U.S. patent application number 13/872999 was filed with the patent office on 2013-09-19 for triazoles as inhibitors of fatty acid synthase.
This patent application is currently assigned to INFINITY PHARMACEUTICALS, INC.. The applicant listed for this patent is INFINITY PHARMACEUTICALS, INC.. Invention is credited to Adilah BAHADOOR, Alfredo C. CASTRO, Lawrence K. CHAN, Gregg F. KEANEY, Marta NEVALAINEN, Vesa NEVALAINEN, Stephane PELUSO, Thomas T. TIBBITTS.
Application Number | 20130243727 13/872999 |
Document ID | / |
Family ID | 44352065 |
Filed Date | 2013-09-19 |
United States Patent
Application |
20130243727 |
Kind Code |
A1 |
BAHADOOR; Adilah ; et
al. |
September 19, 2013 |
TRIAZOLES AS INHIBITORS OF FATTY ACID SYNTHASE
Abstract
Provided herein are triazole FASN inhibitors of the formula (I):
##STR00001## or a pharmaceutically acceptable form thereof; wherein
the variables R.sup.A, X, R.sup.B, and R.sup.C are defined herein.
Also provided herein are pharmaceutical compositions of the
compounds provided herein as well as methods of their use for the
treatment of various disorders such as hyperproliferative
disorders, inflammatory disorders, obesity-related disorders and
microbial infections.
Inventors: |
BAHADOOR; Adilah;
(Stittsville, CA) ; CASTRO; Alfredo C.;
(Winchester, MA) ; CHAN; Lawrence K.; (Brookline,
MA) ; KEANEY; Gregg F.; (Lexington, MA) ;
NEVALAINEN; Marta; (Weymouth, MA) ; NEVALAINEN;
Vesa; (Weymouth, MA) ; PELUSO; Stephane;
(Brookline, MA) ; TIBBITTS; Thomas T.; (Westford,
MA) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
INFINITY PHARMACEUTICALS, INC. |
Cambridge |
MA |
US |
|
|
Assignee: |
INFINITY PHARMACEUTICALS,
INC.
Cambridge
MA
|
Family ID: |
44352065 |
Appl. No.: |
13/872999 |
Filed: |
April 29, 2013 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
13101970 |
May 5, 2011 |
8450350 |
|
|
13872999 |
|
|
|
|
61331632 |
May 5, 2010 |
|
|
|
Current U.S.
Class: |
424/85.5 ;
424/85.4; 424/85.7; 514/314; 514/326; 514/359; 514/43 |
Current CPC
Class: |
A61P 31/04 20180101;
A61P 33/06 20180101; A61P 33/12 20180101; C07D 471/04 20130101;
A61K 31/454 20130101; A61P 33/02 20180101; A61P 31/10 20180101;
A61P 33/04 20180101; C07D 401/12 20130101; A61P 33/10 20180101;
A61K 45/06 20130101; C07D 249/18 20130101; A61P 33/00 20180101;
C07D 401/06 20130101; A61P 31/06 20180101; A61K 31/4709 20130101;
A61K 31/4192 20130101; A61P 31/00 20180101; C07D 249/04 20130101;
C07D 249/06 20130101 |
Class at
Publication: |
424/85.5 ;
424/85.4; 424/85.7; 514/314; 514/359; 514/326; 514/43 |
International
Class: |
A61K 31/4192 20060101
A61K031/4192; A61K 31/454 20060101 A61K031/454; C07D 401/12
20060101 C07D401/12; C07D 401/06 20060101 C07D401/06; C07D 249/04
20060101 C07D249/04; A61K 31/4709 20060101 A61K031/4709; A61K 45/06
20060101 A61K045/06 |
Claims
1. A method of treating a FASN-mediated disorder selected from
hyperproliferative disorders, inflammatory disorders, obesity
related disorders, Type II diabetes mellitus, fatty liver disease,
microbial infections, viral infections, bacterial infections,
fungal infections, parasitic infections, and protozoal infections
comprising administering to a subject a therapeutically effective
amount of a compound of the formula (I): ##STR00105## or a
pharmaceutically acceptable form thereof; wherein: R.sup.A is
selected C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl, 5-14 membered heteroaryl, and hydrogen; X is
selected from hydrogen, --CN, --CHO, --C(.dbd.O)R.sup.X1,
--C(.dbd.O)N(R.sup.X2).sub.2, --CO.sub.2H, CO.sub.2R.sup.X1,
--SO.sub.2R.sup.X1, --C(.dbd.NR.sup.X2)OR.sup.X1,
--C(.dbd.NR.sup.X2)N(R.sup.X2).sub.2, --SO.sub.2N(R.sup.X2).sub.2,
--SO.sub.2R.sup.X1, --SO.sub.3H, --SO.sub.2OR.sup.X1, --SOR.sup.X1,
--C(.dbd.S)N(R.sup.X2).sub.2, --C(.dbd.O)SR.sup.X1,
--C(.dbd.S)SR.sup.X1, --P(.dbd.O).sub.2R.sup.X1,
--P(.dbd.O)(R.sup.X1).sub.2, --P(.dbd.O).sub.2N(R.sup.X2).sub.2,
--P(.dbd.O)(NR.sup.X2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; or R.sup.A and X, together with the carbon
atoms to which each is attached, are joined to form a 5-10 membered
carbocyclyl, heterocyclyl, aryl or heteroaryl ring; R.sup.B is
selected from C.sub.6-14 aryl, 5-14 membered heteroaryl,
C.sub.1-10alkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14
membered heteroaliphatic, C.sub.3-10 carbocyclyl, and 3-14 membered
heterocyclyl; R.sup.C is selected from hydrogen, --OH, --OR.sup.C1,
--ON(R.sup.C2).sub.2, --N(R.sup.C2).sub.2, --C(.dbd.O)R.sup.C1,
--CHO, --CO.sub.2R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2,
--C(.dbd.NR.sup.C2)OR.sup.C1, --C(NR.sup.C2)N(R.sup.C2).sub.2,
--SO.sub.2R.sup.C1, --S(.dbd.O)R.sup.C1, --Si(R.sup.C1).sub.3,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; or R.sup.B and R.sup.C together with the
nitrogen (N) atom to which each is attached are joined to form a
5-14 membered carbocyclyl, heterocyclyl, aryl or heteroaryl ring;
each R.sup.C1 and R.sup.X1 is, independently. selected from
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; each R.sup.C2 is, independently, selected from
hydrogen, --OH, --OR.sup.C1, --N(R.sup.C3).sub.2, --CN,
--C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C3).sub.2,
--CO.sub.2R.sup.C1, --SO.sub.2R.sup.C1,
--C(.dbd.NR.sup.C3)OR.sup.C1, --C(.dbd.NR.sup.C3)N(R.sup.C3).sub.2,
--SO.sub.2N(R.sup.C3).sub.2, --SO.sub.2R.sup.C3,
--SO.sub.2OR.sup.C3, --SOR.sup.C1, --C(.dbd.S)N(R.sup.C3).sub.2,
--C(.dbd.O)SR.sup.C3, --C(.dbd.S)SR.sup.C3,
--P(.dbd.O).sub.2R.sup.C1, --P(.dbd.O)(R.sup.C1).sub.2,
--P(.dbd.O).sub.2N(R.sup.C3).sub.2, --P(.dbd.O)(NR.sup.C3).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10) alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; each R.sup.X2 is, independently, selected from
hydrogen, --OH, --N(R.sup.X3).sub.2, --CN, --C(.dbd.O)R.sup.X1,
--C(.dbd.O)N(R.sup.X3).sub.2, --CO.sub.2R.sup.X1,
--SO.sub.2R.sup.X1, --C(.dbd.NR.sup.X3)OR.sup.X1,
--C(.dbd.NR.sup.X3)N(R.sup.X3).sub.2, --SO.sub.2N(R.sup.X3).sub.2,
--SO.sub.2R.sup.X3, --SO.sub.2OR.sup.X3, --SOR.sup.X1,
--C(.dbd.S)N(R.sup.X3).sub.2, --C(.dbd.O)SR.sup.X3,
--C(.dbd.S)SR.sup.X3, --P(.dbd.O).sub.2R.sup.X1,
--P(.dbd.O)(R.sup.X1).sub.2, --P(.dbd.O).sub.2N(R.sup.X3).sub.2,
--P(.dbd.O)(NR.sup.X3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl; and
each R.sup.C3 and R.sup.X3 is, independently, selected from
hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic,
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, and 5-14 membered heteroaryl.
2. The method of claim 1, wherein X is selected from hydrogen,
--CN, --CHO, --C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2,
--CO.sub.2H, --CO.sub.2R.sup.C1, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2, --C(.dbd.S)N(R.sup.C2).sub.2,
--C(.dbd.O)SR.sup.C1, --C(.dbd.S)SR.sup.C1, C.sub.1-10
perhaloalkyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
3. The method of claim 2, wherein X is --CN.
4. The method of claim 1, wherein R.sup.A is selected from
C.sub.6-14 aryl and 5-14 membered heteroaryl.
5. The method of claim 4, wherein R.sup.A is C.sub.6-14 aryl.
6. The method of claim 5, wherein R.sup.A is a group of the formula
(ii): ##STR00106## wherein R.sup.1, R.sup.2, R.sup.3, R.sup.4 and
R.sup.5 are independently selected from hydrogen, halogen, --CN,
--NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.A1,
--ON(R.sup.A2).sub.2, --N(R).sub.2, --N(OR.sup.A3)R.sup.A3, --SH,
--SR.sup.A1, --SSR.sup.A3, --C(.dbd.O)R.sup.A1, --CO.sub.2H, --CHO,
--C(OR.sup.A3).sub.2, --CO.sub.2R.sup.A1, --OC(.dbd.O)R.sup.A1,
--OCO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--OC(.dbd.O)N(R.sup.A2).sub.2, --NR.sup.A2C(.dbd.O)R.sup.A1,
--NR.sup.A2CO.sub.2R.sup.A1, NR.sup.A2C(.dbd.O)N(R.sup.A2).sub.2,
--C(.dbd.NR.sup.A2)OR.sup.A1, --OC(.dbd.NR.sup.A2)R.sup.A1,
--OC(.dbd.NR.sup.A2)OR.sup.A1,
--C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--OC(.dbd.NR.sup.A2)N(R).sub.2,
--NR.sup.A2C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--C(.dbd.O)NR.sup.A2SO.sub.2R.sup.A1, --NR.sup.A2SO.sub.2R.sup.A1,
--SO.sub.2N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1,
--SO.sub.2OR.sup.A1, --OSO.sub.2R.sup.A1, --S(.dbd.O)R.sup.A1,
--OS(.dbd.O)R.sup.A1, --Si(R.sup.A1).sub.3,
--OSi(R.sup.A1).sub.3--C(.dbd.S)N(R.sup.A2).sub.2,
--C(.dbd.O)SR.sup.A1, --C(.dbd.S)SR.sup.A1, --SC(.dbd.S)SR.sup.A1,
--P(.dbd.O).sub.2R.sup.A1, --OP(.dbd.O).sub.2R.sup.A1,
--P(.dbd.O)(R.sup.A1).sub.2, --OP(.dbd.O)(R.sup.A1).sub.2,
--OP(.dbd.O)(OR.sup.A3).sub.2, --P(.dbd.O).sub.2N(R.sup.A2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.A2).sub.2, --P(.dbd.O)(NR.sup.A2).sub.2,
--OP(.dbd.O)(NR.sup.A2).sub.2,
--NR.sup.A2P(.dbd.O)(OR.sup.A3).sub.2,
--NR.sup.A2P(.dbd.O)(NR.sup.A2).sub.2, --P(R.sup.A3).sub.2,
--P(R.sup.A3).sub.3, --OP(R.sup.A3).sub.2, --OP(R.sup.A3).sub.3,
--B(OR.sup.A3).sub.2, or --BR.sup.A1(OR.sup.A3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; or one or more of R.sup.1 and R.sup.2, R.sup.2 and
R.sup.3. R.sup.3 and R.sup.4 or R.sup.4 and R.sup.5 are joined to
form a C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl or 5-14 membered heteroaryl ring; each R.sup.A1 is,
independently, selected from C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl; each
R.sup.A2 is, independently, selected from hydrogen, --OH,
--OR.sup.A1, --N(R.sup.A3).sub.2, --CN, --C(.dbd.O)R.sup.A1,
--C(.dbd.O)N(R.sup.A3).sub.2, --CO.sub.2R.sup.A1,
--SO.sub.2R.sup.A1, --C(.dbd.NR.sup.A3)OR.sup.A1,
--C(.dbd.NR.sup.A3)N(R.sup.A3).sub.2, --SO.sub.2N(R.sup.A3).sub.2,
--SO.sub.2R.sup.A3, --SO.sub.2OR.sup.A3, --SOR.sup.A1,
--C(.dbd.S)N(R.sup.A3).sub.2, --C(.dbd.O)SR.sup.A3,
--C(.dbd.S)SR.sup.A3, --P(.dbd.O).sub.2R.sup.A1,
--P(.dbd.O)(R.sup.A1).sub.2, --P(.dbd.O).sub.2N(R.sup.A3).sub.2,
--P(.dbd.O)(NR.sup.A3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.A2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and each R.sup.A3 is, independently,
selected from hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
alkenyl, C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic,
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, and 5-14 membered heteroaryl, or two R.sup.A3 groups are
joined to form a 3-14 membered heterocyclyl or 5-14 membered
heteroaryl ring.
