exemplary GPCR, have discovered that ligands which
bind with high affinity to the R.sup.0 state, in addition to the RG
state, have a longer activity half-life than ligands that bind to
R.sup.0 with lower affinity, and that this prolonged activity does
not depend on the bioavailability or the pharmacokinetics of the
ligand in vivo. Correspondingly, agonists with a short duration of
action have a lower affinity for the R.sup.0 form of the receptor.
Based on this discovery, the invention provides methods for
identification of either long-acting or short-acting GPCR agonists,
and peptide agonists identified using the methods of the
invention.
[0013] In a first aspect, the invention provides a method for
determining whether a candidate compound is a long-acting agonist
of a G protein coupled receptor (GPCR). The method includes (a)
contacting the GPCR with the compound, where the GPCR is in the RG
form, (b) measuring the affinity of the compound for the RG form of
the GPCR, (c) contacting the GPCR with the compound, where the GPCR
is in the R.sup.0 form, and (d) measuring the affinity of the
compound for the R.sup.0 form of the GPCR, where a compound that
(i) has an affinity for the RG form of the GPCR that is at least 1%
(e.g., 5, 10, 25, 30, 50, 60, 75, 90, 100, 125, 150, 200, 150, 300,
400, 500, 750, or 1000%) of an endogenous agonist for the GPCR, and
(ii) has a greater affinity (e.g., 1, 5, 10, 25, 50, 100, 200, 500,
1000, 2000, 5000, or 10,000% greater) for the R.sup.0 form of the
GPCR than the endogenous agonist or is identified as a long-acting
agonist of the GPCR. The method may further include the steps of
(e) administering the candidate compound to an animal, and (f)
measuring at least one physiological response of the animal to the
compound. The receptor may be a human receptor. The GPCR may be a
secretin family receptor (e.g., a PTH/PTHrP receptor such as a
human PTH/PTHrP receptor). When the receptor is involved in calcium
homeostasis or transport, the measuring step (b) or (f) may be
performed by measuring intracellular or blood calcium levels. For
any GPCR, the affinity-measuring step (b) or step (d) may be
performed using a competition binding assay. The competition
binding assay may use a ligand that is specific for the RG form or
specific for the R.sup.0 form of the GPCR. The measuring step (b)
may be performed using a delayed cAMP assay (e.g., as described
herein). The R.sup.0 form of the GPCR may enriched using a
nonhydrolizable nucleotide analog (e.g., GTP.gamma.S). The RG form
of the GPCR may be enriched using a dominant-negative G-protein.
The receptor may be on a cell or in a membrane. The candidate
compound may include a peptide or may be from a chemical library or
natural product library.
[0014] In another aspect, the invention also features a method for
determining whether a candidate compound is a short-acting agonist
of a G protein coupled receptor (GPCR). The method includes (a)
contacting the GPCR with the compound, where the GPCR is in the RG
form, (b) measuring the affinity of the compound for the RG form of
the GPCR, (c) contacting the GPCR with the compound, where the GPCR
is in the R.sup.0 form; and (d) measuring the affinity of the
compound for the R.sup.0 form of the GPCR, where a compound that
(i) has an affinity for the RG form of the GPCR that is at least 1%
(e.g., 5, 10, 25, 30, 50, 60, 75, 90, 100, 125, 150, 200, 150, 300,
400, 500, 750, or 1000%) of an endogenous agonist for the GPCR, and
(ii) has a lower affinity (e.g., 99, 95, 90, 85, 75, 65, 55, 50,
40, 30, 25, 15, 10, 5, 1, 0.5, 0.1, 0.05, 0.01, 0.005, 0.001,
0.0005, or 0.0001%) for the R.sup.0 form of the GPCR than the
endogenous agonist is identified as a short-acting agonist of the
GPCR. The receptor may be a human receptor. The method may further
including the steps of (e) administering the candidate compound to
an animal, and (f) measuring at least one physiological response of
the animal to the compound. The GPCR may be a secretin family
receptor (e.g., a PTH/PTHrP receptor such a human PTH/PTHrP
receptor). When the receptor is involved in calcium homeostasis or
transport, measuring step (b) may be performed by measuring
intracellular calcium levels. For any GPCR, the measuring step (b)
or step (d) is performed using a competition binding assay (e.g.,
using a ligand that is specific for the RG form or specific for the
R.sup.0 form of the GPCR). The measuring step (b) may be performed
using a delayed cAMP assay. In certain embodiments, the R.sup.0
form of the GPCR may be enriched using a nonhydrolizable nucleotide
analog (e.g., GTP.gamma.S). The RG form of the GPCR may be enriched
using a dominant-negative G-protein. The receptor may be on a cell
or in a membrane. The candidate compound may include a peptide or
may be from a chemical library or a natural product library.
[0015] In another aspect the invention features a polypeptide
having a low affinity for PTH R.sup.0 (e.g., and a high affinity
for RG). The polypeptide may be a short-acting agonist or may be RG
selective. The polypeptide may have an amino acid sequence modified
by a substitution, deletion and/or addition of one or more (e.g.,
2, 3, 4, 5, 6, 7, 8) amino acids relative to the wild-type PTH or
PTHrP sequence. The polypeptide may have a histidine at position 5
or an alanine at position 20, 23, 24, or 28. The polypeptide may be
Ala.sup.23-PTH(1-34) (SEQ ID NO:7), Ala.sup.23-PTHrP(1-36) (SEQ ID
NO:8), His.sup.5-PTH(1-34) (SEQ ID NO:9), His.sup.5-PTHrP(1-36)
(SEQ ID NO:10), or a fragment thereof. The polypeptide may be
selected from the group consisting of any of those identified as RG
selective in the table of FIG. 26B. The polypeptide may be
formulated for pharmaceutical administration (e.g., as described
herein) or may be purified.
[0016] The invention also features a method for treating
osteoporosis in a subject comprising administering the polypeptide
of the previous aspect, an RG selective polypeptide (e.g., those
described herein), a polypeptide described herein that is a
long-acting agonist, or any polypeptide described herein, or a
pharmaceutically acceptable form thereof, to the subject in need
thereof in an amount sufficient to treat osteoporosis. The
invention also features a method for treating fracture repair,
osteomalacia, arthritis, thrombocytopenia, hypoparathyroidism or
hyperphosphatemia or increasing stem cell mobilization in a
subject, comprising administering the polypeptide of the previous
aspect or any polypeptide described herein, or a pharmaceutically
acceptable form thereof, to the subject in an amount sufficient to
treat the disease or condition or to increase stem cell
mobilization. The polypeptide or pharmaceutically acceptable form
thereof may be administered subcutaneously, intravenously,
intranasally, transpulmonarily, transdermally, or orally.
[0017] In another aspect, the invention features a polypeptide (PTH
analog or PTH derivative) which binds the PTH receptor and has a
high affinity for PTH receptor R.sup.0 form. The polypeptide may
have an amino acid sequence modified by a substitution, deletion
and/or addition of one or more amino acids relative to the
wild-type PTH or PTHrP sequence. The polypeptide may also have an
arginine at position 19 or an isoleucine at position 5. The
polypeptide may be Ala.sup.1,Aib.sup.3-[M]PTH(1-28) (SEQ ID NO:11),
Ala.sup.1,Aib.sup.3-[M]PTH(1-34) (SEQ ID NO:12), or
Ile.sup.5-PTHrP(1-36) (SEQ ID NO:13). The polypeptide may be
selected from the group consisting of any of the peptides of FIG.
26B having an IC.sub.50 less than or equal to 2.9 nM or 7.9 nM and
I.sup.5-hPTHrP(1-36) (SEQ ID NO:13) (#1208), based on the data of
FIG. 26B. The polypeptide may be formulated for pharmaceutical
administration (e.g., as described herein) or may be purified.
[0018] The invention also features a method for treating a disease
or condition selected from the group consisting of
hypoparathyroidism, hyperphosphatemia, tumoral calcinosis, and
osteoporosis in a subject, by administering a polypeptide of the
previous aspect, an R.sup.0 selective polypeptide described herein,
a polypeptide described herein that is a long-acting agonist, or
any polypeptide described herein, or a pharmaceutically acceptable
form thereof, to a subject in need thereof in an amount sufficient
to treat the disease or condition. The invention also features a
method for treating a subject needing fracture repair, or having
osteomalacia, arthritis, thrombocytopenia, or requiring stem cell
mobilization comprising administering the polypeptide of the
previous aspect or any polypeptide described herein, or a
pharmaceutically acceptable form thereof, to a subject in an amount
sufficient to repair the fracture, to treat the disease, or to
mobilize stem cells. The polypeptide or pharmaceutical composition
thereof may be administered subcutaneously, intravenously,
intranasally, transpulmonarily, transdermally, and orally.
[0019] The invention also features a PTH or PTHrP polypeptide
having an amino acid sequence modified by a substitution, deletion
and/or addition of one or more amino acids relative to the
wild-type PTH or PTHrP sequence. The polypeptide may have an
arginine at position 19 or an isoleucine at position 5. The
polypeptide may be selected from the group consisting of
AVAEIQLMHQRGKSIQDLRRRFFLHHLIAEIHTAEI: M-PTH(1-11)/PTHrP(12-36)OH
(SEQ ID NO:14); AVAEIQLMHQRAKWIQDLRRRFFLHHLIAEIHTAEI:
M-PTH(1-14)/PTHrP(15-36)OH (SEQ ID NO:15);
AVAEIQLMHQRAKWLNSMRRRFFLHHLIAEIHTAEI: M-PTH (1-18)/PTHrP(19-36)OH
(SEQ ID NO:16); SVSEHQLMHNLGKHIQDLRRRFFLHHLIAEIHTAEI:
[H.sup.5]-hPTH (1-14)/PTHrP(15-36)OH (SEQ ID NO:17);
AVAEIQLMHQRAKWLNSMRRVEWLRKKLQDVHNF: [R.sup.19],M-hPTH(1-34)OH (SEQ
ID NO:18); SVSEIQLMHNLGKHIQDLERRFFLHHLIAEIHTAEI: [E.sup.19]-hPTH
(1-14)/PTHrP(15-36)OH (SEQ ID NO:19);
AVAEIQLMHQRAKWIQDLERRFFLHHLIAEIHTAEI:
[E.sup.19],M-hPTH(1-14)/PTHrP(15-36)OH (SEQ ID NO:20); and
AVAEIQLMHQRAKWLNSMERVEWLRKKLQDVHNF: [E.sup.19],M-hPTH(1-34)OH (SEQ
ID NO:21). The polypeptide may have a histidine at position 5. The
polypeptide may be represented by one of the follow formulas
Ala.sup.1,Aib.sup.3-[M]PTH(1-28) (SEQ ID NO:11), Ala.sup.23PTH (SEQ
ID NO:22), and Ile.sup.5-PTHrP (SEQ ID NO:23). The polypeptide may
be selected from the group consisting of:
AVAEHQLMHQRAKWLNSMERVEWLRKKLQDVHNF: [H.sup.5,E.sup.19],M-PTH(1-34)
(SEQ ID NO:24); AVAEHQLMHQRAKWIQDLERRFFLHHLIAEIHTAEI:
[H.sup.5,E.sup.19],M-hPTH(1-14)/PTHrP(15-36) (SEQ ID NO:25);
SVSEIQLMHNLGKHLNSMERVEFLHHLIAEIHTAEI: hPTH(1-22)/PTHrP(23-36) (SEQ
ID NO:26); SVSEIQLMHNLGKHLNSMERVEWLRKKLQDIHTAEI:
PTH(1-30)/PTHrP(31-36) (SEQ ID NO:27);
AVAEIQLMHQRAKWLNSMERVEALRKKLQDVHNF: [A.sup.23,E.sup.19],M-PTH(1-34)
(SEQ ID NO: 28); and AVAEIQLMHQRAKWLNSMRRVEALRKKLQDVHNF
[A.sup.23],M-PTH(1-34) (SEQ ID NO:29). The polypeptide may be used
in any treatment methods or any compositions (e.g., pharmaceutical
compositions described herein).
[0020] In another aspect, the invention features a polypeptide
including an amino acid sequence having the formula or including an
amino acid sequence substantially identical to an amino acid
sequence defined by the formula:
X1-Val-X2-Glu-His-Gln-Lys-Met His
X3.times.4.times.5.times.6.times.7 (SEQ ID NO:30),
[0021] wherein:
[0022] X1 is Ser, Ala, Gly, or an .alpha.-helix stabilizing residue
(e.g., Aib);
[0023] X2 is Ser, Ala, or an .alpha.-helix stabilizing residue
(e.g., Aib);
[0024] X3 is Asn, Ala, Glu, Val, Asp, or Gln;
[0025] X4 is Val, Ala, Trp, Ile, Met, Lys, Arg, Leu, or Har;
[0026] X5 is Gly, His, Arg, Ala, or an .alpha.-helix stabilizing
residue (e.g., Aib);
[0027] X6 is Lys, Gln, Leu, His, Trp, Ala, Arg, or an .alpha.-helix
stabilizing residue (e.g., Aib); and
[0028] X7 is Arg, Leu, Phe, Trp, His, or an .alpha.-helix
stabilizing residue (e.g., Aib);
[0029] or a fragment thereof containing amino acids 1-10, 1-11,
1-12, or 1-13, or a pharmaceutically acceptable salt thereof. The
.alpha.-helix stabilizing residue may be, for example, a
non-encoded amino acid such as (2-aminoisobutyric acid), ACPC
(1-aminocyclopropylcarboxylic acid), DEG (diethylglycine), or
1-aminocyclopentanecarboxylic acid. In certain embodiments, the
amino acid sequence has 1, 2, 3, 4, 5, 6, 7, or 8 substitutions
relative to the corresponding wild-type PTH sequence. In certain
embodiments, the polypeptide includes an Ala, Gly, or an
.alpha.-helix stabilizing residue (e.g., Aib) at X1; an Ala or an
.alpha.-helix stabilizing residue (e.g., Aib) at X2; an Ala, Glu,
Val, Asp, or Gln at X3; a Val, Ala, Trp, Ile, Met, Lys, Arg, or Har
at X4; a His, Arg, Ala, or an .alpha.-helix stabilizing residue
(e.g., Aib) at X5; a Gln, Leu, His, Trp, Ala, Arg, or an
.alpha.-helix stabilizing residue (e.g., Aib) at X6; an Arg, Leu,
Phe, Trp, or an .alpha.-helix stabilizing residue (e.g., Aib) at
X7; or a combination thereof. In any of these embodiments, the
polypeptide may have an amino acid sequence fewer than 100, 50, 36,
34, 30, 25, or 20 in length (e.g., 10-14 amino acids). In certain
embodiments, the polypeptide is 21, 20, 19, 18, 17, 16, 15, 14, 13,
12, 11, or 10 amino acids in length. The polypeptide may be part of
a composition including a pharmaceutically acceptable carrier.
[0030] In another aspect, the invention features a polypeptide
including an amino acid sequence of the formula, or includes an
amino acid sequence substantially identical to an amino acid
sequence defined by the formula:
TABLE-US-00001 (SEQ ID NO: 31)
X1-Val-X2-Glu-X3-Gln-Leu-Met-His-X4-X5-X6-X7-X8-Leu-Asn-Ser-
Met-Glu-X9-Val-Glu-X10-X11-Arg-Lys-Lys-X12,
[0031] wherein:
[0032] X1 is Ser, Ala, or an .alpha.-helix stabilizing residue
(e.g., Aib);
[0033] X2 is Ser, Ala, or an .alpha.-helix stabilizing residue
(e.g., Aib);
[0034] X3 is Ile or His;
[0035] X4 is Asn, Glu, Val, Asp, or Gln;
[0036] X5 is Val, Ala, Trp, Ile, Met, Lys, Arg, Leu, or Har;
[0037] X6 is Gly, His, Arg, or Ala;
[0038] X7 is Lys, Gln, Leu, His, Trp, Ala or Arg;
[0039] X8 is Arg, Leu, Phe, Trp, His, or Ser;
[0040] X9 is Arg or Ala;
[0041] X10 is Trp, Ala or Phe;
[0042] X11 is Leu or Ala; and
[0043] X12 is Leu or Ala;
[0044] and wherein the amino acid sequence comprises at least one
of the amino acids selected from the group consisting of His at
position X3, Ala at position X9, Ala at position X10, Ala at
position X11, and Ala at position X12, a fragment thereof
comprising amino acids 1-24, 1-25, 1-26, or 1-27 of said amino acid
sequence, or a pharmaceutically salt thereof. The polypeptide may
bind with low affinity to the R.sup.0 form of a PTH receptor (e.g.,
bind with high affinity to the RG form of the PTH receptor). The
polypeptide may be RG selective or may be a short-acting agonist of
the receptor. The polypeptide may include 1, 2, 3, 4, 5, 6, 7, 8,
9, 10, or more substitutions relative to the corresponding wild
type sequence. In certain embodiments, the polypeptide includes an
Ala or an .alpha.-helix stabilizing residue (e.g., Aib) at X1; an
Ala or an .alpha.-helix stabilizing residue (e.g., Aib) at X2; an
His at X3; a Glu, Val, Asp, or Gln at X4; a Val, Ala, Trp, Ile,
Met, Lys, Arg, or Har at X5; a His, Arg, or Ala at X6; a Gln, Leu,
His, Trp, Ala, or Arg at X7; an Arg, Leu, Phe, Trp, or Ser at X8;
an Ala at X9; an Ala or Phe at X10; an Ala at X11; an Ala at X12;
or a combination thereof. The polypeptide may be fewer than 100,
75, 60, 50, 40, 36, 34, 33, 32, 31, 30, 29, or 28 amino acids in
length. The polypeptide may be 24, 25, 26, 27, 28, 29, 30, 31, 32,
33, 34, 35, 36, 37, 38, 39, or 40 amino acids in length (e.g.,
24-28 amino acids in length). In certain embodiments at least one
(e.g., 2, 3, or 4) of X9, X10, X11, or X12 is alanine.
[0045] In another aspect, the invention features a polypeptide
including an amino acid sequence of the formula, or substantially
identical to an amino acid sequence defined by the formula:
TABLE-US-00002 (SEQ ID NO: 32)
X1-Val-X2-Glu-Ile-Gln-Leu-Met-His-X3-X4-X5-X6-X7-Leu-Asn-Ser-Met-
Arg-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu,
[0046] wherein
[0047] X1 is Ser, Ala, or Aib;
[0048] X2 is Ser, Ala, or Aib;
[0049] X3 is Asn, Glu, Val, Asp, or Gln;
[0050] X4 is Val, Ala, Trp, Ile, Met, Lys, Arg, or Leu;
[0051] X5 is Gly, His, Arg, or Ala;
[0052] X6 is Lys, Gln, Leu, His, Trp, Ala, or Arg; and
[0053] X7 is Arg, Leu, Phe, Trp, His, or Ser, or a fragment thereof
containing amino acids 1-24, 1-25, 1-26, or 1-27 of said amino acid
sequence, or a pharmaceutically acceptable salt thereof. The
polypeptide may be R.sup.0 selective or may be a long-acting PTH
agonist. The amino acid sequence may contain 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, or more substitutions (e.g., at any of the positions
described above relative to the wild type PTH sequence). In certain
embodiments, the polypeptide includes an Ala or Aib at X1; an Ala
or Aib at X2; a Glu, Val, Asp, or Gln at X3; a Val, Ala, Trp, Ile,
Met, Lys, or Arg at X4; a His, Arg, or Ala at X5; a Gln, Leu, His,
Trp, Ala, or Arg at X6; an Arg, Leu, Phe, Trp, or Ser at X7; or a
combination thereof. The polypeptide may be fewer than 100, 75, 60,
50, 40, 36, 34, 33, 32, 31, 30, 29, or 28 amino acids in length.
The polypeptide may be 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34,
35, 36, 37, 38, 39, or 40 amino acids in length (e.g., 24-28 amino
acids in length). The polypeptide may be in a composition with a
pharmaceutically acceptable carrier.
[0054] In another aspect, the invention features a polypeptide
comprising an amino acid sequence having the formula, or an amino
acid sequence substantially identical to a polypeptide defined by
the formula:
TABLE-US-00003 (SEQ ID NO: 33)
Ala-Val-Ser-Glu-His-Glu-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-X1-
Arg-Arg-Arg-X2-Phe-Leu-X3-X4-Leu-Ile-X5-X6-X7-X8-X9-X10-Glu-Ile,
[0055] wherein:
[0056] X1 is Leu, Ala, Ser, Met, Phe, or Glu;
[0057] X2 is Phe, Ala, Ser, Leu, Asn, Trp, Glu, or Lys;
[0058] X3 is His, Leu, Arg, Lys, Trp, Ile, or Phe;
[0059] X4 is His, Ala, Ser, Asn, Lys, or Arg;
[0060] X5 is Ala, Gly, Ser, Asn, Gln, Trp, Glu, or Lys;
[0061] X6 is Glu, Gly, Ser, Leu, Asn, Asp, Lys, or Ala;
[0062] X7 is Ile, Leu, Val, Lys, or Ala;
[0063] X8 is His or Ala
[0064] X9 is Thr, Asn, or Ala; and
[0065] X10 is Ala or Phe,
[0066] or a fragment thereof containing amino acids 1-24, 1-25,
1-26, 1-27, 1-28, 1-29, 1-30, 1-31, 1-32, 1-33, 1-34, or 1-35 of
said amino acid sequence, and wherein said polypeptide comprises at
least one amino acid substitution as compared to the corresponding
wild type PTHrP sequence or a fragment thereof; or a
pharmaceutically acceptable salt thereof. The polypeptide may bind
with low affinity to the R.sup.0 form of a PTH receptor (e.g., bind
with high affinity to the RG form of the PTH receptor). The
polypeptide may be RG selective or may be a short-acting agonist of
the PTH receptor. The polypeptide may include 1, 2, 3, 4, 5, 6, 7,
8, 9, 10, or more substitutions relative to the corresponding wild
type PTHrP sequence. In certain embodiments, the polypeptide has an
Ala, Ser, Met, Phe, or Glu at X1; an Ala, Ser, Leu, Asn, Trp, Glu,
or Lys at X2; a Leu, Arg, Lys, Trp, Ile, or Phe at X3; an Ala, Ser,
Asn, Lys, or Arg at X4; Gly, Ser, Asn, Gln, Trp, Glu, or Lys at X5;
a Gly, Ser, Leu, Asn, Asp, Lys, or Ala X6; a Leu, Val, Lys, or Ala
at X7; an Ala at X8; an Asn or Ala at X9; a Phe at X10; or a
combination thereof. In particular embodiments, the polypeptide has
an Ala or Glu at X1, an Ala at X2, a Leu at X3, a Lys at X4, or a
combination thereof. The polypeptide may be fewer than 100, 75, 60,
50, 40, 36, 34, 33, 32, 31, 30, 29, or 28 amino acids in length.
The polypeptide may be 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34,
35, 36, 37, 38, 39, or 40 amino acids in length (e.g., 28-36 amino
acids in length). The polypeptide may have a free hydroxyl or be
amidated at its C-terminus. The polypeptide may include a sequence
selected from the amino acid sequences of Table 1, or be
substantially identical to such sequences. The polypeptide may be
in a composition with a pharmaceutically acceptable carrier.
TABLE-US-00004 TABLE 1 (SEQ ID NO: 34-117) A18-PTHrP(1-28)
S18-PTHrP(1-28) M18-PTHrP(1-28) F18-PTHrP(1-28) E18-PTHrP(1-28)
A22-PTHrP(1-28) S22-PTHrP(1-28) L22-PTHrP(1-28) N22-PTHrP(1-28)
W22-PTHrP(1-28) E22-PTHrP(1-28) K22-PTHrP(1-28) A26-PTHrP(1-28)
S26-PTHrP(1-28) N26-PTHrP(1-28) K26-PTHrP(1-28) R26-PTHrP(1-28)
L25-PTHrP(1-28) W25-PTHrP(1-28) K25-PTHrP(1-28) R25-PTHrP(1-28)
A18,22,26-PTHrP(1-28) A18,22,K26-PTHrP(1-28) A18,26,S22-PTHrP(1-28)
A18,S22,K26-PTHrP(1-28) A18,26,N22-PTHrP(1-28)
A18,N22,K26-PTHrP(1-28) A18,26,L22-PTHrP(1-28)
A18,L22,K26-PTHrP(1-28) A18,26,W22-PTHrP(1-28)
A18,W22,K26-PTHrP(1-28) E18,A22,K26-PTHrP(1-28)
E18,S22,A26-PTHrP(1-28) E18,N22,A26-PTHrP(1-28)
E18,N22,K26-PTHrP(1-28) E18,L22,A26-PTHrP(1-28)
E18,L22,K26-PTHrP(1-28) E18,W22,A26-PTHrP(1-28)
E18,W22,K26-PTHrP(1-28) E18,K22,A26-PTHrP(1-28)
E18,K22,26-PTHrP(1-28) E18,A22,26-PTHrP(1-28)
A18,22,L25,K26-PTHrP(1-28) A18,22,K25,26-PTHrP(1-28)
A18,22,I25,K26-PTHrP(1-28) A18,22,W25,K26-PTHrP(1-28)
A18,22,F25,K26-PTHrP(1-28) A18,S22,L25,K26-PTHrP(1-28)
A18,S22,K25,26-PTHrP(1-28) E18,A22,L25,K26-PTHrP(1-28)
E18,A22,K25,26-PTHrP(1-28) E18,S22,L25,K26-PTHrP(1-28)
E18,S22,K25,26-PTHrP(1-28) A18,22,K26-PTHrP(1-30)
E18,A22,K27-PTHrP(1-30) A18,22,L25,K26-PTHrP(1-30)
E18,A22,L25,K26-PTHrP(1-30) A18,22,K26-PTHrP(1-31)
E18,A22,K27-PTHrP(1-31) A18,22,L25,K26-PTHrP(1-31)
E18,A22,L25,K26-PTHrP(1-31) E18,A22,L25,K26,G29-PTHrP(1-31)
E18,A22,L25,K26,S29-PTHrP(1-31) E18,A22,L25,K26,N29-PTHrP(1-31)
E18,A22,L25,K26,Q29-PTHrP(1-31) E18,A22,L25,K26,W29-PTHrP(1-31)
E18,A22,L25,K26,E29-PTHrP(1-31) E18,A22,L25,K26,K29-PTHrP(1-31)
E18,A22,L25,K26,G30-PTHrP(1-31) E18,A22,L25,K26,S30-PTHrP(1-31)
E18,A22,L25,K26,L30-PTHrP(1-31) E18,A22,L25,K26,N30-PTHrP(1-31)
E18,A22,L25,K26,D30-PTHrP(1-31) E18,A22,L25,K26,K30-PTHrP(1-31)
E18,A22,L25,K26,S31-PTHrP(1-31) E18,A22,L25,K26,L31-PTHrP(1-31)
E18,A22,L25,K26,V31-PTHrP(1-31) E18,A22,L25,K26,K31-PTHrP(1-31)
E18,A22,L25,K26-PTHrP(1-34) E18,A22,L25,K26,A30-PTHrP(1-34)
E18,A22,L25,K26,A31-PTHrP(1-34) E18,A22,L25,K26,A32-PTHrP(1-34)
E18,A22,L25,K26,A33-PTHrP(1-34) E18,A22,L25,K26,Q29,D30,V31,N33,
F34-PTHrP(1-34)
[0067] In another aspect, the invention features a PTH or PTHrP
polypeptide (e.g., of any of the above aspects or described herein)
where the N-terminus is substituted with a bulky residue (e.g.,
Trp). Such polypeptides include Trp.sup.1-PTH(1-34) (SEQ ID
NO:118), Trp.sup.1-M-PTH(1-34) (SEQ ID NO:119), and
TRP.sup.1-PTHrP(1-36) (SEQ ID NO:120), or a fragment thereof
containing amino acids 1-10, 1-11, 1-12, 1-13, 1-14, 1-15, 1-16,
1-17, 1-18, 1-19, 1-20, 1-21, 1-22, 1-23, 1-24, 1-25, 1-26, 1-27,
1-28, 1-29, 1-30, 1-31, 1-32, 1-33, 1-34, or 1-35 of said sequence.
The polypeptide may have reduced (e.g., by at least 1, 5, 10, 25,
50, 75, 90, 95, 99, 99.5, 99.9, 99.95, or 99.99%) PLC signaling
activity at the PTH receptor as compared to the polypeptide lacking
the bulky residue substitution. Other bulky residues include Phe,
Tyr, and p-benzoylphenylalanine (Bpa). In certain embodiments, the
polypeptide includes any one (e.g., 2, 3, 4, 5, 6, or 7) of the
mutations set forth in the M or Mc modifications, where M
represents
[Ala.sup.1,12,Aib.sup.3,Gln.sup.10,homoarginine.sup.11,Trp.sup.14,Arg.sup-
.19] and Mc represents
Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14, Arg.sup.19 PTH
sequence, or any combination thereof. Hybrid peptides may further
include a substitution at position 5 (e.g., a histidine at position
5). Exemplary polypeptides include Trp.sup.1-PTH(1-28) (SEQ ID
NO:121) and Trp.sup.1-M-PTH(1-28) (SEQ ID NO:122).
[0068] In another aspect of the invention, the invention features a
polypeptide including a hybrid PTH/PTHrP polypeptide or a
polypeptide including an amino acid sequence substantially
identical to a hypbrid PTH/PTHrP polypeptide. The polypeptide may
be represented by the formula PTH(1-X)/PTHrP(Y-36), where X is 8,
9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25,
26, 27, 28, 29, 30, 31, 32, 33, or 34 and Y.dbd.X+1. In certain
embodiments, the hybrid polypeptide contains any one (e.g., 2, 3,
4, 5, 6, or 7) of the mutations set forth in the M or Mc
modifications, where M represents
[Ala.sup.1,12,Aib.sup.3,Gln.sup.10,homoarginine.sup.11,Trp.sup.14,Arg.sup-
.19] and Mc represents
Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14, Arg.sup.19 PTH
sequence, or any combination thereof. Hybrid peptides may further
include a substitution at position 5 (e.g., a histidine at position
5).
[0069] In any of the polypeptides described above, the polypeptide
may be biologically active, e.g., have an affinity for the RG form
of the GPCR that is at least 1% (e.g., 5, 10, 25, 30, 50, 60, 75,
90, 100, 125, 150, 200, 150, 300, 400, 500, 750, or 1000%) of an
endogenous agonist for the GPCR, and have a lower affinity (e.g.,
99, 95, 90, 85, 75, 65, 55, 50, 40, 30, 25, 15, 10, 5, 1, 0.5, 0.1,
0.05, 0.01, 0.005, 0.001, 0.0005, or 0.0001%) for the R.sup.0 form
as compared to a control (e.g., an endogenous ligand for the GPCR).
In other embodiments, the polypeptide has an affinity for the RG
form of the GPCR that is at least 1% (e.g., 5, 10, 25, 30, 50, 60,
75, 90, 100, 125, 150, 200, 150, 300, 400, 500, 750, or 1000%) of
an endogenous agonist for the GPCR, and (ii) has a greater affinity
(e.g., 1, 5, 10, 25, 50, 100, 200, 500, 1000, 2000, 5000, or
10,000% greater) for the R.sup.0 form of the GPCR than the
endogenous agonist or is identified as a long-acting agonist of the
GPCR. In the above aspects, the polypeptide may be RG selective,
R.sup.0 selective, a short-acting agonist, or a long-acting
agonist. In certain embodiments, the polypeptide may be modified
(e.g., acetylated at the N-terminal, amidated at the C-terminal, or
contain any of the modifications described herein).
[0070] The invention also features a nucleic acid including a
sequence encoding a polypeptide described herein (e.g., those
described above). The nucleic acid may be operably linked to
promoter and/or part of a vector. The invention also features a
cell (e.g., a prokaryotic cell such as bacterial cell or a
eukaryotic cell such as yeast or mammalian, for example, human,
cell) including the vector. The invention also features a method of
making the polypeptide by growing the cell under conditions which
induce expression of said nucleic acid and optionally purifying
said polypeptide.
[0071] By "GPCR" is meant any polypeptide comprising a G protein
coupled receptor or functional fragment thereof. Desirably, a GPCR
has at least 70%, 80%, 90%, 95%, 99%, or 100% sequence identity to
a naturally occurring GPCR. Exemplary GPCRs are described
herein.
[0072] By "RG form" of a GPCR is meant the G-protein-bound receptor
conformation. The RG form of a GPCR can be induced, for example, by
increased G-protein binding of the GPCR. In the assays of the
invention, at least 1%, 5%, 10%, 25%, 50%, 75%, 90%, 95%, or 99% of
the receptors are in the RG form when affinity for RG form is
measured.
[0073] By "R.sup.0 form" of a GPCR is meant the receptor
conformation that occurs when the GPCR is not bound to a G-protein,
but is capable of binding at least some ligands of the receptor.
The R.sup.0 form of a GPCR, relative to RG, can be favored, for
example, by preventing or reducing G-protein binding to the GPCR.
In the assays of the invention, at least 0.1%, 1%, 5%, 10%, 25%,
50%, 75%, 90%, 95%, or 99% of the receptors may be in the R.sup.0
form when affinity for the R.sup.0 form is measured.