7. The method of claim 6, wherein each of R.sup.1R.sup.2, R.sup.3,
R.sup.4 and R.sup.5 is independently selected from hydrogen,
halogen, --CN, --OR.sup.A1, --N(R.sup.A2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--SO.sub.2R.sup.A1, C.sub.1-10 alkyl, C.sub.2-10 alkynyl, 3-14
membered heterocyclyl, and C.sub.6-14 aryl; or one or more of
R.sup.1 and R.sup.2, R.sup.2 and R.sup.3, R.sup.3 and R.sup.4 or
R.sup.4 and R.sup.5 are joined to form a 5-14 membered heteroaryl
ring.
8. The method of claim 7, wherein each of R.sup.1, R.sup.2,
R.sup.3, R.sup.4 and R.sup.5 is independently selected from
hydrogen, halogen, --OR.sup.A1, C.sub.1-10 alkyl, and
--C(.dbd.O)N(R.sup.A2).sub.2; or R.sup.4 and R.sup.5 are joined to
form a 5-14 membered heteroaryl ring.
9. The method of claim 6, wherein R.sup.A is a group of the formula
(ii-d): ##STR00107## wherein one of R.sup.1 and R.sup.5 is selected
from halogen, --CN, --OR.sup.A1, --N(R.sup.A2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--SO.sub.2R.sup.A1, C.sub.1-10 alkyl. C.sub.2-10 alkynyl, 3-14
membered heterocyclyl, and C.sub.6-14 aryl, and the other of
R.sup.1 and R.sup.3 is selected from halogen, --CN, --OR.sup.A1,
--N(R.sup.A2).sub.2, --CO.sub.2H, --CO.sub.2R.sup.A1,
--C(.dbd.O)N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1, C.sub.1-10 alkyl,
C.sub.2-10 alkynyl, 3-14 membered heterocyclyl, and C.sub.6-14
aryl.
10. The method of claim 9, wherein each of R.sup.1 and R.sup.5 is
independently halogen.
11. The method of claim 10, wherein each of R.sup.1 and R.sup.5 is
independently selected from fluoro and chloro.
12. The method of claim 1, wherein R.sup.B and R.sup.C together
with the nitrogen (N) atom to which each is attached are joined to
form a 5-14 membered carbocyclyl, heterocyclyl, aryl or heteroaryl
ring.
13. The method of claim 12, wherein R.sup.B and R.sup.C together
with the nitrogen (N) atom to which each is attached are joined to
form a 5-14 membered ring of the formula (xiv): ##STR00108##
wherein: Q is N, NR.sup.40, O, S, or CR.sup.41R.sup.42; m is 0, 1
or 2; and each R.sup.41, R.sup.42, R.sup.43, R.sup.44, R.sup.45,
R.sup.46, R.sup.47, R.sup.48, R.sup.49 and R.sup.50 is,
independently, selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.F1,
--ON(R.sup.F2).sub.2, --N(R.sup.F2).sub.2, --N(OR.sup.F3)R.sup.F3,
--SH, --SR.sup.F1, --SSR.sup.F3, --C(.dbd.O)R.sup.F1, --CO.sub.2H,
--CHO, --C(OR.sup.F3).sub.2, --CO.sub.2R.sup.F1,
OC(.dbd.O)R.sup.F1, --OCO.sub.2R.sup.F1,
C(.dbd.O)N(R.sup.F2).sub.2, --OC(.dbd.O)N(R.sup.F2).sub.2,
--NR.sup.F2, --NR.sup.F2C(.dbd.O)R.sup.F1,
--NR.sup.F2C(.dbd.O)N(R.sup.F2).sub.2,
--C(.dbd.NR.sup.F2)OR.sup.F1, --OC(.dbd.NR.sup.F2)R.sup.F1,
--OC(.dbd.NR.sup.F2)OR.sup.F1,
--C(.dbd.NR.sup.F2)N(R.sup.F2).sub.2,
--OC(.dbd.NR.sup.F2)N(R.sup.F2).sub.2,
--NR.sup.F2C(.dbd.NR.sup.F2N(R.sup.F2).sub.2,
--C(.dbd.O)NR.sup.F2SO.sub.2R.sup.BC1, --NR.sup.F2SO.sub.2R.sup.F1,
--SO.sub.2N(R.sup.F2).sub.2, --SO.sub.2R.sup.F1,
--SO.sub.2OR.sup.F1, --OSO.sub.2R.sup.F1, --S(.dbd.O)R.sup.F1,
--OS(.dbd.O)R.sup.F1, --Si(R.sup.F1).sub.3, --OSi(R.sup.F1).sub.3,
--C(.dbd.S)N(R.sup.F2).sub.2, --C(.dbd.O)SR.sup.F1,
--C(.dbd.S)SR.sup.F1, --SC(.dbd.S)SR.sup.F1,
--P(.dbd.O).sub.2R.sup.F1, --OP(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --OP(.dbd.O)(R.sup.F1).sub.2,
--OP(.dbd.O)(OR.sup.F3).sub.2, --P(.dbd.O).sub.2N(R.sup.F2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.F2).sub.2, --P(.dbd.O)(NR.sup.F2).sub.2,
--OP(.dbd.O)(NR.sup.F2).sub.2,
--NR.sup.F2P(.dbd.O)(OR.sup.F3).sub.2,
--NR.sup.F2(.dbd.O)(NR.sup.F2).sub.2, --P(R.sup.F3).sub.2,
--P(R.sup.F3).sub.3, --OP(R.sup.F3).sub.2, --OP(R.sup.F3).sub.3,
--B(OR.sup.F3).sub.2, or --BR.sup.F1(OR.sup.F3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl,
-L-R.sup.D and --R.sup.E; or one or more of R.sup.47 and R.sup.49,
R.sup.48 and R.sup.50, R.sup.49 and R.sup.41, R.sup.50 and
R.sup.42, R.sup.41 and R.sup.45, R.sup.42 and R.sup.46, R.sup.45
and R.sup.43, and R.sup.46 and R.sup.44 are joined to form a double
bond or a C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl or 5-14 membered heteroaryl ring; optionally
wherein Q is N, then N and R.sup.49 or N and R.sup.46 are joined to
form a double bond; R.sup.40 is selected from hydrogen, --OH,
--OR.sup.F1, --N(R.sup.F3).sub.2, --CN, --C(.dbd.O)R.sup.F1,
--C(.dbd.O)N(R.sup.F3).sub.2, --CO.sub.2R.sup.F1,
--SO.sub.2R.sup.F1, --C(.dbd.NR.sup.F3)OR.sup.F1,
--C(.dbd.NR.sup.F3)N(R.sup.F3).sub.2, --SO.sub.2N(R.sup.F3).sub.2,
--SO.sub.2R.sup.F3, --SO.sub.2OR.sup.F3, --SOR.sup.F1,
--C(.dbd.S)N(R.sup.F3).sub.2, --C(.dbd.O)SR.sup.F3,
--C(.dbd.S)SR.sup.F3, --P(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --P(.dbd.O).sub.2N(R.sup.F3).sub.2,
--P(.dbd.O)(NR.sup.F3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or
R.sup.49 and R.sup.40 or R.sup.40 and R.sup.45 are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring; each
R.sup.F1 is, independently, selected from C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, and 5-14 membered heteroaryl; each R.sup.F2 is,
independently, selected from hydrogen, --OH, --OR.sup.F1,
--N(R.sup.F3).sub.2, --CN, --C(.dbd.O)R.sup.F1,
--C(.dbd.O)N(R.sup.F3).sub.2, --CO.sub.2R.sup.F1,
--SO.sub.2R.sup.F1, --C(.dbd.NR.sup.F3)OR.sup.F1,
--C(.dbd.NR.sup.F3)N(R.sup.F3).sub.2, --SO.sub.2N(R.sup.F3).sub.2,
--SO.sub.2R.sup.F3, --SO.sub.2OR.sup.F3, --S(.dbd.O)R.sup.F1,
--C(.dbd.S)N(R.sup.F3).sub.2, --C(.dbd.O)SR.sup.F3,
--C(.dbd.S)SR.sup.F3, --P(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --P(.dbd.O).sub.2N(R.sup.F3).sub.2,
--P(.dbd.O)(NR.sup.F3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.F2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and each R.sup.F3 is, independently,
selected from hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.F3 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; L is a covalent bond or a divalent
C.sub.1-10 hydrocarbon chain, wherein one, two or three methylene
units of L are optionally and independently replaced with one or
more --O--, --S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--,
--C(.dbd.O)--, --C(.dbd.S)--, --S(.dbd.O)--, --S(.dbd.O).sub.2--,
divalent C.sub.3-10 carbocyclyl, divalent 3-14 membered
heterocyclyl, divalent C.sub.6-14 aryl or divalent 5-14 membered
heteroaryl group; R.sup.D is selected from --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --C(.dbd.O)R.sup.B7,
--CO.sub.2H, --CHO, --C(OR.sup.B9).sub.2, --CO.sub.2R.sup.B7,
--OC(.dbd.O)R.sup.B7, --OCO.sub.2R.sup.B7,
--C(.dbd.O)N(R.sup.B8).sub.2, --OC(.dbd.O)N(R.sup.B8).sub.2,
NR.sup.B8C(.dbd.O)R.sup.B7, --NR.sup.B8CO.sub.2R.sup.B7,
--NR.sup.B8C(.dbd.O)N(R.sup.B8).sub.2, --C(NR.sup.B8)OR.sup.B7,
--OC(.dbd.NR.sup.B8)R.sup.B7, --OC(.dbd.NR.sup.B8)OR.sup.B7,
--C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--OC(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--NR.sup.B8C(.dbd.NR.sup.B8)N(R.sup.B8).sup.2,
--C(.dbd.O)NR.sup.B8SO.sub.2R.sup.B7, --NR.sup.B8SO.sub.2R.sup.B7,
--SO.sub.2N(R.sup.B8).sub.2, --SO.sub.2R.sup.B7,
--SO.sub.2OR.sup.B7, --OSO.sub.2R.sup.B7, --S(.dbd.O)R.sup.B7,
--OS(.dbd.O)R.sup.B7, --C(.dbd.S)N(R.sup.B8).sub.2,
--C(.dbd.O)SR.sup.B7, --C(.dbd.S)SR.sup.B7, --SC(.dbd.S)SR.sup.B7,
--P(.dbd.O).sub.2R.sup.B7, --OP(.dbd.O).sub.2R.sup.B7,
--P(.dbd.O)(R.sup.B7).sub.2, --OP(.dbd.O)(R.sup.B7).sub.2,
--OP(.dbd.O)(OR.sup.B9).sub.2, --P(.dbd.O).sub.2N(R.sup.B8).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B8).sub.2, --P(.dbd.O)(NR.sup.B8).sub.2,
--OP(.dbd.O)(NR.sup.B8).sub.2,
--NR.sup.B8P(.dbd.O)(OR.sup.B9).sub.2,
--NR.sup.B8P(.dbd.O)(NR.sup.B8).sub.2, --B(OR.sup.B9).sub.2, and
--BR.sup.B7(OR.sup.B9); each R.sup.B7 is, independently, selected
from C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; each R.sup.B8 is, independently, selected from
hydrogen, --OH, --OR.sup.B7, --N(R.sup.B9).sub.2, --CN,
--C(.dbd.O)R.sup.B7, --C(.dbd.O)N(R.sup.B9).sub.2,
--CO.sub.2R.sup.B7, --SO.sub.2R.sup.B7,
--C(.dbd.NR.sup.B9)OR.sup.B7, --C(.dbd.NR.sup.B9)N(R.sup.B9).sub.2,
--SO.sub.2N(R.sup.B9).sub.2, --SO.sub.2R.sup.B9,
--SO.sub.2OR.sup.B9, --SOR.sup.B7, --C(.dbd.S)N(R.sup.B9).sub.2,
--C(.dbd.O)SR.sup.B9, --C(.dbd.S)SR.sup.B9,
--P(.dbd.O).sub.2R.sup.B7, --P(.dbd.O)(R.sup.B7).sub.2,
--P(.dbd.O).sub.2N(R.sup.B9).sub.2, --P(.dbd.O)(NR.sup.B9).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B8 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring; and
each R.sup.B9 is, independently, selected from hydrogen, C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl, or two R.sup.B9 groups are joined to form a 3-14
membered heterocyclyl or 5-14 membered heteroaryl ring; R.sup.E is
selected from halogen, --OH, --OR.sup.B10, --ON(R.sup.B11).sub.2,
--N(R.sup.B11).sub.2, --N(OR.sup.B12)R.sup.B12, --SH, --SR.sup.B10,
--SSR.sup.B12, --OC(.dbd.O)R.sup.B10, --OCO.sub.2R.sup.B10,
OC(.dbd.O)N(R.sup.B11).sub.2, --NR.sup.B11C(.dbd.O)R.sup.B19,
--NR.sup.B11CO.sub.2R.sup.B10, NR.sup.B10,
--NR.sup.B11C(.dbd.O)N(R.sup.B11).sub.2,
--OC(.dbd.NR.sup.B11)R.sup.10, --OC(.dbd.NR.sup.B11OR.sup.B10,
--OC(.dbd.NR.sup.B11)N(R.sup.B11).sub.2,
--NR.sup.B11C(.dbd.NR.sup.B11)N(R.sup.B11).sub.2, --NR.sup.B11
SO.sub.2R.sup.B10, --OSO.sub.2R.sup.B10, --OS(.dbd.O)R.sup.B10,
--Si(R.sup.B10).sub.3, --OSi(R.sup.B10).sub.3, --SC(S)SR.sup.B10,
--OP(.dbd.O).sub.2R.sup.B10, --OP(.dbd.O)(R.sup.B10).sub.2,
--OP(.dbd.O)(OR.sup.B12).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B11).sub.2--OP(.dbd.O)(NR.sup.B11).sub.2NR.sup.-
B11P(.dbd.O)(OR.sup.B12).sub.2,
--NR.sup.B11P(.dbd.O)(NR.sup.B11).sub.2, --P(R.sup.B12).sub.2,
--P(R.sup.B12).sub.3, --OP(R.sup.B12).sub.2, --OP(R.sup.B12).sub.3,
3-14 membered heterocyclyl and 5-14 membered heteroaryl, wherein
the point of attachment of the 3-14 membered heterocyclyl or 5-14
membered heteroaryl group is on a nitrogen atom; each R.sup.B10 is,
independently, selected from C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl; each
R.sup.B11 is, independently, selected from hydrogen, --OH,
--OR.sup.B10, --N(R.sup.B12).sub.2, --CN, --C(.dbd.O)R.sup.B10,
--C(.dbd.O)N(R.sup.B12).sub.2, --CO.sub.2R.sup.B10,
--SO.sub.2R.sup.B10, --C(.dbd.NR.sup.B12)OR.sup.B10,
C(NR.sup.B12)N(R.sup.B12).sub.2, --SO.sub.2N(R.sup.B12).sub.2,
--SO.sub.2R.sup.B12, --SO.sub.2OR.sup.B12, SOR.sup.B10,
--C(.dbd.S)N(R.sup.B12).sub.2, --C(.dbd.O)SR.sup.B12,
--C(.dbd.S)SR.sup.B12, --P(.dbd.O).sub.2R.sup.B10,
--P(.dbd.O)(R.sup.B10).sub.2, --P(.dbd.O).sub.2N(R.sup.B12).sub.2,
--P(.dbd.O)(NR.sup.B12).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B11 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and each R.sup.B12 is,
independently, selected from hydrogen, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B12 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring.
14. The method of claim 13, wherein R.sup.47 and R.sup.49 are
joined to form a C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl or 5-14 membered heteroaryl ring.
15. The method of claim 14, wherein R.sup.47 and R.sup.49 are
joined to form a C.sub.3-10 carbocyclyl.
16. The method of claim 15, wherein Q is CR.sup.41R.sup.42.
17. The method of claim 16, wherein m is 1.
18. The method of claim 17, wherein each R.sup.41, R.sup.42,
R.sup.43, R.sup.44, R.sup.45, R.sup.46, R.sup.48, and R.sup.50 is
hydrogen; and R.sup.47 and R.sup.49 are joined to form a C.sub.3-10
carbocyclyl.
19. The method of claim 18, wherein R.sup.B and R.sup.C together
with the nitrogen (N) atom to which each is attached are joined to
form a group of the formula (xiv-a): ##STR00109##
20. The method of claim 1, wherein R.sup.B is C.sub.6-14 aryl or
5-14 membered heteroaryl.
21. The method of claim 20, wherein R.sup.B is C.sub.6-14 aryl.
22. The method of claim 21, wherein R.sup.B is phenyl.
23. The method of claim 22, wherein R.sup.B is unsubstituted
phenyl.
24. The method of claim 22, wherein R.sup.B is phenyl that is
substituted with L-R.sup.D: wherein: L is a covalent bond or a
divalent C.sub.1-10 hydrocarbon chain, wherein one, two or three
methylene units of L are optionally and independently replaced with
one or more --O--, --S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--,
--C(.dbd.O)--, --S(.dbd.O)--. --S(.dbd.O).sub.2--, divalent
C.sub.3-10 carbocyclyl, divalent 3-14 membered heterocyclyl,
divalent C.sub.6-14 aryl or divalent 5-14 membered heteroaryl
group; and R.sup.D is selected from --C(.dbd.O)R.sup.B7,
--CO.sub.2H, --CHO, and --CO.sub.2R.sup.B7; wherein R.sup.B7 is
selected from C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic,
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, and 5-14 membered heteroaryl.
25. The method of claim 24, wherein L is a covalent bond, and
R.sup.D is --CO.sub.2H.
26. The method of claim 1, wherein R.sup.C is an acyclic group.
27. The method of claim 26, wherein R.sup.C is C.sub.1-10
alkyl.
28. The method of claim 27, wherein R.sup.C is unsubstituted
C.sub.1-10 alkyl.
29. The method of claim 28, wherein R.sup.C is unsubstituted ethyl
or unsubstituted isopropyl.
30. The method of claim 1, wherein R.sup.B is C.sub.6-14 aryl or
5-14 membered heteroaryl; and R.sup.C is C.sub.1-10 alkyl.
31. The method of claim 30, wherein R.sup.B is C.sub.6-14 aryl; and
R.sup.C is C.sub.1-10 alkyl.
32. The method of claim 1, wherein: R.sup.A is C.sub.6-14 aryl;
R.sup.B and R.sup.C together with the nitrogen (N) atom to which
each is attached are joined to form a 5-14 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring; and X is selected from
hydrogen, --CN, --CHO, --C(.dbd.O)R.sup.C1,
--C(.dbd.O)N(R.sup.C2).sub.2, --CO.sub.2H, --CO.sub.2R.sup.C1,
--C(.dbd.NR.sup.C2)OR.sup.C1, --C(NR.sup.C2N(R.sup.C2).sub.2,
--C(.dbd.S)N(R.sup.C2).sub.2,
--C(.dbd.O)SR.sup.C1--C(.dbd.S)SR.sup.C1, C.sub.1-10 perhaloalkyl,
C.sub.6-14 aryl, and 5-14 membered heteroaryl.
33. The method of claim 32, wherein X is --CN.
34. The method of claim 1, wherein: R.sup.A is C.sub.6-14 aryl;
R.sup.B is C.sub.6-14 aryl or 5-14 membered heteroaryl; R.sup.C is
an acyclic group; and X is selected from hydrogen, --CN, --CHO,
--C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.C1, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2, --C(.dbd.S)N(R.sup.C2).sub.2,
--C(.dbd.O)SR.sup.C1, --C(.dbd.S)SR.sup.C1, C.sub.1-10
perhaloalkyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
35. The method of claim 34, wherein R.sup.B is C.sub.6-14 aryl and
R.sup.C is C.sub.1-10 alkyl.
36. The method according to claim 34, wherein X is --CN.
37-38. (canceled)
39. The method of claim 1, wherein the FASN-mediated disorder is a
microbial infection.
40. The method of claim 39, wherein the microbial infection is a
viral infection.
41. The method of claim 40, wherein the viral infection is an
infection with an enveloped virus or a picornavirus.
42. The method of claim 40, wherein the viral infection is selected
from HSV-1, HSV-2, VZV, EBV, CMV, HHV-6, HHV-8, HMCV, CVB3,
influenza type A, influenza type B, RSV, PIV, measles virus,
rhinovirus, adenovirus, HMPV, SARS virus, vaccinia virus, cowpox
virus, ectomelia virus, monkeypox virus, rabbitpox virus, HBV, HCV,
papillomavirus, BK virus, VEE virus, Rift Valley fever virus,
Tavaribe virus, Yellow fever virus, West Nile virus, dengue virus,
PTV or Pichinde virus.
43. The method of claim 42, wherein the viral infection is
infection with HCV or dengue virus.
44. The method of claim 39, which further comprises administration
of one or more additional anti-viral agents.
45. The method of claim 44, wherein the additional anti-viral agent
is an interferon, a protease inhibitor, an integrase inhibitor, a
reverse transciptase inhibitor, or a combination thereof.
46. The method of claim 44, wherein the additional anti-viral agent
is an interferon, ribavirin or a combination thereof.
47. The method of claim 46, wherein the interferon is interferon
type III, interferon type II, interferon type I, peginterferon
alfa-2a, peginterferon alfa-2b, standard interferon alfa-2a,
standard interferon alfa-2b, consensus interferon, interferon
alfacon-1, ALBUFERON, omega interferon, interferon gamma-1b,
lymphoblastoid interferon tau, or a combination thereof.
48. The method of claim 39, wherein the microbial infection is a
bacterial infection.
49. The method of claim 48, wherein the bacterial infection is
selected from Helicobacter pyloris, Borelia burgdorferi, Legionella
pneumophilia, Mycobacteria tuberculosis, M. avium, M.
intracellulare, M. kansaii, M. gordonae, Staphylococcus aureus,
Neisseria gonorrhoeae, Neisseria meningitidis, Listeria
monocytogenes, Streptococcus pyogenes, Streptococcus agalactiae,
Streptococcus viridans, Streptococcus faecalis, Streptococcus
bovis, Streptococcus pneumoniae, Haemophilus influenzae, Bacillus
antracis, corynebacterium diphtheriae, Erysipelothrix
rhusiopathiae, Clostridium perfringers, Clostridium tetani,
Enterobacter aerogenes, Klebsiella pneumoniae, Pasturella
multocida, Fusobacterium nucleatum, Streptobacillus moniliformis,
Treponema pallidium, Treponema pertenue, Leptospira, Rickettsia,
Actinotnyces israelli or a combination thereof.
50. The method of claim 49, wherein the bacterial infection is
Mycobacteria tuberculosis.
51. The method of claim 39, wherein the microbial infection is a
fungal infection.