[0074] By "affinity" is meant the ability of a compound to interact
with a target receptor. In the assays and polypeptides of the
invention, affinity may be measured directly by binding (e.g.,
competition binding assays or FRET), or indirectly through an
activity assay (e.g., cAMP signaling or changes in intracellular
calcium). Desirably the compound has an affinity for the receptor
of at least 10 .mu.mol, 1 .mu.mol, 500 nmol, 100 nmol, 50 nmol, 25
nmol, 10 nmol, 5 nmol, 1 nmol, 500 pmol, 200 pmol, 100 pmol, 50
pmol, 25 pmol 10 pmol, or 1 pmol as measured by EC.sub.50 for the
RG form or the R.sup.0 form of the GPCR.
[0075] By "long-acting agonist" is meant an agonist whose activity
(e.g., measured in vivo or in vitro) has a half life that is at
least 5%, 10%, 25%, 50%, 75%, 100%, 150%, 200%, 500%, 1000%, or
5000% longer as compared to an endogenous agonist for the same
receptor.
[0076] By "short-acting agonist" is meant an agonist whose activity
(e.g., measured in vivo or in vitro using an assay described
herein) has a half life that is less than 95%, 90%, 75%, 60%, 50%,
40%, 30%, 20%, 10%, 5%, or 1% as compared to an endogenous agonist
for the same receptor.
[0077] By "RG selective agonist" is an agonist that exhibits
increased binding to the RG form of a receptor relative to the
R.sup.0 form of the receptor, as compared to a control agonist
(e.g., an endogenous agonist). Receptor selectivity can be
expressed as a ratio of binding constants between each receptor
form, e.g., R.sup.0/RG ratio, where an increase in this ratio
indicates stronger binding to the RG form. As shown in FIGS. 26A
and 26B, the R.sup.0/RG ratio of PTH(1-34) (SEQ ID NO:5) is 67 and
the relatively more RG selective PTHrP(1-36) (SEQ ID NO:6) is 260
in binding the human PTH receptor expressed on COS-7 cell
membranes. An RG selective agonist may have an R.sup.0/RG ratio of
at least 100, 150, 200, 250, 300, 400, 500, 1000, 2000, 3000, 5000,
7000, 10,000, 15,000, 20,000, or 50,000 in this system. The
R.sup.0/RG ratio may be at least 1.5, 2, 3, 4, 5, 10, 15, 25, 50,
75, or 100-fold that of the control agonist.
[0078] By "R.sup.0 selective agonist" is an agonist that exhibits
decreased binding to the RG form of a receptor relative to the
R.sup.0 form of the receptor, as compared to a control agonist
(e.g., an endogenous agonist). Receptor selectivity can be
expressed as a ratio of binding constants between each receptor
form, e.g., R.sup.0/RG ratio, where a decrease in this ratio
indicates stronger binding to the R.sup.0 form. As shown in FIGS.
26A and 26B, the R.sup.0/RG ratio of PTH(1-34) (SEQ ID NO:5) is 67
and the relatively more RG selective PTHrP(1-36) (SEQ ID NO:6) is
260 in binding the human PTH receptor expressed on COS-7 cell
membranes. The R.sup.0 selective agonist may have an R.sup.0/RG
ratio of less than 60, 50, 40, 30, 25, 20, 25, 10, 5, 2, 1, 0 in
this system. The R.sup.0/RG ratio thus may be less than 0.9, 0.8,
0.7, 0.6, 0.5, 0.4, 0.3, 0.2, 0.1, 0.08, 0.05, 0.03, 0.01, 0.008,
0.005, 0.003, or 0.001-fold of that the control agonist.
[0079] By "endogenous agonist" of a GPCR is meant a compound
produced by an organism, or a synthetic phenocopy of that compound,
i.e., a compound having the same pharmacological activity as the
endogenous agonist. For example, the native PTH peptide (SEQ ID
NO:3) is 1-84, and PTHrP (SEQ ID NO:4) is .about.1-140 amino acids;
phenocopies of these ligands include PTH(1-34) (SEQ ID NO:5) and
PTHrP(1-36) (SEQ ID NO:6), respectively. An endogenous agonist is
involved in or modulates the normal physiological activation of the
GPCR. Some GPCRs have multiple endogenous agonists (e.g.,
endogenous agonists for the PTHR include PTH and PTHrP); for
purposes of the invention, any endogenous agonist may be used to
determine whether the candidate compound is short-acting or
long-acting.
[0080] By "peptide" or "polypeptide" is meant a chain of amino
acids of at least 4, 6, 10, 25, 50, 100, 150, 200, 500, or 1000
amino acids.
[0081] By "fragment" of a polypeptide is meant a portion of a
sequence at least 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17,
18, 19, 20, 21, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, or
35 amino acids in length
[0082] By "subject" is meant either a human or non-human animal
(e.g., a mammal).
[0083] By "an amount sufficient to treat" is meant an amount
sufficient to reduce, prevent, or eliminate at least one symptom
associated with the disease or condition.
[0084] By a "purified polypeptide" or "isolated polypeptide" is
meant a polypeptide that has been separated from other components.
Typically, the polypeptide is substantially pure when it is at
least 30%, by weight, free from other components. In certain
embodiments, the preparation is at least 50%, 60%, 75%, 85%, 90%,
95%, 96%, 97%, 98%, or 99% by weight, free from other components. A
purified polypeptide may be obtained, for example, by extraction
from a natural source; by expression of a recombinant
polynucleotide encoding such a polypeptide; or by chemically
synthesizing the polypeptide. Purity can be measured by any
appropriate method, for example, column chromatography,
polyacrylamide gel electrophoresis, or by HPLC analysis.
[0085] By "biologically active" is meant that the compound or
composition (e.g., a polypeptide described herein) has at least one
biologically significant effect upon administration to a cell or
animal (e.g., a human or non-human mammal). Biological activities
of PTH, PTHrP, and analogs thereof (e.g., those described herein)
include receptor binding, cAMP or IP.sub.3 production, protein
kinase A, protein kinase C, phospholipase C, phospholipase D, and
phospholipase A.sub.2 activation, changes (e.g., increases or
decreases) in intracellular, plasma, or urinary calcium or
phosphate levels, and changes in bone metabolism or catabolism in
vivo or in vitro. A biologically active peptide of the invention
(e.g., any peptide described herein), for example, may exhibit
increases (e.g., at least 5%, 10%, 25%, 50%, 100%, 500%, 1000%,
10,000%) or decreases (e.g., 95%, 90%, 75%, 50%, 25%, 10%, 5%, 1%,
0.1%, 0.01%, or 0.001%) in any biological activity as compared to
an appropriate control (e.g., a wild-type peptide or a phenocopy
thereof such as PTH(1-34) (SEQ ID NO:5) or PTHrP(1-36) (SEQ ID
NO:6)).
[0086] By "substantially identical" is meant a nucleic acid or
amino acid sequence that, when optimally aligned, for example,
using the methods described below, share at least 60%, 65%, 70%,
75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or 100% sequence
identity with a second nucleic acid or amino acid sequence, e.g.,
an PTH or PTHrP sequence or fragment thereof. "Substantial
identity" may be used to refer to various types and lengths of
sequence, such as full-length sequence, epitopes or immunogenic
peptides, functional domains, coding and/or regulatory sequences,
exons, introns, promoters, and genomic sequences. Percent identity
between two polypeptides or nucleic acid sequences is determined in
various ways that are within the skill in the art, for instance,
using publicly available computer software such as Smith Waterman
Alignment (Smith et al., J. Mol. Biol. 147:195-7 (1981)); "Best
Fit" (Smith and Waterman, Advances in Applied Mathematics, 482-489
(1981)) as incorporated into GeneMatcher Plus.TM., Schwarz and
Dayhof (1979) Atlas of Protein Sequence and Structure, Dayhof, M.
O., Ed pp 353-358; BLAST program (Basic Local Alignment Search
Tool; (Altschul et al., J. Mol. Biol. 215: 403-10 (1990)), BLAST-2,
BLAST-P, BLAST-N, BLAST-X, WU-BLAST-2, ALIGN, ALIGN-2, CLUSTAL, or
Megalign (DNASTAR) software. In addition, those skilled in the art
can determine appropriate parameters for measuring alignment,
including any algorithms needed to achieve maximal alignment over
the length of the sequences being compared. In general, for
proteins, the length of comparison sequences will be at least 6 or
8 amino acids, preferably 9, 10, 11, 12, 13, 14, 15, 16, 17, 18,
19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35,
36, 40, 50, 60, 70, 80, 90, 100, 125, 150, 200, 250, 300, 350, 400,
or 500 amino acids or more up to the entire length of the protein.
For nucleic acids, the length of comparison sequences will
generally be at least 18, 21, 24, 27, 30, 33, 36, 39, 42, 45, 48,
51, 54, 57, 60, 63, 66, 69, 72, 75, 78, 81, 84, 87, 90, 93, 96, 99,
102, 105, 108, 111, 125, 150, 200, 250, 300, 350, 400, 450, 500,
550, 600, 650, 700, 800, 900, 1000, 1100, 1200, or at least 1500
nucleotides or more up to the entire length of the nucleic acid
molecule. It is understood that for the purposes of determining
sequence identity when comparing a DNA sequence to an RNA sequence,
a thymine nucleotide is equivalent to a uracil nucleotide.
Conservative substitutions typically include substitutions within
the following groups: glycine, alanine; valine, isoleucine,
leucine; aspartic acid, glutamic acid, asparagine, glutamine;
serine, threonine; lysine, arginine; and phenylalanine,
tyrosine.
[0087] By "bulky amino acid" is meant any amino acid with a
molecular weight greater than 100 Da (e.g., greater than 125, 150,
175, 200, 225, 250, 300, or 400). The molecular weight of each
coding amino acid is as follows. Ala: 71.09, Arg: 156.19, Asp:
115.09, Asn: 114.11, Cys: 103.15, Glu: 129.12, Gln: 128.14, Gly:
57.05, His: 137.14, Ile: 113.16, Leu: 113.16, Lys: 128.17, Met:
131.19, Phe: 147.18, Pro: 97.12, Ser: 87.08, Thr: 101.11, Trp:
186.12, Tyr: 163.18, and Val: 99.14.
[0088] Other features and advantages of the invention will be
apparent from the following Detailed Description, the drawings, and
the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0089] FIGS. 1A-1C are graphs showing dissociation of PTH and PTHrP
analogs from the human PTH receptor (PTHR) and the effects of
GTP.gamma.S. The radioligands
.sup.125I-[Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ ID
NO:123) (FIG. 1A), .sup.125I[Tyr.sup.36]PTHrP(1-36)NH.sub.2 (SEQ ID
NO:124) (FIG. 1B) and
.sup.125I-[Ile.sup.5,Tyr.sup.36]PTHrP(1-36)NH.sub.2 (SEQ ID NO:125)
(FIG. 1C) were pre-bound to the human PTHR in membranes prepared
from HKRK-B7 cells for 90 minutes; then dissociation was initiated
(t=0) by the addition of an excess of the unlabeled analog
(5.times.10.sup.-7 M), added either alone (filled circles) or
together with GTP.gamma.S (5.times.10.sup.-5 M, open circles). At
each time point, aliquots were removed from the reaction tubes and
immediately subjected to rapid vacuum filtration using a 96-well
vacuum filtration plate to separate bound from free radioactivity.
Non-specific binding was determined in tubes containing the
unlabeled ligand (5.times.10.sup.-7 M) during both the
pre-incubation and dissociation phases. The specifically bound
radioactivity (SB) at each time point was then expressed as the
percent of the specific binding observed at t=0. Aggregate data
from four (FIG. 1A), five (FIG. 1B), or three (FIG. 1C) experiments
are shown. Curves were fit to the data using either a two-phase
(FIGS. 1A and 1B) or single phase (FIG. 1C) exponential decay
equation.
[0090] FIGS. 2A and 2B are graphs showing GTP.gamma.S sensitivity
of PTH and PTHrP analog binding to the human and rat PTHRs.
Radioligand analog binding to the PTHR in membranes prepared from
HKRK-B7 (FIG. 2A) or ROS 17/2.8 cells (FIG. 2B) was assessed under
near-equilibrium conditions in the absence or presence of varying
concentrations of GTP.gamma.S. Data are expressed as a percent of
radioactivity specifically bound (SB) in the absence of
GTP.gamma.S. Data in FIG. 2A are means (.+-.s.e.m.) from three
(PTH(1-34)) or five (PTHrP(1-36) analogs) experiments, and those in
FIG. 2B are from six experiments, each performed in duplicate. The
radioligands studied were
.sup.125I-[Nle.sup.8,21,Tyr.sup.34]PTH(1-34)NH.sub.2 (SEQ ID
NO:123); [Tyr.sup.36]PTHrP(1-36)NH.sub.2 (SEQ ID NO:124);
[Ile.sup.5,Tyr.sup.36]PTHrP(1-36)NH.sub.2 (SEQ ID NO:125) and
[Aib.sup.1,3,Nle.sup.8,Gln.sup.10,Har.sup.11,Ala.sup.12,Trp.sup.14,Tyr.su-
p.15]hPTH(1-15)NH.sub.2 (SEQ ID NO:126).
[0091] FIGS. 3A-3D are graphs showing binding of PTH and PTHrP
analogs to the G protein-coupled and G protein-uncoupled
conformations of the hPTHR. The binding of unlabeled PTH and PTHrP
analogs to the G protein-coupled PTHR conformation (RG) and G
protein-uncoupled PTHR conformation (R.sup.0) was assessed by
competition methods using membranes prepared from transiently
transfected COS-7 cells. To assess binding to RG, the cells were
co-transfected with the hPTHR and a negative-dominant Gas subunit
(G.alpha..sup.ND); and .sup.125I-[Aib.sup.1,3,M]PTH(1-15)NH.sub.2
(SEQ ID NO:126) was used as a tracer radioligand. To assess binding
to R.sup.0, the cells were transfected with the hPTHR alone,
.sup.125I-[Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ ID
NO:123) was used as a tracer radioligand, and the binding reactions
were performed in the presence of GTP.gamma.S. The unlabeled
ligands used were [Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ
ID NO:123) (FIG. 3A); [Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID
NO:124) (FIG. 3B);
[His.sup.5,Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ ID
NO:127) (FIG. 3C); and [Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2
(SEQ ID NO:125) (FIG. 3D). Whereas each ligand binds with
relatively high affinity to RG, PTHrP(1-36), and
His.sup.5-PTH(1-34) bind with considerably lower affinity to
R.sup.0 than do PTH(1-34) and Ile.sup.5-PTHrP(1-36), and thus
exhibit stronger RG selectivity. Data are means (.+-.s.e.m.) of
three to seven experiments, each performed in duplicate (see also
Table 5).
[0092] FIGS. 4A-4D are graphs showing fluorescent resonance energy
transfer (FRET) analysis of ligand binding to the PTHR in HEK-293
cells. HEK-293 cells stably transfected with a PTHR construct
(PTHR-cam) containing cyan fluorescent protein (CFP) in the third
intracellular loop and yellow fluorescent protein (YFP) in the
carboxy-terminal tail, were used to assess the kinetics of ligand
binding to, and dissociation from the PTHR. With PTHR-cam,
excitation of the CFP with ultraviolet light (.lamda..sub.exc=436
nm) produces an intramolecular FRET to the YFP, which is observable
as an increase in light emission from YFP (.lamda..sub.emm=535 nm)
and a decrease in light emission from CFP .lamda..sub.emm=480 nm).
This FRET signal occurs in the ground-state receptor and decreases
upon agonist binding. In each panel, the trace shows the ratio of
the fluorescence signals (F.sub.YFP(535)/F.sub.CFP(480), normalized
for channel spill-over) obtained over time in cells superfused with
buffer alone or with buffer containing a PTH peptide ligand (times
of peptide addition indicated by the black bars above each trace).
The ligands used were hPTH(1-34) (SEQ ID NO:5) (FIG. 4A);
[Aib.sup.1,3,Gln.sup.10,Har.sup.11,Ala.sup.12,Trp.sup.14]rPTH(1-14)NH.sub-
.2 (SEQ ID NO:128) (FIG. 4B); [Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ
ID NO:124) (FIG. 4C), and
[Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID NO:125) (FIG.
4D). The onset of the FRET signal induced by PTHrP(1-36) was slower
than that induced by the three other analogs. The signals induced
by PTH(1-14) and PTHrP(1-36) analogs decayed upon ligand removal,
whereas those induced by PTH(1-34) and Ile.sup.5-PTHrP(1-36)
analogs remained stable. Data are from a single experiment, and
identical results were obtained in at least three others.
[0093] FIGS. 5A and 5B are graphs showing the duration of
cAMP-signaling responses induced by PTH and PTHrP analogs in cells
stably expressing the human PTHR. The duration of cAMP responses
induced by PTHrP(1-36) (SEQ ID NO:6) or Ile.sup.5-PTHrP(1-36) (SEQ
ID NO:13) in HKRK-B7 cells (950,000 hPTHRs/per cell) was assessed
by time course experiments (FIG. 5A). The cells were pre-treated
for 10 minutes with either buffer alone (basal) or buffer
containing ligand (100 nM); at t=0, the cells were washed,
incubated in buffer for the times indicated (wash-out phase),
treated with 3-isobutyl-1-methylxanthine (IBMX) for five minutes,
and then assessed for intracellular cAMP. The maximum response to
each peptide, assessed by incubating cells concomitantly with
peptide and IBMX and omitting the wash-out phase, was 185116 and
198118 pmoles/well for PTHrP(1-36) and Ile.sup.5-PTHrP(1-36),
respectively. The cAMP level in cells treated with IBMX in the
absence of ligand was 2.0.+-.0.3 pmole/well. Data are means
(.+-.s.e.m.) of three experiments, each performed in duplicate. In
these experiments, PTH(1-34) (SEQ ID NO:5) was also analyzed and
induced responses at each time point that were not different from
those induced by PTHrP(1-36). Analogs were similarly assessed in
HKRK-B64 cells (90,000 hPTHRs/cell) at a single time-point, 60
minutes after ligand wash-out (FIG. 5B). For each peptide, the data
are expressed as a percentile of the maximum cAMP responses
(indicated in side panel) produced in cells treated concomitantly
with that ligand and IBMX for 10 minutes and omitting the wash-out
phase. The analogs included His.sup.s-PTH(1-34) (SEQ ID NO:9) and
[Aib.sup.1,3,M]PTH(1-15) (SEQ ID NO:126) (FIG. 5B). Data are means
(.+-.s.e.m) of four experiments, each performed in triplicate.
Asterisks indicate statistical analyses of paired responses:
PTHrP(1-36) vs. Ile.sup.5-PTHrP(1-36) (FIG. 5A), or as indicated by
brackets (FIG. 5B): *, P.ltoreq.0.05; **, P.ltoreq.0.003.
[0094] FIGS. 6A-6D are graphs showing binding of PTH and PTHrP
analogs to the G protein-coupled and G protein-uncoupled
conformations of the hPTHR. Binding reactions were performed as
described above for FIGS. 3A-3D. The unlabeled ligands used were
hPTH(1-34)NH.sub.2 (SEQ ID NO:5) (FIG. 6A);
[Aib.sup.1,3,Nle.sup.8,Gln.sup.10,Har.sup.11,Ala.sup.12,Trp.sup.14,Tyr.su-
p.15]rPTH(1-15)NH.sub.2 (SEQ ID NO:126) (FIG. 6B);
[His.sup.5]hPTH(1-34)NH.sub.2 (SEQ ID NO:9) (FIG. 6C);
hPTHrP(1-36)NH.sub.2 (SEQ ID NO:6) (FIG. 6D). Data are means
(.+-.s.e.m.) of three or five experiments, each performed in
duplicate (Table 6).
[0095] FIGS. 7A and 7B shows a dose-response analysis of analog
signaling potency. The capacity of PTH and PTHrP ligands to
stimulate cAMP formation was assessed in HKRK-B64 cells (FIG. 7A).
Cells were treated for 30 minutes at room temperature with varying
concentrations of ligand in the presence of IBMX. The capacity of
the ligands to stimulate the production of inositol phosphates
(IPs) was assessed in COS-7 cells transiently transfected with the
hPTHR (FIG. 7B). Cells were treated for 30 minutes at room
temperature with varying concentrations of ligand. The ligands used
were [Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ ID NO:123);
[His.sup.5,Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 (SEQ ID
NO:127); [Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID NO:124) and
[Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID NO:125). Data
are means (.+-.s.e.m.) of four (FIG. 7A) or five (FIG. 7B)
experiments, each performed in duplicate. The EC.sub.50 and Emax
values are reported in Table 6 and were not significantly different
between peptides, with the exception of the cAMP EC.sub.50 values
for H.sup.5-PTH(1-34) and PTH(1-34) analogs (P=0.02).
[0096] FIG. 8 is a graph showing cAMP dose responses in rat cells.
Rat osteoblastic cells treated with hPTH(1-28)NH.sub.2 (SEQ ID
NO:129);
Ala.sup.1,12,Aib.sup.3,Gln.sup.10,Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH
hPTH(1-28)NH.sub.2 (SEQ ID NO:11); hPTH(1-34)NH.sub.2 (SEQ ID
NO:5), or r(rat)PTH(1-34)NH.sub.2 (SEQ ID NO:130). The resulting
intracellular cAMP formed was quantified by radioimmuno assay. EC50
values are listed below the graph. Curve fits were obtained by
non-linear regression analysis.
[0097] FIGS. 9A-9D are graphs showing in vivo plasma cAMP levels in
mice treated with PTH analogs. Wild-type mice were injected
subcutaneously with vehicle (0.9% NaCl/0.05% Tween-20), or vehicle
containing a PTH peptide at a dose-level of 10 to 1,000 nmol of
peptide per kg of body weight, and at indicated times after
injection, blood was withdrawn from the tail vein, and the amount
of cAMP in the resulting plasma was quantified by radioimmuno
assay. Each curve corresponds to a peptide at a defined
concentration, as indicated in the graph keys. The plasma cAMP
concentrations are plotted as picomole per .mu.l plasma. The data
show that at 50 nmol/kg,
Ala.sup.1,12,Aib.sup.3,Gln.sup.10,Har.sup.11,Trp.sup.14,Arg.sup.19
hPTH(1-28)NH.sub.2 (SEQ ID NO:11) (Aib-50, FIG. 9A) and
hPTH(1-34)NH.sub.2 (SEQ ID NO:5) ((1-34)-50, FIG. 9B) produce
comparable increases in plasma cAMP concentrations, whereas 1,000
nmol/kg of hPTH(1-28)NH.sub.2 (SEQ ID NO:129) is required to
achieve the same increase ((1-28)-1000, FIG. 9C, also FIG. 9D).
[0098] FIGS. 10A and 10B are graphs showing in vivo plasma
phosphate and serum ionized calcium levels in mice treated with PTH
analogs. Wild-type mice were injected subcutaneously with vehicle
(0.9% NaCl/0.05% Tween-20), or vehicle containing
Ala.sup.1,12,Aib.sup.3,Gln.sup.10,Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-
-28)NH.sub.2 (SEQ ID NO:11) or hPTH(1-34)NH.sub.2 (SEQ ID NO:5) at
a dose level of 50 nanomoles per kg of body weight, or
hPTH(1-28)NH.sub.2 (SEQ ID NO:129) at a dose level of 1,000
nanomoles per kg of body weight and at the indicated times
concentrations of plasma phosphate (FIG. 10A) and serum ionized
calcium (FIG. 10B) were determined. Serum ionized calcium
concentrations were determined using a Chiron Diagnostics Model 634
Ca.sup.++/pH analyzer. Data in A are means (.+-.s.e.m.) of one
experiment using six mice (n=6) for each injection condition;
similar results were obtained in three other experiments. Data in B
are means (.+-.s.e.m.) of two experiments, each performed using
triplicate mice (n=3) for each injection condition.
[0099] FIG. 11 is a graph showing the time courses of phosphate
uptake inhibition in opossum kidney cells for PTH(1-34) (SEQ ID
NO:5), PTHrP(1-36) (SEQ ID NO:6), and the long-acting PTH(1-28)
analog,
Ala.sup.1,12,Aib.sup.3,Gln.sup.10,Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-
-28)NH.sub.2(SEQ ID NO:11). Data at each time point are plotted as
a percentile of the amount of .sup.32P radioactivity in lysates of
cells treated for the same time with vehicle alone; these control
levels ranged from 5,864.+-.338 cpm (12 h) to 3,429.+-.224 cpm (0
h). Data are means (.+-.s.e.m.) of two experiments, each performed
in duplicate.
[0100] FIG. 12 shows pharmacokinetic profile of PTHrP(1-36) (SEQ ID
NO:6) and [I.sup.5]-PTHrP(1-36) (SEQ ID NO:13) in normal rats.
Plasma concentrations of peptides were measured by radioimmunoassay
(RIA). The His.sup.5.fwdarw.Ile substitution in PTHrP(1-36) did not
significantly change the pharmokinetic profile.
[0101] FIGS. 13A-13C are a set of graphs showing the effects of
PTHrP(1-36) (SEQ ID NO:6) and [I.sup.5]-PTHrP(1-36) (SEQ ID NO:13)
in normal rats. FIG. 13A shows transient calcemic action of
PTHrP(1-36) and [I.sup.5]-PTHrP(1-36) in normal rats. The
His.sup.5.fwdarw.Ile substitution in PTHrP(1-36), which increased
affinity for R.sup.0 by 9-fold (see Table inset) resulted in a more
prolonged calcemic effect. FIGS. 13B and 13C show the delayed (60
min; FIG. 13B) and the maximal (FIG. 13C) cAMP response in cells
treated with each of these ligands.
[0102] FIGS. 14A-14C are graphs showing prolonged calcemic effects
in TPTX rats (FIG. 14A) and prolonged cAMP signaling in ROS 17/2.8
cells (FIGS. 14B and 14C) for Mc-PTH(1-14)/PTHrP(15-36) (SEQ ID
NO:15)
(Mc=Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14,Arg.sup.19).
FIGS. 14B and 14C show the delayed (60 min; FIG. 14B) and the
maximal (FIG. 14C) cAMP response in cells treated with hPTH(1-34)
(SEQ ID NO:5) or Mc-hPTH(1-14)/PTHrP(15-36) (SEQ ID NO:15). The
Table inset shows binding affinities for the analogs at the R.sup.0
and RG receptor conformations, measured in vitro.
[0103] FIGS. 15A and 15B are graphs showing transient calcemic
action of modified PTH/PTHrP hybrids in normal rats. Prolonged
calcemic effects are observed for Mc-PTH(1-11)/PTHrP(15-36) (SEQ ID
NO:14) and Mc-PTH(1-14)/PTHrP(15-36) (SEQ ID NO:15). The Table
inset shows binding affinities for the analogs at the R.sup.0 and
RG receptor conformations, measured in vitro. The analogs used were
hPTH(1-34)OH (SEQ ID NO:5), Mc-PTH(1-11)/PTHrP(15-36) (SEQ ID
NO:14), Mc-PTH(1-14)/PTHrP(15-36) (SEQ ID NO:15), and
Mc-PTH(1-18)/PTHrP(19-36) (SEQ ID NO:16)
(Mc=Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14,
Arg.sup.19).
[0104] FIGS. 16A-16C are graphs showing calcemic action of
Mc-modified PTH(1-34) analogs with or without the
Ile.sup.5.fwdarw.His and Arg.sup.19.fwdarw.Glu substitutions, in
normal rats (FIG. 16A) and delayed and maximal cAMP responses in
ROS 17/2.8 cells (FIGS. 16B and 16C). The Table inset shows binding
affinities for the analogs at the R.sup.0 and RG receptor
conformations, measured in vitro. The Ile.sup.5.fwdarw.His and
Arg.sup.19.fwdarw.Glu substitutions reduce affinity for R.sup.0,
and reduce duration of cAMP signaling in vitro and the calcemic
effect in vivo. The analogs used were Mc-hPTH(1-34)OH (SEQ ID
NO:131), [H.sup.5],Mc-hPTH(1-34)OH (SEQ ID NO:132), and
[H.sup.5,E.sup.19],Mc-hPTH(1-34)OH (SEQ ID NO:24)
(Mc=Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14,
Arg.sup.19).
[0105] FIGS. 17A-17C are graphs showing transient calcemic action
of Mc-modified PTH(1-34)/PTHrP(1-36) analogs without the
Ile.sup.5.fwdarw.His and Arg.sup.19.fwdarw.Glu substitutions in
normal rats and delayed cAMP and maximal response in ROS 17/2.8
cells (FIGS. 17B and 17C). The Table inset shows binding affinities
for the analogs at the R.sup.0 and RG receptor conformations,
measured in vitro. The Ile.sup.5.fwdarw.His and
Arg.sup.19.fwdarw.Glu substitutions reduce affinity for R.sup.0,
and reduce duration of cAMP signaling in vitro and the calcemic
effect in vivo. The analogs used were Mc-PTH(1-14)/PTHrP(15-36)OH
(SEQ ID NO:15), [H.sup.5],Mc-hPTH(1-14)/PTHrP(15-36) (SEQ ID
NO:133), and [H.sup.5,E.sup.19],Mc-hPTH(1-14)/PTHrP(15-36) (SEQ ID
NO:25) (Mc=Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14,
Arg.sup.19).
[0106] FIGS. 18A and 18B are graphs showing the calcemic and cAMP
actions of E.sup.19,Mc-modified PTH(1-34) analogs, with or without
the Trp.sup.23.fwdarw.Ala substitution in normal rats (FIG. 18A)
and in ROS 17/2.8 cells (FIG. 18B). The Table inset shows binding
affinities for the analogs at the R.sup.0 and RG receptor
conformations, measured in vitro. The Trp.sup.23.fwdarw.Ala
substitution reduced binding affinity of [E.sup.19,Mc]PTH(1-34) for
R.sup.0 by 10-fold, reduced duration of cAMP signaling in cells,
and reduced the hypercalcemic effect of this peptide in vivo. The
analogs used were [E.sup.19],Mc-hPTH(1-34)OH (SEQ ID NO:21) and
[A.sup.23,E.sup.19],Mc-hPTH(1-34)OH (SEQ ID NO:28)
(Mc=Ala.sup.1,3,12,Gln.sup.10,Arg.sup.11,Trp.sup.14,
Arg.sup.19).
[0107] FIGS. 19A and 19B are graphs showing cAMP signaling of
native PTH/PTHrP hybrid analogs in cells expressing the human PTH1
receptor. The analogs show similar potencies in acute dose-response
assays. The analogs used were hPTH(1-14)/PTHrP(15-36) (SEQ ID
NO:134), hPTH(1-18)/PTHrP(19-36) (SEQ ID NO:135),
hPTH(1-22)/PTHrP(23-36) (SEQ ID NO:26), hPTH(1-26)/PTHrP(27-36)
(SEQ ID NO:136), hPTH(1-30)/PTHrP(31-36) (SEQ ID NO:27),
hPTH(1-14)/PTHrP(15-36) (SEQ ID NO:134), hPTH(1-11)/PTHrP(12-36)
(SEQ ID NO:137), and hPTH(1-17)/PTHrP(18-36) (SEQ ID NO:138). The
controls used were hPTH(1-34) (SEQ ID NO:5) and PTHrP(1-36) (SEQ ID
NO:6).
[0108] FIGS. 20A and 20B are graphs showing cAMP signaling of
Mc-modified PTH/PTHrP hybrid analogs with human PTH1 receptor. The
analogs show similar potencies in acute dose-response assays. The
analogs used were M-hPTH(1-11)/PTHrP(12-36) (SEQ ID NO:14),
M-PTH(1-14)/PTHrP(15-36)OH (SEQ ID NO:15),
M-PTH(1-17)/PTHrP(18-36)OH (SEQ ID NO:139),
M-PTH(1-18)/PTHrP(19-36)OH (SEQ ID NO:16),
M-PTH(1-22)/PTHrP(23-36)OH (SEQ ID NO:140),
M-PTH(1-26)/PTHrP(27-36)OH (SEQ ID NO:141), and
M-PTH(1-30)/PTHrP(31-36)OH (SEQ ID NO:142). The controls used were
hPTH(1-34) (SEQ ID NO:5) and PTHrP(1-36) (SEQ ID NO:6).
[0109] FIGS. 21A and 21B are graphs showing acute (FIG. 21A) and
delayed (FIG. 21B) cAMP analyses in ROS 17/2.8 cells of
hPTH(1-34)NH.sub.2 (SEQ ID NO:5), hPTH(1-28)NH.sub.2 (SEQ ID
NO:129) and [A.sup.1,Aib.sup.3,M]-PTH(1-28 NH
([A.sup.1,12,Aib.sup.3,Q.sup.10,homoarginine.sup.11,W.sup.14,R.sup.19]hPT-
H(1-28)NH.sub.2) (SEQ ID NO:11). In FIG. 21A, cells were incubated
with peptides in the presence of IBMX for 10 minutes, and cAMP was
measured. The EC.sub.50 values were 0.32, 7.6, and 0.33 nM,
respectively. In FIG. 21B, the cells were treated with 10.sup.-7 M
of hPTH(1-34), [A.sup.1,Aib.sup.3,M]-PTH(1-28), or 10.sup.-6M of
hPTH(1-28) for 10 minutes, washed three times, incubated in buffer
alone for the times indicated, treated for a final 5 minutes with
IBMX, and then cAMP was measured. The data in FIG. 21B are
expressed as a percent of the maximum response observed for each
ligand, determined by incubating the cells with ligand in the
presence of IBMX for 10 minutes (no ligand wash-out). These values
were 67.+-.6; 68.+-.3; and 71.+-.1 pmole/well, respectively. The
basal (vehicle) cAMP value was 3.7.+-.0.4 pmole/well.