52. The method of claim 51, wherein the fungal infection is an
infection with aspergilliosis, crytococcosis, sporotrichosis,
coccidioidomycosis, paracoccidioidomycosis, histoplasmosis,
blastomycosis, zygomycosis or candidiasis.
53. The method of claim 39, wherein the microbial infection is a
parasitic or protozoal infection.
54. The method of claim 53, wherein the parasitic or protozoal
infection is an infection with P. falcifarium, P. ovale, P. vivax,
P. malariae, L. donovari, L. inlantum, L. aethiopica, L. major, L.
tropica, L. mexicana, L. braziliensis, T. Gondii, B. microti, B.
divergens, B. coli, B. hominis, C. parvum, C. cayetanensis, D.
fragilis, E. histolytica, I. belli, S. mansonii, S. haematobium,
Trypanosoma ssp., Toxoplasma ssp., O. volvulus, Babesia bovis,
Babesia canis, Banesia Gibsoni, Besnoitia darlingi, Cytauxzoon
felis, Eimeria ssp., Hammondia ssp. T. canis, Cestoda, Theileria
ssp. or a combination thereof.
55. The method of claim 53, wherein the parasitic or protozoal
infection causes malaria, babesiosis, trypanosomiasis, American
trypanosomiasis, leishmaniasis, toxoplasmosis, meningoencephalitis,
keratitis, amebiasis, giardiasis, cryptosporidiosis, isosporiasis,
cyclosporiasis, microsporidiosis, ascariasis, trichuriasis,
ancylostomiasis, strongyloidiasis, toxocariasis, trichinosis,
lymphatic filariasis, onchocerciasis, filariasis schistosomiasis or
dermatitis caused by animal schistosomes.
56. The method of claim 55, wherein the parasitic or protozoal
infection causes malaria.
57. The method of claim 55, wherein the parasitic or protozoal
infection causes leishmaniasis, babesiosis, toxoplasmosis or
trypanosomiasis.
58. The method of claim 1, wherein the compound is: ##STR00110##
##STR00111## ##STR00112## ##STR00113## ##STR00114## ##STR00115## or
a pharmaceutically acceptable form thereof.
Description
[0001] This application claims priority to U.S. Provisional
Application No. 61/331,632, filed May 5, 2010, which is
incorporated herein by reference in its entirety.
[0002] A text file of sequence listing (SEQLIST 12928-032-999.TXT;
careated May 4, 2011; size 20,000 bytes) filed electronically is
incorporated herein by reference.
BACKGROUND
[0003] Fatty acid synthase (FASN) is a key enzyme for the synthesis
of long-chain fatty acids from acetyl-coenzyme A (CoA) and
malonyl-CoA that uses reduced nicotinamide adenine
dinucleotidephosphate as a cofactor. FASN is minimally expressed in
most normal human tissues except the liver and adipose tissue,
where it is expressed at high levels.
[0004] Since FASN expression is markedly increased in several human
cancers compared with the corresponding normal tissue, and FASN
overexpression in tumors has been associated with a poor prognosis,
FASN inhibitors have long been viewed as potential therapeutics for
the treatment of cancer. FASN inhibitors have also shown promise in
the treatment of other FASN-mediated diseases, disorders or
conditions, such as obesity, lack of appetite control and
inflammatory conditions.
[0005] Furthermore, FASN has been identified as a target for
treatment of microbial infections. In particular, it was reported
that fatty acid synthesis or the level of fatty acid is critical in
viral pathogenesis. For example, it was reported that the formation
of a novel vesicular compartment (i.e., remodelled golgi
apparatus), on the surface of which viral RNA replication takes
place, requires fatty acid biosynthesis. (See Chemy et al., PLoS
Pathogens, 2(10): e102 (2006)). In addition, fatty acid
biosynthesis has been identified as a target for anti-viral therapy
using a metabolic profiling of the hosts upon viral infection. (See
Munger et al., Nature Biotechnology, 26: 1179-1186 (2008). It was
also reported that inhibition of fatty acid biosynthesis (e.g.,
inhibition of fatty acid synthase) results in reduced replication
of human cytomegalomous virus (HCMV) and influenza A viruses.
(Id.).
[0006] Reports establishing FASN as a valid target for the
treatment of viral infections are available for various viruses.
For example, the role of FASN has been implicated in the
pathogenesis of an enveloped virus such as human cytomegalomous
virus (HCMV), influenza A and Heptatitis C(HCV). (See Munger et
al., Nature Biotechnology, 26: 1179-1186 (2008); Syed et al.,
Trends in Endocrinology and Metabolism, 21: 33-40 (2009); Sakamoto
et al., Nature Chemcial Biology, 1: 333-337 (2005); Yang et al.,
Hepatology, 48: 1396-1403 (2008)). With regard to HCV, it was
reported that an elevated level of fatty acid biosynthesis enzymes,
including FASN, contributes to liver steatosis, leading to
cirrhosis and hepatocellular carcinoma, upon HCV infection.
(Fukusawa et al., Biol. Pharm. Bull., 29(9): 1958-1961 (2006)). HCV
replication was reported to be regulated by, among others, fatty
acid biosynthesis. (Kapadia et al., Proc. Natl. Acad. Sci., 102(7):
2561-2566 (2005)). Other reports establishing FASN as a potential
host-target against HCV have also been published. (See, e.g.,
Hepatology, 48: 1396 (2008); Trends Endocrine Metabol., 21: 33
(2010); and Virology, 394: 130 (2009)).
[0007] With regard to other various viruses, it was reported that
the FASN expression is increased in the cells infected by
coxsackievirus B3 (CVB3), a picornavirus, and the replication of
CVB3 is blocked by FASN inhibitors. (See Rassmann et al., Antiviral
Research, 76: 150-158 (2007)). FASN was reported to be important in
lytic viral replication of Epstein-Barr virus (EBV), and it was
suggested that FASN inhibition can be a novel approach for blocking
the EBV replication. (Li et al., Journal of Virology, 78(8):
4197-4206 (2004)). The role of FASN in the replication of dengue
virus has also been implicated. (See, e.g., Heaton et al., Proc.
Natl. Acad. Sci., 107(40): 17345-17350 (2010); and Samsa et al.,
PLoS Pathegens, 5(10): e1000632 (2009)).
[0008] Moreover, aside from being a potential target for anti-viral
therapy, the role of FASN has also been implicated in diabetes or
regulation of the general wellness of the liver. (See, e.g., Wu et
al., PNAS Early Edition,
www.pnas.org/cgi/doi/10.1073/pnas.1002588108 (2011)). Thus, there
is a need for effective inhibitors of FASN, which can be
potentially used as therpies for microbial infections, including,
but not limited to viral infections, or other diseases and
disorders.
SUMMARY
[0009] For example, in one aspect, provided herein is a compound of
formula (I):
##STR00002##
or a pharmaceutically acceptable form thereof; wherein the
variables X, R.sup.A, R.sup.B and R.sup.C are defined below and
herein.
[0010] Also provided herein are pharmaceutical compositions
comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof. Also provided herein are
methods of treating cancer comprising administering at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition thereof, to a subject in
need thereof. Also provided herein are methods of treating
microbial infections comprising administering at least one compound
of formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition thereof, to a subject in need
thereof.
[0011] The details of additional or alternative embodiments are set
forth in the accompanying Detailed Description and Exemplification
as described below. Other features, objects, and advantages will be
apparent from this description and from the claims.
SEQUENCE IDENTIFICATION NUMBERS
[0012] SEQ ID NO. 1: Homo sapiens FASN amino acid sequence:
TABLE-US-00001
MEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDL
SRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGVWVGVSGSET
SEALSRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLMALQNAYQAI
HSGQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSEGVVAVLLT
KKSLARRVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGVAPESFEYIEAHG
TGTKVGDPQELNGITRALCATRQEPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLW
APNLHFHSPNPEIPALLDGRLQVVDQPLPVRGGNVGINSFGFGGSNVHIILRPNTQPPPAP
APHATLPRLLRASGRTPEAVQKLLEQGLRHSQDLAFLSMLNDIAAVPATAMPFRGYAVL
GGERGGPEVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFG
LKVSQLLLSTDESTFDDIVHSFVSLTAIQIGLIDLLSCMGLRPDGIVGHSLGEVACGYADG
CLSQEEAVLAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTV
TISGPQAPVFEFVEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQELKKVIREPKPRS
ARWLSTSIPEAQWHSSLARTSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQ
AVLKRGLKPSCTIIPLMKKDHRDNLEFFLAGIGRLHLSGIDANPNALFPPVEFPAPRGTPLI
SPLIKWDHSLAWDVPAAEDFPNGSGSPSAAIYNIDTSSESPDHYLVDHTLDGRVLFPATG
YLSIVWKTLARALGLGVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSEN
GNLVVSGKVYQWDDPDPRLFDHPESPTPNPTEPLFLAQAEVYKELRLRGYDYGPHFQGI
LEASLEGDSGRLLWKDNWVSFMDTMLQMSILGSAKHGLYLPTRVTAIHIDPATHRQKL
YTLQDKAQVADVVVSRWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEE
GCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLS
AACRLQLNGNLQLELAQVLAQERPKLPEDPLLSGLLDSPALKACLDTAVENMPSLKMK
VVEVLAGHGHLYSRIPGLLSPHPLLQLSYTATDRHPQALEAAQAELQQHDVAQGQWDP
ADPAPSALGSADLLVCNCAVAALGDPASALSNMVAALREGGFLLLHTLLRGHPLGDIV
AFLTSTEPQYGQGILSQDAWESLFSRVSLRLVGLKKSFYGSTLFLCRRPTPQDSPIFLPVD
DTSFRWVESLKGILADEDSSRPVWLKAINCATSGVVGLVNCLRREPGGNRLRCVLLSNL
SSTSHVPEVDPGSAELQKVLQGDLVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVST
LTRGDLSSIRWVCSSLRHAQPTCPGAQLCTVYYASLNFRDIMLATGKLSPDAIPGKWTS
QDSLLGMEFSGRDASGKRVMGLVPAKGLATSVLLSPDFLWDVPSNWTLEEAASVPVVY
STAYYALVVRGRVRPGETLLIHSGSGGVGQAAIAIALSLGCRVFTTVGSAEKRAYLQAR
FPQLDSTSFANSRDTSFEQHVLWHTGGKGVDLVLNSLAEEKLQASVRCLATHGRFLEIG
KFDLSQNHPLGMAIFLKNVTFHGVLLDAFFNESSADWREVWALVQAGIRDGVVRPLKC
TVFHGAQVEDAFRYMAQGKHIGKVVVQVLAEEPEAVLKGAKPKLMSAISKTFCPAHKS
YIIAGGLGGFGLELAQWLIQRGVQKLVLTSRSGIRTGYQAKQVRRWRRQGVQVQVSTS
NISSLEGARGLIAEAAQLGPVGGVFNLAVVLRDGLLENQTPEFFQDVCKPKYSGTLNLD
RVTREACPELDYFVVFSSVSCGRGNAGQSNYGFANSAMERICEKRRHEGLPGLAVQWG
AIGDVGILVETMSTNDTIVSGTLPQRMASCLEVLDLFLNQPHMVLSSFVLAEKAAAYRD
RDSQRDLVEAVAHILGIRDLAAVNLDSSLADLGLDSLMSVEVRQTLERELNLVLSVREV
RQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQ
SSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEG
PYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPG
CEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSF
AARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSV
HVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG
DEFINITIONS
[0013] Definitions of specific functional groups and chemical terms
are described in more detail below. The chemical elements are
identified in accordance with the Periodic Table of the Elements,
CAS version, Handbook of Chemistry and Physics, 75.sup.th Ed.,
inside cover, and specific functional groups are generally defined
as described therein. Additionally, general principles of organic
chemistry, as well as specific functional moieties and reactivity,
are described in Organic Chemistry, Thomas Sorrell, University
Science Books, Sausalito, 1999; Smith and March March's Advanced
Organic Chemistry, 5.sup.th Edition, John Wiley & Sons, Inc.,
New York, 2001; Larock, Comprehensive Organic Transformations, VCH
Publishers, Inc., New York, 1989; and Carruthers, Some Modern
Methods of Organic Synthesis, 3.sup.rd Edition, Cambridge
University Press, Cambridge, 1987.