[0110] FIGS. 22A-22C are graphs showing pharmacokinetic analysis of
PTH ligands injected into mice, assessed by a bioassay procedure
using COS-7 cells transfected with the PTHR (FIGS. 22A and 22C) for
activity read-out. COS-7 cells transfected with the pcDNA1 vector
were used as controls (FIG. 22B). Mice were injected with vehicle,
with hPTH(1-34) (SEQ ID NO:5) (50 nmol/kg), hPTH(1-28) (SEQ ID
NO:129) (1,000 nmol/kg), or [A.sup.1,Aib.sup.3,M]-PTH(1-28) (SEQ ID
NO:11) (50 nmol/kg) and at the indicated times after injection,
blood was collected from the tail vein, plasma was prepared in the
presence of EDTA and proteinase inhibitors, the plasma was diluted
50-fold, and 45 .mu.l of the diluted sample was applied to COS
cells in 96-well plates. Then, following a 15 minute incubation,
the intracellular cAMP in the COS cells was measured. Each tracing
shows data (mean.+-.SE), from six identically treated mice.
[0111] FIG. 23 is a graph showing changes in blood ionized calcium
in mice. Shown are the changes in blood ionized calcium
(iCa.sup.++) in mice treated with hPTH(1-34) (SEQ ID NO:5) (50
nmol/kg), hPTH(1-28) (SEQ ID NO:129) (1,000 nmol/kg), or
[A.sup.1,Aib.sup.3,M]-PTH(1-28) (SEQ ID NO:11) (50 nmol/kg), at
times after injection (studies performed in conjunction with those
of FIGS. 22A-22C). Data are normalized to the iCa.sup.++ in blood
drawn from each mouse prior to injection (pre). Each trace shows
data (mean.+-.SE) from six identically treated mice.
[0112] FIGS. 24A and 24B are graphs showing changes in
bone-formation and bone-resorption markers in mice after long-term
treatment with PTH ligands. Shown are the serum levels of the
bone-formation marker osteocalcin (FIG. 24A) and the
bone-resorption marker, collagen-type I C-terminal fragment (CTX)
(FIG. 24B) in mice treated with hPTH(1-34) (SEQ ID NO:5) (50
nmol/kg), and [A.sup.1,Aib.sup.3,]M-PTH(1-28) (SEQ ID NO:11) (50
nmol/kg). Markers were measured using Mouse Osteocalcin EIA kit
(Biomedical Technologies) and RatLaps CTX ELISA (Nordic Bioscience)
kit. Each trace shows data (mean.+-.SE) from six identically
treated mice.
[0113] FIG. 25 is a table showing cAMP signaling potency of
PTH/PTHrP hybrid analogs (SEQ ID NOs provided therein) on the human
PTH receptor in HKRK-B7 cells.
[0114] FIG. 26A is a table showing competition analysis of R.sup.0
and RG binding of PTH/PTHrP analogs (SEQ ID NOs provided therein)
with the human PTH receptor expressed in COS-7 cell membranes.
[0115] FIG. 26B is a table showing the same data as FIG. 26A,
sorted by R.sup.0 binding values.
[0116] FIGS. 27A-27D are graphs showing alanine-scan and
type-substitution of PTHrP(1-28) (SEQ ID NO:151). The effects of
alanine substitutions in the 15-28 region of PTHrP(1-28) on cAMP
activity was examined in renal tubule LLCPK1-B64 (FIG. 27A) and
ROS17/2.8 (FIG. 27B) cells. Alanine substitution at position 18,
22, 25 and 26 increased activity in at least one cell type. These
positions were further substituted to various types of amino acids,
and cAMP activity was analyzed in LLCPK1-B64 cells (FIG. 27C) or
SaOS-2 cells (FIG. 27D). Cells were treated with analogs at
3.times.10.sup.-9M in the presence of IBMX for 30 minutes at room
temperature. Responses for each analog were normalized to the
response for the parent (native) PTHrP(1-28) peptide. Alanine
substitutions were A.sup.15 to A.sup.17 (SEQ ID NO:152-154),
A.sup.18 (SEQ ID NO:34), A.sup.19 to A.sup.21 (SEQ ID
NO:155-157),A.sup.22 (SEQ ID NO:39), A.sup.23 to A.sup.25 (SEQ ID
NO:158-160), A.sup.26 (SEQ ID NO:46), and A.sup.27 to A.sup.28 (SEQ
ID NO:161-162). Substitutions at position 18 were A.sup.18 (SEQ ID
NO: 34), G.sup.18 (SEQ ID NO:163), S.sup.18 (SEQ ID NO:35),
M.sup.18 (SEQ ID NO:36), L.sup.18 (SEQ ID NO:164), F.sup.18 (SEQ ID
NO:37), N.sup.18 (SEQ ID NO:165), E.sup.18 (SEQ ID NO:38), and
K.sup.18 (SEQ ID NO:166). Substitutions at position 22 were
A.sup.22 (SEQ ID NO:39), G.sup.22 (SEQ ID NO:167), and S.sup.22 to
K.sup.22 (SEQ ID NO:40-45). Substitutions at position 26 were
A.sup.26 (SEQ ID NO:46), G.sup.26 (SEQ ID NO:168), S.sup.26 (SEQ ID
NO:47), L.sup.26 (SEQ ID NO:169), N.sup.26 (SEQ ID NO:48), W.sup.26
to E.sup.26 (SEQ ID NO:170-171), and K.sup.26 to R.sup.26 (SEQ ID
NO:49-50). Substitutions at position 25 were G.sup.25 to S.sup.25
(SEQ ID NO:172-173), L.sup.25 (SEQ ID NO:51), N.sup.25 (SEQ ID
NO:174), W.sup.25 (SEQ ID NO:52), E.sup.25 (SEQ ID NO:175), and
K.sup.25 to R.sup.25 (SEQ ID NO:53-54).
[0117] FIGS. 28A and 28B are graphs showing cAMP activity in vitro
(FIG. 28A) and in vivo (FIG. 28B) by peptides having substitutions
in the PTHrP(1-28) scaffold. Dose response curves of cAMP activity
of representative modified PTHrP(1-28) analogs in SaOS cells are
shown in (FIG. 28A), where analogs used were
A.sup.18,.sup.22,K.sup.26 (SEQ ID NO:56),
A.sup.18,.sup.22,L.sup.25,K.sup.26 (SEQ ID NO:76),
E.sup.18,A.sup.22,K.sup.26 (SEQ ID NO:65), or
E.sup.18,A.sup.22,L.sup.25,K.sup.26 (SEQ ID NO:83). FIG. 28B shows
in vivo cAMP induction, from C57BL/6 mice (3 month old, male)
injected intravenously with either vehicle, PTHrP(1-36) (SEQ ID
NO:5), PTHrP(1-28) (SEQ ID NO:151),
A.sup.18,.sup.22,L.sup.25,K.sup.26 (AALK)-PTHrP(1-28) (SEQ ID
NO:76), or E.sup.18,A.sup.22,L.sup.25,K.sup.26 (EALK)-PTHrP(1-28)
SEQ ID NO:83) (n=3). Blood was withdrawn 10 minutes after
injection, and the plasma level of cAMP was measured by RIA.
[0118] FIGS. 29A and 29B are graphs showing the effect of R.sup.0
and RG selective PTH analogs on plasma cAMP and calcium in mice.
FIGS. 29A and 29B show plasma cAMP concentrations in mice (C57BL/6,
males, 3 months) that were administered either vehicle, rPTH(1-34)
(SEQ ID NO:130), M-PTH(1-34)
(M=A.sup.1,Aib.sup.3,Q.sup.10,Har.sup.11,A.sup.12,W.sup.14,R.sup.19)
(SEQ ID NO:12), or
E.sup.18,A.sup.22,L.sup.25,K.sup.26-(EALK)-PTHrP(1-30) (SEQ ID
NO:90) (5 nmol/kg; n=7 for cAMP, n=4 for calcium) intravenously.
FIG. 29B shows ionic calcium levels in mice treated with the same
peptides. In the calcium experiment, blood was withdrawn before,
and 1, 2, 4 and 6 hours after injection, and ionized calcium was
measured using a Ca.sup.++/pH analyzer.
[0119] FIGS. 30A-30F are graphs showing the effects of PTH analogs
on plasma bone markers in mice. Mice (C57BL/6, males, 3 months)
were intravenously injected daily with either vehicle, rPTH(1-34)
(SEQ ID NO:130), M-PTH(1-34) (SEQ ID NO:12), or (EALK)-PTHrP(1-30)
(SEQ ID NO:90) (5 nmol/kg; n=7 group) for 14 days. Markers of bone
turnover (PINP, CTX and osteocalcin) were assessed by ELISA in
blood at day 6 (FIGS. 30A, 30C, and 30E, respectively) and 13
(FIGS. 30B, 30D, and 30F, respectively).
[0120] FIG. 31 is a set of images showing the effects of two-week
daily treatment of R.sup.0 and RG ligands on trabecular and
cortical bone structure in mice. Mice (C57BL/6, males, 3 months)
were treated (i.v.) with either vehicle, rPTH(1-34) (SEQ ID
NO:130), M-PTH(1-34) (SEQ ID NO:12), or
E.sup.18,A.sup.22,L.sup.25,K.sup.26 (EALK)PTHrP(1-30) (SEQ ID
NO:90) (5 nmol/kg; n=7 group), daily for 14 days, and femurs were
analyzed by .mu.CT.
[0121] FIGS. 32A and 32B are graphs showing the effects of amino
acid substitutions in the 29-31 region of EALK-PTHrP(1-31) (SEQ ID
NO:94) (FIG. 32A) and the 29-33 region of EALK-PTHrP(1-34) (SEQ ID
NO:112) (FIG. 32B) on induction of cAMP activity in MC3T3-E1 cells.
Substitutions at position 29 for EALK-PTHrP(1-31) were G.sup.29 to
S.sup.29 (SEQ ID NO:95-96), L.sup.29 (SEQ ID NO:176), and N.sup.29
to K.sup.29 (SEQ ID NO:97-101). Substitutions at position 30 for
EALK-PTHrP(1-31) were G.sup.30 to D.sup.30 (SEQ ID NO:102-106),
W.sup.30 (SEQ ID NO:177), and K.sup.30 (SEQ ID NO:107).
Substitutions at position 31 for EALK-PTHrP(1-31) were S.sup.31 to
L.sup.31 (SEQ ID NO:108-109), N.sup.31 (SEQ ID NO:178), V.sup.31
(SEQ ID NO:110), W.sup.31 to E.sup.31 (SEQ ID NO:179-180), and
K.sup.31 (SEQ ID NO:111). Substitutions for EALK-PTHrP(1-34)
A.sup.30 to A.sup.33 (SEQ ID NO:113-116) and
EALK-PTHrP(1-28)/PTH(29-34) (SEQ ID NO:117).
[0122] FIG. 33 is a graph showing calcemic action of PTH(1-34) (SEQ
ID NO:5) and M-PTH(1-14)/PTHrP(15-36) (SEQ ID NO:15) (SP-PTH) in
TPTX rats from time zero to 24 hours.
[0123] FIG. 34 is a graph showing urinary calcium at 0-6 hours
following a single injection of SP-PTH (SEQ ID NO:15) or PTH(1-34)
(SEQ ID NO:5) in TPTX rats.
[0124] FIG. 35 is graph showing hypophosphatemic action of
PTH(1-34) (SEQ ID NO:5) and SP-PTH (SEQ ID NO:15) in TPTX rats.
[0125] FIG. 36 is a graph showing urinary phosphorus at 0-6 hours
after a single injection of SP-PTH (SEQ ID NO:15) or PTH(1-34) (SEQ
ID NO:5) in TPTX rats.
[0126] FIG. 37 is a graph showing a dose-response analysis of cAMP
signaling potency for Mc-PTH(1-34) (SEQ ID NO:131),
[A.sup.1,3,A.sup.23,Q.sup.10,R.sup.11]-hPTH(1-34) (SEQ ID NO:181),
[A.sup.1,3,A.sup.23]-hPTH(1-34) (SEQ ID NO:182), and
[A.sup.18,A.sup.22,L.sup.25,K.sup.26]-PTHrP(1-28) (SEQ ID NO:76).
For comparison, hPTH(1-34) (SEQ ID NO:5) and PTHrP(1-36) (SEQ ID
NO:6) are also shown. The capacity of these peptides to stimulate
cAMP formation was assessed on the human PTH1 receptor in HKRK-B7
cells. These PTH analogs show comparable cAMP signaling to
hPTH(1-34).
DETAILED DESCRIPTION
[0127] We have discovered a correlation between (i) the ability of
a GPCR ligand to bind a GPCR when uncoupled to a G-protein (the
R.sup.0 state) and (ii) the length of time over which the ligand
activates the receptor. In particular, an enhanced ability of a
ligand to interact in vitro with the exemplary GPCR, the PTH/PTHrP
receptor (PTHR), uncoupled to a G-protein (the R.sup.0 form), as
compared to PTH or PTHrP, closely correlates its ability to exert
more prolonged activity in vivo. The reverse is also true, i.e.,
that ligands selective for the G-protein coupled forms of GPCR (the
RG form) have a shorter duration of activity as compared to the
native ligand. This discovery provides the basis for a novel means
of determining whether a compound has either long-acting or
shorting-acting in vivo activity on a GPCR. On this basis, ligands
with therapeutically desirable properties (e.g., long-acting or
short-acting ligands) can be identified using the methods described
herein. Exemplary ligands with either long-acting or short-acting
activity are described herein.
[0128] Depending on the disease being treated, long-acting or
short-acting therapeutics are desirable. Recent studies using
PTHrP(1-36) injected in humans show that bone mineral density
increased to about the same extent as with PTH(1-34), the standard
therapy for osteoporosis, but without inducing the bone-resorptive
responses that would be expected for an equivalent dose of
PTH(1-34) (Horwitz et al., J. Endocrinol. Metab. 88:569-575
(2003)). Related studies from this group suggest that the
differences are not likely based solely on pharmacokinetics, as an
acute safety study indicated that PTHrP(1-36) could be administered
at doses nearly 20-fold above the usual dose of PTH(1-34) without
producing a hypercalcemic effect (Horwitz et al., Osteoporosis Int.
17:225-230 (2006)). While both PTHrP(1-36) and PTH(1-34) exhibit
similar receptor binding to the RG form of the PTHR, our discovery
that PTHrP binds less strongly to the R.sup.0 form of the PTHR and
correspondingly exhibits less prolonged activity in vivo as
compared to PTH can explain the difference. Accordingly, we believe
that RG selective ligands of PTHR (i.e., with relatively low
R.sup.0 affinity) will prove useful for treatment of
osteoporosis.
[0129] In other situations, a longer acting ligand may be
desirable. For example, PTHrP is less effective than PTH(1-34) in
stimulating renal production of 1,25,(OH).sub.2vitamin D (Horwitz
et al., J. Bone Mineral. Res. 20:1792-1803 (2005)), suggesting that
PTH(1-34) may be more effecting in treating disease where
long-acting PTHR signaling is desired. Such diseases include
certain forms of hypoparathyroidism caused by activating mutations
in the calcium-sensing receptor. Currently, treating this disease
requires twice daily injections of PTH(1-34) (Winer et al., J.
Clin. Endocrinol. Metab. 88:4214-4220 (2003)). By using the
screening methods of the invention, it becomes possible to identify
longer acting PTHR ligands, which can prove highly useful in the
treatment of such diseases and may allow for less frequent
administration of the drug.
[0130] PTH(1-34), via its greater capacity to bind stably to
R.sup.0, may be able to induce a cumulatively greater signaling
response in target bone and kidney cells than does PTHrP, and this
difference in R.sup.0 selectivity then leads to a divergence in
biological responses, such as the induction in osteoblasts of
factors (RANK Ligand) involved in stimulating osteoclastic bone
resorption, and the stimulation in renal proximal tubule cells of
1-.alpha.-hydroxylase mRNA synthesis. According to these
considerations, a ligand that binds with particularly high
selectivity to the RG (versus R.sup.0) PTHR conformation might be
highly effective in stimulating bone formation responses, and thus
useful for treating osteoporosis.
[0131] Thus, the two ligands preferentially stabilize distinct
receptor conformations. There is now much discussion in the GPCR
field regarding the capacity of structurally varied ligands for a
given receptor to exhibit altered selectivities for distinct
receptor conformations, and thus produce distinct biological
effects (Kenakin, T. Sci STKE 342:pe29 (2006)). The results of the
kinetic and equilibrium binding assays performed herein suggest
that whereas PTH(1-34) and PTHrP(1-36) bind with similar affinities
to the G protein-coupled PTHR conformation, RG, PTH(1-34) exhibits
a greater capacity to bind to the G protein-uncoupled conformation,
R.sup.0, defined as a receptor conformation that has the capacity
to bind ligand with high affinity in the presence in GTP.gamma.S
(5,14), than does PTHrP(1-36).
[0132] The delayed cAMP assays presented herein demonstrate that
altered selectivity for distinct PTHR conformations can lead to
altered signaling responses in PTHR-expressing cells. Thus,
PTH(1-34) and Ile.sup.5-PTHrP(1-36) induced more prolonged, and
cumulatively greater, cAMP signaling responses in PTHR-expressing
cells. PTH(1-34) and Ile.sup.5-PTHrP(1-36), which also have a
greater capacity to stabilize R.sup.0 than PTHrP(1-36), can induce
more prolonged signaling responses due to the eventual coupling of
the LR.sup.0 complex to a heterotrimeric G protein (LR.sup.0-LRG)
and activation of the corresponding signaling cascade. Another
potential mechanistic consequence of stable LR.sup.0 binding is
that it may permit multiple (catalytic) rounds of G protein
activation, by which an LR.sup.0 complex is preserved after
successive cycles of G protein coupling, activation and release
(Rodbel, M. Adv. Enzyme Regul, 37: 427-435 (1997); Heck and
Hofmann, J. Biol. Chem. 276:10000-10009 (2001)).
[0133] Little if any difference in the potencies with which
PTH(1-34) and PTHrP(1-36) ligands stimulated cAMP and inositol
phosphate responses was detected when the ligands were assessed in
conventional dose-response, cAMP and inositol phosphate stimulation
assays performed in cells at a single-time-point (FIG. 7). These
results are consistent with the view that the two ligands interact
with the PTHR via the same, or similar mechanisms. The time-delayed
cAMP assays thus identified previously unappreciated differences in
the second-messenger signaling properties of the two ligands,
evident as differences in the cumulative signal output over time.
While the agonist-activated PTHR is known to be subject to
desensitization processes involving receptor phosphorylation,
beta-arrestin recruitment, and receptor internalization (Biselo, A.
et al., (2002); Tawfeek et al., Mol. Endocrinol. (2002); Castro et
al., Endocrinology 143:3854-3865 (2002); Chauvin et al., Mol.
Endocrinol. 16:2720-2732 (2002)), it is not expected that such a
process would operate on receptors in the R.sup.0 conformation, as
these are, by definition, functionally inactive, at least in terms
of G protein coupling. Nevertheless, the possibility that the
effects observed in our delayed cAMP assays of FIG. 5 involve, to
some extent, differential effects of the ligands on such receptor
desensitization mechanisms cannot be excluded.
[0134] In general, a stable LR.sup.0 binding capacity might
facilitate, or augment, the signaling potential of a ligand in
target cells that express a low level of the cognate heterotrimeric
G protein, relative to the target receptor. It may also facilitate
coupling to "secondary" G proteins that presumably have lower
affinity for the ligand-receptor complex than does the primary G
protein. For the PTHR, this could involve coupling to
G.alpha..sub.q/11, G.alpha..sub.i/o, or G.alpha..sub.12/13, each of
which has been shown to be activated by the PTHR in response to
PTH(1-34). While PTHrP has at least some capacity to bind R.sup.0
(FIGS. 3A-3D) and activate delayed cAMP signaling (FIGS. 5A and
5B), the binding is less than that of PTH(1-34). Indeed, some
capacity to form a stable LR.sup.0 complex may be an intrinsic
property of the class B GPCRs, as several of these, including the
receptors for calcitonin (Hilton et al., J. Endocrinol. 166:213-226
(2002)), corticortropin-releasing hormone (Hoare et al., Peptides
24:1881-1897 (2003)) and glucagon (Post et al., J. Biol. Chem.
267:25776-25785 (1992)) have been shown to form a stable complex
with their cognate peptide ligand in the presence of a
non-hydrolyzable guanine nucleotide analog.
[0135] The findings described herein may also relate to the
mechanisms by which PTH and PTHrP function in normal physiology.
PTH, as an endocrine hormone, acts on target cells (in bone and
kidney) that are distal from its site of secretion (the parathyroid
glands). Concentrations of PTH in the serum, while varying
marginally as Ca.sup.++ levels fluctuate, generally stay within the
low picomolar range, well below the affinity with which PTH binds
to its receptor. The capacity of PTH to bind stably to the receptor
even in the uncoupled, R.sup.0 conformation may be an evolutionary
adaptation that helps to ensure a response to even minimal
increases in the ligand's concentration. By contrast, PTHrP, as a
paracrine factor, acts on cells within the same tissue in which it
is produced (e.g., the growth-plate chondrocytes of developing long
bones). The concentrations of PTHrP in such tissues have not been
directly quantified, but they appear to form a gradient across the
zones of differentiating cells and high near the sites of
production (Chen et al., J. Bone Miner. Res. 21:113-123 (2006)). It
may be that, as an adaptation for its role in controlling the
differentiation events that occur in these cells, PTHrP evolved to
bind to the receptor only transiently, so as to induce a relatively
short-lived, and more easily timed, signaling response.
G-Protein-Coupled Receptors
[0136] The present invention can use any G-protein-coupled
receptor. Long-acting and short-lived ligands may be assayed as
described herein and useful therapeutic candidates identified.
Hundreds of such receptors are known in the art; see, e.g.,
Fredriksson et al., Mol. Pharmacol. 63:1256-1272, 2003, which is
hereby incorporated by reference. This reference has characterized
the human GPCRs based on sequence homology and function. Human
GPCRs can be broken down into five classes: secretin, rhodopsin,
glutamate, frizzled/Tas2, and adhesion. Alternatively, receptors
may be classified by their ligands, e.g., peptide hormones or small
molecules (e.g., biogenic amines). Other classification schemes
include the A-F classification, where class A represents receptors
related to rhodopsin and the adrenergic receptors, class B,
receptors related to the calcitonin and parathyroid hormone
receptors, class C, receptors related to the metabotropic
receptors, and classes D-F represent receptors found in fungi and
archaebacteria.
[0137] Using the Fredriksson classification, the secretin receptors
have four main subgroups: the CRHRs/CALCRLs, the PTHRs,
GLPRs/GCGR/GIPR and the subgroup including secretin and four other
receptors. Secretin receptors include the PTHR, as well as the
calcitonin receptor (CALCR), the corticotropin-releasing hormone
receptors (CRHRs), the glucagon receptor (GCGR), the gastric
inhibitory polypeptide receptor (GIPR), the glucagon-like peptide
receptors (GLPRs), the growth hormone-releasing hormone receptor
(GHRHR), pituitary adenylyl cyclase-activating protein (PACAP), the
secretin receptor (SCTR), and vasoactive intestinal peptide
receptor (VIPR).
[0138] The adhesion receptors feature GPCR-like
transmembrane-spanning regions fused together with one or several
functional domains with adhesion-like motifs in the N terminus,
such as EGF-like repeats, mucin-like regions, and conserved
cysteine-rich motifs. Members of this family include the CELSRs
(EGF LAG seven-pass G-type receptors), the brain-specific
angiogenesis-inhibitory receptors (BAIs), the lectomedin receptors
(LECs) and the EGF-like module containing (EMRs). Other receptors
include the CD97 antigen receptor (CD97) and
EGF-TMVII-latrophilin-related (ETL). These receptors also include
HE6 (TMVIILN2) and GPR56 (TMVIIXN1 or TMVIILN4) and a group of
recently discovered receptors, related to GPR56 and HE6, named
GPR97 and GPR110 to GPR116.
[0139] The glutamate receptors consists of eight metabotropic
glutamate receptors (GRM), two GABA receptors (e.g., GAB-AbR1,
which has two splice variants, a and b, and GAB-AbR2), a single
calcium-sensing receptor (CASR), and five receptors believed to be
taste receptors (TAS1).
[0140] Other GPCRs include opioid, muscarinic, dopamine,
adrenergic, cAMP, opsins, angiotensin, serotonin, thyrotropin,
gonadotropin, substance-K, substance-P and substance-R, and
melanocortin, metabotropic glutamate receptors.
[0141] The largest group is the rhodopsin receptor family, which
includes at least 701 human receptors, 241 of which are
non-olfactory. Receptors in this group include various
acetylcholine (muscarinic) receptors, adrenergic receptors,
dopamine receptors, histamine receptors, serotonin receptors, and
octopamine receptors; peptide receptors, e.g., angiotensin,
bombesin, bradykinin, endothelin, interleukin-8, chemokine,
melanocortin, neuropeptide Y, neurotensin, opioid, somatostatin,
tachykinin, thrombin, vasopressin, galanin, proteinase-activated,
orexin, and chemokine/chemotatic factor receptors; protein hormone
receptors, e.g., FSH, lutropin-choriogonadotropic hormone, and
thyrotropin receptors; rhodopsin receptors; olfactory receptors;
prostanoid receptors; nucleotide-like receptors, including
adenosine and purinoceptors; cannabis receptors; platelet
activating factor receptor; gonadotropin-releasing hormone
receptor; melatonin receptor, lysosphingolipid and LPA (EDG)
receptors, as well as various orphan receptors.
Candidate Compounds
[0142] Any type or source of compound may be used in the screening
methods of the invention. For example, naturally occurring
chemicals (e.g., from a chemical library), peptides, modified
peptide hormones, antibodies, nanobodies, chimeric peptides, and
fragments of endogenous ligands (e.g., peptide ligands) may all be
used in the present invention. Approaches involving random
screening, such as natural libraries of compounds, or designed
ligands (e.g., ligands based on the PTH sequence) may be used in
the screening methods of the invention. In some embodiments,
antibodies or nanobodies can be generated against the GPCR or a
ligand binding fragment of the GPRC using methods known in the
art.
[0143] Modified Receptor Agonists
[0144] One strategy for identification of new receptor agonists is
the modification of existing agonists. Peptide hormones can be
modified by point mutations, truncations, insertions, and
generation of chimeric peptides. Using the PTH receptor, for
example, many modified PTH and PTHrP sequences are known in the
art. Peptides can made either recombinantly or synthetically, as is
known in the art. See, for example, U.S. Pat. Nos. 7,057,012,
7,022,815, 6,417,333, 6,495,662, hereby incorporated by reference,
which describe various PTH sequences, as well as any of those
described herein. These sequences can include chimeric peptides. In
one particular example, any agonist may be fused to an antibody or
antibody fragment (such as an Fc fragment) to generate a candidate
therapeutic.
[0145] Antibodies and Nanobodies
[0146] Antibodies or nanobodies which bind the GPCR can also be
used in the methods of the invention and can be raised against the
GPCR or a fragment thereof (e.g., a ligand-binding portion of the
GPCR) using any method known in the art. In one example, an IgG
directed to a GPCR or fragment thereof can be generated in New
Zealand white rabbits using a purified protein. The initial
immunization protocol consists of an initial intramuscular
injection of 10-20 purified protein, followed by a boosting
immunization 21 days later. Further boosts and/or the addition of
adjuvant may be used if no or few antibodies are detected.
Antibodies may be quantified by ELISA, analogous to that described
(Siber et al., J. Infect. Dis. 152:954-964, 1985; Warren et al., J.
Infect. Dis. 163:1256-1266, 1991). IgG may be purified from the
rabbit antiserum, for example, by precipitation in 50% ammonium
sulfate followed by affinity chromatography on Protein G sepharose
4B (Pharmacia). Monoclonal antibodies to GPCRs can be produced
using hybridoma technology. Nanobodies can be generated by
immunization of an animal (e.g., a camel or llama) which produce
nanobodies, which can then be purified using standard techniques.
These antibodies or nanobodies would be screened as described
herein for those agonistic molecules that produce long-lived or
short-acting effects.
[0147] Test Compounds and Extracts
[0148] In general, compounds capable of binding a GPCR (e.g., PTHR)
are identified from large libraries of both natural product or
synthetic (or semi-synthetic) extracts or chemical libraries
according to methods known in the art. Those skilled in the field
of drug discovery and development will understand that the precise
source of test extracts or compounds is not critical to the
screening procedure(s) of the invention. Accordingly, virtually any
number of chemical extracts or compounds can be screened using the
methods described herein. Examples of such extracts or compounds
include, but are not limited to, plant-, fungal-, prokaryotic- or
animal-based extracts, fermentation broths, and synthetic
compounds, as well as modification of existing compounds. Numerous
methods are also available for generating random or directed
synthesis (e.g., semi-synthesis or total synthesis) of any number
of chemical compounds, including, but not limited to, saccharide-,
lipid-, peptide-, and polynucleotide-based compounds. Synthetic
compound libraries are commercially available. Alternatively,
libraries of natural compounds in the form of bacterial, fungal,
plant, and animal extracts are commercially available. In addition,
natural and synthetically produced libraries are produced, if
desired, according to methods known in the art, e.g., by standard
extraction and fractionation methods. Furthermore, if desired, any
library or compound is readily modified using standard chemical,
physical, or biochemical methods.
[0149] In addition, those skilled in the art of drug discovery and
development readily understand that methods for dereplication
(e.g., taxonomic dereplication, biological dereplication, and
chemical dereplication, or any combination thereof) or the
elimination of replicates or repeats of materials already known for
their activity in treating metabolic disorders should be employed
whenever possible.
[0150] When a crude extract is found to bind the GPCR in its RG
state, and either exhibits altered binding (e.g., higher affinity
or lower affinity) as compared to the endogenous ligand when the
receptor is in its R.sup.0 state, further fractionation of the
positive lead extract is necessary to isolate chemical constituents
responsible for the observed effect. Thus, the goal of the
extraction, fractionation, and purification process is the
characterization and identification of a chemical entity within the
crude extract having activity that may be useful in treating a
metabolic disorder (e.g., diabetes and obesity). Methods of
fractionation and purification of such heterogenous extracts are
known in the art. If desired, compounds shown to be useful agents
in the screening methods of the invention are chemically modified
according to methods known in the art.
[0151] Such test compounds include naturally occurring or synthetic
chemical compounds, (including small molecules) as well as amino
acid or nucleic acid aptamers. Any of these compounds may include
synthetic or modified amino acids or nucleic acids.
Contacting a Receptor with a Candidate Compound
[0152] In the screening method of the present invention, a
candidate compound is contacted with a GPCR. The receptor may be
found on a cell (e.g., in an organism), or a in a membrane
preparation. Alternatively, the receptor may be isolated in
functional form (Shimada et al., J. Biol. Chem. 277:31,774-31780,
2002).
[0153] Cells which either naturally express the GPCR of interest
(e.g., PTHR) or express the receptor recombinantly can be used in
the methods of the invention. Alternatively, or in addition, the
cells can be tranfected (e.g., using any method known in the art)
to express a recombinant gene encoding the GPCR. Cells expressing a
particular GPCR can also be obtained commercially, for example,
from Millipore (ChemiScreen.TM. cell lines).
[0154] In other embodiments, the receptor is present in a membrane
preparation (e.g., cell free) which contains the GPCR of interest.
Such preparations are commercially available; see, e.g., the
ChemiSCREEN.TM. receptor preparations available from Millipore.
Membrane preparations can also be produced using methods known in
the art (see, e.g., Mills et al., J. Biol. Chem. 263:13-16,
1988).
[0155] If purified receptor components are utilized, candidate
compound are contacted with the receptor or receptor complex in
vitro.
Assay Readout--Measuring Ligand Binding or Activity
[0156] Any method for analysis of ligand binding or ligand activity
may be used in the methods of the invention; the particular readout
is not critical. In some embodiments, ligand binding to the GPCR is
measured by displacement of a radiolabeled ligand by a non-labeled
compound and measuring the radioactivity of the cell or membrane
preparation before and after treatment with the non-labeled
compound. In general, this approach involves incubating the
membranes and radioligand to allow complex formation. Dissociation
phase can be initiated by the addition of excess unlabeled
compound. Immediately prior to the addition (t=0), and at
successive time-points thereafter, aliquots can be withdrawn and
immediately processed by vacuum filtration. Non-specific binding is
determined in parallel reaction tubes containing the unlabeled
compound in both the pre-incubation and dissociation phases. The
specifically bound radioactivity at each time point can be
calculated as a percent of the radioactivity specifically bound at
t=0. Such dissociation methods are well suited to large scale
screening (e.g., libraries of candidate compounds).
[0157] As described in Example 1 below, other methods such as FRET
can also be used to measure ligand binding to a receptor. In one
application, two fluorescent molecules are conjugated to the
receptor such that ligand binding results in a conformational
change in the receptor that can be detected by a change in FRET
signal. FRET allows for real time measurement of ligand binding and
is thus useful in the assays of the invention.
[0158] Other readouts include measurements of cAMP activity
including the delayed cAMP activity assay described herein, which
indirectly measures binding of the compound to the RG form of the
receptor. Intracellular cAMP levels can be measured using a
radioimmuno assay, e.g., as described by Shimizu et al. (J. Biol.
Chem. 276:49003-49012 (2001)). Briefly, this method includes
treatment with a candidate compound, rinsing with 0.5 ml of binding
buffer (50 mM Tris-HCl, 100 mM NaCl, 5 mM KCl, 2 mM CaCl.sub.2, 5%
heat-inactivated horse serum, 0.5% fetal bovine serum, adjusted to
pH 7.7 with HCl), and treating with 200 .mu.l of cAMP assay buffer
(Dulbecco's modified Eagle's medium containing 2 mM
3-isobutyl-1-methylxanthine, 1 mg/ml bovine serum albumin, 35 mM
Hepes-NaOH, pH 7.4) and 100 .mu.l of binding buffer containing
varying amounts of the candidate compound (final volume=300 .mu.l).
The medium can then be removed after incubation for 30-60 min at
room temperature. The cells can then be frozen, lysed with 0.5 ml
50 mM HCl, and refrozen (at -80.degree. C.). The cAMP content of
the diluted lysate can be determined by radioimmunoassay. The
EC.sub.50 response values can be calculated using nonlinear
regression.
[0159] Any suitable physiological change that affects GPCR activity
can be used to assess the influence of a test compound on GPCR
activity. When the functional consequences are determined using
intact cells or animals, a variety of effects such as transmitter
release, hormone release, transcriptional changes to both known and
uncharacterized genetic markers (e.g., northern blots), changes in
cell metabolism such as cell growth or pH changes, and changes in
intracellular second messengers such as Ca.sup.++, IP.sub.3, or
cAMP, can also be measured.
[0160] In one embodiment, the changes in intracellular cAMP can be
measured using immunoassays. The method described in Offermanns and
Simon, J. Biol. Chem. 270:15175-15180 (1995), may be used to
determine the level of cAMP. Assay kits for measuring cAMP as
described in U.S. Pat. No. 4,115,538, herein incorporated by
reference, can also be used. Other assays that may be used include
measuring in vivo changes in serum/urinary calcium, phosphate, and
markers of bone-turnover (e.g., deoxypridonoline crosslinks),
decreases in serum reciprocal changes in urine.
Measuring R.sup.0 or RG Binding
[0161] The methods of the present invention involve measurement of
binding of a candidate compound to the RG or R.sup.0 form of the
GPCR (e.g., PTHR). Thus, the readout of the assay can distinguish
between the affinity of the compound for each form of the receptor.
One possible approach is to use a system or condition where one
receptor conformation is favored. R.sup.0 can be favored, for
example, by forced dissociation of the GPCR from its G-protein, or
using a system that lacks G-proteins. One manner in which
dissociation of the GPCR from G-proteins can be achieved is by
treatment with a compound that prevents binding of the G-protein to
its GPCR. Such compounds include nucleotide analogs such
non-hydrolyzable nucleotide analogs including GTP.gamma.S.
GTP.gamma.S binds the G-protein, but as it is unable to hydrolize
this compound, the G-protein cannot recycle itself back on the
GPCR. Thus, by contacting a cell or cell membrane with GTP.gamma.S
prior to addition of the candidate compound, it is possible to
generate a system in which the R.sup.0 state of the GPCRs is highly
favored.
[0162] To stabilize the RG form of the GPCR, dominant-negative
G-proteins can be used. These proteins bind the GPCR in a stable
manner, and thus enrich for the RG conformation.
[0163] Other approaches to modulate the ratio between R.sup.0 and
RG include using cells from animals in which expression of one or
more G-proteins has been downregulated or eliminated. Genetic
knockout technologies are well known in the art and can be used to
target specific G-proteins (see, e.g., Dean et al., Mol.
Endocrinol. 20:931-943 (2006)). In other embodiments, RNAi
techniques (e.g., administration of siRNA to a cell) can be used to
"knock down" expression of G-proteins, thereby favoring the R.sup.0
state of the receptor. Alternatively, it may be possible to favor
the RG form by overexpressing the appropriate G protein or
G-proteins in a cell.
[0164] A second approach for measuring the ability of a compound to
bind either the R.sup.0 or RG state involves displacement of a
ligand known to be selective for a particular state. In the case of
the PTH receptor, previous work has shown that
.sup.125I-[Aib.sup.1,3,M]PTH(1-15) (SEQ ID NO:126) is selective for
the RG state. By measuring ligand displacement by a candidate
compound of a such ligand, the binding of the compound to that
state can be specifically measured, even if the receptor is present
in both the RG and the R.sup.0 states in the assay.
[0165] Compounds identified in the methods of the invention
typically bind to the RG form of the receptor with at least 5%,
(e.g., at least 10%, 20%, 50%, 100%, 500%, 1000%, 10,000%) of the
activity of an endogenous receptor for either long-acting or
short-lived agonists. For example, human PTH binds the human PTHR
with an EC50 of about 0.13 nmol. Thus desirable compounds typically
bind the hPTHR with at least 10% of this affinity, i.e., at least
1.3 nmol EC50.
Ligands Identified Using the Methods of the Invention
[0166] Using the screening methods described herein, we have
identified a variety of ligands for the exemplary GPCR, the PTH
receptor, representing different combinations of either class of
peptide (PTH/PTHrP hybrids) chosen on the basis of their relative
R.sup.0/RG selectivity to be either short-acting ligands or
long-acting ligands (FIGS. 26A and 26B). Based on the results of
our screening assay, we then tested these peptides for in vitro and
in vivo activity to demonstrate proof of concept of the importance
of R.sup.0/RG selectivity in determining biological activity of the
ligand.
[0167] The identified peptides represent proof of concept for the
PTH receptor and other GPCRs that R.sup.0/RG selectivity determines
biological action in vivo.
[0168] These peptides include five different classes. A first class
is typified by Ile.sup.5-PTHrP, an analog that converts PTHrP to a
form with high R.sup.0 selectivity and prolonged action. A second
class includes hybrid peptides with high R.sup.0/RG selectivity
composed of MPTH(1-11) combined with PTHrP(12-36) or MPTH(1-14)
with PTHrP(15-36). These peptides have very prolonged biological
activity in vivo. The third type is [His.sup.5,Arg.sup.19]PTH,
which illustrates shorter acting biological activity due to its
reduced R.sup.0 affinity. A fourth class of compounds is
exemplified by Ala.sup.1,Aib.sup.3-M-PTH(1-28) (SEQ ID NO:11),
which has a potent R.sup.0-activating activity, as well as striking
activity to promote urinary phosphate excretion, a property
desirable in the treatment of disorders associated with high
phosphate retention. A fifth class is typified by Ala.sup.23-PTH,
which has a much lower R.sup.0 affinity and therefore more
desirable for the treatment of osteoporosis.
[0169] For the PTH receptor ligands, we have identified ligands
with variety of R.sup.0 and RG binding affinities and various
R.sup.0/RG selectivities. Exemplary peptides, sorted by R.sup.0
affinity are shown in FIG. 26B. The affinity for the R.sup.0 form
of the receptor may be at least 2000, 1000, 750, 500, 250, 150,
100, 90, 75, 50, 40, 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2.5,
2, 1.5, 1, 0.5, 0.2, 0.1, or 0.05 nmol. The affinity for the RG
form of the receptor may be at least 100, 50, 25, 20, 15, 10, 9, 8,
7, 6, 5, 4, 3, 2.5, 2, 1.75, 1.5, 0.125, 1, 0.9, 0.8, 0.7, 0.6,
0.5, 0.4, 0.3, 0.25, 0.2, 0.15, 0.1, 0.075, 0.05, 0.025 nmol. The
selectivity of R.sup.0/RG may be (where a higher values indicates
greater RG-selectivity) at least 0.5, 1, 2, 3, 4, 5, 8, 10, 15, 20,
25, 30, 40, 50, 60, 75, 100, 150, 200, 250, 400, 500, 750, 1000,
1250, 1500, 2000, 2500, or 5000. Ligands of the invention may have
any of the RG or R.sup.0 affinities described herein, or any
combination thereof.
RG and R.sup.0 Selective Ligands
[0170] Using the screening methods described herein, we have
developed new RG selective and R.sup.0 selective ligands. In one
example, we used PTHrP(1-28) (SEQ ID NO:151) as a starting point,
as PTHrP binds to the RG receptor conformation with greater
selectivity as compared to PTH. Table 2 summarizes the in vitro
activities of particular analogs; additional analogs are shown in
Table 3. More detailed information regarding these analogs are
described below in Example 3. These analogs, A(E)18, A22, (L25),
K26-PTHrP(1-28) or (1-30) generally exhibit enhanced potency for
cAMP generation, and bind with relatively high selectivity to the
RG conformation, as compared to PTHrP(1-36) (Table 2).
TABLE-US-00005 TABLE 2 In vitro activities of representative PTHrP
analogs SaOS MC3T3-E1 RG binding R.sup.0 binding SEQ camp cAMP
affinity hPTHR affinity hPTHR R0/RG Analog ID NO: EC50 (nM) EC50
(nM) IC50 (nM) IC50 (nM) selectivity PTHrP(1-36) 6 0.190 0.322 0.33
74.8 229 PTHrP(1-28) 151 20.3 4.09 0.66 20449 31069 A18, 22,
K28-PTHrP(1-28) 56 0.024 0.091 0.10 1815 18079 E18, A22,
K26-PTHrP(1-28) 65 0.241 0.251 0.24 9237 38327 A18, 22, L25,
K26-PTHrP(1-28) 76 0.002 0.054 0.04 310 6971 E18, A22, L25,
K28-PTHrP(1-28) 83 0.010 0.083 0.10 1741 18317 A18, 22, L25,
K26-PTHrP(1-30) 89 0.008 0.067 0.05 144 3025 E18, A22, L25,
K26-PTHrP(1-30) 90 0.063 0.059 0.08 945 11169
[0171] Additional peptides and binding/activity data for such
peptides are shown in Table 3 below.
TABLE-US-00006 TABLE 3 Binding/activity of PTHrP analogs screen
dose-response human human cAMP in cAMP in human human rat rat SEQ
cAMP PIR RG PIR R0 SaOS MC3T3-E1 PIR RG PIR R0 PIR RG PIR R0
Sequence ID (% (% (% (EC50, (EC50, (IC50 (IC50 (IC50 (IC50 (parent
shown in bold) NO: parent).sup.1 parent).sup.2 parent).sup.2 nM)
nM) nM) nM) nM) nM) PTHrP(1-28)NH 151 A18-PTHrP(1-28)NH 34 164
S18-PTHrP(1-28)NH 35 121 M18-PTHrP(1-28)NH 36 113 F18-PTHrP(1-28)NH
37 109 E18-PTHrP(1-28)NH 38 140 A22-PTHrP(1-28)NH 39 185
S22-PTHrP(1-28)NH 40 141 L22-PTHrP(1-28)NH 41 142 N22-PTHrP(1-28)NH
42 138 W22-PTHrP(1-28)NH 43 129 E22-PTHrP(1-28)NH 44 121
K22-PTHrP(1-28)NH 45 150 A26-PTHrP(1-28)NH 46 142 S26-PTHrP(1-28)NH
47 107 N26-PTHrP(1-28)NH 48 113 K26-PTHrP(1-28)NH 49 142
R26-PTHrP(1-28)NH 50 143 L25-PTHrP(1-28)NH 51 325 W25-PTHrP(1-28)NH
52 270 K25-PTHrP(1-28)NH 53 163 R25-PTHrP(1-28)NH 54 204 A18, 22,
26-PTHrP(1-28)NH 55 343 167 160 A18, 22, K26-PTHrP(1-28)NH 56 405
193 178 0.024 0.091 0.10 1815 A18, 26, S22-PTHrP(1-28)NH 57 229 148
133 A18, S22, K26-PTHrP(1-28)NH 58 372 175 155 0.038 A18, 26,
N22-PTHrP(1-28)NH 59 265 161 136 A18, N22, K26-PTHrP(1-28)NH 60 326
172 139 A18, 26, L22-PTHrP(1-28)NH 61 252 163 133 A18, L22,
K26-PTHrP(1-28)NH 62 350 177 160 A18, 26, W22-PTHrP(1-28)NH 63 188
120 126 A18, W22, K26-PTHrP(1-28)NH 64 267 115 136 E18, A22,
K26-PTHrP(1-28)NH 65 301 145 68.8 0.241 0.251 0.24 9237 E18, S22,
A26-PTHrP(1-28)NH 66 119 132 31.9 E18, N22, A26-PTHrP(1-28)NH 67
171 140 53.7 E18, N22, K26-PTHrP(1-28)NH 68 236 147 84.4 E18, L22,
A26-PTHrP(1-28)NH 69 139 125 52.5 E18, L22, K26-PTHrP(1-28)NH 70
264 152 64.4 E18, W22, A26-PTHrP(1-28)NH 71 75 116 18.8 E18, W22,
K26-PTHrP(1-28)NH 72 165 149 46.6 E18, K22, A26-PTHrP(1-28)NH 73
315 192 106.1 E18, K22, 26-PTHrP(1-28)NH 74 374 208 119.8 E18, A22,
26-PTHrP(1-28)NH 75 190 A18, 22, L25, K26-PTHrP(1-28)NH 76 305
0.002 0.054 0.04 310 0.16 34.9 A18, 22, K25, 26-PTHrP(1-28)NH 77
349 0.012 A18, 22, I25, K26-PTHrP(1-28)NH 78 342 A18, 22, W25,
K26-PTHrP(1-28)NH 79 329 A18, 22, F25, K26-PTHrP(1-28)NH 80 337
A18, S22, L25, K26-PTHrP(1-28)NH 81 367 0.009 0.10 540 A18, S22,
K25, 26-PTHrP(1-28)NH 82 316 0.015 E18, A22, L25, K26-THrP(1-28)NH
83 340 0.010 0.10 1741 E18, A22, K25, 26-PTHrP(1-28)NH 84 323 0.054
E18, S22, L25, K26-PTHrP(1-28)NH 85 337 0.055 0.11 2056 E18, S22,
K25, 26-PTHrP(1-28)NH 86 335 PTHrP(1-30)NH 183 A18, 22,
K26-PTHrP(1-30)NH 87 0.058 E18, A22, K27-PTHrP(1-30)NH 88 0.082
A18, 22, L25, K26-PTHrP(1-30)NH 89 0.067 0.05 144 0.13 11.1 E18,
A22, L25, K26-PTHrP(1-30)NH 90 0.059 0.08 945 0.21 76.3
PTHrP(1-31)NH 184 A18, 22, K26-PTHrP(1-31)NH 91 0.060 E18, A22,
K27-PTHrP(1-31)NH 92 0.060 0.23 54.8 A18, 22, L25,
K26-PTHrP(1-31)NH 93 0.20 E18, A22, L25, K26-PTHrP(1-31)NH 94 0.112
E18, A22, L25, K26-PTHrP(1-31)OH 94 100 0.78 E18, A22, L25, K26,
G29-PTHrP(1-31)OH 95 206 E18, A22, L25, K26, S29-PTHrP(1-31)OH 96
209 0.41 E18, A22, L25, K26, M29-PTHrP(1-31)OH 97 210 E18, A22,
L25, K26, Q29-PTHrP(1-31)OH 98 226 0.59 E18, A22, L25, K26,
W29-PTHrP(1-31)OH 99 142 E18, A22, L25, K26, E29-PTHrP(1-31)OH 100
100 E18, A22, L25, K26, K29-PTHrP(1-31)OH 101 227 0.28 E18, A22,
L25, K26, G30-PTHrP(1-31)OH 102 286 E18, A22, L25, K26,
S30-PTHrP(1-31)OH 103 331 0.12 E18, A22, L25, K26,
L30-PTHrP(1-31)OH 104 185 E18, A22, L25, K26, N30-PTHrP(1-31)OH 105
189 E18, A22, L25, K26, D30-PTHrP(1-31)OH 106 251 0.32 E18, A22,
L25, K26, K30-PTHrP(1-31)OH 107 245 0.20 E18, A22, L25, K26,
S31-PTHrP(1-31)OH 108 99 E18, A22, L25, K26, L31-PTHrP(1-31)OH 109
198 0.25 E18, A22, L25, K26, V31-PTHrP(1-31)OH 110 181 E18, A22,
L25, K26, K31-PTHrP(1-31)OH 111 134 E18, A22, L25,
K26-PTHrP(1-34)OH 112 100 0.45 E18, A22, L25, K26,
A30-PTHrP(1-34)OH 113 237 0.14 E18, A22, L25, K26,
A31-PTHrP(1-34)OH 114 249 0.15 E18, A22, L25, K26,
A32-PTHrP(1-34)OH 115 197 E18, A22, L25, K26, A33-PTHrP(1-34)OH 116
196 E18, A22, L25, K26, Q29, D30, V31, 117 204 0.56 N33,
F34-PTHrP(1-34)OH
[0172] We also produced the peptides A.sup.20,Mc-PTH(1-34)OH (SEQ
ID NO:149), F.sup.23,Mc-PTH(1-34)OH (SEQ ID NO:150),
[A.sup.1,A.sup.3,A.sup.23,Q.sup.10,R.sup.11]-PTH(1-34)OH (SEQ ID
NO:181), [A.sup.1,A.sup.3,A.sup.23]-PTH(1-34)OH (SEQ ID NO:182),
and E.sup.18,A.sup.22,L.sup.25,K.sup.26-PTHrP(1-30) (SEQ ID NO:90).
R.sup.0 and RG binding of these peptides to the human PTH1 receptor
is shown in Table 4 below.
TABLE-US-00007 TABLE 4 RG and R.sup.0 binding of exemplary peptides
RG SEQ ID R0 binding binding R0/RG Peptide NO: IC50 (nM) IC50 (nM)
ratio hPTH(1-34) 5 8.7 .+-. 1.2 0.13 .+-. 0.02 67 hPTHrP(1-36) 6
37.7 .+-. 4.7 0.14 .+-. 0.02 260 A20,Mc-PTH(1-34)OH 149 31.9 .+-.
10.5 0.40 .+-. 0.09 80 F23,Mc-PTH(1-34)OH 150 1.2 .+-. 0.4 0.23
.+-. 0.07 5 [A1,3,23,Q10,R11]- 181 197 .+-. 33 0.14 .+-. 0.00 1407
PTH(1-34)OH [A1,3,23]-PTH(1-34)OH 182 1845 .+-. 170 0.43 .+-. 0.09
4291 E18,A22,L25,K26- 90 945.0.+-. 0.08.+-. 11813 PTHrP(1-30) Mc =
A1,3,12,Q10,R11,W14,R19
Polypeptide Modifications
[0173] Any of the polypeptides described herein may contain one or
more modifications such as N-terminal or C-terminal modifications.
Modifications include acetylation, acylation, ADP-ribosylation,
amidation, covalent attachment of flavin, covalent attachment of a
heme moiety, covalent attachment of a nucleotide or nucleotide
derivative, covalent attachment of a lipid or lipid derivative,
covalent attachment of phosphotidylinositol, cross-linking,
cyclization, disulfide bond formation, demethylation, formation of
covalent cross-links, formation of cystine, formation of
pyroglutamate, formylation, garnma-carboxylation, glycosylation,
GPI anchor formation, hydroxylation, iodination, methylation,
myristoylation, oxidation, proteolytic processing, phosphorylation,
prenylation, racemization, selenoylation, sulfation, transfer-RNA
mediated addition of amino acids to proteins such as aiginylation,
and ubiquitination. See, for instance, Proteins-Structure and
Molecular Properties, 2nd Ed., T. E. Creighton, W. H. Freeman and
Company, New York, 1993 and Wold, F., Posttranslational Protein
Modifications: Perspectives and Prospects, pgs. 1-12 in
Posttranslational Covalent Modification of Proteins, B. C. Johnson,
Ed., Academic Press, New York, 1983; Seifter et al, Methods Enzymol
182:626 646 (1990) and Rattan et al, Ann NY Acad Sci 663A & 62
(1992).
[0174] Any of the polypeptides of the invention may further include
a heterologous sequence (a fusion partner), thus forming a fusion
protein. The fusion protein may include a fusion partner such as a
purification or detection tag, for example, proteins that may be
detected directly or indirectly such as green fluorescent protein,
hemagglutinin, or alkaline phosphatase), DNA binding domains (for
example, GAL4 or LexA), gene activation domains (for example, GAL4
or VP16), purification tags, or secretion signal peptides (e.g.,
preprotyrypsin signal sequence). In other embodiments the fusion
partner may be a tag, such as c-myc, poly histidine, or FLAG. Each
fusion partner may contain one or more domains, e.g., a
preprotrypsin signal sequence and FLAG tag. In other cases, the
fusion partner is an Fc protein (e.g., mouse Fc or human Fc).
Methods of Treatment of Disease
[0175] Any disease associated with PTH dysfunction, or calcium or
phosphate imbalances, can be treated with any of the peptides
described herein, including those in FIGS. 26A and 26B, those of
Table 1, or those identified using the methods of the invention.
The peptides may be used to treat osteoporosis, fracture repair,
osteomalacia, arthritis, thrombocytopenia, hypoparathyroidism or
hyperphosphatemia or may be used to increase stem cell mobilization
in a subject. Any mode of administration (e.g., oral, intravenous,
intramuscular, ophthalmic, topical, dermal, subcutaneous, and
rectal) can be used in the treatment methods of the invention. A
physician will determine appropriate dosing for the patient being
treated, which will depend in part on the size of the patient, the
severity of the disease or condition, and the particular disease or
condition being treated.
Formulation of Pharmaceutical Compositions
[0176] The administration of any compound described herein (e.g.,
PTH-derived peptides) or identified using the methods of the
invention may be by any suitable means that results in a
concentration of the compound that treats the subject disease
condition. The compound may be contained in any appropriate amount
in any suitable carrier substance, and is generally present in an
amount of 1-95% by weight of the total weight of the composition.
The composition may be provided in a dosage form that is suitable
for the oral, parenteral (e.g., intravenously or intramuscularly),
rectal, cutaneous, nasal, vaginal, inhalant, skin (patch), ocular,
or intracranial administration route. Thus, the composition may be
in the form of, e.g., tablets, ampules, capsules, pills, powders,
granulates, suspensions, emulsions, solutions, gels including
hydrogels, pastes, ointments, creams, plasters, drenches, osmotic
delivery devices, suppositories, enemas, injectables, implants,
sprays, or aerosols. The pharmaceutical compositions may be
formulated according to conventional pharmaceutical practice (see,
e.g., Remington: The Science and Practice of Pharmacy, 20th
edition, 2000, ed. A. R. Gennaro, Lippincott Williams &
Wilkins, Philadelphia, and Encyclopedia of Pharmaceutical
Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel
Dekker, New York).
[0177] Pharmaceutical compositions may be formulated to release the
active compound immediately upon administration or at any
predetermined time or time period after administration. The latter
types of compositions are generally known as controlled release
formulations, which include (i) formulations that create
substantially constant concentrations of the agent(s) of the
invention within the body over an extended period of time; (ii)
formulations that after a predetermined lag time create
substantially constant concentrations of the agents of the
invention within the body over an extended period of time; (iii)
formulations that sustain the agent(s) action during a
predetermined time period by maintaining a relatively constant,
effective level of the agent(s) in the body with concomitant
minimization of undesirable side effects associated with
fluctuations in the plasma level of the agent(s) (sawtooth kinetic
pattern); (iv) formulations that localize action of agent(s), e.g.,
spatial placement of a controlled release composition adjacent to
or in the diseased tissue or organ; (v) formulations that achieve
convenience of dosing, e.g., administering the composition once per
week or once every two weeks; and (vi) formulations that target the
action of the agent(s) by using carriers or chemical derivatives to
deliver the compound to a particular target cell type.
Administration of the compound in the form of a controlled release
formulation is especially preferred for compounds having a narrow
absorption window in the gastro-intestinal tract or a relatively
short biological half-life.
[0178] Any of a number of strategies can be pursued in order to
obtain controlled release in which the rate of release outweighs
the rate of metabolism of the compound in question. In one example,
controlled release is obtained by appropriate selection of various
formulation parameters and ingredients, including, e.g., various
types of controlled release compositions and coatings. Thus, the
compound is formulated with appropriate excipients into a
pharmaceutical composition that, upon administration, releases the
compound in a controlled manner. Examples include single or
multiple unit tablet or capsule compositions, oil solutions,
suspensions, emulsions, microcapsules, molecular complexes,
microspheres, nanoparticles, patches, and liposomes.
Parenteral Compositions
[0179] The composition containing compounds described herein or
identified using the methods of the invention may be administered
parenterally by injection, infusion, or implantation (subcutaneous,
intravenous, intramuscular, intraperitoneal, or the like) in dosage
forms, formulations, or via suitable delivery devices or implants
containing conventional, non-toxic pharmaceutically acceptable
carriers and adjuvants. The formulation and preparation of such
compositions are well known to those skilled in the art of
pharmaceutical formulation.
[0180] Compositions for parenteral use may be provided in unit
dosage forms (e.g., in single-dose ampoules), or in vials
containing several doses and in which a suitable preservative may
be added (see below). The composition may be in form of a solution,
a suspension, an emulsion, an infusion device, or a delivery device
for implantation, or it may be presented as a dry powder to be
reconstituted with water or another suitable vehicle before use.
Apart from the active agent(s), the composition may include
suitable parenterally acceptable carriers and/or excipients. The
active agent(s) may be incorporated into microspheres,
microcapsules, nanoparticles, liposomes, or the like for controlled
release. Furthermore, the composition may include suspending,
solubilizing, stabilizing, pH-adjusting agents, tonicity adjusting
agents, and/or dispersing agents.
[0181] As indicated above, the pharmaceutical compositions
according to the invention may be in a form suitable for sterile
injection. To prepare such a composition, the suitable active
agent(s) are dissolved or suspended in a parenterally acceptable
liquid vehicle. Among acceptable vehicles and solvents that may be
employed are water, water adjusted to a suitable pH by addition of
an appropriate amount of hydrochloric acid, sodium hydroxide or a
suitable buffer, 1,3-butanediol, Ringer's solution, dextrose
solution, and isotonic sodium chloride solution. The aqueous
formulation may also contain one or more preservatives (e.g.,
methyl, ethyl, or n-propyl p-hydroxybenzoate). In cases where one
of the compounds is only sparingly or slightly soluble in water, a
dissolution enhancing or solubilizing agent can be added, or the
solvent may include 10-60% w/w of propylene glycol or the like.
[0182] The following examples are intended to illustrate rather
than limit the invention.
Example 1
Identification of Short-Lived and Long-Acting PTH Peptides
[0183] Characterization of Ligands Using a Competitive Binding
Assay.
[0184] To identify PTHR ligands, kinetic dissociation experiments
were first performed to examine the stability of complexes formed
between PTH and PTHrP radioligand analogs and the human PTHR
expressed in membranes prepared from HKRK-B7 cells. For each
radioligand, dissociation was examined in the presence and absence
of GTP.gamma.S, so as to assess the effects of functionally
uncoupling the receptor from heterotrimeric G proteins (FIGS.
1A-1C). For .sup.125I-PTH(1-34) and .sup.125I-PTHrP(1-36) (FIGS. 1A
and 1B, respectively), the dissociation data, both in the absence
and presence of GTP.gamma.S (solid and open symbols, respectively),
were better fit by a two-phase decay equation than by a
single-phase equation. For .sup.125I-PTH(1-34) and in the absence
of GTP.gamma.S, 17% of the complexes were unstable and decayed
rapidly (t.sub.1/2<1 min), whereas the remaining 83% were stable
and decayed slowly (t.sub.1/2.about.4 h). Upon the addition of
GTP.gamma.S, the rapid, unstable component increased to 21%, such
that 77% of the complexes remained stable (t.sub.1/2.about.2 h)
(FIG. 1A). These findings with .sup.125I-PTH(1-34) agree closely
with previous dissociation studies performed on this radioligand,
and highlight the capacity of PTH(1-34) to bind to a high affinity,
G protein-uncoupled PTHR conformation (R.sup.0) (Shimizu et al., J.
Biol. Chem. 280:1797-807 (2005); Dean et al., Mol. Endocrinol.
20:931-43 (2006)). The complexes formed with .sup.125I-PTHrP(1-36)
and the PTHR were again mostly stable in the absence of GTP.gamma.S
(68% decayed with a t.sub.1/2 of .about.3 h). By contrast, most of
the complexes became unstable upon addition of GTP.gamma.S (72%
decayed with a t.sub.1/2 of .about.1 minute; FIG. 1B). This rapid
dissociation of .sup.125I-PTHrP(1-36) from the PTHR induced by
GTP.gamma.S addition mirrors that observed previously for
.sup.125I-[Aib.sup.1,3,M]PTH(1-15) (Dean et al., Mol. Endocrinol.
20:931-43 (2006)); each of these radioligands thus appears to bind
predominantly to the PTHR in a G protein-coupled conformation
(RG).
[0185] The structural differences in PTH(1-34) and PTHrP(1-36) that
underlie the functional differences seen for the two ligands in the
above dissociation studies then identified. The divergent residues
at position 5 in PTH and PTHrP (Ile and His, respectively) have
been shown to play important roles in determining the affinity
(Shimizu et al., J. Biol. Chem. 280:1797-807 (2005); Gardella et
al., J. Biol. Chem. 270:6584-6588 (1995)) and subtype selectivity
(Gardella et al., J. Biol. Chem. 271:19888-19893 (1996); Behar et
al., Endocrinology 137:4217-4224 (1996)) with which these ligands
bind to the receptor. The receptor-dissociation properties of
.sup.125I-Ile.sup.5-PTHrP(1-36) were examined, again in the absence
and presence of GTP.gamma.S. This radioligand dissociated from the
receptor slowly, both in the presence and absence of GTP.gamma.S,
and, in each case, with mono-phasic kinetics (t.sub.1/2>2 h;
FIG. 1C). Thus, the His.sup.s Ile substitution markedly enhanced
the stability with which PTHrP binds to the PTHR, in the G
protein-coupled, and especially in the G protein-uncoupled
state.
[0186] Effects of GTP.gamma.S on Equilibrium Binding.
[0187] The effects of GTP.gamma.S on the binding of these
radioligands to the PTHR under approximate-equilibrium conditions
was assessed. by incubating with cell membranes for 90 minutes in
the absence or presence of GTP.gamma.S at varying concentrations.
The binding of .sup.125I-PTH(1-34) and
.sup.125I-Ile.sup.5-PTHrP(1-36) to membranes prepared from HKRK-B7
cells was largely unaffected by GTP.gamma.S (<.about.20%
inhibition at 1.times.10.sup.-4 M GTP.gamma.S), whereas the binding
of .sup.125I-PTHrP(1-36) was strongly inhibited by GTP.gamma.S
(.about.70% inhibition at 1.times.10.sup.-7 M GTP.gamma.S;
IC.sub.50=1 .times.10.sup.-9 M; FIG. 2A). To assess binding to the
rat PTHR, parallel studies were performed using membranes prepared
from the rat osteoblastic cell line ROS17/2.8, which endogenously
expresses the rat PTHR. As with the human PTHR in HKRK-B7 cell
membranes, the binding of .sup.125I-Ile.sup.5-PTHrP(1-36) to rat
PTHR likewise was largely insensitive to GTP.gamma.S (FIG. 2B). The
binding of .sup.125I-PTH(1-34) to the rat PTHR appeared more
sensitive to GTP.gamma.S than was its binding to the human PTHR
(FIG. 2A vs. 2B), although the majority of the binding was
resistant to the nucleotide analog. As for the human PTHR,
GTP.gamma.S strongly inhibited the binding of .sup.125I-PTHrP(1-36)
to the rat PTHR, which was as sensitive to the nucleotide analog as
the binding of .sup.125I-[Aib.sup.1,3,M]PTH(1-15) (FIG. 2B). Thus,
PTH(1-34) and Ile.sup.5-PTHrP(1-36) bind more strongly to the G
protein-uncoupled conformation of the PTHR (R.sup.0) than does
PTHrP(1-36) or [Aib.sup.1,3,M]PTH(1-15). By contrast, the later two
peptides bind preferentially to the G protein-coupled conformation,
RG.
[0188] Competition methods were then used to analyze the relative
affinities with which PTH and PTHrP ligands bind to the RG and
R.sup.0 receptor conformations of the PTHR. To assess binding to
RG, .sup.125I-[Aib.sup.1,3,M]PTH(1-15) was used as a tracer
radioligand, as this peptide binds predominantly to RG. Membranes
were prepared from COS-7 cells co-transfected with the hPTHR and a
negative-dominant G.alpha..sub.s subunit (G.alpha..sub.sND), which
enriches for RG, related to R and R.sup.0, as described previously
(Dean et al., Mol. Endocrinol. 20:931-943 (2006); Berlot, C. H., J.