[0014] Certain compounds provided herein can comprise one or more
asymmetric centers, and thus can exist in various isomeric forms,
e.g., enantiomers and/or diastereomers and/or stereoisomers. The
compounds provided herein can be in the form of an individual
enantiomer, diastereomer or geometric isomer, or can be in the form
of a mixture of stereoisomers, including racemic mixtures and
mixtures enriched in one or more stereoisomer. In certain
embodiments, the compounds provided herein are enantiopure
compounds. In certain other embodiments, mixtures of stereoisomers
are provided.
[0015] Furthermore, certain compounds, as described herein can have
one or more double bonds that can exist as either the cis or trans,
or the E or Z isomer, unless otherwise indicated. Also encompassed
are the compounds as individual isomers substantially free of other
isomers, and alternatively, as mixtures of various isomers, e.g.,
racemic mixtures of E/Z isomers or mixtures enriched in one E/Z
isomer.
[0016] The terms "optically enriched", "enantiomerically enriched,"
"enantiomerically pure" and "non-racemic," as used interchangeably
herein, refer to compositions in which the percent by weight of one
enantiomer is greater than the amount of that one enantiomer in a
control mixture of the racemic composition (e.g., greater than 1:1
by weight). In addition, the term "non-racemic" can apply more
broadly to mixtures of stereoisomers, diastereomers or olefin E/Z
isomers. For example, an enantiomerically enriched preparation of
the (S)-enantiomer, means a preparation of the compound having
greater than 50% by weight of the (S)-enantiomer relative to the
(R)-enantiomer, such as at least 75% by weight, and even such as at
least 80% by weight. In some embodiments, the enrichment can be
much greater than 80% by weight, providing a "substantially
optically enriched," "substantially enantiomerically enriched,"
"substantially enantiomerically pure" or a "substantially
non-racemic" preparation, which refers to preparations of
compositions which have at least 85% by weight of one enantiomer
relative to other enantiomer, such as at least 90% by weight, and
such as at least 95% by weight. In some embodiments, the
enantiomerically enriched composition has a higher potency with
respect to therapeutic utility per unit mass than does the racemic
mixture of that composition. Enantiomers can be isolated from
mixtures by methods known to those skilled in the art, including
chiral high pressure liquid chromatography (HPLC) and the formation
and crystallization of chiral salts; or enantiomers can be prepared
by asymmetric syntheses. See, for example, Jacques, et al.,
Enantiomers, Racemates and Resolutions (Wiley Interscience, New
York, 1981); Wilen, S. H., et al., Tetrahedron 33:2725 (1977);
Eliel, E. L. Stereochemistry of Carbon Compounds (McGraw-Hill, NY,
1962); and Wilen, S. H. Tables of Resolving Agents and Optical
Resolutions p. 268 (E. L. Eliel, Ed., Univ. of Notre Dame Press,
Notre Dame, Ind. 1972).
[0017] As used herein, alone or as part of another group, "halo"
and "halogen" refer to fluorine (fluoro, --F), chlorine (chloro,
--Cl), bromine (bromo, --Br), or iodine (iodo, --I).
[0018] As used herein, alone or as part of another group, "alkyl"
refers to a monoradical of a straight-chain or branched saturated
hydrocarbon group having from 1 to 10 carbon atoms ("C.sub.1-10
alkyl"). In some embodiments, an alkyl group has 1 to 9 carbon
atoms ("C.sub.1-9 alkyl"). In some embodiments, an alkyl group has
1 to 8 carbon atoms ("C.sub.1-8 alkyl"). In some embodiments, an
alkyl group has 1 to 7 carbon atoms ("C.sub.1-7 alkyl"). In some
embodiments, an alkyl group has 1 to 6 carbon atoms ("C.sub.1-6
alkyl"). In some embodiments, an alkyl group has 1 to 5 carbon
atoms ("C.sub.1-5 alkyl"). In some embodiments, an alkyl group has
1 to 4 carbon atoms ("C.sub.1-4 alkyl"). In some embodiments, an
alkyl group has 1 to 3 carbon atoms ("C.sub.1-3 alkyl"). In some
embodiments, an alkyl group has 1 to 2 carbon atoms ("C.sub.1-2
alkyl"). In some embodiments, an alkyl group has 1 carbon atom
("C.sub.1 alkyl"). In some embodiments, an alkyl group has 2 to 6
carbon atoms ("C.sub.2-6 alkyl"). Examples of C.sub.1-6 alkyl
groups include methyl (C.sub.1), ethyl (C.sub.2), n-propyl
(C.sub.3), isopropyl (C.sub.3), n-butyl (C.sub.4), tert-butyl
(C.sub.4), sec-butyl (C.sub.4), iso-butyl (C.sub.4), n-pentyl
(C.sub.5), 3-pentanyl (C.sub.5), amyl (C.sub.5), neopentyl
(C.sub.5), 3-methyl-2-butanyl (C.sub.5), tertiary amyl (C.sub.5),
and n-hexyl (C.sub.6). Additional examples of alkyl groups include
n-heptyl (C.sub.7), n-octyl (C.sub.8) and the like. Unless
otherwise specified, each alkyl group is independently
unsubstituted (an "unsubstituted alkyl") or substituted (a
"substituted alkyl") with 1, 2, 3, 4, or 5 substituents as
described herein. In certain embodiments, the alkyl group is an
unsubstituted C.sub.1-10alkyl (e.g., --CH.sub.3). In certain
embodiments, the alkyl group is a substituted C.sub.1-10 alkyl.
[0019] When a range of values is listed, it is intended to
encompass each value and sub-range within the range. For example
"C.sub.1-6 alkyl" is intended to encompass, C.sub.1, C.sub.2,
C.sub.3, C.sub.4, C.sub.5, C.sub.6, C.sub.1-6, C.sub.1-5,
C.sub.1-4, C.sub.1-3, C.sub.1-2, C.sub.2-6, C.sub.2-5, C.sub.2-4,
C.sub.2-3, C.sub.3-6, C.sub.3-5, C.sub.3-4, C.sub.4-6, C.sub.4-5,
and C.sub.5-6 alkyl.
[0020] "Perhaloalkyl" as defined herein refers to an alkyl group
having from 1 to 10 carbon atoms wherein all of the hydrogen atoms
are each independently replaced by a halogen, e.g., selected from
fluoro, bromo, chloro or iodo ("C.sub.1-10 perhaloalkyl"). In some
embodiments, the alkyl moiety has 1 to 9 carbon atoms ("C.sub.1-9
perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 8
carbon atoms ("C.sub.1-8 perhaloalkyl"). In some embodiments, the
alkyl moiety has 1 to 7 carbon atoms ("C.sub.1-7 perhaloalkyl"). In
some embodiments, the alkyl moiety has 1 to 6 carbon atoms
("C.sub.1s perhaloalkyl"). In some embodiments, the alkyl moiety
has 1 to 5 carbon atoms ("C.sub.1-5 perhaloalkyl"). In some
embodiments, the alkyl moiety has 1 to 4 carbon atoms ("C.sub.1-4
perhaloalkyl"). In some embodiments, the alkyl moiety has 1 to 3
carbon atoms ("C.sub.1-3 perhaloalkyl"). In some embodiments, the
alkyl moiety has 1 to 2 carbon atoms ("C.sub.1-2 perhaloalkyl"). In
some embodiments, all of the hydrogen atoms are each replaced with
fluoro. In some embodiments, all of the hydrogen atoms are each
replaced with chloro. Examples of perhaloalkyl groups include
--CF.sub.3, --CF.sub.2CF.sub.3, --CF.sub.2CF.sub.2CF.sub.3,
--CCl.sub.3, --CFCl.sub.2, --CF.sub.2Cl and the like.
[0021] As used herein, alone or as part of another group, "alkenyl"
refers to a monoradical of a straight-chain or branched hydrocarbon
group having from 2 to 10 carbon atoms and one or more
carbon-carbon double bonds ("C.sub.2-10 alkenyl"). In some
embodiments, an alkenyl group has 2 to 9 carbon atoms ("C.sub.2-9
alkenyl"). In some embodiments, an alkenyl group has 2 to 8 carbon
atoms ("C.sub.2-8 alkenyl"). In some embodiments, an alkenyl group
has 2 to 7 carbon atoms ("C.sub.2-7 alkenyl"). In some embodiments,
an alkenyl group has 2 to 6 carbon atoms ("C.sub.2-6 alkenyl"). In
some embodiments, an alkenyl group has 2 to 5 carbon atoms
("C.sub.2-5 alkenyl"). In some embodiments, an alkenyl group has 2
to 4 carbon atoms ("C.sub.2-4 alkenyl"). In some embodiments, an
alkenyl group has 2 to 3 carbon atoms ("C.sub.2-3 alkenyl"). In
some embodiments, an alkenyl group has 2 carbon atoms ("C.sub.2
alkenyl"). The one or more carbon-carbon double bonds can be
internal (such as in 2-butenyl) or terminal (such as in 1-butenyl).
Examples of C.sub.2-4 alkenyl groups include ethenyl (C.sub.2),
1-propenyl (C.sub.3), 2-propenyl (C.sub.3), 1-butenyl (C.sub.4),
2-butenyl (C.sub.4), butadienyl (C.sub.4) and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkenyl groups as well as pentenyl (C.sub.5), pentadienyl
(C.sub.5), hexenyl (C.sub.6) and the like. Additional examples of
alkenyl include heptenyl (C.sub.7), octenyl (C.sub.8), octatrienyl
(C.sub.8) and the like. Unless otherwise specified, each alkenyl
group is independently unsubstituted (an "unsubstituted alkenyl")
or substituted (a "substituted alkenyl") with 1, 2, 3, 4, or 5
substituents as described herein. In certain embodiments, the
alkenyl group is an unsubstituted C.sub.2-10 alkenyl. In certain
embodiments, the alkenyl group is a substituted C.sub.2-10
alkenyl.
[0022] As used herein, alone or as part of another group, "alkynyl"
refers to a monoradical of a straight-chain or branched hydrocarbon
group having from 2 to 10 carbon atoms and one or more
carbon-carbon triple bonds ("C.sub.2-10 alkynyl"). In some
embodiments, an alkynyl group has 2 to 9 carbon atoms ("C.sub.2-9
alkynyl"). In some embodiments, an alkynyl group has 2 to 8 carbon
atoms ("C.sub.2-8 alkynyl"). In some embodiments, an alkynyl group
has 2 to 7 carbon atoms ("C.sub.2-7 alkynyl"). In some embodiments,
an alkynyl group has 2 to 6 carbon atoms ("C.sub.2-6 alkynyl"). In
some embodiments, an alkynyl group has 2 to 5 carbon atoms
("C.sub.2-5 alkynyl"). In some embodiments, an alkynyl group has 2
to 4 carbon atoms ("C.sub.2-4 alkynyl"). In some embodiments, an
alkynyl group has 2 to 3 carbon atoms ("C.sub.2-3 alkynyl"). In
some embodiments, an alkynyl group has 2 carbon atoms ("C.sub.2
alkynyl"). The one or more carbon-carbon triple bonds can be
internal (such as in 2-butynyl) or terminal (such as in 1-butynyl).
Examples of C.sub.2-4 alkynyl groups include, without limitation,
ethynyl (C.sub.2), 1-propynyl (C.sub.3), 2-propynyl (C.sub.3),
1-butynyl (C.sub.4), 2-butynyl (C.sub.4) and the like. Examples of
C.sub.2-6 alkenyl groups include the aforementioned C.sub.2-4
alkynyl groups as well as pentynyl (C.sub.5), hexynyl (C.sub.6) and
the like. Additional examples of alkynyl include heptynyl
(C.sub.7), octynyl (C.sub.8) and the like. Unless otherwise
specified, each alkynyl group is independently unsubstituted (an
"unsubstituted alkynyl") or substituted (a "substituted alkynyl")
with 1, 2, 3, 4, or 5 substituents as described herein. In certain
embodiments, the alkynyl group is an unsubstituted C.sub.2-10
alkynyl. In certain embodiments, the alkynyl group is a substituted
C.sub.2-10 alkynyl.