Biol. Chem. 277:21080-21085 (2002); Dean et al., J. Biol. Chem.
281:32485-32495 (2006)). To assess binding to R.sup.0,
.sup.125I-PTH(1-34) was used as a radioligand (binds predominantly
to R.sup.0). Membranes were prepared from COS-7 cells transfected
with the hPTHR alone. GTP.gamma.S (1.times.10.sup.-5) was added to
the binding reactions so as to functionally uncouple
receptor-heterotrimeric G protein complexes, thus enriching for the
R.sup.0 (and R) conformations, relative to RG. The relative
apparent affinities obtained for several unlabeled PTH and PTHrP
ligand were then compared in these two assays, to assess the
selectivity with which each of the ligands bound to the R.sup.0 vs.
RG PTHR conformation.
[0189] PTH(1-34) bound to the R.sup.0 conformation with a five-fold
weaker affinity than it did to the RG conformation (IC.sub.50=4.2
nM vs. 0.86 nM, P=0.0002; FIG. 3A, Table 5). PTHrP(1-36) exhibited
greater selectivity as it bound to R.sup.0 with a 66-fold weaker
affinity than it did to RG (P=0.04; FIG. 3B; Table 5). Thus its
selectivity for RG (vs. R.sup.0) was 13-fold greater than that of
PTH(1-34). Reciprocal exchange of residue 5 in the ligands reversed
this pattern of conformational selectivity; thus,
His.sup.5-PTH(1-34) bound to R.sup.0 with a 750-fold weaker
affinity than it did to RG, and Ile.sup.5-PTHrP(1-36) bound to
R.sup.0 with only a three-fold weaker affinity than it did to RG
(P<0.002; FIGS. 3C and 3D; Table 5).
TABLE-US-00008 TABLE 5 Competition binding to the RG and R.sup.0
conformations of the human PTH receptor IC.sub.50 (nM) RG RR.sup.0
SEQ .sup.125I-PTH(1-15) + .sup.125I-PTH(1-34) + ID NO: G.sub.sND n
GTP.gamma.S n R0:RG [Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 123
0.86 .+-. 0.24 7 4.2 .+-. 0.5 7 5
[His.sup.5,Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 127 0.094
.+-. 0.019 4 71 .+-. 7 4 753 [Tyr.sup.36]hPTHrP(1-36)NH.sub.2 124
0.42 .+-. 0.09 3 28 .+-. 6 3 66
[Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2 125 0.92 .+-. 0.07 3 2.9
.+-. 0.1 3 3 rPTH(1-34)NH.sub.2 130 0.34 .+-. 0.16 3 2.3 .+-. 0.3 3
7 [His.sup.5]rPTH(1-34)NH.sub.2 185 0.19 .+-. 0.04 5 26 .+-. 5 5
138 hPTH(1-34)NH.sub.2 5 0.39 .+-. 0.24 3 6.6 .+-. 2.4 3 17
[His.sup.5]hPTH(1-34)NH.sub.2 9 0.76 .+-. 0.04 5 122 .+-. 35 5 160
hPTHrP(1-36)NH.sub.2 6 0.59 .+-. 0.02 3 24 .+-. 3 3 42
[Aib.sup.1,3,M]rPTH(1-15)NH.sub.2 126 0.74 .+-. 0.18 3 1029 .+-.
148 3 1,397
[0190] The Ile.sup.5.fwdarw.His substitution also strongly reduced
affinity for R.sup.0 without greatly affecting affinity for RG in
human-PTH(1-34) and rat-PTH(1-34) peptides that lacked the
methionine.sup.8,21.fwdarw.norleucine and Phe.sup.34 Tyr.sup.34
substitutions of our control PTH(1-34) analog (FIGS. 6A, 6B, 6D,
and 6E and Table 4). Thus, PTH(1-34) binds with higher affinity to
R.sup.0 than does PTHrP(1-36), whereas both PTH(1-34) and
PTHrP(1-36) bind with high affinity to the RG PTHR conformation.
Residue 5 in the ligand plays a significant role in modulating the
capacity of the ligands to bind to the R.sup.0 versus RG
conformations. In addition, residues carboxy-terminal of position
15 in PTH(1-34) contribute to the capacity of the ligand to bind
strongly to R.sup.0, as shown by [Aib.sup.1,3,M]PTH(1-15), which
binds only weakly to R.sup.0 but maintains strong affinity for RG
(FIG. 6C and Table 4).
[0191] Direct Recording of PTHR Activation.
[0192] The fluorescent resonance energy transfer (FRET) approach
has recently been used to assess, in real time and in intact cells,
the processes of ligand binding and receptor activation for the
PTHR. This approach was therefore used as an independent means to
compare the time courses by which PTH and PTHrP ligands interact
with the PTHR. The approach used exploits an intramolecular FRET
signal that occurs in a human PTHR construct,
PTHR-CFP.sub.IC3/YFP.sub.CT (formerly called PTHR-cam). This
construct contains cyan-fluorescent protein (CFP) in the third
intracellular loop and yellow-fluorescent protein (YFP) in the
carboxy-terminal tail. A FRET signal is produced by
PTHR-CFP.sub.IC3/YFP.sub.CT in the basal state, and this signal
diminishes upon agonist binding, likely due to conformational
change that occurs upon activation.
[0193] hPTH(1-34) induced a rapid (t.sub.1/2=0.7 sec) reduction
(.about.13%) in the FRET signal produced by cells expressing
PTHR-CFP.sub.IC3/YFP.sub.CT (FIG. 4A). The FRET signal remained
suppressed during the 15 seconds of ligand application, as well as
for at least 60 seconds after the ligand-containing buffer was
exchanged for a ligand-free buffer (ligand application times are
marked by the black horizontal line above the graphs in FIGS.
4A-4C). The FRET response profile obtained for hPTH(1-34)
replicates the profile observed for this ligand in previous FRET
studies (Vilardaga et al., Nat. Biotechnol. 21:807-812 (2003)). The
amino-terminal peptide, [Aib.sup.1,3,M]PTH(1-14), induced a FRET
response with slightly faster kinetics (t.sub.1/2=0.5 sec) and with
a shallower magnitude (.about.5%) than that produced by hPTH(1-34)
(FIG. 4B). Moreover, the FRET response produced by
[Aib.sup.1,3,M]PTH(1-15) began to decay immediately upon exchange
of the buffer to a ligand-free one (FIG. 4B). PTHrP(1-36) induced a
relatively slow FRET response (t.sub.1/2=.about.2 to 5 seconds),
and the signal began to decay immediately upon changing to a
ligand-free buffer (FIG. 4C). The Ile.sup.5-substituted ligand
Ile.sup.5-PTHrP(1-36) induced a FRET signal that was remarkably
similar to that of PTH(1-34), in that the response was rapid
(t.sub.1/2=0.5-0.7 sec), and stable after ligand removal (FIG. 4D).
These kinetic data, derived by a spectroscopic approach, fully
agree with those obtained in the above binding radioligand
dissociation assays, thus indicating that PTH(1-34) and PTHrP(1-36)
bind predominantly to distinct conformations of the PTHR. They also
confirm the important role of residue five in the ligands in
contributing to this conformational selectivity.
[0194] cAMP Measurements in HKRK-B7 Cells.
[0195] Given that LR.sup.0 complexes can isomerize to LRG
complexes, a potential consequence of stable binding of a ligand to
R.sup.0 is a prolongation of the signaling response induced by that
ligand, relative to a ligand that only poorly stabilizes R.sup.0.
To examine this possibility, the capacity of PTH and PTHrP ligands
to produce sustained cAMP responses in PTHR-expressing cells was
assessed. Cells were thus treated with a ligand for ten minutes,
washed to remove unbound ligand. At various times after washing,
IBMX was applied for five minutes, and the resulting intracellular
cAMP was measured. Using this approach, only the cAMP produced
during the final, five minute IBMX incubation phase is measurable.
The experiments of FIG. 5A compare the time courses of the cAMP
responses produced by PTHrP(1-36) and Ile.sup.5-PTHrP(1-36) in
HKRK-B7 cells. Immediately after the wash-out step, cells treated
with either ligand produced approximately the same amount of cAMP,
which was .about.100-fold above the basal cAMP level in untreated
cells. Two hours after the wash-out step, the cells treated with
Ile.sup.5-PTHrP(1-36) maintained a cAMP signaling capacity that was
.about.50% of the signaling capacity seen immediately after ligand
wash-out (FIG. 5A). By contrast, the signaling capacity of cells
treated with PTHrP(1-36) at two hours was .about.19% of the initial
response, and thus .about.65% less than the response observed at
two hours for Ile.sup.5-PTHrP(1-36) (P<0.003). PTH(1-34)
produced responses at each time point that were nearly identical to
those produced by Ile.sup.5-PTHrP(1-36) (P=>0.05, data not
shown). Thus, the cAMP signaling responses induced by PTH(1-34) and
Ile.sup.5-PTHrP(1-36) decayed about twice as slowly as did that of
and PTHrP(1-36) (t.sub.1/2=2 h vs. .about.1 h). These differences
in the duration of the cAMP signaling capacity observed for the PTH
and PTHrP analogs parallel the differences seen in the rates with
which the corresponding radioligands dissociated from the PTHR in
the presence of GTP.gamma.S (FIGS. 1A-1C).
[0196] cAMP Measurements in HKRK-B64 Cells.
[0197] The capacity of the ligands to produce sustained (or
delayed) cAMP signaling responses was further examined in HKRK-B64
cells, which express the hPTHR at a more physiological level than
do HKRK-B7 cells (90,000 per cell vs. 950,000/cell). Time course
experiments indicated that differences in the duration of
ligand-induced signaling responses were best resolved in these
cells 60 minutes after ligand wash-out (data not shown). In these
experiments, a maximum response was determined for each peptide by
incubating the cells concomitantly with ligand and IBMX for 10
minutes (no wash-out phase); the cAMP responses observed at 60
minutes after ligand washout were then expressed as a percentile of
the corresponding maximum response.
[0198] As in HKRK-B7 cells, PTH(1-34) and Ile.sup.5-PTHrP(1-36)
produced cAMP responses at 60 minutes after wash-out that were 47%
and 40% of their corresponding maximum responses, respectively, in
HKRK-B64 cells (FIG. 5B). The analogs His.sup.5-PTH(1-34) and
PTHrP(1-36) produced responses at 60 minutes that were 34% and 19%
of their maximum response. The response induced by
[Aib.sup.1,3,M]PTH(1-15) at two hours was 23% of its maximum
response, and thus was comparable to that of PTHrP(1-36) (P=0.7).
Different PTH and PTHrP ligand analogs that exhibit the same or
comparable activities when assessed in acute dose-response
signaling assays (FIG. 7; Table 6), can produce quantitatively
different cumulative signaling responses in cells, that are most
likely due to the capacity of the ligands to form a stable complex
with the receptor.
TABLE-US-00009 TABLE 6 cAMP and IP signaling properties of PTH and
PTHrP ligands. cAMP in HKRK-B64 IP in COS-7/hPTHR SEG cells.sup.a
cells.sup.c ID EC.sub.50 E.sub.max.sup.b EC.sub.50 E.sub.max.sup.d
NO: (nM) (picomole/well) (nM) (cpm/well)
[Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 123 5.1 .+-. 0.5 55
.+-. 12 18 .+-. 3 2,407 .+-. 138
[His.sup.5,Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 127 .sup. 2.7
.+-. 0.6.sup.e 59 .+-. 12 30 .+-. 12 2,231 .+-. 229
[Tyr.sup.36]hPTHrP(1-36)NH.sub.2 124 5.6 .+-. 1.3 62 .+-. 15 23
.+-. 8 2,514 .+-. 270 [Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2
125 5.4 .+-. 1.9 61 .+-. 14 23 .+-. 7 2,793 .+-. 303 .sup.adata are
means (.+-.s.e.m.) from four experiments; .sup.bbasal camp (not
subtracted) was 5.2 .+-. 0.9 pmole/well). .sup.cdata are means
(.+-.s.e.m.) from five experiments; .sup.dbasal IP value (not
subtracted) was 330 .+-. 8 cpm/well. .sup.eP vs.
[Nle.sup.8,21,Tyr.sup.34]rPTH(1-34)NH.sub.2 = 0.02.
[0199] cAMP Measurements in Rat Osteoblastic Cells.
[0200] The capacity of certain ligands to produce cAMP signaling
responses was further examined in vitro using rat osteoblastic
cells (ROS17/2.8 cell line; FIG. 8). ROS 17/2.8 cells were treated
with hPTH(1-28)NH.sub.2; Ala.sup.1,12,Aib.sup.3,Gln.sup.10,
Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-28)NH.sub.2;
hPTH(1-34)NH.sub.2, or r(rat)PTH(1-34)NH.sub.2 for 10 minutes at
room temperature in the presence of IBMX, and the resulting
intracellular cAMP formed was quantified by radioimmuno assay. The
EC.sub.50 values for the various peptides were 7.39 nM for
hPTH(1-28)NH.sub.2; 0.37 nM for Ala.sup.1,12,Aib.sup.3,Gln.sup.10,
Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-28)NH.sub.2; 0.31 nM for
hPTH(1-34)NH.sub.2; and 0.021 nM for r(rat)PTH(1-34)NH.sub.2.
[0201] cAMP Plasma Measurements in Mice In Vivo.
[0202] Wild-type mice were injected subcutaneously with vehicle
(0.9% NaCl/0.05% Tween-20), or vehicle containing a PTH peptide so
as to achieve a concentration ranging from 10 to 1000 nmol/kg of
body weight. At the indicated times after injection, blood was
withdrawn from the tail vein, and the amount of cAMP in the
resulting plasma was quantified by radioimmuno assay (FIGS.
9A-9D).
[0203] The mice were further analyzed for changes in plasma
phosphate and serum ionized calcium concentrations. Wild-type mice
were injected subcutaneously with vehicle (0.9% NaCl/0.05%
Tween-20), or vehicle containing Ala.sup.1,12,Aib.sup.3,Gln.sup.10,
Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-28)NH.sub.2 or
hPTH(1-34)NH.sub.2 at doses of 50 nmol/kg body weight. At the
indicated times after injection, blood was withdrawn from the tail
vein and the concentrations of plasma phosphate (FIG. 10A) and
serum ionized calcium (FIG. 10B) were determined. Serum ionized
calcium concentrations were determined using a Chiron Diagnostics
Model 634 Ca.sup.++/pH analyzer. Plasma phosphate concentrations
were measured using a Phosphorous Liqui-UV assay kit (StanBio
Laboratory, Boerne, Tex.). Both peptides resulted in similar
maximal increases in serum calcium and similar maximal reductions
in plasma phosphate, but that the responses to
Ala.sup.1,12,Aib.sup.3,Gln.sup.10,
Har.sup.11,Trp.sup.14,Arg.sup.19-hPTH(1-28)NH.sub.2 were more
prolonged than those to hPTH(1-34)NH.sub.2.
[0204] Phosphate Uptake Inhibition in Opossum Kidney Cells.
[0205] Inhibition of phosphate uptake was assessed using the
opossum kidney (OK) cell line, which are derived from the renal
proximal tubule. These cells mediate sodium-dependent phosphate
transport function which is regulated by PTH receptor ligands.
Thus, treating OK cells with PTH(1-34) inhibits their uptake of
phosphate from the culture media.
[0206] Brief (10 minute) exposure of the cells to
A.sup.1,Aib.sup.3,M-PTH(1-28) results in a dramatically prolonged
inhibitory effect on phosphate uptake, whereas PTH(1-34) and
hPTHrP(1-36) peptides exhibit a much shorter duration of phosphate
uptake inhibition (FIG. 11).
[0207] Pharmacokinetics and Hypercalcemic Action of PTHR Ligands in
Normal Rats.
[0208] Pharmacokinetic profiles of iv injected PTHrP(1-36) and
[I.sup.5]-PTHrP(1-36) were investigated in normal rats (FIG. 12).
Both PTHrP(1-36) and [I.sup.5]-PTHrP(1-36) rapidly disappeared from
the circulation, and the pharmacokinetic profile of
[I.sup.5]-PTHrP(1-36) was comparable to that of PTHrP(1-36).
[0209] We also measured the calcemic actions of intravenously
injected PTHrP(1-36) and [I.sup.5]-PTHrP(1-36) in normal rats (FIG.
13). PTHrP(1-36) and [I.sup.5]-PTHrP(1-36) at 20 and 80 nmol/kg
increased blood ionized calcium levels to the same extent at one
hour. Blood ionized calcium levels declined at two hours after
injection with PTHrP(1-36), but were sustained at high levels at
two hours after injection with [I.sup.5]-PTHrP(1-36). Thus,
[I.sup.5]-PTHrP(1-36) and PTHrP(1-36) exhibited comparable
pharmacokinetic profiles (FIG. 12), but [I.sup.5]-PTHrP(1-36)
exhibited a higher binding affinity for the R.sup.0 PTHR
conformation (FIGS. 3 and 6). Therefore, the prolonged calcemic
actions of [I.sup.5]-PTHrP(1-36) observed in vivo can best be
explained by its high R.sup.0 binding affinity.
[0210] In Vitro and In Vivo Screening of PTH or PTHrP Analogs with
Human PTH Receptor.
[0211] We designed and synthesized native PTH-PTHrP hybrid analogs,
and [A.sup.1,3,12,Q.sup.10,R.sup.11,W.sup.14] (M-modified)
PTH-PTHrP hybrid analogs, and tested their cAMP signaling
capacities in HKRK-B7 cells expressing the hPTH receptor. Each of
the native, and M-modified PTH/PTHrP hybrid analogs showed cAMP
signaling activity comparable to hPTH(1-34) (FIG. 25). We assessed
affinity of native or M-modified PTH and PTHrP hybrid analogs for
the R.sup.0 and RG states of the human PTH receptor (FIGS. 26A and
26B) in COS-7 cell membranes.
[0212] Hypercalcemic Action of PTH and PTHrP Analogs in Normal and
TPTX Rats.
[0213] The transient calcemic actions of the native and M-modified
PTH-PTHrP hybrid analogs were evaluated in normal and TPTX rats
using PTH(1-34) and PTHrP(1-36) as controls (FIGS. 13A, 14A, 15A,
15B, 16A, 17A, and 18A). I.sup.5-PTHrP(1-36),
MPTH(1-14)/PTHrP(15-36), PTH(1-14)/PTHrP(15-36),
PTH(1-18)/PTHrP(19-36), M-PTH(1-34) showed higher calcemic actions
than did PTH(1-34); in contrast, PTH(1-22)/PTHrP(23-36) and
PTH(1-26)/PTHrP(27-36) showed weaker calcemic actions than did
either PTH(1-34) or PTHrP(1-36) control peptides. Binding to the
rat PTHR was also measured in vitro. Length of signaling activity
was confirmed using the delayed cAMP assay (FIGS. 13B-13C, 14B-14C,
15B, 16B-16C, 17B-17C, and 18B), which clearly demonstrates a
correlation between the R.sup.0/RG selectivity from binding data
shown in vitro and both the hypercalcemic action in vivo as well as
and delayed cAMP response in vitro. The cAMP signaling of all these
peptides did not vary substantially (FIGS. 19A, 19B, 20A, and
20B).
Materials and Methods
[0214] The following materials and methods were used to perform the
above experiments.
[0215] Peptides.
[0216] The peptides used in FIGS. 1-3, and 5-11 were synthesized by
the M.G.H. Biopolymer Core facility, as described in Shimizu et
al., J. Biol. Chem. 276:49003-49012 (2001). These peptides include
[Nle.sup.8,21,Tyr.sup.34]rat(r)PTH(1-34)NH.sub.2 (PTH(1-34) (SEQ ID
NO:123);
[Aib.sup.1,3,Nle.sup.8,Gln.sup.10,homoarginine.sup.11,Ala.sup.12-
,Trp.sup.14,Tyr.sup.15]rPTH(1-15)NH.sub.2
([Aib.sup.1,3,M]PTH(1-15), SEQ ID NO:126);
[Ala.sup.1,12,Aib.sup.3,Gln.sup.10,homoarginine.sup.11,Trp.sup.14,Arg.sup-
.19]human(h)PTH(1-28)NH.sub.2 (SEQ ID NO:11)
{[Ala.sup.1,Aib.sup.3,M]PTH(1-28)};
[Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID NO:124) {(PTHrP(1-36)};
[Ile.sup.5,Tyr.sup.36]hPTHrP(1-36)NH.sub.2 (SEQ ID NO:125)
{Ile.sup.5-PTHrP(1-36)}; hPTH(1-34)NH.sub.2 (SEQ ID NO:5);
[His.sup.5]rPTH(1-34)NH.sub.2 (SEQ ID NO:9); rPTH(1-34)NH.sub.2
(SEQ ID NO:130) and [His.sup.5]rPTHrP(1-36)NH.sub.2 (SEQ ID NO:10).
The hPTH(1-34)COOH peptide (free carboxyl) used in FRET analyses
(FIG. 4) was purchased from Bachem California (Torrance, Calif.).
The rat studies used human PTHrP(1-36) synthesized by American
Peptide Company, Inc. (California, USA). Human PTH(1-34) was
purchased from Peptide Institute Inc (Osaka, Japan). PTH or PTHrP
analogs were synthesized by Sigma Aldrich Japan (Tokyo, Japan).
Peptides used in rat studies were dissolved at 1 mM in 10 mM acetic
acid, and stocked at -80.degree. C. refrigerator.
[0217] The peptides used in FIGS. 12-16 were purchased from either
American Peptide Company, Inc., California, USA (hPTHrP(1-36)COOH),
Peptide Institute Inc., Osaka, Japan (hPTH(1-34)COOH), or
Sigma-Aldrich Japan, Tokyo, Japan (PTH/PTHrP hybrid analogs). All
peptides were dissolved in 10 mM acetic acid to a peptide
concentration of between 0.1 mM and 4 mM; and stored at -80.degree.
C. Peptide purity and quality was verified by analytical high
performance liquid chromatography (HPLC), matrix-assisted laser
desorption/ionization (MALDI) mass spectrometry. Radiolabeled
peptide variants were prepared by the oxidative chloramine-T
procedure using Na.sup.125I (specific activity: 2,200 Ci/mmol,
Perkin Elmer/NEN Life Science Products, Boston, Mass.) and were
purified by reversed-phase HPLC.
[0218] Cell Culture.
[0219] Cells were cultured at 37.degree. C. in a humidified
atmosphere containing 5% CO.sub.2 in Dulbecco's modified Eagle's
medium (DMEM), supplemented with 10% fetal bovine serum (HyClone,
Logan Utah), 100 units/ml penicillin G, and 100 .mu.g/ml
streptomycin sulfate (Invitrogen Corp. Carlsbad, Calif.). The
PTHR-expressing cell lines used were HKRK-B7, HKRK-B64, ROS 17/2.8,
and HEK-PTHR-cam. The HKRK-B7 and HKRK-B64 lines were derived from
the porcine kidney cell line, LLC-PK1, via stable transfection with
plasmid DNA (pCDNA1 vector, Invitrogen Corp.) encoding the human
PTHR, and express the PTHR at approximate surface densities of
950,000 and 90,000 PTH-binding sites per cell, respectively (Takasu
et al., J. Bone Miner. Res. 14:11-20 (1999)). ROS 17/2.8 cells are
rat osteosarcoma cells (Majeska et al., Endocrinology 107:1494-1503
(1980)) and express the endogenous rat PTHR at an approximate
surface density of 70,000 PTH-binding sites per cell (Yamamoto, I.
et al., Endocrinology 122:1208-1217 (1988)). HEK-PTHR-cam cells
were derived from HEK-293 cells by stable DNA transfection and
express a human PTHR derivative (PTHR-cam) containing cyan
fluorescent protein (CFP) inserted at Gly.sup.395 in the third
intracellular loop and yellow fluorescent protein (YFP) inserted in
the carboxy-terminal tail (Vilardaga et al., Nat. Biotechnol.
21:807-812 (2003)). Cells were propagated in T75 flasks and divided
into 24-well plates for assays with intact cells, six-well plates
for membrane preparations, or onto glass cover-slips for FRET
studies. COS-7 cells were transiently transfected in six-well
plates using Fugene-6 (Roche Diagnostics, Indianapolis Ind.) and
CsCl-purified plasmid DNA encoding the PTHR (3 .mu.l Fugene, 1
.mu.g DNA, per well), or co-transfected with plasmids encoding the
PTHR and a negative-dominant G.alpha..sub.s subunit
G.alpha..sub.sND (6 .mu.l Fugene, 1 .mu.g each DNA per well). This
G.alpha..sub.sND subunit binds more effectively, but
unproductively, to receptors than does wild-type G.alpha..sub.s
(Berlot, C. H. J. Biol. Chem. 277:21080-21085 (2002)), and has been
found to enhance the binding of
.sup.125I-[Aib.sup.1,3,M]PTH(1-15)NH.sub.2 radioligand to the PTHR
in cell membranes (see below) (Dean, T. et al., J. Biol. Chem.
(2006)).
[0220] Binding Studies.
[0221] Binding studies were performed using cell membranes as
described (Dean et al., Mol Endocrinol 20(4):931-43 (2006)).
Briefly, reactions were incubated at room temperature in membrane
assay buffer (20 mM HEPES, pH 7.4, 0.1 M NaCl, 3 mM MgSO.sub.4, 20%
glycerol, 3 mg/ml bovine serum albumin, protease inhibitor
cocktail--final concentrations: 1 mM AEBSF, 0.8 .mu.M Aprotonin, 20
.mu.M leupeptin, 40 .mu.M Bestatin, 15 .mu.M Pepstatin A, 14 .mu.M
E-64--Sigma-Aldrich Inc., St. Louis, Mo.). Reactions contained a
total membrane protein concentration of 20 to 100 .mu.g/mL, and a
total radioactivity concentration of approximately 150,000 cpm/ml.
Unlabeled peptide ligands and/or GTP.gamma.S (Sigma-Aldrich Inc.
St. Louis, Mo.) were added to the reactions as indicated. At the
end of the reaction, bound and free radioligand were separated by
vacuum filtration using a 96-well vacuum filter plate and vacuum
filter apparatus (Multi-Screen system with Durapore HV, 0.65 .mu.M
filters; Millipore Corp., Milford, Mass.); the air-dried filters
were then detached from the plate and counted for gamma
radioactivity using a gamma counter.
[0222] Radioligand Dissociation.
[0223] These studies were performed as bulk reactions in 15 mL
round-bottom polystyrene snap-cap tubes (Falcon) (total reaction
volume=5.0 ml). Membranes and radioligand were pre-incubated for 90
minutes to allow complex formation; the dissociation phase was then
initiated by the addition of an excess of the unlabeled analog of
the radioligand (5.times.10.sup.-7 M final concentration), with or
without GTP.gamma.S (5.times.M). Immediately prior to this addition
(t=0), and at successive time-points thereafter, 0.2 ml aliquots
(.about.30,000 cpm) were withdrawn and immediately processed by
vacuum filtration, as described above. Non-specific binding was
determined in parallel reaction tubes containing the unlabeled
analog of the radioligand (5.times.10.sup.-7 M) in both the
pre-incubation and dissociation phases. The specifically bound
radioactivity at each time point was calculated as a percent of the
radioactivity specifically bound at t=0.
[0224] Equilibrium Competition Binding and GTP.gamma.S
Inhibition.
[0225] Binding reactions performed with
.sup.125I-[Aib.sup.1,3,M]PTH(1-15) radioligand were assembled and
incubated in the wells of the 96-well, Multi-Screen vacuum
filtration plates. Membranes, tracer radioligand, and various
concentrations of unlabeled ligands and/or GTP.gamma.S were
incubated in the wells for 90 minutes, following which, the
reaction plates were processed by rapid vacuum filtration to
separate bound from free radioligand, as described above. Binding
reactions performed with .sup.125I-PTH(1-34) radioligand were
assembled and incubated in 96-well polystyrene micro-titer plates
(Falcon, total reaction volume=230 .mu.l), and at the end of the
incubation were transferred to wells of a 96-well, Multi-Screen
vacuum filtration plate and processed, as described above. This
transfer maneuver was performed for the
.sup.125I-PTH(1-34)-containing reactions to minimize non-specific
binding of the radioligand to the Multi-screen filter membranes.
For both radioligands, the non-specific binding was determined in
reactions containing a saturating concentration of the unlabeled
analog of the radioligand. The specifically bound radioactivity was
calculated as a percent of the radioactivity specifically bound in
the absence of a competing ligand or GTP.gamma.S.
[0226] To assess the capacities of various unlabeled peptide
ligands to bind to the G protein-uncoupled and G protein-coupled
PTHR conformations (R.sup.0 and RG, respectively), membranes were
prepared from transiently transfected COS-7 cells and the following
assay conditions. To assess binding to R.sup.0, membranes were
prepared from cells transfected with the PTHR, .sup.125I-PTH(1-34)
as a tracer radioligand, and GTP.gamma.S (1.times.10.sup.-5 M) was
added to the binding reactions. This binding format is based on the
premise that .sup.125I-PTH(1-34) binds predominantly to the R.sup.0
conformation of the PTHR, and that this conformation is enriched in
the membranes, relative to RG, by the presence of GTP.gamma.S
(Hoare et al., J. Biol. Chem. 276:7741-53 (2001); Dean et al., Mol
Endocrinol (2006)). To assess binding to RG, membranes prepared
from cells co-transfected with the PTHR and a negative dominant
G.alpha..sub.s subunit (G.alpha..sub.sND) were used, and
.sup.125I-[Aib.sup.1,3,M]PTH(1-15) was used as a tracer
radioligand. This binding format is based on the premise that
.sup.125I-[Aib.sup.1,3,M]PTH(1-15) binds predominantly to the RG
conformation of the PTHR, and that this conformation is enriched in
the membranes, relative to R or R.sup.0, by the presence of
G.alpha..sub.s.sup.ND (Hoare, S. J. Biol. Chem. (2001); Berlot, C.
H. J. Biol. Chem. (2002); Dean, T. et al., J. Biol. Chem. (2006)).
Analysis of binding to any low affinity PTHR conformation (R)
present in the membrane preparations is precluded by the low
concentrations (.about.25 pM) of tracer radioligands in the
reactions.
[0227] Fluorescent Resonance Energy Transfer (FRET).
[0228] HEK-293 cells stably expressing
HEK-PTHR-CFP.sub.IC3/YFP.sub.CT (previously called HEK-PTHR-Cam
cells (Vilardaga et al., Nat. Biotechnol. 21:807-812 (2003)) were
grown on glass coverslips and processed for FRET analysis as
described. With these cells, excitation of the CFP (donor) in
PTHR-CFP.sub.IC3/YFP.sub.CT with ultraviolet light
(.lamda..sub.max.ex.=436 nm; .lamda..sub.max.em.=480 nm) produces
an intramolecular FRET to the YFP (acceptor), resulting in emission
from that YFP (.lamda..sub.max.ex.=480 nm, .lamda..sub.max.em.=535
nm). This FRET response is observable as a decrease in intensity of
CFP light emission at 480 nm, and an increase in intensity of YFP
light emission at 535 nm. The FRET signal is produced by
PTHR-CFP.sub.IC3/YFP.sub.CT in the ground-state receptor and
decreases upon binding of an agonist. PTH ligands were added to the
cells, and washed from the cells using a computer-assisted,
solenoid valve-controlled, rapid superfusion device (ALA Scientific
Instruments, Westbury, N.Y.); solution-exchange times were 5 ms to
10 ms. Fluorescence was monitored using a Zeiss inverted microscope
equipped with a 100.times. objective and a dual emission
photometric system (Til Photonics), coupled to an avalanche
photodiode detection system and an analog-digital converter (Axon
Instruments). The FRET signal detected upon excitation at 436 nm
was calculated as the normalized FRET ratio: F.sub.YFP(535
nm)/F.sub.CFP(480 nm) where F.sub.YFP(535 nm) is the emission at
535 nm, corrected for spillover of the CFP signal into the YFP
channel, and F.sub.CFP(480 nm) is the emission at 480 nm, corrected
for spillover (minimal) of the YFP emission into the CFP channel.
Changes in fluorescence emissions due to photo-bleaching were
subtracted.
[0229] Stimulation of Intracellular cAMP.
[0230] Following treatment of cells with a ligand, the
intracellular cAMP levels were measured by radioimmuno assay, as
described (Shimizu et al., J. Biol. Chem. 276:49003-49012 (2001)).
The capacities of ligands to produce a delayed cAMP response in
cells after a brief exposure to the ligand was assessed as follows.
The cells in 24-well plates were rinsed in binding buffer (50 mM
Tris-HCl, pH 7.7, 100 mM NaCl, 5 mM KCl, 2 mM CaCl.sub.2, 5%
heat-inactivated horse serum, 0.5% heat-inactivated fetal bovine
serum) and then incubated in binding buffer with or without a
peptide ligand (1.times.10.sup.-7 or 3.times.10.sup.-7 M) for 10
minutes at room temperature; the buffer was then removed, the cells
were washed three times with binding buffer, incubated further in
binding buffer for varying times (1 to 120 minutes); the buffer was
then replaced by binding buffer containing IBMX (2 mM), and after
an additional five minute incubation, the intracellular cAMP was
quantified. By this approach, which has been used previously for
the PTH receptor (Tawfeek, H., and Abou-Samra, A., J. Bone Miner.
Res. 14:SU444 (1999); Biselo et al., J. Biol. Chem. 277:38524-38530
(2002)), only the cAMP produced during the final IBMX-containing
stage of the incubation is measurable, because cAMP produced prior
to IBMX addition is degraded by cellular phosphodiesterases.
[0231] In the cAMP experiments of FIG. 14, HKRK-B7 were seeded in
96 well plates at 1.times.10.sup.5 cells/well and incubated
overnight. On the following day, the cells were washed once with
200 .mu.A of binding buffer (50 mM Tris-HCl, pH 7.7, 100 mM NaCl, 5
mM KCl, 2 mM CaCl.sub.2, 5% heat-inactivated horse serum, 0.5%
heat-inactivated fetal bovine serum), followed by addition of 100
.mu.l cAMP assay buffer (DMEM, 2 mM IBMX, 1 mg/ml bovine serum
albumin, 35 mM Hepes-NaOH, pH 7.4) on ice. Then, 50 .mu.l of
binding buffer containing varying amounts of human PTH(1-34), human
PTHrP(1-36), or PTH analogs (final volume=150 .mu.l), were added to
each well, and placed in a water bath at 37.degree. C., and
incubated for 15 minutes. After removing the medium, the plates
were placed on powdered dry ice to freeze the cells and then
removed from dry ice. The cells were thawed with 50 .mu.l of 50 mM
HCl and frozen again on dry ice. The level of intracellular cAMP
was measured with a commercially available cAMP EIA kit (Biotrack
cAMP EIA system, GE Healthcare).
[0232] Stimulation of Inositol Phosphate.
[0233] The stimulation of intracellular inositol phosphates (IPs)
was measured in transiently transfected COS-7 cells that were
pre-labeled (16 hours) with .sup.3H-myo-D-inositol (2 .mu.Ci/ml).
Cells were treated with ligand in DMEM containing fetal bovine
serum (10%) and LiCl (30 mM) for 30 minutes; cells were lysed with
ice cold trichloro acetic acid (5%) and IPs were extracted from the
acid-lysates by ion-exchange filtration, as described (Shimizu et
al., J. Biol. Chem. 276:49003-49012 (2001)).
[0234] OK Cell Methods.
[0235] Cells were treated for 10 minutes at 37.degree. C. with
media (vehicle) or media containing a peptide ligand
(1.times.10.sup.-7 M); then (t=0), the cells were then rinsed three
times with media and incubated in alone at 37.degree. C. for
varying times. At each time point, .sup.32PO.sub.4 was then added
to the media, and after five minutes of incubation, the cells were
washed, lysed, and the lysate was counted for .sup.32P beta
radioactivity by liquid scintillation counting. The results of
these experiments are shown in FIG. 11, plotted as a percentile of
the amount of .sup.32P radioactivity in lysates of cells treated
for the same time with vehicle alone.
[0236] Data Calculations for In Vitro Binding and Signaling
Assays.
[0237] Data were processed for curve fitting and parameter
determination using Microsoft Excel and GraphPad Prism 4.0 software
packages. Dissociation time course data were analyzed using a
bi-exponential decay equation, except when an F test analysis
indicated a mono-exponential equation provided a better fit
(Palpha>0.02). Data from equilibrium binding, cAMP and IP
dose-response assays were analyzed using a sigmoidal dose-response
equation with variable slope. This analysis yielded curves for the
data and values of EC.sub.50, IC.sub.50 (the concentration of a
ligand that produces half of the maximal effect) and E.sub.max (the
maximum response obtained by a ligand). Paired data sets were
statistically compared using the Student's t-test (two-tailed)
assuming unequal variances for the two sets.
[0238] Pharmacokinetic Analysis of PTHrP(1-36) and 15-PTHrP(1-36)
in Normal Rats.
[0239] Concentration of human PTHrP(1-36) and [I.sup.5]-PTHrP(1-36)
in stock solution were adjusted by dilution with 25 mmol/L
phosphate-citrate buffer/100 mmol/L NaCl/0.05% Tween 80 (pH. 5.0)
(PC-buffer). Both peptides were allowed to stand on ice immediately
before administration.
[0240] Female SD-IGS rats at 8 weeks of age (Charles River Japan,
Inc.) were measured for their body weight. Rats received
intravenous administration of Human PTHrP(1-36) and
[I.sup.5]-PTHrP(1-36) at a dose of 10 nmol/1 ml/kg. Peptides were
administered to groups of 3 rats for each peptide-dose and/or time
point. At 2.5, 5, 7.5, 10, 15, 30, 60, 120 min after
administration, blood was collected by tail vein in tubes with EDTA
(final 0.2%) and aprotinin (final 0.6 TIU/ml) to monitor the time
course of concentration of human PTHrP(1-36) and
[I.sup.5]-PTHrP(1-36) in rat plasma. Samples were centrifuged to
collect plasma and stored at -80.degree. C., until assayed for
human PTHrP(1-36) and [I.sup.5]-PTHrP(1-36) levels.
[0241] The level of human PTHrP(1-36) and [I.sup.5]-PTHrP(1-36)
were determined by EIA analysis using PTH-RP 1-34 (Human, Rat)
Enzyme Immunoassay kit (Peninsula Laboratories Inc.)
[I.sup.5]-PTHrP(1-36) cross-reacted with PTHrP EIA kit, and
[I.sup.5]-PTHrP(1-36) was used as a standard for measurement of the
level of [I.sup.5]-PTHrP(1-36) in plasma.
[0242] Hypercalcemic Action of Human PTH(1-34), PTHrP(1-36) and PTH
or PTHrP Analogs in Normal Rats.
[0243] Human PTH(1-34), PTHrP(1-36), and PTH or PTHrP analogs were
studied for hypercalcemic effects in normal rat as follows.
Concentration of peptides in stock solution were adjusted by
dilution with 25 mmol/L phosphate-citrate buffer/100 mmol/L
NaCl/0.05% Tween 80 (pH. 5.0) (PC-buffer). All peptides were
allowed to stand on ice immediately before administration.
[0244] Female SD-IGS rat at 8 weeks of age (Charles River Japan,
Inc.) were measured for their body weight. Blood was collected by
tail vein into heparinized capillary tubes and measured for
baseline levels of blood ionized calcium and pH using Ca.sup.++/pH
analyzer (Model 634/Bayer Medical Ltd.) to give the corrected level
of ionized calcium at pH 7.4 for each sample. Rats received
intravenous administration of each peptides at a dose of 1 ml/kg.
Peptides were administered to groups of 6 rats each respectively.
At 1, 2, 4, or 6 hours after administration, blood was collected by
tail vein to monitor the time course of corrected blood ionized
calcium levels. The time course of changes in corrected ionized
calcium levels, compared to vehicle, and are expressed as
means+/-standard error.
[0245] Statistical Analysis.
[0246] Statistical analysis was carried out by analysis of variance
(ANOVA), using SAS software. The significance of differences was
determined using Student's t-test or Dunnett's multiple test.
P<0.05 was considered a statistically significant.
[0247] Calcemic Action of
[A.sup.1,3,12,Q.sup.10,R.sup.11,W.sup.14]-hPTH(1-14)/PTHrP(15-36)(MPTH14)
in Thyroparathyroidectomy Rats.
[0248] Five-week-old male
[0249] Crl:CD(SD) rats were obtained from Charles River
Laboratories Japan, Inc. (Kanagawa, Japan) and acclimated for 1
week under standard laboratory conditions at 20-26.degree. C. and
35-75% humidity. The rats received free access to tap water and
standard rodent chow (CE-2) containing 1.1% calcium, 1.0% phosphate
and 250 IU/100 g of vitamin D.sub.3 (Clea Japan, Inc., Shizuoka,
Japan).
[0250] Thyroparathyroidectomy (TPTX) was performed on six-week-old
rats. TPTX rats were selected for use based on serum ionized
calcium (iCa) levels (<1.0 mM) in samples taken from tail vein
bleeding at 24 hours or 72 hours after the operation using the
electrode method. The TPTX rats were divided into six groups of
five animals based on iCa levels at 48 hours after the operation.
TPTX-vehicle group intravenously received the vehicle alone (10 mM
acetic acid solution) at a dose of 1 ml/kg body weight administered
to the tail vein. Human parathyroid hormone (1-34) (hPTH(1-34)) and
M-PTH(1-14)/rP(15-36) (MPTH14) were intravenously injected into the
TPTX rats at doses of 1.25, 5, 20 nmol/kg (3 groups) and 1.25, 5
nmol/kg (2 groups), respectively.
[0251] Blood was obtained from the tail vein for detecting iCa at
1, 2, 4, 6, and 24 hours after each injection. Ionized calcium
levels were determined by the electrode method using an
autoanalyzer (M-634, Chiba Corning Diagnostics Co. Ltd., Tokyo,
Japan).
[0252] Mouse Studies.
[0253] Wild-type mice were injected subcutaneously with vehicle
(0.9% NaCl/0.05% Tween-20), or vehicle containing a PTH peptide at
a dose level of 10 to 1000 nmol/kg of body weight. At indicated
times after injection, blood was withdrawn from the tail vein, and
the amount of cAMP in the resulting plasma was quantified by
radioimmuno assay. Ionized calcium in serum was measured as above
and phosphate was measured by a U.V. spectroscopic kit assay.
[0254] Statistical Analysis for Animal Studies.
[0255] Data are represented as the mean.+-.standard error (SE).
Statistical significance was determined using SAS (Ver.5.00.010720,
SAS Institute Japan, Tokyo, Japan). A p value of <0.05 was
considered statistically significant. *P<0.05, **P<0.01,
***P<0.001 versus TPTX-vehicle level by Dunnett's multiple
comparison test.
Example 2
Characterization of Alanine Substitutions in PTH and PTHrP
[0256] As shown above, PTH(1-34) has a greater capacity to bind to
the R.sup.0 receptor conformation than does PTHrP(1-36), which
favors the RG conformation. To explore the molecular basis for this
differential binding and conformational selectivity, we compared
the effects of substitutions in the N-terminal and C-terminal
regions of PTH and PTHrP peptides on the interaction of the ligands
with the PTHR. Unlike in PTH(1-14), where alanine substitutions at
positions 1, 3, 10, 11, 12 and 14 increased cAMP activity, each
alanine substitution in PTHrP(1-14) abolished activity in cells
expressing PTHR. Thus, the (1-14) regions of PTH and PTHrP interact
with the juxtamembrane (J) region of the PTHR differently. Both
PTHrP(1-14) and PTHrP(1-36) were much less potent for cAMP activity
in cells expressing a PTHR lacking the extracellular N-terminal (N)
domain (delNT), as compared to their respective PTH(1-14) and
PTH(1-34) counterparts. PTHrP(1-36) activity therefore depends more
heavily on interactions between the C-terminal ligand region and
the PTHR N domain than does PTH(1-34) activity. We therefore
studied the C-terminal region of the PTHrP sequence, as described
in Example 3.
Example 3
C-Terminal Substitutions in PTH(1-28) and PTHrP(1-28)
[0257] Using alanine-scan and type-substitution strategies, we were
able to generate peptides with much greater selectivity for RG
receptor conformation than the native PTHrP(1-28) sequence. We
focused our studies on the C-terminal region of the PTHrP sequence,
and thus performed an alanine-scan of the 15-28 region of PTH(1-28)
(data not shown) and PTHrP(1-28). Ala-scan analysis of the
C-terminal regions of PTH(1-28) and PTHrP(1-28) revealed for each
peptide strong reductions in activity at positions Arg.sup.20,
Trp/Phe.sup.23, Leu.sup.24, and Leu/Ile.sup.28, known in PTH to
form the core N domain-binding motif. Enhancements in activity were
found at several, but different positions in each scaffold:
Leu.sup.18, Phe.sup.22, and His.sup.26 in PTHrP(1-28) and
Asn.sup.16, Glu.sup.19, and Ala.sup.22 in PTH(1-28). The alanine
substitutions at positions 16, 19, and 22 in PTH increased binding
to delNT (PTH receptor missing the N-terminal ligand binding
domain), whereas those at positions 18, 22, 26 in PTHrP decreased
binding to delNT. The enhancing effects of the Ala substitutions at
positions 16, 19, and 22 of PTH are thus mediated via the PTHR J
domain, whereas, those at positions 18, 22, 26 of PTHrP require the
PTHR N domain. Further type substitution analysis of positions 16,
19, 22, as well as 25 (neutral to Ala substitution) in PTHrP(1-28)
resulted in the analog
[Ala.sup.18,22,Leu.sup.25,Lys.sup.26]-PTHrP(1-28), which exhibits a
cAMP potency and RG binding affinity that is greater than that of
PTH(1-34) and among the highest observed of any PTH or PTHrP
peptide. This scan revealed that alanine substitutions at positions
18, 22, 25, and 26 each enhance cAMP activity in human and rat
PTHR-expressing cells (FIGS. 27A and 27B). Following the alanine
scan, these positions were further substituted individually with
various amino acids; of which some were found to increase cAMP
activity (FIGS. 27C and 27D). We then combined these mutations in
various combinations, thus obtaining a number of PTHrP analogs with
markedly enhanced activity, as described herein.
Example 4
Characterization of Exemplary Substituted PTHrP(1-28) Peptides
[0258] Dose-response curves for cAMP production in SaOS cells using
PTHrP(1-36), PTHrP(1-28), A.sup.18,22,K.sup.26-PTHrP(1-28),
A.sup.18,22,L.sup.25,K.sup.26 (AALK)-PTHrP(1-28),
E.sup.18,A.sup.22,K.sup.26-PTHrP(1-28), or
E.sup.18,A.sup.22,L.sup.25,K.sup.26 (EALK)-PTHrP(1-28) were
generated (FIG. 28A). Marked enhancements of cAMP-inducing activity
were found for A(E).sup.18,22,L.sup.25,K.sup.26-PTHrP(1-28) (AALK
or EALK), as compared to parental PTHrP(1-28).
[0259] These enhancing effects were confirmed in vivo studies (FIG.
28B) by injecting C57BL/6 mice (3-month-old, male) intravenously
with either vehicle, PTHrP(1-36), PTHrP(1-28), AALK-PTHrP(1-28), or
EALK-PTHrP(1-28) (n=3). Blood was withdrawn 10 minutes after
injection and plasma level of cAMP was measured by RIA. Marked
enhancements were also observed in the mouse assay for the
AALK-PTHrP(1-28) and EALK-PTHrP(1-28) as compared to wt
PTHrP(1-28). The greater apparent potency of PTHrP(1-36) peptide in
these assays may reflect slower clearance of the longer-length
peptide from the blood.
Example 5
Characterization of the RG Selective Peptide EALK-PTHrP(1-30)
[0260] We also characterized the effects of the EALK-PTHrP(1-30)
peptide on cAMP production. Three month old male C57BL/6 mice were
intravenously injected with either vehicle, rPTH(1-34), M-PTH(1-34)
(M=A.sup.1,Aib.sup.3,Q.sup.10,Har.sup.11,A.sup.12,W.sup.14,R.sup.19)
or E.sup.18,A.sup.22,L.sup.25,K.sup.26-(EALK)-PTHrP(1-30) (5
nmol/kg). In the cAMP experiment (FIG. 29A), blood was withdrawn 10
minutes after injection and plasma level of cAMP was measured by
RIA. In the calcium experiment (FIG. 29B), blood was withdrawn
prior to injection and 1, 2, 4, and 6 hours after injection.
Ionized calcium was measured using a Ca.sup.++/pH analyzer. The
ligands induced approximately the same level of plasma cAMP, but
the R.sup.0 selective ligand, M-PTH(1-34) induced an ionized
calcium response markedly more robust and more sustained than that
of PTH(1-34). By contrast, the RG-selective ligand,
EALK-PTHrP(1-30) induced an ionized calcium response that was,
similar, if not lower, than that of PTH(1-34).
[0261] A second set of experiments was performed in which mice
received 5 nmol/kg intravenous daily treatment with rPTH(1-34),
M-PTH(1-34), or EALK-PTHrP(1-30) for 14 days. Blood samples were
taken at days 6 and 13, and markers of bone turnover (PINP,
osteocalcin and CTX) were assessed by ELISA. The R.sup.0 selective
ligand, M-PTH(1-34) strongly induced increases in markers of both
bone formation (PINP, FIGS. 30A and 30B; osteocalcin, FIG. 30D) and
bone resorption (CTX, FIGS. 30E and 30F), as early as day 6. By
contrast, the RG-selective ligand, EALK-PTHrP(1-30) increased bone
formation markers, with relatively smaller effects on the
resorption marker, as evident on day 6 (FIGS. 30A, 30C, and 30E).
Under the dose and time conditions analyzed, PTH(1-34) had only
minor effects on bone markers.
[0262] Consistent with the effects on bone markers, M-PTH(1-34)
robustly increased trabecular bone, but also detectably diminished
cortical bone (FIG. 31), consistent with its severe hypercalcemic
actions (FIG. 29B). By contrast, EALK-PTHrP(1-30) increased
cortical bone thickness with significance in the distal femur (FIG.
30 and Table xx), without inducing severe hypercalcemia. These
findings demonstrate that the modified ligands with different
R.sup.0/RG selectivities have differential effects on bone
metabolism. The findings also show that RG selective analogs, such
as EALK-PTHrP(1-30), preferentially stimulate bone formation over
bone resorption, and have beneficial effects on cortical bones with
minimum effects on blood calcium levels. M-PTH(1-34) greatly
increases the trabecular bone at the distal femur metaphysis, but
induced cortical bone resorption at the mid-femur diaphysis, as
indicated by erosion of endosteal surface.
[0263] Table 7 shows quatitation of bone structural parameters
following two weeks of daily treatment of the above peptides. As
described above, mice were treated intravenously) with either
vehicle, rPTH(1-34), M-PTH(1-34), or EALK-PTHrP(1-30) daily for 14
days. All analogs significantly increased bone mineral density at
both femur and lumbar spine. Cortical wall thickness was
significantly lower in both distal and mid femur region for
M-PTH(1-34). In contrast, EALK-PTHrP(1-30) increased cortical bone
thickness with significance in the distal femur.
TABLE-US-00010 TABLE 7 7. Bone structural parameters after two-week
daily treatment in mice PTH(1-34) M-PTH(1-34) EALK-PTHrP (SEQ ID P
vs. (SEQ ID P vs. (1-30) (SEQ ID P vs. vehicle NO: 130) veh NO: 12)
veh NO: 90) veh Piximus.sup.a Total Femur BMD (g/cm.sup.2) 0.0599
.+-. 0.0002 0.0615 .+-. 0.0003 0.003 0.664 .+-. 0.0003 <0.0001
0.620 .+-. 0.0003 0.0004 Lumbar Spine BMD (g/cm.sup.2) 0.0455 .+-.
0.0001 0.0464 .+-. 0.0002 0.001 0.0524 .+-. 0.0002 <0.0001
0.0464 .+-. 0.0002 0.001 microCT.sup.b distal femur TrabecularBV/TV
(%) 17.6 .+-. 0.8 17.4 .+-. 1.2 0.883 35.0 .+-. 3.0 0.001 16.5 .+-.
1.3 0.506 Tb N (1/mm) 4.37 .+-. 0.08 4.02 .+-. 0.14 0.055 5.22 .+-.
0.34 0.047 4.13 .+-. 0.16 0.201 Tb Th (.mu.m) 55.4 .+-. 1.7 57.5
.+-. 1.4 0.361 71.5 .+-. 1.8 <0.0001 57.8 .+-. 2.1 0.393 TbSp
(.mu.m) 224 .+-. 5 246 .+-. 10 0.076 208 .+-. 17 0.398 238 .+-. 10
0.235 Conn-Dens. (1/mm.sup.3) 132 .+-. 4 116 .+-. 8 0.091 263 .+-.
25 0.002 117 .+-. 9 0.132 Cort Th. (.mu.m) 213 .+-. 7 229 .+-. 11
0.229 166 .+-. 6 0.0003 238 .+-. 9 0.048 mid femur TA (mm.sup.2)
2.05 .+-. 0.07 2.17 .+-. 0.05 0.197 2.10 .+-. 0.06 0.630 2.03 .+-.
0.06 0.840 BA(mm.sup.2) 0.813 .+-. 0.019 0.839 .+-. 0.032 0.503
0.837 .+-. 0.022 0.423 0.821 .+-. 0.027 0.825 MA (mm.sup.2) 1.24
.+-. 0.05 1.33 .+-. 0.02 0.177 1.26 .+-. 0.04 0.792 1.21 .+-. 0.03
0.702 BA/TA (%) 39.7 .+-. 0.9 38.7 .+-. 0.7 0.380 40.0 .+-. 0.8
0.837 40.3 .+-. 0.6 0.614 Cort Th. (.mu.m) 172 .+-. 4 172 .+-. 5
0.965 151 .+-. 3 0.003 176 .+-. 4 0.558
Example 6
Optimization of EALK-PTHrP Peptides
[0264] To optimize the activity of the EALK-PTHrP peptides, we
generated EALK-PTHrP(1-30) and PTHrP(1-34) variants with
substitutions in the 29-33 region. In the 1-30 scaffold, Gly, Ser,
Leu, Asn, Gln, Trp, Glu, and Lys were substituted at position 29;
Gly, Ser, Leu, Asn, Asp, Trp, and Lys were substituted at position
30; and Ser, Leu, Asn, Val, Trp, Glu, and Lys were substituted at
position 31. In EALK-PTHrP(1-34), the 30-33 region was substituted
with alanine, or the C-terminal six amino acids were replaced by
the corresponding region of PTH(1-34). A predicted advantage of
these longer-length peptides, relative to the PTHrP(1-30) scaffold,
is that they will have longer a longer half-life in circulation due
to slower clearance. The C-terminal substitutions were thus
designed to provide the added chain length, but to avoid increasing
R.sup.0 binding affinity, which occurs when the native PTHrP(29-34)
region (SEQ ID NO:186) is installed. These peptides were tested for
cAMP activity in MC3T3-E1 cells. As shown in FIGS. 32A and 32B,
several of these peptides exhibited greater activity than the
unsubstituted C-terminal sequence.
Example 7
Characterization of Trp.sup.1-M-PTH in Renal Phosphate
Transport
[0265] To help elucidate further the signaling mechanisms by which
PTH ligands regulate renal phosphate transport, we developed a
derivative of M-PTH(1-28) that is defective for PLC/PKC signaling,
yet retains potent cAMP/PKA signaling activity. Such a peptide
allows for study of the relative roles of the PKA and PKC signaling
pathways in modulating the function and surface expression of the
Pi transporters NaPi-IIa and NaPi-IIc in proximal tubule (PT)
cells. The analog M-PTH(1-28) (M=Ala.sup.1,Aib.sup.3,Gln.sup.10,
Har.sup.11,Trp.sup.14,Arg.sup.19), a potent agonist for cAMP and
IP.sub.3 signaling pathways, induces, when injected into mice,
prolonged hypophosphatemic and hypercalcemic effects. The analog
also induced prolonged reductions in NaPi-IIa immunoreactivity at
the brush border membrane and cytoplasmic compartments of renal PT
cells of injected mice.
[0266] To impair PLC signaling, we replaced alanine at position 1
of M-PTH(1-28) with tryptophan, in accordance with findings of
Bisello and colleagues (J Biol Chem 277:38524-30, 2002) showing
that such bulky substitutions at this position selectively impair
PLC signaling. In HEK-293 cells transiently transfected with the
rat PTHR, Trp.sup.1-M-PTH(1-28) was about as potent as M-PTH(1-28)
for stimulating cAMP formation, but at least 100-fold less potent
than the parent peptide for stimulating IP.sub.3 formation.
Trp.sup.1-M-PTH(1-28) retained the capacity to produce a prolonged
cAMP response in MC3T3-E1 cells after ligand wash-out, as seen with
MPTH(1-28). When injected into mice (20 nmol/kg)
Trp.sup.1-M-PTH(1-28), like M-PTH(1-28), induced prolonged
suppression of plasma phosphate levels, as compared to effects of
PTH(1-34): maximal suppression at 2 h for each analog; recovery to
vehicle control levels at 4 h for PTH(1-34), and at 6 h for
M-PTH(1-28) and Trp.sup.1-M-PTH(1-28). Apical and cytoplasmic
NaPi-IIa staining in renal PT cells was reduced in mice treated
with each peptide at 2 h, but where staining returned to vehicle
control levels at 6 h with PTH(1-34), it remained reduced for at
least six hours in mice treated with M-PTH(1-28) or
Trp.sup.1-M-PTH(1-28). Immunostaining of NaPi-IIc in renal PT cells
was reduced in mice treated with M-PTH(1-28) over the interval 4 to
6 h, but was unchanged in mice treated with Trp.sup.1-M-PTH(1-28)
or PTH(1-34). M-PTH(1-28) inhibited .sup.32P uptake in early
passage LLC-PK1 cells (NHERF-1/ezrin positive) virally transduced
to express NaPi-IIc transporter and the rat PTHR (Mahon, Am J
Physiol Renal Physiol. 294:F667-75 (2008)), but
Trp.sup.1-M-PTH(1-28) failed to inhibit this activity. The findings
suggest that PTHR-mediated regulation of renal Pi transport
involves, as one component, the cAMP/PKA-dependent control of
NaPi-IIa down regulation, and, as another, perhaps slower and minor
component, the PLC-dependent control of NaPi-IIc down
regulation.
Example 8
Characterization of M-PTH(1-14)/PTHrP(15-36) on Serum and Urinary
Calcium and Phosphate in TPTX Rats
[0267] We also studied the effects of the M-PTH(1-14)/PTHrP(15-36)
hybrid peptide (SP-PTH) on serum and urinary calcium and phosphate.
A single intravenous injection into thyroparathyroidectomized
(TPTX) rats, PTH(1-34) at 1.25 nmol/kg, transiently increased serum
calcium(sCa) and decreased serum phosphorus (sPi) levels at 1 hr,
but not to the normal range, as levels returned to pre-injection
conditions by 6 hrs (FIGS. 33 and 35, respectively). PTH(1-34) did
not change urinary calcium (FIG. 34) or urinary phosphate levels
(FIG. 36) over 0-6 hours. By contrast, administration of SP-PTH at
1.25 nmol/kg, increased sCa and decreased sPi to normal levels
within 6 hrs, and these levels were maintained for 24 hrs. SP-PTH
decreased urinary calcium and increased urinary phosphate level at
0-6 hours. These results indicate that SP-PTH can normalize
hypocalcemia in TPTX rats without causing hypercalciuria, thus
suggesting that this peptide can be used to treat
hypoparathyroidism with decreased risk of renal complications.
Example 9
cAMP Stimulation Using PTH or PTHrP Analogs
[0268] HKRK-B, which are LLC-PK1 cells over-expressing human PTH1
receptor at levels of 9.5.times.10.sup.5 per cell were used in the
cAMP signaling assay. The cells were cultured at 37.degree. C. in a
humidified atmosphere containing 5% CO.sub.2 in Dulbecco's modified
Eagle's medium (DMEM), supplemented with 10% fetal bovine serum
(Hyclone), 100 units/ml penicillin G, and 100 .mu.g/ml streptomycin
sulfate (Invitrogen Corp). Human PTHrP(1-36) was synthesized by
American Peptide Company, Inc. (California, USA), Human PTH(1-34)
(SEQ ID NO:5) was purchased from Peptide Institute Inc. (Osaka,
Japan), and the PTH or PTHrP analogs (Mc-PTH(1-34) (SEQ ID NO:131),
[A.sup.1,A.sup.3,A.sup.23,Q.sup.10,R.sup.11]-hPTH(1-34) (SEQ ID
NO:181), [A.sup.1,A.sup.3,A.sup.23]-hPTH(1-34) (SEQ ID NO:182), and
[A'.sup.8,A.sup.22,L.sup.25,K.sup.26]-PTHrP(1-28) (SEQ ID NO:76))
were synthesized by Sigma Aldrich Japan (Tokyo, Japan). All
peptides were dissolved at 1 mM in 10 mM acetic acid, and stored at
-80.degree. C. The cAMP stimulation assay was performed as
described above for HKRK-B7 cells. PTH(1-34) and PTHrP(1-36) were
used as controls. Cells were treated for 15 minutes at 37.degree.
C. with varying concentrations of ligands in the presence of IBMX.
The EC.sub.50 and Emax values are reported in Table 8. All
M-modified PTH analogs with C-terminal modification show comparable
cAMP signaling to hPTH(1-34) (FIG. 37).
TABLE-US-00011 TABLE 8 SEQ ID cAMP in HKRK-B7 cells NO: EC50 (nM)
Max (pm/well) hPTH(1-34) 5 2.26 67.2 PTHrP(1-36) 6 1.47 61.9
Mc-PTH34(R19) 131 3.25 65.5 [A1,3,23,Q10,R11]-hPTH(1-34) 181 1.76
63.8 [A1,3,23]-hPTH(1-34) 182 1.93 66.6
[A18,22,L25,K26]-PTHrP(1-28) 76 0.52 56.4
Example 10
Use of Short-Acting PTH Peptides for Treatment of Osteoporosis
[0269] Short-acting peptides, such as those described above, are
administered to a patient having osteoporosis. Generally, in the
case of the therapy of osteoporosis by intermittent i.v./i.m. or
subcutaneous injection, the dosage given is in the range of 100 to
1200 units (.mu.g)/day.
[0270] The exact doses and regimen for administration of these
compounds and compositions will necessarily be dependent upon the
needs of the individual subject being treated, the type of
treatment, the degree of affliction or need and, of course, the
judgment of the medical practitioner. In general, parenteral
administration requires lower dosage than other methods of
administration which are more dependent upon absorption.
Example 11
Use of Long-Acting PTH Peptides for Treatment of PTH Deficiency
[0271] Long-acting peptides, such as those described above, are
administered to a patient having a disease linked to PTH
deficiency. Examples of these diseases include hyperphosphatemia
associated with tumoral calcinosis, early stage chronic kidney
disease and hypoparathyroidism. The daily dosage of peptide to be
administered depends upon the indication. Generally, in the case of
daily i.v./i.m. or subcutaneous injection preferably at 300-2400
units (.mu.g)/day.
[0272] The exact doses and regimen for administration of these
compounds and compositions will necessarily be dependent upon the
needs of the individual subject being treated, the type of
treatment, the degree of affliction or need and, of course, the
judgment of the medical practitioner. In general, parenteral
administration requires lower dosage than other methods of
administration, which are more dependent upon absorption.
Other Embodiments
[0273] All patents, patent applications, and publications mentioned
in this specification are herein incorporated by reference to the
same extent as if each independent patent, patent application, or
publication was specifically and individually indicated to be
incorporated by reference. U.S. Provisional Application Nos.
60/963,117, 60/963,082, and 60/963,867, filed Aug. 1, 2007, Aug. 2,
2007, and Aug. 6, 2007, respectively, are hereby incorporated by
reference.