[0023] As used herein, alone or as part of another group,
"heteroaliphatic" refers to a monoradical of an acyclic 3- to
14-membered straight-chain or branched-chain having from 2 to 13
carbon atoms and 1 to 4 heteroatoms selected from oxygen, sulfur,
phosphorous, and nitrogen, and wherein the point of attachment is a
carbon atom ("3-14 membered heteroaliphatic"). In some embodiments,
"heteroaliphatic" is a saturated group ("heteroalkyl"). In some
embodiments, "heteroaliphatic" is a group containing one or more
double bonds ("heteroalkenyl"). In some embodiments,
"heteroaliphatic" is a group containing one or more triple bonds
("heteroalkynyl"). Exemplary heteroaliphatic groups include,
without limitation, ethers such as methoxyethanyl
(--CH.sub.2CH.sub.2OCH.sub.3), ethoxymethanyl
(--CH.sub.2OCH.sub.2CH.sub.3), (methoxymethoxy)ethanyl
(--CH.sub.2CH.sub.2OCH.sub.2OCH.sub.3), (methoxymethoxy)methanyl
(--CH.sub.2OCH.sub.2OCH.sub.3) and (methoxyethoxy)methanyl
(--CH.sub.2OCH.sub.2 CH.sub.2OCH.sub.3) and the like; amines such
as --CH.sub.2CH.sub.2NHCH.sub.3,
--CH.sub.2CH.sub.2N(CH.sub.3).sub.2, --CH.sub.2NHCH.sub.2CH.sub.3,
--CH.sub.2N(CH.sub.2CH.sub.3)(CH.sub.3) and the like. Unless
otherwise specified, each heteroaliphatic group is independently
unsubstituted (an "unsubstituted heteroaliphatic") or substituted
(a "substituted heteroaliphatic") with 1-5 substituents as
described herein. In certain embodiments, the heteroaliphatic group
is an unsubstituted 3-14 membered heteroaliphatic. In certain
embodiments, the heteroaliphatic group is a substituted 3-14
membered heteroaliphatic.
[0024] As used herein, alone or as part of another group,
"carbocyclyl" refers to a radical of a non-aromatic cyclic
hydrocarbon group having from 3 to 10 ring carbon atoms
("C.sub.3-10 carbocyclyl") and zero heteroatoms in the non-aromatic
ring system. In some embodiments, a carbocyclyl group has 3 to 9
ring carbon atoms ("C.sub.3-9 carbocyclyl"). In some embodiments, a
carbocyclyl group has 3 to 8 ring carbon atoms ("C.sub.3-8
carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 7
ring carbon atoms ("C.sub.3-7 carbocyclyl"). In some embodiments, a
carbocyclyl group has 3 to 6 ring carbon atoms ("C.sub.3-6
carbocyclyl"). In some embodiments, a carbocyclyl group has 3 to 5
ring carbon atoms ("C.sub.3-5 carbocyclyl"). In some embodiments, a
carbocyclyl group has 3 to 4 ring carbon atoms ("C.sub.3-4
carbocyclyl"). In some embodiments, a carbocyclyl group has 5 to 10
ring carbon atoms ("C.sub.5-10 carbocyclyl"). Examples of C.sub.3-6
carbocyclyl groups include, without limitation, cyclopropyl
(C.sub.3), cyclobutyl (C.sub.4), cyclopentyl (C.sub.5),
cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl
(C.sub.6), cyclohexadienyl (C.sub.6) and the like. Examples of
C.sub.3-8 carbocyclyl groups include the aforementioned C.sub.3-6
carbocyclyl groups as well as cycloheptyl (C.sub.7),
cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7), cyclooctyl
(C.sub.8), bicyclo[2.2.1]heptanyl, bicyclo[2.2.2]octanyl, and the
like. Examples of C.sub.3-10 carbocyclyl groups include the
aforementioned C.sub.3-8 carbocyclyl groups as well as
octahydro-1H-indenyl, decahydronaphthalenyl, spiro[4.5]decanyl and
the like. As the foregoing examples illustrate, in certain
embodiments, the carbocyclyl group is either monocyclic
("monocyclic carbocyclyl") or polycyclic (e.g., containing a fused,
bridged or spiro ring system such as a bicyclic system ("bicyclic
carbocyclyl") or tricyclic system ("tricyclic carbocyclyl")) and
can be saturated or can contain one or more carbon-carbon double or
triple bonds. "Carbocyclyl" also includes ring systems wherein the
carbocyclyl ring, as defined above, is fused with one or more aryl
or heteroaryl groups wherein the point of attachment is on the
carbocyclyl ring. Unless otherwise specified, each carbocyclyl
group is independently unsubstituted (an "unsubstituted
carbocyclyl") or substituted (a "substituted carbocyclyl") with 1,
2, 3, 4, or 5 substituents as described herein. In certain
embodiments, the carbocyclyl group is an unsubstituted C.sub.3-10
carbocyclyl. In certain embodiments, the carbocyclyl group is a
substituted C.sub.3-10 carbocyclyl.
[0025] In some embodiments, "carbocyclyl" is a monocyclic,
saturated carbocyclyl group having from 3 to 10 ring carbon atoms
("C.sub.3-10 cycloalkyl"). In some embodiments, a cycloalkyl group
has 3 to 8 ring carbon atoms ("C.sub.3-8 cycloalkyl"). In some
embodiments, a cycloalkyl group has 3 to 6 ring carbon atoms
("C.sub.3-6 cycloalkyl"). In some embodiments, a cycloalkyl group
has 5 to 6 ring carbon atoms ("C.sub.5-6 cycloalkyl"). In some
embodiments, a cycloalkyl group has 5 to 10 ring carbon atoms
("C.sub.5-10 cycloalkyl"). Examples of C.sub.5-6 cycloalkyl groups
include cyclopentyl (C.sub.5) and cyclohexyl (C.sub.5). Examples of
C.sub.3-6 cycloalkyl groups include the aforementioned C.sub.5-6
cycloalkyl groups as well as cyclopropyl (C.sub.3) and cyclobutyl
(C.sub.4). Examples of C.sub.3-8 cycloalkyl groups include the
aforementioned C.sub.3-6 cycloalkyl groups as well as cycloheptyl
(C.sub.7) and cyclooctyl (C.sub.8). Unless otherwise specified,
each cycloalkyl group is independently unsubstituted (an
"unsubstituted cycloalkyl") or substituted (a "substituted
cycloalkyl") with 1, 2, 3, 4, or 5 substituents as described
herein. In certain embodiments, the cycloalkyl group is an
unsubstituted C.sub.3-10 cycloalkyl. In certain embodiments, the
cycloalkyl group is a substituted C.sub.3-10 cycloalkyl.
[0026] As used herein, alone or as part of another group,
"heterocyclyl" refers to a radical of a 3- to 14-membered
non-aromatic ring system having ring carbon atoms and 1 to 4 ring
heteroatoms, wherein each heteroatom is independently selected from
nitrogen, oxygen, phosphorous, and sulfur ("3-14 membered
heterocyclyl"). In heterocyclyl groups that contain one or more
nitrogen or phosphorous atoms, the point of attachment can be a
carbon, nitrogen, or phosphorous atom, as valency permits. A
heterocyclyl group can either be monocyclic ("monocyclic
heterocyclyl") or polycyclic (e.g., a fused, bridged or spiro ring
system such as a bicyclic system ("bicyclic heterocyclyl") or
tricyclic system ("tricyclic heterocyclyl")), and can be saturated
or can contain one or more carbon-carbon double or triple bonds.
Heterocyclyl polycyclic ring systems can include one or more
heteroatoms in one or both rings. "Heterocyclyl" also includes ring
systems wherein the heterocycyl ring, as defined above, is fused
with one or more carbocycyl groups wherein the point of attachment
is either on the carbocycyl or heterocyclyl ring, or ring systems
wherein the heterocyclyl ring, as defined above, is fused with one
or more aryl or heteroaryl groups, wherein the point of attachment
is on the heterocyclyl ring. In some embodiments, a heterocyclyl
group is a 5-10 membered non-aromatic ring system having ring
carbon atoms and 1-4 ring heteroatoms, wherein each heteroatom is
independently selected from nitrogen, oxygen, phosphorous, and
sulfur ("5-10 membered heterocyclyl"). In some embodiments, a
heterocyclyl group is a 5-8 membered non-aromatic ring system
having ring carbon atoms and 1-4 ring heteroatoms, wherein each
heteroatom is independently selected from nitrogen, oxygen,
phosphorous, and sulfur ("5-8 membered heterocyclyl"). In some
embodiments, a heterocyclyl group is a 5-6 membered non-aromatic
ring system having ring carbon atoms and 1-4 ring heteroatoms,
wherein each heteroatom is independently selected from nitrogen,
oxygen, phosphorous, and sulfur ("5-6 membered heterocyclyl"). In
some embodiments, the 5-6 membered heterocyclyl has 1-3 ring
heteroatoms selected from nitrogen, oxygen, phosphorous, and
sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1-2
ring heteroatoms selected from nitrogen, oxygen, phosphorous, and
sulfur. In some embodiments, the 5-6 membered heterocyclyl has 1
ring heteroatom selected from nitrogen, oxygen, phosphorous, and
sulfur. Exemplary 3-membered heterocyclyls containing 1 heteroatom
include, without limitation, azirdinyl, oxiranyl, and thiorenyl.
Exemplary 4-membered heterocyclyls containing 1 heteroatom include,
without limitation, azetidinyl, oxetanyl and thietanyl. Exemplary
5-membered heterocyclyls containing heteroatom include, without
limitation, tetrahydrofuranyl, dihydrofuranyl,
tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl,
dihydropyrrolyl and pyrrolyl-2,5-dione. Exemplary 5-membered
heterocyclyls containing 2 heteroatoms include, without limitation,
dioxolanyl, oxathiolanyl and dithiolanyl. Exemplary 5-membered
heterocyclyls containing 3 heteroatoms include, without limitation,
triazolinyl, oxadiazolinyl, and thiadiazolinyl. Exemplary
6-membered heterocyclyl groups containing 1 heteroatom include,
without limitation, piperidinyl, tetrahydropyranyl,
dihydropyridinyl, and thianyl. Exemplary 6-membered heterocyclyl
groups containing 2 heteroatoms include, without limitation,
piperazinyl, morpholinyl, dithianyl, and dioxanyl. Exemplary
6-membered heterocyclyl groups containing 2 heteroatoms include,
without limitation, triazinanyl. Exemplary 7-membered heterocyclyl
groups containing 1 heteroatom include, without limitation,
azepanyl, oxepanyl and thiepanyl. Exemplary 8-membered heterocyclyl
groups containing 1 heteroatom include, without limitation,
azocanyl, oxecanyl and thiocanyl. Exemplary bicyclic heterocyclyl
groups include, without limitation, indolinyl, isoindolinyl,
dihydrobenzofuranyl, dihydrobenzothienyl, tetra-hydrobenzothienyl,
tetrahydrobenzofuranyl, tetrahydroindolyl, tetrahydroquinolinyl,
tetrahydroisoquinolinyl, decahydroquinolinyl,
decahydroisoquinolinyl, octahydrochromenyl, octahydroisochromenyl,
decahydronaphthyridinyl, decahydro-1,8-naphthyridinyl,
octahydropyrrolo[3,2-b]pyrrole, indolinyl, phthalimidyl,
naphthalimidyl, chromanyl, chromenyl, 1H-benzo[e][1,4]diazepinyl,
1,4,5,7-tetrahydropyrano[3,4-b]pyrrolyl,
5,6-dihydro-4H-furo[3,2-b]pyrrolyl,
6,7-dihydro-5H-furo[3,2-b]pyranyl,
5,7-dihydro-4H-thieno[2,3-c]pyranyl,
2,3-dihydro-1H-pyrrolo[2,3-b]pyridinyl,
2,3-dihydrofuro[2,3-b]pyridinyl,
4,5,6,7-tetrahydro-1H-pyrrolo[2,3-b]pyridinyl,
4,5,6,7-tetrahydrofuro[3,2-c]pyridinyl,
4,5,6,7-tetrahydrothieno[3,2-b]pyridinyl,
1,2,3,4-tetrahydro-1,6-naphthyridinyl, and the like. Unless
otherwise specified, each heterocyclyl is independently
unsubstituted (an "unsubstituted heterocyclyl") or substituted (a
"substituted heterocyclyl") with 1, 2, 3, 4, or 5 substituents as
described herein. In certain embodiments, the heterocyclyl group is
an unsubstituted 3-14 membered heterocyclyl. In certain
embodiments, the heterocyclyl group is a substituted 3-14 membered
heterocyclyl.
[0027] As used herein, alone or as part of another group, "aryl"
refers to a radical of a monocyclic or polycyclic (e.g., bicyclic
or tricyclic) aromatic ring system (e.g., having 6, 10 or 14 .pi.
electrons shared in a cyclic array) having 6-14 ring carbon atoms
and zero heteroatoms provided in the aromatic ring system
("C.sub.6-14 aryl"). In some embodiments, an aryl group has 6 ring
carbon atoms ("C.sub.6 aryl"; e.g., phenyl). In some embodiments,
an aryl group has 10 ring carbon atoms ("C.sub.10 aryl"; e.g.,
naphthyl, such as 1-naphthyl and 2-naphthyl). In some embodiments,
an aryl group has 14 ring carbon atoms ("C.sub.14 aryl"; e.g.,
anthracyl). "Aryl" also includes ring systems wherein the aryl
ring, as defined above, is fused with one or more carbocyclyl or
heterocyclyl groups wherein the radical or point of attachment is
on the aryl ring. Unless otherwise specified, each aryl group is
independently unsubstituted (an "unsubstituted aryl") or
substituted (a "substituted aryl") with 1, 2, 3, 4, or 5
substituents as described herein. In certain embodiments, the aryl
group is an unsubstituted C.sub.6-14 aryl. In certain embodiments,
the aryl group is a substituted C.sub.6-14 aryl.
[0028] As used herein, alone or part of another group, "aralkyl"
refers to a C.sub.1-10 alkyl group as defined herein substituted by
a C.sub.6-14 aryl group as defined herein, wherein the point of
attachment is on the alkyl group ("C.sub.1-10 aralkyl").
[0029] As used herein, alone or as part of another group,
"heteroaryl" refers to a radical of a 5-14 membered monocyclic or
polycyclic (e.g., bicyclic or tricyclic) aromatic ring system
(e.g., having 6, 10 or 14 .pi. electrons shared in a cyclic array)
having ring carbon atoms and 1-4 ring heteroatoms provided in the
aromatic ring system, wherein each heteroatom is independently
selected from nitrogen, oxygen, phosphorous, and sulfur ("5-14
membered heteroaryl"). In heteroaryl groups that contain one or
more nitrogen or phosphorous atoms, the point of attachment can be
a carbon, phosphorous or nitrogen atom, as valency permits.
Heteroaryl polycyclic ring systems can include one or more
heteroatoms in one or both rings. "Heteroaryl" also includes ring
systems wherein the heteroaryl ring, as defined above, is fused
with one or more aryl groups wherein the point of attachment is
either on the aryl or on the heteroaryl ring, or wherein the
heteroaryl ring, as defined above, is fused with one or more
carbocycyl or heterocycyl groups wherein the point of attachment is
on the heteroaryl ring. For polycyclic heteroaryl groups wherein
one ring does not contain a heteroatom (e.g., indolyl, quinolinyl,
carbazolyl and the like) the point of attachment can be on either
ring, i.e., either the ring bearing a heteroatom (e.g., 2-indolyl)
or the ring that does not contain a heteroatom (e.g., 5-indolyl).
In some embodiments, a heteroaryl group is a 5-10 membered aromatic
ring system having ring carbon atoms and 1-4 ring heteroatoms
provided in the aromatic ring system, wherein each heteroatom is
independently selected from nitrogen, oxygen, phosphorous, and
sulfur ("5-10 membered heteroaryl"). In some embodiments, a
heteroaryl group is a 5-8 membered aromatic ring system having ring
carbon atoms and 1-4 ring heteroatoms provided in the aromatic ring
system, wherein each heteroatom is independently selected from
nitrogen, oxygen, phosphorous, and sulfur ("5-8 membered
heteroaryl"). In some embodiments, a heteroaryl group is a 5-6
membered aromatic ring system having ring carbon atoms and 1-4 ring
heteroatoms provided in the aromatic ring system, wherein each
heteroatom is independently selected from nitrogen, oxygen,
phosphorous, and sulfur ("5-6 membered heteroaryl"). In some
embodiments, the 5-6 membered heteroaryl has 1-3 ring heteroatoms
selected from nitrogen, oxygen, phosphorous, and sulfur. In some
embodiments, the 5-6 membered heteroaryl has 1-2 ring heteroatoms
selected from nitrogen, oxygen, phosphorous, and sulfur. In some
embodiments, the 5-6 membered heteroaryl has 1 ring heteroatom
selected from nitrogen, oxygen, phosphorous, and sulfur. Exemplary
5-membered heteroaryls containing 1 heteroatom include, without
limitation, pyrrolyl, furanyl and thiophenyl. Exemplary 5-membered
heteroaryls containing 2 heteroatoms include, without limitation,
imidazolyl, pyrazolyl, oxazolyl, isoxazolyl, thiazolyl, and
isothiazolyl. Exemplary 5-membered heteroaryls containing 3
heteroatoms include, without limitation, triazolyl, oxadiazolyl,
and thiadiazolyl. Exemplary 5-membered heteroaryls containing 4
heteroatoms include, without limitation, tetrazolyl. Exemplary
6-membered heteroaryls containing 1 heteroatom include, without
limitation, pyridinyl. Exemplary 6-membered heteroaryls containing
2 heteroatoms include, without limitation, pyridazinyl, pyrimidinyl
and pyrazinyl. Exemplary 6-membered heteroaryls containing 3 or 4
heteroatoms include, without limitation, triazinyl and tetrazinyl,
respectively. Exemplary 7 membered heteroaryls containing 1
heteroatom include, without limitation, azepinyl, oxepinyl and
thiepinyl. Exemplary 5,6-bicyclic heteroaryls include, without
limitation, indolyl, isoindolyl, indazolyl, benzotriazolyl,
benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl,
benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl,
benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and
purinyl. Exemplary 6,6-bicyclic heteroaryls include, without
limitation, naphthyridinyl, pteridinyl, quinolinyl, isoquinolinyl,
cinnolinyl, quinoxalinyl, phthalazinyl and quinazolinyl. Exemplary
tricyclic heteroaryls include, without limitation, phenanthridinyl,
dibenzofuranyl, carbazolyl, acridinyl, phenothiazinyl, phenoxazinyl
and phenazinyl. Unless otherwise specified, each heteroaryl group
is independently unsubstituted (an "unsubstituted heteroaryl") or
substituted (a "substituted heteroaryl") with 1, 2, 3, 4, or 5
substituents as described herein. In certain embodiments, the
heteroaryl group is an unsubstituted 5-14 membered heteroaryl. In
certain embodiments, the heteroaryl group is a substituted 5-14
membered heteroaryl.
[0030] As used herein, alone or part of another group,
"heteroaralkyl" refers to a C.sub.1-10 alkyl group as defined
herein substituted by a 5-14 membered heteroaryl group as defined
herein, wherein the point of attachment is on the alkyl group
("C.sub.1-10 heteroaralkyl").
[0031] As used herein, a "covalent bond" or "direct bond" refers to
a single bond joining two groups.
[0032] As used herein, the term "partially unsaturated" refers to a
ring moiety that includes at least one double or triple bond. The
term "partially unsaturated" is intended to encompass rings having
multiple sites of unsaturation, but is not intended to include aryl
or heteroaryl moieties, as herein defined.
[0033] As used herein a "divalent" group, such as a divalent alkyl,
divalent alkenyl, divalent alkynyl, divalent heteroaliphatic,
divalent carbocyclyl, divalent heterocyclyl, divalent aryl or
divalent heteroaryl group, refers to a bis-radical of the group, as
defined herein.
[0034] Monovalent or divalent alkyl, alkenyl, alkynyl,
heteroaliphatic, carbocyclyl, heterocyclyl, aryl and heteroaryl
groups, as defined herein, are either "substituted" or
"unsubstituted" alkyl, "substituted" or "unsubstituted" alkenyl,
"substituted" or "unsubstituted" alkynyl, "substituted" or
"unsubstituted" heteroaliphatic, "substituted" or "unsubstituted"
carbocyclyl, "substituted" or "unsubstituted" heterocyclyl,
"substituted" or "unsubstituted" aryl or "substituted" or
"unsubstituted" heteroaryl groups. In general, the term
"substituted" means that at least one hydrogen present on a group
(e.g., a carbon or nitrogen atom, etc.) is replaced with a
permissible substituent, e.g., a substituent which upon
substitution results in a stable compound, e.g., a compound which
does not spontaneously undergo transformation such as by
rearrangement, cyclization, elimination, or other reaction. Unless
otherwise indicated, a "substituted" group can have a substituent
at one or more substitutable positions of the group, and when more
than one position in any given structure is substituted, the
substituent is either the same or different at each position. A
group referred to as "not hydrogen" indicates that the group is an
exemplary and permissible substituent as described herein.