Sequence CWU 1 SEQUENCE LISTING <160> NUMBER OF SEQ ID
NOS: 186 <210> SEQ ID NO 1 <211> LENGTH: 593
<212> TYPE: PRT <213> ORGANISM: Homo sapiens
<400> SEQUENCE: 1 Met Gly Thr Ala Arg Ile Ala Pro Gly Leu Ala
Leu Leu Leu Cys Cys 1 5 10 15 Pro Val Leu Ser Ser Ala Tyr Ala Leu
Val Asp Ala Asp Asp Val Met 20 25 30 Thr Lys Glu Glu Gln Ile Phe
Leu Leu His Arg Ala Gln Ala Gln Cys 35 40 45 Glu Lys Arg Leu Lys
Glu Val Leu Gln Arg Pro Ala Ser Ile Met Glu 50 55 60 Ser Asp Lys
Gly Trp Thr Ser Ala Ser Thr Ser Gly Lys Pro Arg Lys 65 70 75 80 Asp
Lys Ala Ser Gly Lys Leu Tyr Pro Glu Ser Glu Glu Asp Lys Glu 85 90
95 Ala Pro Thr Gly Ser Arg Tyr Arg Gly Arg Pro Cys Leu Pro Glu Trp
100 105 110 Asp His Ile Leu Cys Trp Pro Leu Gly Ala Pro Gly Glu Val
Val Ala 115 120 125 Val Pro Cys Pro Asp Tyr Ile Tyr Asp Phe Asn His
Lys Gly His Ala 130 135 140 Tyr Arg Arg Cys Asp Arg Asn Gly Ser Trp
Glu Leu Val Pro Gly His 145 150 155 160 Asn Arg Thr Trp Ala Asn Tyr
Ser Glu Cys Val Lys Phe Leu Thr Asn 165 170 175 Glu Thr Arg Glu Arg
Glu Val Phe Asp Arg Leu Gly Met Ile Tyr Thr 180 185 190 Val Gly Tyr
Ser Val Ser Leu Ala Ser Leu Thr Val Ala Val Leu Ile 195 200 205 Leu
Ala Tyr Phe Arg Arg Leu His Cys Thr Arg Asn Tyr Ile His Met 210 215
220 His Leu Phe Leu Ser Phe Met Leu Arg Ala Val Ser Ile Phe Val Lys
225 230 235 240 Asp Ala Val Leu Tyr Ser Gly Ala Thr Leu Asp Glu Ala
Glu Arg Leu 245 250 255 Thr Glu Glu Glu Leu Arg Ala Ile Ala Gln Ala
Pro Pro Pro Pro Ala 260 265 270 Thr Ala Ala Ala Gly Tyr Ala Gly Cys
Arg Val Ala Val Thr Phe Phe 275 280 285 Leu Tyr Phe Leu Ala Thr Asn
Tyr Tyr Trp Ile Leu Val Glu Gly Leu 290 295 300 Tyr Leu His Ser Leu
Ile Phe Met Ala Phe Phe Ser Glu Lys Lys Tyr 305 310 315 320 Leu Trp
Gly Phe Thr Val Phe Gly Trp Gly Leu Pro Ala Val Phe Val 325 330 335
Ala Val Trp Val Ser Val Arg Ala Thr Leu Ala Asn Thr Gly Cys Trp 340
345 350 Asp Leu Ser Ser Gly Asn Lys Lys Trp Ile Ile Gln Val Pro Ile
Leu 355 360 365 Ala Ser Ile Val Leu Asn Phe Ile Leu Phe Ile Asn Ile
Val Arg Val 370 375 380 Leu Ala Thr Lys Leu Arg Glu Thr Asn Ala Gly
Arg Cys Asp Thr Arg 385 390 395 400 Gln Gln Tyr Arg Lys Leu Leu Lys
Ser Thr Leu Val Leu Met Pro Leu 405 410 415 Phe Gly Val His Tyr Ile
Val Phe Met Ala Thr Pro Tyr Thr Glu Val 420 425 430 Ser Gly Thr Leu
Trp Gln Val Gln Met His Tyr Glu Met Leu Phe Asn 435 440 445 Ser Phe
Gln Gly Phe Phe Val Ala Ile Ile Tyr Cys Phe Cys Asn Gly 450 455 460
Glu Val Gln Ala Glu Ile Lys Lys Ser Trp Ser Arg Trp Thr Leu Ala 465
470 475 480 Leu Asp Phe Lys Arg Lys Ala Arg Ser Gly Ser Ser Ser Tyr
Ser Tyr 485 490 495 Gly Pro Met Val Ser His Thr Ser Val Thr Asn Val
Gly Pro Arg Val 500 505 510 Gly Leu Gly Leu Pro Leu Ser Pro Arg Leu
Leu Pro Thr Ala Thr Thr 515 520 525 Asn Gly His Pro Gln Leu Pro Gly
His Ala Lys Pro Gly Thr Pro Ala 530 535 540 Leu Glu Thr Leu Glu Thr
Thr Pro Pro Ala Met Ala Ala Pro Lys Asp 545 550 555 560 Asp Gly Phe
Leu Asn Gly Ser Cys Ser Gly Leu Asp Glu Glu Ala Ser 565 570 575 Gly
Pro Glu Arg Pro Pro Ala Leu Leu Gln Glu Glu Trp Glu Thr Val 580 585
590 Met <210> SEQ ID NO 2 <211> LENGTH: 591 <212>
TYPE: PRT <213> ORGANISM: Rattus norvegicus <400>
SEQUENCE: 2 Met Gly Ala Ala Arg Ile Ala Pro Ser Leu Ala Leu Leu Leu
Cys Cys 1 5 10 15 Pro Val Leu Ser Ser Ala Tyr Ala Leu Val Asp Ala
Asp Asp Val Phe 20 25 30 Thr Lys Glu Glu Gln Ile Phe Leu Leu His
Arg Ala Gln Ala Gln Cys 35 40 45 Asp Lys Leu Leu Lys Glu Val Leu
His Thr Ala Ala Asn Ile Met Glu 50 55 60 Ser Asp Lys Gly Trp Thr
Pro Ala Ser Thr Ser Gly Lys Pro Arg Lys 65 70 75 80 Glu Lys Ala Ser
Gly Lys Phe Tyr Pro Glu Ser Lys Glu Asn Lys Asp 85 90 95 Val Pro
Thr Gly Ser Arg Arg Arg Gly Arg Pro Cys Leu Pro Glu Trp 100 105 110
Asp Asn Ile Val Cys Trp Pro Leu Gly Ala Pro Gly Glu Val Val Ala 115
120 125 Val Pro Cys Pro Asp Tyr Ile Tyr Asp Phe Asn His Lys Gly His
Ala 130 135 140 Tyr Arg Arg Cys Asp Arg Asn Gly Ser Trp Glu Val Val
Pro Gly His 145 150 155 160 Asn Arg Thr Trp Ala Asn Tyr Ser Glu Cys
Leu Lys Phe Met Thr Asn 165 170 175 Glu Thr Arg Glu Arg Glu Val Phe
Asp Arg Leu Gly Met Ile Tyr Thr 180 185 190 Val Gly Tyr Ser Met Ser
Leu Ala Ser Leu Thr Val Ala Val Leu Ile 195 200 205 Leu Ala Tyr Phe
Arg Arg Leu His Cys Thr Arg Asn Tyr Ile His Met 210 215 220 His Met
Phe Leu Ser Phe Met Leu Arg Ala Ala Ser Ile Phe Val Lys 225 230 235
240 Asp Ala Val Leu Tyr Ser Gly Phe Thr Leu Asp Glu Ala Glu Arg Leu
245 250 255 Thr Glu Glu Glu Leu His Ile Ile Ala Gln Val Pro Pro Pro
Pro Ala 260 265 270 Ala Ala Ala Val Gly Tyr Ala Gly Cys Arg Val Ala
Val Thr Phe Phe 275 280 285 Leu Tyr Phe Leu Ala Thr Asn Tyr Tyr Trp
Ile Leu Val Glu Gly Leu 290 295 300 Tyr Leu His Ser Leu Ile Phe Met
Ala Phe Phe Ser Glu Lys Lys Tyr 305 310 315 320 Leu Trp Gly Phe Thr
Ile Phe Gly Trp Gly Leu Pro Ala Val Phe Val 325 330 335 Ala Val Trp
Val Gly Val Arg Ala Thr Leu Ala Asn Thr Gly Cys Trp 340 345 350 Asp
Leu Ser Ser Gly His Lys Lys Trp Ile Ile Gln Val Pro Ile Leu 355 360
365 Ala Ser Val Val Leu Asn Phe Ile Leu Phe Ile Asn Ile Ile Arg Val
370 375 380 Leu Ala Thr Lys Leu Arg Glu Thr Asn Ala Gly Arg Cys Asp
Thr Arg 385 390 395 400 Gln Gln Tyr Arg Lys Leu Leu Arg Ser Thr Leu
Val Leu Val Pro Leu 405 410 415 Phe Gly Val His Tyr Thr Val Phe Met
Ala Leu Pro Tyr Thr Glu Val 420 425 430 Ser Gly Thr Leu Trp Gln Ile
Gln Met His Tyr Glu Met Leu Phe Asn 435 440 445 Ser Phe Gln Gly Phe
Phe Val Ala Ile Ile Tyr Cys Phe Cys Asn Gly 450 455 460 Glu Val Gln
Ala Glu Ile Arg Lys Ser Trp Ser Arg Trp Thr Leu Ala 465 470 475 480
Leu Asp Phe Lys Arg Lys Ala Arg Ser Gly Ser Ser Ser Tyr Ser Tyr 485
490 495 Gly Pro Met Val Ser His Thr Ser Val Thr Asn Val Gly Pro Arg
Ala 500 505 510 Gly Leu Ser Leu Pro Leu Ser Pro Arg Leu Pro Pro Ala
Thr Thr Asn 515 520 525 Gly His Ser Gln Leu Pro Gly His Ala Lys Pro
Gly Ala Pro Ala Thr 530 535 540 Glu Thr Glu Thr Leu Pro Val Thr Met
Ala Val Pro Lys Asp Asp Gly 545 550 555 560 Phe Leu Asn Gly Ser Cys
Ser Gly Leu Asp Glu Glu Ala Ser Gly Ser 565 570 575 Ala Arg Pro Pro
Pro Leu Leu Gln Glu Glu Trp Glu Thr Val Met 580 585 590 <210>
SEQ ID NO 3 <211> LENGTH: 115 <212> TYPE: PRT
<213> ORGANISM: Homo sapiens <220> FEATURE: <221>
NAME/KEY: mat_peptide <222> LOCATION: (32)..(115) <223>
OTHER INFORMATION: The native peptide is 1-84, which is shown by
residues 32 to 115 in this sequence. <400> SEQUENCE: 3 Met
Ile Pro Ala Lys Asp Met Ala Lys Val Met Ile Val Met Leu Ala -30 -25
-20 Ile Cys Phe Leu Thr Lys Ser Asp Gly Lys Ser Val Lys Lys Arg Ser
-15 -10 -5 -1 1 Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His
Leu Asn Ser 5 10 15 Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu Gln
Asp Val His Asn 20 25 30 Phe Val Ala Leu Gly Ala Pro Leu Ala Pro
Arg Asp Ala Gly Ser Gln 35 40 45 Arg Pro Arg Lys Lys Glu Asp Asn
Val Leu Val Glu Ser His Glu Lys 50 55 60 65 Ser Leu Gly Glu Ala Asp
Lys Ala Asp Val Asn Val Leu Thr Lys Ala 70 75 80 Lys Ser Gln
<210> SEQ ID NO 4 <211> LENGTH: 177 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <220> FEATURE:
<221> NAME/KEY: mat_peptide <222> LOCATION: (37)..(177)
<223> OTHER INFORMATION: The native peptide is .about.1-140,
which is approximately shown by residues 37 to 177 in this
sequence. <400> SEQUENCE: 4 Met Gln Arg Arg Leu Val Gln Gln
Trp Ser Val Ala Val Phe Leu Leu -35 -30 -25 Ser Tyr Ala Val Pro Ser
Cys Gly Arg Ser Val Glu Gly Leu Ser Arg -20 -15 -10 -5 Arg Leu Lys
Arg Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly -1 1 5 10 Lys
Ser Ile Gln Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile 15 20
25 Ala Glu Ile His Thr Ala Glu Ile Arg Ala Thr Ser Glu Val Ser Pro
30 35 40 Asn Ser Lys Pro Ser Pro Asn Thr Lys Asn His Pro Val Arg
Phe Gly 45 50 55 60 Ser Asp Asp Glu Gly Arg Tyr Leu Thr Gln Glu Thr
Asn Lys Val Glu 65 70 75 Thr Tyr Lys Glu Gln Pro Leu Lys Thr Pro
Gly Lys Lys Lys Lys Gly 80 85 90 Lys Pro Gly Lys Arg Lys Glu Gln
Glu Lys Lys Lys Arg Arg Thr Arg 95 100 105 Ser Ala Trp Leu Asp Ser
Gly Val Thr Gly Ser Gly Leu Glu Gly Asp 110 115 120 His Leu Ser Asp
Thr Ser Thr Thr Ser Leu Glu Leu Asp Ser Arg Arg 125 130 135 140 His
<210> SEQ ID NO 5 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 5 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 6 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 6 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 7 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 7 Ser
Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 8 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 8 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Ala Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 9 <211>
LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 9 Ser Val Ser Glu His Gln Leu Met His Asn Leu Gly Lys His
Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu
Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID NO 10
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 10 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 11 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 11 Ala Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu 20 25 <210> SEQ ID NO 12 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (3)..(3)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Har <400> SEQUENCE: 12 Ala Val Xaa Glu Ile
Gln Leu Met His Gln Xaa Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg
Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn
Phe <210> SEQ ID NO 13 <211> LENGTH: 36 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Description of Artificial
Sequence: Synthetic peptide <400> SEQUENCE: 13 Ala Val Ser
Glu Ile Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp
Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25
30 Thr Ala Glu Ile 35 <210> SEQ ID NO 14 <211> LENGTH:
36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 14 Ala
Val Ala Glu Ile Gln Leu Met His Gln Arg Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 15 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 15 Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys
Trp Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 16 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 16 Ala Val Ala Glu Ile Gln Leu Met
His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 17 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 17 Ser Val Ser Glu His Gln
Leu Met His Asn Leu Gly Lys His Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 18 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 18 Ala
Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10
15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 19 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 19 Ser
Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Ile Gln 1 5 10
15 Asp Leu Glu Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 20 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 20 Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys
Trp Ile Gln 1 5 10 15 Asp Leu Glu Arg Arg Phe Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 21 <211> LENGTH: 34 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 21 Ala Val Ala Glu Ile Gln Leu Met
His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 22 <211> LENGTH: 84 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 22 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
Val Ala Leu Gly Ala Pro Leu Ala Pro Arg Asp Ala Gly Ser 35 40 45
Gln Arg Pro Arg Lys Lys Glu Asp Asn Val Leu Val Glu Ser His Glu 50
55 60 Lys Ser Leu Gly Glu Ala Asp Lys Ala Asp Val Asn Val Leu Thr
Lys 65 70 75 80 Ala Lys Ser Gln <210> SEQ ID NO 23
<211> LENGTH: 141 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 23 Ala Val Ser Glu Ile Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile Arg Ala
Thr Ser Glu Val Ser Pro Asn Ser Lys Pro 35 40 45 Ser Pro Asn Thr
Lys Asn His Pro Val Arg Phe Gly Ser Asp Asp Glu 50 55 60 Gly Arg
Tyr Leu Thr Gln Glu Thr Asn Lys Val Glu Thr Tyr Lys Glu 65 70 75 80
Gln Pro Leu Lys Thr Pro Gly Lys Lys Lys Lys Gly Lys Pro Gly Lys 85
90 95 Arg Lys Glu Gln Glu Lys Lys Lys Arg Arg Thr Arg Ser Ala Trp
Leu 100 105 110 Asp Ser Gly Val Thr Gly Ser Gly Leu Glu Gly Asp His
Leu Ser Asp 115 120 125 Thr Ser Thr Thr Ser Leu Glu Leu Asp Ser Arg
Arg His 130 135 140 <210> SEQ ID NO 24 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 24 Ala
Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 25 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 25 Ala
Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Ile Gln 1 5 10
15 Asp Leu Glu Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 26 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 26 Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys
His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 27 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 27 Ser Val Ser Glu Ile Gln Leu Met
His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Trp Leu Arg Lys Lys Leu Gln Asp Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 28 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 28 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 29 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 29 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 30 <211> LENGTH: 14 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Ser, Ala, Gly or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Ser, Ala or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (10)..(10) <223>
OTHER INFORMATION: Ala, Asn, Glu, Val, Asp or Gln <220>
FEATURE: <221> NAME/KEY: MOD_RES <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Leu, Val, Ala, Trp, Ile,
Met, Lys, Arg or Har <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (12)..(12) <223> OTHER
INFORMATION: Gly, His, Arg, Ala or Aib <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (13)..(13)
<223> OTHER INFORMATION: Lys, Gln, Leu, His, Trp, Ala, Arg or
Aib <220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (14)..(14) <223> OTHER INFORMATION: His, Arg, Leu,
Phe, Trp or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (14)..(14) <223> OTHER INFORMATION:
His, Arg, Leu, Phe, Trp or Aib <400> SEQUENCE: 30 Xaa Val Xaa
Glu His Gln Lys Met His Xaa Xaa Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 31 <211> LENGTH: 28 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Ser,
Ala or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (3)..(3) <223> OTHER INFORMATION: Ser,
Ala or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (5)..(5) <223> OTHER INFORMATION: Ile
or His <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (10)..(10) <223> OTHER INFORMATION:
Asn, Glu, Val, Asp or Gln <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Leu, Val, Ala, Trp, Ile, Met, Lys, Arg or Har
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Gly, His, Arg
or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (13)..(13) <223> OTHER INFORMATION:
Lys, Gln, Leu, His, Trp, Ala or Arg <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (14)..(14)
<223> OTHER INFORMATION: His, Arg, Leu, Phe, Trp or Ser
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (20)..(20) <223> OTHER INFORMATION: Arg or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (23)..(23) <223> OTHER INFORMATION: Trp, Phe or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (24)..(24) <223> OTHER INFORMATION: Leu or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (28)..(28) <223> OTHER INFORMATION: Leu or Ala
<400> SEQUENCE: 31 Xaa Val Xaa Glu Xaa Gln Leu Met His Xaa
Xaa Xaa Xaa Xaa Leu Asn 1 5 10 15 Ser Met Glu Xaa Val Glu Xaa Xaa
Arg Lys Lys Xaa 20 25 <210> SEQ ID NO 32 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Ser, Ala or Aib <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (3)..(3)
<223> OTHER INFORMATION: Ser, Ala or Aib <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (10)..(10)
<223> OTHER INFORMATION: Asn, Glu, Val, Asp or Gln
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Leu, Val, Ala,
Trp, Ile, Met, Lys or Arg <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (12)..(12) <223>
OTHER INFORMATION: Gly, His, Arg or Ala <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (13)..(13)
<223> OTHER INFORMATION: Lys, Gln, Leu, His, Trp, Ala or Arg
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (14)..(14) <223> OTHER INFORMATION: His, Arg, Leu,
Phe, Trp or Ser <400> SEQUENCE: 32 Xaa Val Xaa Glu Ile Gln
Leu Met His Xaa Xaa Xaa Xaa Xaa Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Trp Leu Arg Lys Lys Leu 20 25 <210> SEQ ID NO 33
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (18)..(18) <223> OTHER INFORMATION: Leu, Ala, Ser,
Met, Phe or Glu <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (22)..(22) <223> OTHER INFORMATION:
Phe, Ala, Ser, Leu, Asn, Trp, Glu or Lys <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (25)..(25)
<223> OTHER INFORMATION: His, Leu, Arg, Lys, Trp, Ile or Phe
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (26)..(26) <223> OTHER INFORMATION: His, Ala, Ser,
Asn, Lys or Arg <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (29)..(29) <223> OTHER INFORMATION:
Ala, Gly, Ser, Asn, Gln, Trp, Glu or Lys <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (30)..(30)
<223> OTHER INFORMATION: Glu, Gly, Ser, Leu, Asn, Asp, Lys or
Ala <220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (31)..(31) <223> OTHER INFORMATION: Ile, Leu, Val,
Lys or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (32)..(32) <223> OTHER INFORMATION: His
or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (33)..(33) <223> OTHER INFORMATION:
Thr, Asn or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (34)..(34) <223> OTHER INFORMATION: Ala
or Phe <400> SEQUENCE: 33 Ala Val Ser Glu His Glu Leu Leu His
Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Xaa Arg Arg Arg Xaa Phe
Leu Xaa Xaa Leu Ile Xaa Xaa Xaa Xaa 20 25 30 Xaa Xaa Glu Ile 35
<210> SEQ ID NO 34 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 34 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 35
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 35 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ser Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 36 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 36 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Met Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 37 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 37 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Phe Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 38
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 38 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 39 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 39 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Ala Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 40 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 40 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Ser Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 41
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 41 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Leu Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 42 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 42 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Asn Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 43 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 43 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Trp Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 44
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 44 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Glu Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 45 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 45 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Lys Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 46 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 46 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 47
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 47 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Ser Leu Ile 20 25 <210> SEQ ID NO 48 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 48 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His Asn Leu Ile 20 25
<210> SEQ ID NO 49 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 49 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 50
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 50 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Arg Leu Ile 20 25 <210> SEQ ID NO 51 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 51 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu Leu His Leu Ile 20 25
<210> SEQ ID NO 52 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 52 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Trp His Leu Ile 20 25 <210> SEQ ID NO 53
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 53 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
Lys His Leu Ile 20 25 <210> SEQ ID NO 54 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 54 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu Arg His Leu Ile 20 25
<210> SEQ ID NO 55 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 55 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ala Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 56
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 56 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 57 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 57 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ser Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 58 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 58 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ser Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 59
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 59 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Asn Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 60 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 60 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Asn Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 61 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 61 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Leu Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 62
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 62 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Leu Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 63 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 63 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Trp Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 64 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 64 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Trp Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 65
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 65 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 66 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 66 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ser Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 67 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 67 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Asn Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 68
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 68 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Asn Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 69 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 69 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Leu Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 70 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 70 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Leu Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 71
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 71 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Trp Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 72 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 72 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Trp Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 73 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 73 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Lys Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 74
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 74 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Lys Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 75 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 75 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ala Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 76 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 76 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile 20 25 <210> SEQ ID NO 77
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 77 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Lys Lys Leu Ile 20 25 <210> SEQ ID NO 78 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 78 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ala Phe Leu Ile Lys Leu Ile 20 25
<210> SEQ ID NO 79 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 79 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ala Phe Leu Trp Lys Leu Ile 20 25 <210> SEQ ID NO 80
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 80 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Phe Lys Leu Ile 20 25 <210> SEQ ID NO 81 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 81 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ser Phe Leu Leu Lys Leu Ile 20 25
<210> SEQ ID NO 82 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 82 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ser Phe Leu Lys Lys Leu Ile 20 25 <210> SEQ ID NO 83
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 83 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile 20 25 <210> SEQ ID NO 84 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 84 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ala Phe Leu Lys Lys Leu Ile 20 25
<210> SEQ ID NO 85 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 85 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ser Phe Leu Leu Lys Leu Ile 20 25 <210> SEQ ID NO 86
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 86 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ser Phe Leu
Lys Lys Leu Ile 20 25 <210> SEQ ID NO 87 <211> LENGTH:
30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 87 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ala Phe Leu His Lys Leu Ile Ala Glu 20 25 30
<210> SEQ ID NO 88 <211> LENGTH: 30 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 88 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu His His Lys Ile Ala Glu 20 25 30 <210> SEQ ID
NO 89 <211> LENGTH: 30 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 89 Ala Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala
Phe Leu Leu Lys Leu Ile Ala Glu 20 25 30 <210> SEQ ID NO 90
<211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 90 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu 20 25 30 <210> SEQ ID NO 91
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 91 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
His Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 92
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 92 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
His His Lys Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 93
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 93 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 94
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 94 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 95
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 95 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Gly Glu Ile 20 25 30 <210> SEQ ID NO 96
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 96 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ser Glu Ile 20 25 30 <210> SEQ ID NO 97
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 97 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Asn Glu Ile 20 25 30 <210> SEQ ID NO 98
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 98 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Gln Glu Ile 20 25 30 <210> SEQ ID NO 99
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 99 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Trp Glu Ile 20 25 30 <210> SEQ ID NO 100
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 100 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Glu Glu Ile 20 25 30 <210> SEQ ID NO 101
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 101 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Lys Glu Ile 20 25 30 <210> SEQ ID NO 102
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 102 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Gly Ile 20 25 30 <210> SEQ ID NO 103
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 103 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Ser Ile 20 25 30 <210> SEQ ID NO 104
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 104 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Leu Ile 20 25 30 <210> SEQ ID NO 105
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 105 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Asn Ile 20 25 30 <210> SEQ ID NO 106
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 106 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Asp Ile 20 25 30 <210> SEQ ID NO 107
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 107 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Lys Ile 20 25 30 <210> SEQ ID NO 108
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 108 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ser 20 25 30 <210> SEQ ID NO 109
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 109 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Leu 20 25 30 <210> SEQ ID NO 110
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 110 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Val 20 25 30 <210> SEQ ID NO 111
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 111 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Lys 20 25 30 <210> SEQ ID NO 112
<211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 112 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ile His 20 25 30 Thr Ala <210> SEQ ID
NO 113 <211> LENGTH: 34 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 113 Ala Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala
Phe Leu Leu Lys Leu Ile Ala Ala Ile His 20 25 30 Thr Ala
<210> SEQ ID NO 114 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 114 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ala His 20 25 30 Thr Ala
<210> SEQ ID NO 115 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 115 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ile Ala 20 25 30 Thr Ala
<210> SEQ ID NO 116 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 116 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ile His 20 25 30 Ala Ala
<210> SEQ ID NO 117 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 117 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 118 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 118 Trp Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 119 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 119 Trp Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID
NO 120 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 120 Trp Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 121 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 121 Trp Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu 20 25 <210> SEQ ID NO 122
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (3)..(3) <223> OTHER INFORMATION: Aib <220>
FEATURE: <221> NAME/KEY: MOD_RES <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Har <400> SEQUENCE:
122 Trp Val Xaa Glu Ile Gln Leu Met His Gln Xaa Ala Lys Trp Leu Asn
1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu 20 25
<210> SEQ ID NO 123 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (8)..(8) <223> OTHER
INFORMATION: Nle <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (21)..(21) <223> OTHER INFORMATION: Nle
<400> SEQUENCE: 123 Ala Val Ser Glu Ile Gln Leu Xaa His Asn
Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val Glu Arg Xaa Gln Trp Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Tyr <210> SEQ ID
NO 124 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 124 Ala Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Tyr 35
<210> SEQ ID NO 125 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 125 Ala Val Ser Glu Ile Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Tyr 35 <210> SEQ ID NO 126 <211> LENGTH: 15
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (8)..(8) <223> OTHER INFORMATION: Nle
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Har <400>
SEQUENCE: 126 Xaa Val Xaa Glu Ile Gln Leu Xaa His Gln Xaa Ala Lys
Trp Tyr 1 5 10 15 <210> SEQ ID NO 127 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (8)..(8)
<223> OTHER INFORMATION: Nle <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (21)..(21) <223>
OTHER INFORMATION: Nle <400> SEQUENCE: 127 Ala Val Ser Glu
His Gln Leu Xaa His Asn Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val
Glu Arg Xaa Gln Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30
Asn Tyr <210> SEQ ID NO 128 <211> LENGTH: 14
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 128 Xaa Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp 1 5 10 <210> SEQ ID NO 129 <211>
LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 129 Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys
His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys
Leu 20 25 <210> SEQ ID NO 130 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 130
Ala Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Ala 1 5
10 15 Ser Val Glu Arg Met Gln Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 131 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 131
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 132 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 132
Ala Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 133 <211> LENGTH:
36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 133
Ala Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 134
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 134 Ser Val Ser Glu Ile Gln Leu Met His Asn
Leu Gly Lys His Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 135 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 135 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 136 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 136
Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5
10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 137
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 137 Ser Val Ser Glu Ile Gln Leu Met His Asn
Leu Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 138 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 138 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 139 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 139
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 140
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 140 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 141 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 141 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Trp Leu Arg Lys Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 142 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 142
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 143
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 143 Ser Val Ser Glu His Gln Leu Met His Asn
Leu Gly Lys His Ile Gln 1 5 10 15 Asp Leu Glu Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 144 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 144 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 145 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 145
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 146
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 146 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu
Arg Lys Lys Leu Gln Asp Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 147 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 147 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Ala
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 148 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 148 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Ala Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 149 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 149 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Ala
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 150 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 150 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Phe Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 151 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 151 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 152
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 152 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ala Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 153 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 153
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Ala 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 154 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 154 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Ala Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 155
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 155 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Ala Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 156 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 156
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Ala Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 157 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 157 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Ala Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 158
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 158 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Ala Leu
His His Leu Ile 20 25 <210> SEQ ID NO 159 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 159
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Ala His His Leu Ile 20 25
<210> SEQ ID NO 160 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 160 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Ala His Leu Ile 20 25 <210> SEQ ID NO 161
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 161 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Ala Ile 20 25 <210> SEQ ID NO 162 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 162
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ala 20 25
<210> SEQ ID NO 163 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 163 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Gly Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 164
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 164 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 165 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 165
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Asn Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 166 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 166 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Lys Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 167
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 167 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Gly Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 168 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 168
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His Gly Leu Ile 20 25
<210> SEQ ID NO 169 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 169 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His Leu Leu Ile 20 25 <210> SEQ ID NO 170
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 170 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Trp Leu Ile 20 25 <210> SEQ ID NO 171 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 171
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His Glu Leu Ile 20 25
<210> SEQ ID NO 172 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 172 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Gly His Leu Ile 20 25 <210> SEQ ID NO 173
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 173 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
Ser His Leu Ile 20 25 <210> SEQ ID NO 174 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 174
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu Asn His Leu Ile 20 25
<210> SEQ ID NO 175 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 175 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Glu His Leu Ile 20 25 <210> SEQ ID NO 176
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 176 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Leu Glu Ile 20 25 30 <210> SEQ ID NO 177
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 177 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Trp Ile 20 25 30 <210> SEQ ID NO 178
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 178 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Asn 20 25 30 <210> SEQ ID NO 179
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 179 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Trp 20 25 30 <210> SEQ ID NO 180
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 180 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Glu 20 25 30 <210> SEQ ID NO 181
<211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 181 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Ala Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID
NO 182 <211> LENGTH: 34 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 182 Ala Val Ala Glu Ile Gln Leu Met
His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 183 <211> LENGTH: 30 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 183 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu 20 25 30 <210> SEQ ID
NO 184 <211> LENGTH: 31 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 184 Ala Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO
185 <211> LENGTH: 34 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 185 Ala Val Ser Glu His Gln Leu Met
His Asn Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val Glu Arg Met Gln
Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 186 <211> LENGTH: 6 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 186 Ala Glu Ile His Thr Ala
1 5
1 SEQUENCE LISTING <160> NUMBER OF SEQ ID NOS: 186
<210> SEQ ID NO 1 <211> LENGTH: 593 <212> TYPE:
PRT <213> ORGANISM: Homo sapiens <400> SEQUENCE: 1 Met
Gly Thr Ala Arg Ile Ala Pro Gly Leu Ala Leu Leu Leu Cys Cys 1 5 10
15 Pro Val Leu Ser Ser Ala Tyr Ala Leu Val Asp Ala Asp Asp Val Met
20 25 30 Thr Lys Glu Glu Gln Ile Phe Leu Leu His Arg Ala Gln Ala
Gln Cys 35 40 45 Glu Lys Arg Leu Lys Glu Val Leu Gln Arg Pro Ala
Ser Ile Met Glu 50 55 60 Ser Asp Lys Gly Trp Thr Ser Ala Ser Thr
Ser Gly Lys Pro Arg Lys 65 70 75 80 Asp Lys Ala Ser Gly Lys Leu Tyr
Pro Glu Ser Glu Glu Asp Lys Glu 85 90 95 Ala Pro Thr Gly Ser Arg
Tyr Arg Gly Arg Pro Cys Leu Pro Glu Trp 100 105 110 Asp His Ile Leu
Cys Trp Pro Leu Gly Ala Pro Gly Glu Val Val Ala 115 120 125 Val Pro
Cys Pro Asp Tyr Ile Tyr Asp Phe Asn His Lys Gly His Ala 130 135 140
Tyr Arg Arg Cys Asp Arg Asn Gly Ser Trp Glu Leu Val Pro Gly His 145
150 155 160 Asn Arg Thr Trp Ala Asn Tyr Ser Glu Cys Val Lys Phe Leu
Thr Asn 165 170 175 Glu Thr Arg Glu Arg Glu Val Phe Asp Arg Leu Gly
Met Ile Tyr Thr 180 185 190 Val Gly Tyr Ser Val Ser Leu Ala Ser Leu
Thr Val Ala Val Leu Ile 195 200 205 Leu Ala Tyr Phe Arg Arg Leu His
Cys Thr Arg Asn Tyr Ile His Met 210 215 220 His Leu Phe Leu Ser Phe
Met Leu Arg Ala Val Ser Ile Phe Val Lys 225 230 235 240 Asp Ala Val
Leu Tyr Ser Gly Ala Thr Leu Asp Glu Ala Glu Arg Leu 245 250 255 Thr
Glu Glu Glu Leu Arg Ala Ile Ala Gln Ala Pro Pro Pro Pro Ala 260 265
270 Thr Ala Ala Ala Gly Tyr Ala Gly Cys Arg Val Ala Val Thr Phe Phe
275 280 285 Leu Tyr Phe Leu Ala Thr Asn Tyr Tyr Trp Ile Leu Val Glu
Gly Leu 290 295 300 Tyr Leu His Ser Leu Ile Phe Met Ala Phe Phe Ser
Glu Lys Lys Tyr 305 310 315 320 Leu Trp Gly Phe Thr Val Phe Gly Trp
Gly Leu Pro Ala Val Phe Val 325 330 335 Ala Val Trp Val Ser Val Arg
Ala Thr Leu Ala Asn Thr Gly Cys Trp 340 345 350 Asp Leu Ser Ser Gly
Asn Lys Lys Trp Ile Ile Gln Val Pro Ile Leu 355 360 365 Ala Ser Ile
Val Leu Asn Phe Ile Leu Phe Ile Asn Ile Val Arg Val 370 375 380 Leu
Ala Thr Lys Leu Arg Glu Thr Asn Ala Gly Arg Cys Asp Thr Arg 385 390
395 400 Gln Gln Tyr Arg Lys Leu Leu Lys Ser Thr Leu Val Leu Met Pro
Leu 405 410 415 Phe Gly Val His Tyr Ile Val Phe Met Ala Thr Pro Tyr
Thr Glu Val 420 425 430 Ser Gly Thr Leu Trp Gln Val Gln Met His Tyr
Glu Met Leu Phe Asn 435 440 445 Ser Phe Gln Gly Phe Phe Val Ala Ile
Ile Tyr Cys Phe Cys Asn Gly 450 455 460 Glu Val Gln Ala Glu Ile Lys
Lys Ser Trp Ser Arg Trp Thr Leu Ala 465 470 475 480 Leu Asp Phe Lys
Arg Lys Ala Arg Ser Gly Ser Ser Ser Tyr Ser Tyr 485 490 495 Gly Pro
Met Val Ser His Thr Ser Val Thr Asn Val Gly Pro Arg Val 500 505 510
Gly Leu Gly Leu Pro Leu Ser Pro Arg Leu Leu Pro Thr Ala Thr Thr 515
520 525 Asn Gly His Pro Gln Leu Pro Gly His Ala Lys Pro Gly Thr Pro
Ala 530 535 540 Leu Glu Thr Leu Glu Thr Thr Pro Pro Ala Met Ala Ala
Pro Lys Asp 545 550 555 560 Asp Gly Phe Leu Asn Gly Ser Cys Ser Gly
Leu Asp Glu Glu Ala Ser 565 570 575 Gly Pro Glu Arg Pro Pro Ala Leu
Leu Gln Glu Glu Trp Glu Thr Val 580 585 590 Met <210> SEQ ID
NO 2 <211> LENGTH: 591 <212> TYPE: PRT <213>
ORGANISM: Rattus norvegicus <400> SEQUENCE: 2 Met Gly Ala Ala
Arg Ile Ala Pro Ser Leu Ala Leu Leu Leu Cys Cys 1 5 10 15 Pro Val
Leu Ser Ser Ala Tyr Ala Leu Val Asp Ala Asp Asp Val Phe 20 25 30
Thr Lys Glu Glu Gln Ile Phe Leu Leu His Arg Ala Gln Ala Gln Cys 35
40 45 Asp Lys Leu Leu Lys Glu Val Leu His Thr Ala Ala Asn Ile Met
Glu 50 55 60 Ser Asp Lys Gly Trp Thr Pro Ala Ser Thr Ser Gly Lys
Pro Arg Lys 65 70 75 80 Glu Lys Ala Ser Gly Lys Phe Tyr Pro Glu Ser
Lys Glu Asn Lys Asp 85 90 95 Val Pro Thr Gly Ser Arg Arg Arg Gly
Arg Pro Cys Leu Pro Glu Trp 100 105 110 Asp Asn Ile Val Cys Trp Pro
Leu Gly Ala Pro Gly Glu Val Val Ala 115 120 125 Val Pro Cys Pro Asp
Tyr Ile Tyr Asp Phe Asn His Lys Gly His Ala 130 135 140 Tyr Arg Arg
Cys Asp Arg Asn Gly Ser Trp Glu Val Val Pro Gly His 145 150 155 160
Asn Arg Thr Trp Ala Asn Tyr Ser Glu Cys Leu Lys Phe Met Thr Asn 165
170 175 Glu Thr Arg Glu Arg Glu Val Phe Asp Arg Leu Gly Met Ile Tyr
Thr 180 185 190 Val Gly Tyr Ser Met Ser Leu Ala Ser Leu Thr Val Ala
Val Leu Ile 195 200 205 Leu Ala Tyr Phe Arg Arg Leu His Cys Thr Arg
Asn Tyr Ile His Met 210 215 220 His Met Phe Leu Ser Phe Met Leu Arg
Ala Ala Ser Ile Phe Val Lys 225 230 235 240 Asp Ala Val Leu Tyr Ser
Gly Phe Thr Leu Asp Glu Ala Glu Arg Leu 245 250 255 Thr Glu Glu Glu
Leu His Ile Ile Ala Gln Val Pro Pro Pro Pro Ala 260 265 270 Ala Ala
Ala Val Gly Tyr Ala Gly Cys Arg Val Ala Val Thr Phe Phe 275 280 285
Leu Tyr Phe Leu Ala Thr Asn Tyr Tyr Trp Ile Leu Val Glu Gly Leu 290
295 300 Tyr Leu His Ser Leu Ile Phe Met Ala Phe Phe Ser Glu Lys Lys
Tyr 305 310 315 320 Leu Trp Gly Phe Thr Ile Phe Gly Trp Gly Leu Pro
Ala Val Phe Val 325 330 335 Ala Val Trp Val Gly Val Arg Ala Thr Leu
Ala Asn Thr Gly Cys Trp 340 345 350 Asp Leu Ser Ser Gly His Lys Lys
Trp Ile Ile Gln Val Pro Ile Leu 355 360 365 Ala Ser Val Val Leu Asn
Phe Ile Leu Phe Ile Asn Ile Ile Arg Val 370 375 380 Leu Ala Thr Lys
Leu Arg Glu Thr Asn Ala Gly Arg Cys Asp Thr Arg 385 390 395 400 Gln
Gln Tyr Arg Lys Leu Leu Arg Ser Thr Leu Val Leu Val Pro Leu 405 410
415 Phe Gly Val His Tyr Thr Val Phe Met Ala Leu Pro Tyr Thr Glu Val
420 425 430 Ser Gly Thr Leu Trp Gln Ile Gln Met His Tyr Glu Met Leu
Phe Asn 435 440 445 Ser Phe Gln Gly Phe Phe Val Ala Ile Ile Tyr Cys
Phe Cys Asn Gly 450 455 460 Glu Val Gln Ala Glu Ile Arg Lys Ser Trp
Ser Arg Trp Thr Leu Ala 465 470 475 480 Leu Asp Phe Lys Arg Lys Ala
Arg Ser Gly Ser Ser Ser Tyr Ser Tyr 485 490 495 Gly Pro Met Val Ser
His Thr Ser Val Thr Asn Val Gly Pro Arg Ala 500 505 510 Gly Leu Ser
Leu Pro Leu Ser Pro Arg Leu Pro Pro Ala Thr Thr Asn 515 520 525 Gly
His Ser Gln Leu Pro Gly His Ala Lys Pro Gly Ala Pro Ala Thr 530 535
540 Glu Thr Glu Thr Leu Pro Val Thr Met Ala Val Pro Lys Asp Asp Gly
545 550 555 560 Phe Leu Asn Gly Ser Cys Ser Gly Leu Asp Glu Glu Ala
Ser Gly Ser 565 570 575 Ala Arg Pro Pro Pro Leu Leu Gln Glu Glu Trp
Glu Thr Val Met 580 585 590 <210> SEQ ID NO 3 <211>
LENGTH: 115 <212> TYPE: PRT <213> ORGANISM: Homo
sapiens <220> FEATURE:
<221> NAME/KEY: mat_peptide <222> LOCATION: (32)..(115)
<223> OTHER INFORMATION: The native peptide is 1-84, which is
shown by residues 32 to 115 in this sequence. <400> SEQUENCE:
3 Met Ile Pro Ala Lys Asp Met Ala Lys Val Met Ile Val Met Leu Ala
-30 -25 -20 Ile Cys Phe Leu Thr Lys Ser Asp Gly Lys Ser Val Lys Lys
Arg Ser -15 -10 -5 -1 1 Val Ser Glu Ile Gln Leu Met His Asn Leu Gly
Lys His Leu Asn Ser 5 10 15 Met Glu Arg Val Glu Trp Leu Arg Lys Lys
Leu Gln Asp Val His Asn 20 25 30 Phe Val Ala Leu Gly Ala Pro Leu
Ala Pro Arg Asp Ala Gly Ser Gln 35 40 45 Arg Pro Arg Lys Lys Glu
Asp Asn Val Leu Val Glu Ser His Glu Lys 50 55 60 65 Ser Leu Gly Glu
Ala Asp Lys Ala Asp Val Asn Val Leu Thr Lys Ala 70 75 80 Lys Ser
Gln <210> SEQ ID NO 4 <211> LENGTH: 177 <212>
TYPE: PRT <213> ORGANISM: Homo sapiens <220> FEATURE:
<221> NAME/KEY: mat_peptide <222> LOCATION: (37)..(177)
<223> OTHER INFORMATION: The native peptide is .about.1-140,
which is approximately shown by residues 37 to 177 in this
sequence. <400> SEQUENCE: 4 Met Gln Arg Arg Leu Val Gln Gln
Trp Ser Val Ala Val Phe Leu Leu -35 -30 -25 Ser Tyr Ala Val Pro Ser
Cys Gly Arg Ser Val Glu Gly Leu Ser Arg -20 -15 -10 -5 Arg Leu Lys
Arg Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly -1 1 5 10 Lys
Ser Ile Gln Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile 15 20
25 Ala Glu Ile His Thr Ala Glu Ile Arg Ala Thr Ser Glu Val Ser Pro
30 35 40 Asn Ser Lys Pro Ser Pro Asn Thr Lys Asn His Pro Val Arg
Phe Gly 45 50 55 60 Ser Asp Asp Glu Gly Arg Tyr Leu Thr Gln Glu Thr
Asn Lys Val Glu 65 70 75 Thr Tyr Lys Glu Gln Pro Leu Lys Thr Pro
Gly Lys Lys Lys Lys Gly 80 85 90 Lys Pro Gly Lys Arg Lys Glu Gln
Glu Lys Lys Lys Arg Arg Thr Arg 95 100 105 Ser Ala Trp Leu Asp Ser
Gly Val Thr Gly Ser Gly Leu Glu Gly Asp 110 115 120 His Leu Ser Asp
Thr Ser Thr Thr Ser Leu Glu Leu Asp Ser Arg Arg 125 130 135 140 His
<210> SEQ ID NO 5 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 5 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 6 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 6 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 7 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 7 Ser
Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 8 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 8 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Ala Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 9 <211>
LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 9 Ser Val Ser Glu His Gln Leu Met His Asn Leu Gly Lys His
Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu
Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID NO 10
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 10 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 11 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 11 Ala Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu 20 25 <210> SEQ ID NO 12 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (3)..(3)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Har <400> SEQUENCE: 12 Ala Val Xaa Glu Ile
Gln Leu Met His Gln Xaa Ala Lys Trp Leu Asn 1 5 10 15
Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20
25 30 Asn Phe <210> SEQ ID NO 13 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 13 Ala
Val Ser Glu Ile Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 14 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 14 Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Gly Lys
Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 15 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 15 Ala Val Ala Glu Ile Gln Leu Met
His Gln Arg Ala Lys Trp Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 16 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 16 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 17 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 17 Ser
Val Ser Glu His Gln Leu Met His Asn Leu Gly Lys His Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 18 <211>
LENGTH: 34 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 18 Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys
Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys
Leu Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID NO 19
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 19 Ser Val Ser Glu Ile Gln Leu Met His Asn
Leu Gly Lys His Ile Gln 1 5 10 15 Asp Leu Glu Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 20 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 20 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Ile Gln 1 5 10 15 Asp Leu Glu Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 21 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 21 Ala
Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 22 <211> LENGTH: 84
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 22 Ser
Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe Val Ala Leu Gly Ala Pro Leu Ala Pro Arg Asp Ala
Gly Ser 35 40 45 Gln Arg Pro Arg Lys Lys Glu Asp Asn Val Leu Val
Glu Ser His Glu 50 55 60 Lys Ser Leu Gly Glu Ala Asp Lys Ala Asp
Val Asn Val Leu Thr Lys 65 70 75 80 Ala Lys Ser Gln <210> SEQ
ID NO 23 <211> LENGTH: 141 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 23 Ala Val Ser Glu Ile Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile
Arg Ala Thr Ser Glu Val Ser Pro Asn Ser Lys Pro 35 40 45 Ser Pro
Asn Thr Lys Asn His Pro Val Arg Phe Gly Ser Asp Asp Glu 50 55 60
Gly Arg Tyr Leu Thr Gln Glu Thr Asn Lys Val Glu Thr Tyr Lys Glu 65
70 75 80 Gln Pro Leu Lys Thr Pro Gly Lys Lys Lys Lys Gly Lys Pro
Gly Lys 85 90 95
Arg Lys Glu Gln Glu Lys Lys Lys Arg Arg Thr Arg Ser Ala Trp Leu 100
105 110 Asp Ser Gly Val Thr Gly Ser Gly Leu Glu Gly Asp His Leu Ser
Asp 115 120 125 Thr Ser Thr Thr Ser Leu Glu Leu Asp Ser Arg Arg His
130 135 140 <210> SEQ ID NO 24 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 24 Ala
Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10
15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His
20 25 30 Asn Phe <210> SEQ ID NO 25 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 25 Ala
Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Ile Gln 1 5 10
15 Asp Leu Glu Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His
20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 26 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 26 Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys
His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 27 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 27 Ser Val Ser Glu Ile Gln Leu Met
His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Trp Leu Arg Lys Lys Leu Gln Asp Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 28 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 28 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 29 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 29 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 30 <211> LENGTH: 14 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Ser, Ala, Gly or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Ser, Ala or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (10)..(10) <223>
OTHER INFORMATION: Ala, Asn, Glu, Val, Asp or Gln <220>
FEATURE: <221> NAME/KEY: MOD_RES <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Leu, Val, Ala, Trp, Ile,
Met, Lys, Arg or Har <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (12)..(12) <223> OTHER
INFORMATION: Gly, His, Arg, Ala or Aib <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (13)..(13)
<223> OTHER INFORMATION: Lys, Gln, Leu, His, Trp, Ala, Arg or
Aib <220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (14)..(14) <223> OTHER INFORMATION: His, Arg, Leu,
Phe, Trp or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (14)..(14) <223> OTHER INFORMATION:
His, Arg, Leu, Phe, Trp or Aib <400> SEQUENCE: 30 Xaa Val Xaa
Glu His Gln Lys Met His Xaa Xaa Xaa Xaa Xaa 1 5 10 <210> SEQ
ID NO 31 <211> LENGTH: 28 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (1)..(1) <223> OTHER INFORMATION: Ser,
Ala or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (3)..(3) <223> OTHER INFORMATION: Ser,
Ala or Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (5)..(5) <223> OTHER INFORMATION: Ile
or His <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (10)..(10) <223> OTHER INFORMATION:
Asn, Glu, Val, Asp or Gln <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (11)..(11) <223>
OTHER INFORMATION: Leu, Val, Ala, Trp, Ile, Met, Lys, Arg or Har
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Gly, His, Arg
or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (13)..(13) <223> OTHER INFORMATION:
Lys, Gln, Leu, His, Trp, Ala or Arg <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (14)..(14)
<223> OTHER INFORMATION: His, Arg, Leu, Phe, Trp or Ser
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (20)..(20) <223> OTHER INFORMATION: Arg or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (23)..(23) <223> OTHER INFORMATION: Trp, Phe or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (24)..(24) <223> OTHER INFORMATION: Leu or Ala
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (28)..(28) <223> OTHER INFORMATION: Leu or Ala
<400> SEQUENCE: 31 Xaa Val Xaa Glu Xaa Gln Leu Met His Xaa
Xaa Xaa Xaa Xaa Leu Asn 1 5 10 15 Ser Met Glu Xaa Val Glu Xaa Xaa
Arg Lys Lys Xaa 20 25 <210> SEQ ID NO 32 <211> LENGTH:
28 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (1)..(1) <223> OTHER
INFORMATION: Ser, Ala or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Ser, Ala or Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (10)..(10) <223>
OTHER INFORMATION: Asn, Glu, Val, Asp or Gln <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (11)..(11)
<223> OTHER INFORMATION: Leu, Val, Ala, Trp, Ile, Met, Lys or
Arg <220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (12)..(12) <223> OTHER INFORMATION: Gly, His, Arg
or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (13)..(13) <223> OTHER INFORMATION:
Lys, Gln, Leu, His, Trp, Ala or Arg <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (14)..(14)
<223> OTHER INFORMATION: His, Arg, Leu, Phe, Trp or Ser
<400> SEQUENCE: 32 Xaa Val Xaa Glu Ile Gln Leu Met His Xaa
Xaa Xaa Xaa Xaa Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu 20 25 <210> SEQ ID NO 33 <211> LENGTH:
36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (18)..(18)
<223> OTHER INFORMATION: Leu, Ala, Ser, Met, Phe or Glu
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (22)..(22) <223> OTHER INFORMATION: Phe, Ala, Ser,
Leu, Asn, Trp, Glu or Lys <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (25)..(25) <223>
OTHER INFORMATION: His, Leu, Arg, Lys, Trp, Ile or Phe <220>
FEATURE: <221> NAME/KEY: MOD_RES <222> LOCATION:
(26)..(26) <223> OTHER INFORMATION: His, Ala, Ser, Asn, Lys
or Arg <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (29)..(29) <223> OTHER INFORMATION:
Ala, Gly, Ser, Asn, Gln, Trp, Glu or Lys <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (30)..(30)
<223> OTHER INFORMATION: Glu, Gly, Ser, Leu, Asn, Asp, Lys or
Ala <220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (31)..(31) <223> OTHER INFORMATION: Ile, Leu, Val,
Lys or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (32)..(32) <223> OTHER INFORMATION: His
or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (33)..(33) <223> OTHER INFORMATION:
Thr, Asn or Ala <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (34)..(34) <223> OTHER INFORMATION: Ala
or Phe <400> SEQUENCE: 33 Ala Val Ser Glu His Glu Leu Leu His
Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Xaa Arg Arg Arg Xaa Phe
Leu Xaa Xaa Leu Ile Xaa Xaa Xaa Xaa 20 25 30 Xaa Xaa Glu Ile 35
<210> SEQ ID NO 34 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 34 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 35
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 35 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ser Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 36 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 36 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Met Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 37 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 37 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Phe Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 38
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 38 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 39 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 39 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Ala Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 40 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 40 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Ser Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 41
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 41 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Leu Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 42 <211> LENGTH:
28 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 42 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Asn Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 43
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 43 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Trp Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 44 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 44 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Glu Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 45 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 45 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Lys Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 46
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 46 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 47 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 47 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His Ser Leu Ile 20 25
<210> SEQ ID NO 48 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 48 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His Asn Leu Ile 20 25 <210> SEQ ID NO 49
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 49 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 50 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 50 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu His Arg Leu Ile 20 25
<210> SEQ ID NO 51 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 51 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Leu His Leu Ile 20 25 <210> SEQ ID NO 52
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 52 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
Trp His Leu Ile 20 25 <210> SEQ ID NO 53 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 53 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Leu Arg Arg Arg Phe Phe Leu Lys His Leu Ile 20 25
<210> SEQ ID NO 54 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 54 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Arg His Leu Ile 20 25 <210> SEQ ID NO 55
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 55 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 56 <211> LENGTH:
28
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 56 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ala Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 57 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 57 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ser Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 58
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 58 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ser Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 59 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 59 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Asn Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 60 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 60 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Asn Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 61
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 61 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Leu Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 62 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 62 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Leu Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 63 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 63 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Trp Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 64
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 64 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Trp Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 65 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 65 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ala Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 66 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 66 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ser Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 67
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 67 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Asn Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 68 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 68 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Asn Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 69 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 69 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Leu Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 70
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 70 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Leu Phe Leu
His Lys Leu Ile 20 25 <210> SEQ ID NO 71 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 71 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Trp Phe Leu His Ala Leu Ile 20 25
<210> SEQ ID NO 72 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 72 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Trp Phe Leu His Lys Leu Ile 20 25 <210> SEQ ID NO 73
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 73 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Lys Phe Leu
His Ala Leu Ile 20 25 <210> SEQ ID NO 74 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 74 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Lys Phe Leu His Lys Leu Ile 20 25
<210> SEQ ID NO 75 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 75 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu His Ala Leu Ile 20 25 <210> SEQ ID NO 76
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 76 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile 20 25 <210> SEQ ID NO 77 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 77 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ala Phe Leu Lys Lys Leu Ile 20 25
<210> SEQ ID NO 78 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 78 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ala Phe Leu Ile Lys Leu Ile 20 25 <210> SEQ ID NO 79
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 79 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Trp Lys Leu Ile 20 25 <210> SEQ ID NO 80 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 80 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Ala Arg Arg Arg Ala Phe Leu Phe Lys Leu Ile 20 25
<210> SEQ ID NO 81 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 81 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg
Arg Ser Phe Leu Leu Lys Leu Ile 20 25 <210> SEQ ID NO 82
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 82 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ser Phe Leu
Lys Lys Leu Ile 20 25 <210> SEQ ID NO 83 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 83 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile 20 25
<210> SEQ ID NO 84
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 84 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Lys Lys Leu Ile 20 25 <210> SEQ ID NO 85 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 85 Ala
Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10
15 Asp Glu Arg Arg Arg Ser Phe Leu Leu Lys Leu Ile 20 25
<210> SEQ ID NO 86 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 86 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ser Phe Leu Lys Lys Leu Ile 20 25 <210> SEQ ID NO 87
<211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 87 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
His Lys Leu Ile Ala Glu 20 25 30 <210> SEQ ID NO 88
<211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 88 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
His His Lys Ile Ala Glu 20 25 30 <210> SEQ ID NO 89
<211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 89 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu 20 25 30 <210> SEQ ID NO 90
<211> LENGTH: 30 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 90 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu 20 25 30 <210> SEQ ID NO 91
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 91 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
His Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 92
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 92 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
His His Lys Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 93
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 93 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Ala Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 94
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 94 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ala Glu Ile 20 25 30 <210> SEQ ID NO 95
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 95 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Gly Glu Ile 20 25 30 <210> SEQ ID NO 96
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 96 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Ser Glu Ile 20 25 30 <210> SEQ ID NO 97
<211> LENGTH: 31 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 97 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg Arg Ala Phe Leu
Leu Lys Leu Ile Asn Glu Ile 20 25 30
<210> SEQ ID NO 98 <211> LENGTH: 31 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 98 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Gln Glu Ile 20 25 30 <210>
SEQ ID NO 99 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 99 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Trp Glu Ile 20 25 30 <210>
SEQ ID NO 100 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 100 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Glu Glu Ile 20 25 30 <210>
SEQ ID NO 101 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 101 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Lys Glu Ile 20 25 30 <210>
SEQ ID NO 102 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 102 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Gly Ile 20 25 30 <210>
SEQ ID NO 103 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 103 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Ser Ile 20 25 30 <210>
SEQ ID NO 104 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 104 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Leu Ile 20 25 30 <210>
SEQ ID NO 105 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 105 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Asn Ile 20 25 30 <210>
SEQ ID NO 106 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 106 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Asp Ile 20 25 30 <210>
SEQ ID NO 107 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 107 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Lys Ile 20 25 30 <210>
SEQ ID NO 108 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 108 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ser 20 25 30 <210>
SEQ ID NO 109 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 109 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Leu 20 25 30 <210>
SEQ ID NO 110 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 110 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Val 20 25 30 <210>
SEQ ID NO 111 <211> LENGTH: 31 <212> TYPE: PRT
<213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 111 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Lys 20 25 30
<210> SEQ ID NO 112 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 112 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
<210> SEQ ID NO 113 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 113 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Ala Ile His 20 25 30 Thr Ala
<210> SEQ ID NO 114 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 114 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ala His 20 25 30 Thr Ala
<210> SEQ ID NO 115 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 115 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ile Ala 20 25 30 Thr Ala
<210> SEQ ID NO 116 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 116 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Ile His 20 25 30 Ala Ala
<210> SEQ ID NO 117 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 117 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Glu Arg Arg
Arg Ala Phe Leu Leu Lys Leu Ile Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 118 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 118 Trp Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 119 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 119 Trp Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID
NO 120 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 120 Trp Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 121 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 121 Trp Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg
Val Glu Trp Leu Arg Lys Lys Leu 20 25 <210> SEQ ID NO 122
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (3)..(3) <223> OTHER INFORMATION: Aib <220>
FEATURE: <221> NAME/KEY: MOD_RES <222> LOCATION:
(11)..(11) <223> OTHER INFORMATION: Har <400> SEQUENCE:
122 Trp Val Xaa Glu Ile Gln Leu Met His Gln Xaa Ala Lys Trp Leu Asn
1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu 20 25
<210> SEQ ID NO 123 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <220> FEATURE: <221> NAME/KEY:
MOD_RES <222> LOCATION: (8)..(8) <223> OTHER
INFORMATION: Nle <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (21)..(21) <223> OTHER INFORMATION:
Nle
<400> SEQUENCE: 123 Ala Val Ser Glu Ile Gln Leu Xaa His Asn
Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val Glu Arg Xaa Gln Trp Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Tyr <210> SEQ ID
NO 124 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 124 Ala Val Ser Glu His Gln Leu Leu
His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe
Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Tyr 35
<210> SEQ ID NO 125 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 125 Ala Val Ser Glu Ile Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Tyr 35 <210> SEQ ID NO 126 <211> LENGTH: 15
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (8)..(8) <223> OTHER INFORMATION: Nle
<220> FEATURE: <221> NAME/KEY: MOD_RES <222>
LOCATION: (11)..(11) <223> OTHER INFORMATION: Har <400>
SEQUENCE: 126 Xaa Val Xaa Glu Ile Gln Leu Xaa His Gln Xaa Ala Lys
Trp Tyr 1 5 10 15 <210> SEQ ID NO 127 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (8)..(8)
<223> OTHER INFORMATION: Nle <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (21)..(21) <223>
OTHER INFORMATION: Nle <400> SEQUENCE: 127 Ala Val Ser Glu
His Gln Leu Xaa His Asn Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val
Glu Arg Xaa Gln Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30
Asn Tyr <210> SEQ ID NO 128 <211> LENGTH: 14
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <220> FEATURE:
<221> NAME/KEY: MOD_RES <222> LOCATION: (1)..(1)
<223> OTHER INFORMATION: Aib <220> FEATURE: <221>
NAME/KEY: MOD_RES <222> LOCATION: (3)..(3) <223> OTHER
INFORMATION: Aib <220> FEATURE: <221> NAME/KEY: MOD_RES
<222> LOCATION: (11)..(11) <223> OTHER INFORMATION: Har
<400> SEQUENCE: 128 Xaa Val Xaa Glu Ile Gln Leu Met His Gln
Xaa Ala Lys Trp 1 5 10 <210> SEQ ID NO 129 <211>
LENGTH: 28 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 129 Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys
His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys
Leu 20 25 <210> SEQ ID NO 130 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 130
Ala Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Ala 1 5
10 15 Ser Val Glu Arg Met Gln Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 131 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 131
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 132 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 132
Ala Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 133 <211> LENGTH:
36 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 133
Ala Val Ala Glu His Gln Leu Met His Gln Arg Ala Lys Trp Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 134
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 134 Ser Val Ser Glu Ile Gln Leu Met His Asn
Leu Gly Lys His Ile Gln 1 5 10 15
Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20
25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 135 <211>
LENGTH: 36 <212> TYPE: PRT <213> ORGANISM: Artificial
Sequence <220> FEATURE: <223> OTHER INFORMATION:
Description of Artificial Sequence: Synthetic peptide <400>
SEQUENCE: 135 Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys
His Leu Asn 1 5 10 15 Ser Met Arg Arg Arg Phe Phe Leu His His Leu
Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID
NO 136 <211> LENGTH: 36 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 136 Ser Val Ser Glu Ile Gln Leu Met
His Asn Leu Gly Lys His Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Trp Leu Arg Lys Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 137 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 137 Ser Val Ser Glu Ile Gln
Leu Met His Asn Leu Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 138 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 138
Ser Val Ser Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5
10 15 Ser Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 139
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 139 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 140 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 140 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 141 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 141
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Arg Arg Val Glu Trp Leu Arg Lys Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 142
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 142 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg Val Glu Trp Leu
Arg Lys Lys Leu Gln Asp Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 143 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 143 Ser Val Ser Glu His Gln
Leu Met His Asn Leu Gly Lys His Ile Gln 1 5 10 15 Asp Leu Glu Arg
Arg Phe Phe Leu His His Leu Ile Ala Glu Ile His 20 25 30 Thr Ala
Glu Ile 35 <210> SEQ ID NO 144 <211> LENGTH: 36
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 144
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5
10 15 Ser Met Glu Arg Val Glu Phe Leu His His Leu Ile Ala Glu Ile
His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 145
<211> LENGTH: 36 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 145 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu
Arg Lys Leu Ile Ala Glu Ile His 20 25 30 Thr Ala Glu Ile 35
<210> SEQ ID NO 146 <211> LENGTH: 36 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 146 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn
1 5 10 15 Ser Met Glu Arg Val Glu Trp Leu Arg Lys Lys Leu Gln Asp
Ile His 20 25 30 Thr Ala Glu Ile 35 <210> SEQ ID NO 147
<211> LENGTH: 34 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 147 Ala Val Ala Glu Ile Gln Leu Met His Gln
Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Ala Val Glu Trp Leu
Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe <210> SEQ ID
NO 148 <211> LENGTH: 34 <212> TYPE: PRT <213>
ORGANISM: Artificial Sequence <220> FEATURE: <223>
OTHER INFORMATION: Description of Artificial Sequence: Synthetic
peptide <400> SEQUENCE: 148 Ala Val Ala Glu Ile Gln Leu Met
His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Glu Arg Val Glu
Trp Ala Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 149 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 149 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Ala
Val Glu Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 150 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 150 Ala Val Ala Glu Ile Gln
Leu Met His Gln Arg Ala Lys Trp Leu Asn 1 5 10 15 Ser Met Arg Arg
Val Glu Phe Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 151 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 151 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 152
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 152 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ala Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 153 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 153
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Ala 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 154 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 154 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Ala Leu Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 155
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 155 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Ala Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 156 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 156
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Ala Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 157 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 157 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Ala Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 158
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 158 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Ala Leu
His His Leu Ile 20 25 <210> SEQ ID NO 159 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 159
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Ala His His Leu Ile 20 25
<210> SEQ ID NO 160 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 160 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Ala His Leu Ile 20 25 <210> SEQ ID NO 161
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 161 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Ala Ile 20 25 <210> SEQ ID NO 162 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 162
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ala 20 25
<210> SEQ ID NO 163 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 163 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Gly Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 164
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 164 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 165 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 165
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Asn Arg Arg Arg Phe Phe Leu His His Leu Ile 20 25
<210> SEQ ID NO 166 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 166 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Lys Arg Arg
Arg Phe Phe Leu His His Leu Ile 20 25 <210> SEQ ID NO 167
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 167 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Gly Phe Leu
His His Leu Ile 20 25 <210> SEQ ID NO 168 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 168
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His Gly Leu Ile 20 25
<210> SEQ ID NO 169 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 169 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu His Leu Leu Ile 20 25 <210> SEQ ID NO 170
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 170 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
His Trp Leu Ile 20 25 <210> SEQ ID NO 171 <211> LENGTH:
28 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 171
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His Glu Leu Ile 20 25
<210> SEQ ID NO 172 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 172 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Gly His Leu Ile 20 25 <210> SEQ ID NO 173
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 173 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
Ser His Leu Ile 20 25
<210> SEQ ID NO 174 <211> LENGTH: 28 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 174 Ala Val Ser Glu His Gln
Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg
Arg Phe Phe Leu Asn His Leu Ile 20 25 <210> SEQ ID NO 175
<211> LENGTH: 28 <212> TYPE: PRT <213> ORGANISM:
Artificial Sequence <220> FEATURE: <223> OTHER
INFORMATION: Description of Artificial Sequence: Synthetic peptide
<400> SEQUENCE: 175 Ala Val Ser Glu His Gln Leu Leu His Asp
Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp Leu Arg Arg Arg Phe Phe Leu
Glu His Leu Ile 20 25 <210> SEQ ID NO 176 <211> LENGTH:
31 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 176
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile Leu Glu Ile
20 25 30 <210> SEQ ID NO 177 <211> LENGTH: 31
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 177
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile Ala Trp Ile
20 25 30 <210> SEQ ID NO 178 <211> LENGTH: 31
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 178
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Asn
20 25 30 <210> SEQ ID NO 179 <211> LENGTH: 31
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 179
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Trp
20 25 30 <210> SEQ ID NO 180 <211> LENGTH: 31
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 180
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Glu Arg Arg Arg Ala Phe Leu Leu Lys Leu Ile Ala Glu Glu
20 25 30 <210> SEQ ID NO 181 <211> LENGTH: 34
<212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 181
Ala Val Ala Glu Ile Gln Leu Met His Gln Arg Gly Lys His Leu Asn 1 5
10 15 Ser Met Glu Arg Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 182 <211> LENGTH:
34 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 182
Ala Val Ala Glu Ile Gln Leu Met His Asn Leu Gly Lys His Leu Asn 1 5
10 15 Ser Met Glu Arg Val Glu Ala Leu Arg Lys Lys Leu Gln Asp Val
His 20 25 30 Asn Phe <210> SEQ ID NO 183 <211> LENGTH:
30 <212> TYPE: PRT <213> ORGANISM: Artificial Sequence
<220> FEATURE: <223> OTHER INFORMATION: Description of
Artificial Sequence: Synthetic peptide <400> SEQUENCE: 183
Ala Val Ser Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5
10 15 Asp Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu 20 25
30 <210> SEQ ID NO 184 <211> LENGTH: 31 <212>
TYPE: PRT <213> ORGANISM: Artificial Sequence <220>
FEATURE: <223> OTHER INFORMATION: Description of Artificial
Sequence: Synthetic peptide <400> SEQUENCE: 184 Ala Val Ser
Glu His Gln Leu Leu His Asp Lys Gly Lys Ser Ile Gln 1 5 10 15 Asp
Leu Arg Arg Arg Phe Phe Leu His His Leu Ile Ala Glu Ile 20 25 30
<210> SEQ ID NO 185 <211> LENGTH: 34 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 185 Ala Val Ser Glu His Gln
Leu Met His Asn Leu Gly Lys His Leu Ala 1 5 10 15 Ser Val Glu Arg
Met Gln Trp Leu Arg Lys Lys Leu Gln Asp Val His 20 25 30 Asn Phe
<210> SEQ ID NO 186 <211> LENGTH: 6 <212> TYPE:
PRT <213> ORGANISM: Artificial Sequence <220> FEATURE:
<223> OTHER INFORMATION: Description of Artificial Sequence:
Synthetic peptide <400> SEQUENCE: 186 Ala Glu Ile His Thr Ala
1 5
* * * * *