[0035] Exemplary substituents include, but are not limited to,
halogen (i.e., fluoro (--F), bromo (--Br), chloro (--Cl), and iodo
(--I)), --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H,
--OH, --OR.sup.aa, --ON(R.sup.bb).sub.2, --N(R.sup.bb).sub.2,
--N(OR.sub.cc)R.sup.bb, --SH, --SR.sup.aa, --SSR.sub.cc,
--C(.dbd.O)R.sub.aa, --CO.sub.2H, --CHO, --C(OR.sup.cc).sub.2,
--CO.sub.2R.sup.aa, --OC(.dbd.O)R.sup.aa, --OCO.sub.2R.sup.aa,
--C(.dbd.O)N(R.sup.bb).sub.2, --OC(.dbd.O)N(R.sup.bb).sub.2,
--NR.sup.bbC(.dbd.O)R.sup.aa, --NR.sup.bbCO.sub.2R.sup.aa,
--NR.sup.bbC(.dbd.O)N(R.sup.bb).sub.2,
--C(.dbd.NR.sup.bb)OR.sup.aa, --OC(.dbd.NR.sup.bb)R.sup.aa,
--OC(.dbd.NR.sup.bb)OR.sup.aa,
--C(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--OC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--NR.sup.bbC(.dbd.NR.sup.bb)N(R.sup.bb).sub.2,
--C(.dbd.O)NR.sup.bbSO.sub.2R.sup.aa, --NR.sup.bbSO.sub.2R.sup.aa,
--SO.sub.2N(R.sup.bb).sub.2, --SO.sub.2R.sup.aa,
--SO.sub.2OR.sup.aa, --OSO.sub.2R.sup.aa, --S(.dbd.O)R.sup.aa,
--OS(.dbd.O)R.sup.aa, --Si(R.sup.aa).sub.3,
--OSi(R.sup.aa).sub.3--C(.dbd.S)N(R.sup.bb).sub.2,
--C(.dbd.O)SR.sup.aa, --C(.dbd.S)SR.sup.aa, --SC(S)SR.sup.aa,
--P(.dbd.O).sub.2R.sup.aa, --OP(.dbd.O).sub.2R.sup.aa,
--P(.dbd.O)(R.sup.aa).sub.2, --OP(.dbd.O)(R.sup.aa).sub.2,
--OP(.dbd.O)(OR.sup.cc).sub.2, --P(.dbd.O).sub.2N(R.sup.bb).sub.2,
--OP(.dbd.O).sub.2N(R.sup.bb).sub.2, --P(.dbd.O)(NR.sup.bb).sub.2,
--OP(.dbd.O)(NR.sup.bb).sub.2,
--NR.sup.bbP(.dbd.O)(OR.sup.cc).sub.2,
--NR.sup.bbP(.dbd.O)(NR.sup.bb).sub.2, --P(R.sup.cc).sub.2,
--P(R.sup.cc).sub.3, --OP(R.sup.cc).sub.2, --OP(R.sup.cc).sub.3,
--B(OR.sup.cc).sub.2, or --BR.sup.aa(OR.sup.cc), .dbd.O, .dbd.S,
.dbd.NN(R.sup.bb).sub.2, .dbd.NNR.sup.bbC(O)R.sup.aa,
.dbd.NNR.sup.bbCO.sub.2R.sup.aa, .dbd.NNR.sup.bbS(O).sub.2R.sup.aa,
.dbd.NR.sup.bb, .dbd.NOR.sup.cc, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl,
wherein each alkyl, alkenyl, alkynyl, carbocyclyl, heterocyclyl,
aryl, and heteroaryl is independently unsubstituted or substituted
with 1-5 R.sup.dd groups;
[0036] wherein:
[0037] each R.sup.aa is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroaliphatic,
carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently
unsubstituted or substituted with 1-5 R.sup.dd groups;
[0038] each R.sup.bb is, independently, selected from hydrogen,
--OH, --OR.sup.aa, --N(R.sup.cc).sub.2, --CN, --C(.dbd.O)R.sup.aa,
--C(.dbd.O)N(R.sup.cc).sub.2, --CO.sub.2R.sup.aa,
--SO.sub.2R.sup.aa, --C(.dbd.NR.sup.cc)OR.sup.aa,
--C(.dbd.NR.sup.cc)N(R.sup.cc).sub.2, --SO.sub.2N(R.sup.cc).sub.2,
--SO.sub.2R.sup.cc, --SO.sub.2OR.sup.cc, --SOR.sup.aa,
--C(.dbd.S)N(R.sup.cc).sub.2, --C(.dbd.O)SR.sup.cc,
--C(.dbd.S)SR.sup.cc, --P(.dbd.O).sub.2R.sup.aa,
--P(.dbd.O)(R.sup.aa).sub.2, --P(.dbd.O).sub.2N(R.sup.cc).sub.2,
--P(.dbd.O)(NR.sup.cc).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.bb groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring, wherein each alkyl, alkenyl,
alkynyl, heteroaliphatic, carbocyclyl, heterocyclyl, aryl, and
heteroaryl is independently unsubstituted or substituted with 1-5
R.sup.dd groups;
[0039] each R.sup.cc is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.cc groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, heteroaliphatic carbocyclyl,
heterocyclyl, aryl, and heteroaryl is independently unsubstituted
or substituted with 1-5 R.sup.dd groups;
[0040] each R.sup.dd is, independently, selected from halogen,
--CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH,
--OR.sup.ee, --ON(R.sup.ff).sub.2, --N(R.sup.ff).sub.2,
--N(OR.sup.ee)R.sup.ff, --SH, --SR.sup.ee, --SSR.sup.ee,
--C(O)R.sup.ee, --CO.sub.2H, --CO.sub.2R.sup.ee, --OC(O)R.sup.ee,
--OCO.sub.2R.sup.ee, --C(O)N(R.sup.ff).sub.2,
--OC(O)N(R.sup.ff).sub.2, --NR.sup.ffC(O)R.sup.ee,
--NR.sup.ffCO.sub.2R.sup.ee, --NR.sup.ffC(O)N(R.sup.ff).sub.2,
--C(NR.sup.ff)OR.sup.ee, --OC(NR.sup.ff)R.sup.ee,
--OC(NR.sup.ff)OR.sup.ee, --C(NR.sup.ff)N(R.sup.ff).sub.2,
--OC(NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffC(NR.sup.ff)N(R.sup.ff).sub.2,
--NR.sup.ffSO.sub.2R.sup.ee, --SO.sub.2N(R.sup.ff).sub.2,
--SO.sub.2R.sup.ee, --SO.sub.2OR.sup.ee, --OSO.sub.2R.sup.ee,
--SOR.sup.ee, --Si(R.sup.ee).sub.3, --OSi(R.sup.ee).sub.3,
--C(S)N(R.sup.ff).sub.2, --C(O)SR.sup.ee, --C(S)SR.sup.ee,
--SC(S)SR.sup.ee, --P(O).sub.2R.sup.ee, --P(O)(R.sup.ee).sub.2,
--OP(O)(R.sup.ee).sub.2, --OP(O)(OR.sup.ee).sub.2, .dbd.O, .dbd.S,
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl, 5-10
membered heteroaryl, wherein each alkyl, alkenyl, alkynyl,
heteroaliphatic, carbocyclyl, heterocyclyl, aryl, and heteroaryl is
independently unsubstituted or substituted with 1-5 R.sup.gg
groups;
[0041] each R.sup.ee is, independently, selected from C.sub.1-6
alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl, C.sub.2-6
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
C.sub.6-10 aryl, 3-10 membered heterocyclyl, and 3-10 membered
heteroaryl, wherein each alkyl, alkenyl, alkynyl, heteroaliphatic,
carbocyclyl, heterocyclyl, aryl, and heteroaryl is independently
unsubstituted or substituted with 1-5 R.sup.gg groups;
[0042] each R.sup.ff is, independently, selected from hydrogen,
C.sub.1-6 alkyl, C.sub.1-6 perhaloalkyl, C.sub.2-6 alkenyl,
C.sub.2-6 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-10 membered heterocyclyl, C.sub.6-10 aryl and 5-10
membered heteroaryl, or two R.sup.if groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring,
wherein each alkyl, alkenyl, alkynyl, heteroaliphatic, carbocyclyl,
heterocyclyl, aryl, and heteroaryl is independently unsubstituted
or substituted with 1-5 R.sup.gg groups; and
[0043] each R.sup.gg is, independently, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OC.sub.1-6 alkyl,
--ON(C.sub.1-6 alkyl).sub.2, --N(C.sub.1-6 alkyl).sub.2,
--N(OC.sub.1-6 alkyl)(C.sub.1-6 alkyl), --N(OH)(C.sub.1-6 alkyl),
--NH(OH), --SH, --S(C.sub.1-6 alkyl), --SS(C.sub.1-6 alkyl),
--C(O)(C.sub.1-6 alkyl), --CO.sub.2H, --OC.sub.2(C.sub.1-6 alkyl),
--OC(O)(C.sub.1-6 alkyl), --OCO.sub.2(C.sub.1-6 alkyl),
--C(O)NH.sub.2, --C(O)N(C.sub.1-6 alkyl).sub.2, --OC(O)NH(C.sub.1-6
alkyl), --NHC(O)(C.sub.1-6 alkyl), --N(C.sub.1-6
alkyl)C(O)(C.sub.1-6 alkyl), --NHCO.sub.2(C.sub.1-6 alkyl),
--NHC(O)N(C.sub.1-6 alkyl).sub.2, --NHC(O)NH(C.sub.1-6 alkyl),
--NHC(O)NH.sub.2, --C(NH)O(C.sub.1-6 alkyl), --OC(NH)(C.sub.1-6
alkyl), --OC(NH)OC.sub.1-6 alkyl, --C(NH)N(C.sub.1-6 alkyl).sub.2,
--C(NH)NH(C.sub.1-6 alkyl), --C(NH)NH.sub.2, --OC(NH)N(C.sub.1-6
alkyl).sub.2, --OC(NH)NH(C.sub.1-6 alkyl), --OC(NH)NH.sub.2,
--NHC(NH)N(C.sub.1-6 alkyl).sub.2, --NHC(NH)NH.sub.2,
--NHSO.sub.2(C.sub.1-6 alkyl), --SO.sub.2N(C.sub.1-6 alkyl).sub.2,
--SO.sub.2NH(C.sub.1-6 alkyl), --SO.sub.2NH.sub.2,
--SO.sub.2C.sub.1-6 alkyl, --SO.sub.2OC.sub.1-6 alkyl,
--OSO.sub.2C.sub.1-6 alkyl, --SOC.sub.1-6 alkyl, --Si(C.sub.1-6
alkyl).sub.3, --OSi(C.sub.1-6 alkyl).sub.3, --C(S)N(C.sub.1-6
alkyl).sub.2, --C(S)NH(C.sub.1-6 alkyl), --C(S)NH.sub.2,
--C(O)S(C.sub.1s alkyl), --C(S)SC.sub.1-6 alkyl, --SC(S)SC.sub.1-6
alkyl, --P(O).sub.2(C.sub.1-6 alkyl), --P(O)(C.sub.1-6
alkyl).sub.2, --OP(O)(C.sub.1-6 alkyl).sub.2, --OP(O)(OC.sub.1-6
alkyl).sub.2, C.sub.1-6 alkyl, C.sub.1 perhaloalkyl, C.sub.2-6
alkenyl, C.sub.2 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, C.sub.6-10 aryl, 3-10 membered heterocyclyl, 5-10
membered heteroaryl, .dbd.O or .dbd.S.
[0044] These and other exemplary substituents are described in more
detail in the Detailed Description, the Exemplification and in the
claims. The term "substituents" is not intended to be limited in
any manner by the above exemplary listing of substituents.
[0045] As used herein, a "pharmaceutically acceptable form thereof"
includes pharmaceutically acceptable salts, hydrates, solvates,
prodrugs, tautomers, isomers, and/or polymorphs of a compound
provided herein, as defined below and herein.
[0046] In certain embodiments, the pharmaceutically acceptable form
thereof is a pharmaceutically acceptable salt. As used herein, the
term "pharmaceutically acceptable salt" refers to those salts which
are, within the scope of sound medical judgment, suitable for use
in contact with the tissues of humans and lower animals without
undue toxicity, irritation, allergic response and the like, and are
commensurate with a reasonable benefit/risk ratio. Pharmaceutically
acceptable salts are well known in the art. For example, Berge et
al. describes pharmaceutically acceptable salts in detail in J.
Pharmaceutical Sciences (1977) 66:1-19. Pharmaceutically acceptable
salts of the compounds provided herein include those derived from
suitable inorganic and organic acids and bases. Examples of
pharmaceutically acceptable, nontoxic acid addition salts are salts
of an amino group formed with inorganic acids such as hydrochloric
acid, hydrobromic acid, phosphoric acid, sulfuric acid and
perchloric acid or with organic acids such as acetic acid, oxalic
acid, maleic acid, tartaric acid, citric acid, succinic acid or
malonic acid or by using other methods used in the art such as ion
exchange. Other pharmaceutically acceptable salts include adipate,
alginate, ascorbate, aspartate, benzenesulfonate, benzoate,
bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate,
cyclopentanepropionate, digluconate, dodecylsulfate,
ethanesulfonate, formate, fumarate, glucoheptonate,
glycerophosphate, gluconate, hemisulfate, heptanoate, hexanoate,
hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate,
laurate, lauryl sulfate, malate, maleate, malonate,
methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate,
oleate, oxalate, palmitate, pamoate, pectinate, persulfate,
3-phenylpropionate, phosphate, picrate, pivalate, propionate,
stearate, succinate, sulfate, tartrate, thiocyanate,
p-toluenesulfonate, undecanoate, valerate salts, and the like.
Salts derived from appropriate bases include alkali metal, alkaline
earth metal, ammonium and N.sup.+(C.sub.1-4alkyl).sub.4 salts.
Representative alkali or alkaline earth metal salts include sodium,
lithium, potassium, calcium, magnesium, and the like. Further
pharmaceutically acceptable salts include, when appropriate,
nontoxic ammonium, quaternary ammonium, and amine cations formed
using counterions such as halide, hydroxide, carboxylate, sulfate,
phosphate, nitrate, lower alkyl sulfonate and aryl sulfonate.
[0047] In certain embodiments, the pharmaceutically acceptable form
thereof is a hydrate or solvate. As used herein, the term "hydrate"
refers to a compound non-covalently associated with one or more
molecules of water, which in some embodiments can be crystalline.
Likewise, "solvate" refers to a compound non-covalently associated
with one or more molecules of an organic solvent, which in some
embodiments can be crystalline.
[0048] In certain embodiments, the pharmaceutically acceptable form
thereof is a prodrug. As used herein, the term "prodrug" refers to
a derivative of a parent compound that requires transformation
within the body in order to release the parent compound.
[0049] The term "prodrug" refers to compounds that are transformed
in vivo to yield a disclosed compound or a pharmaceutically
acceptable form of the compound. The transformation can occur by
various mechanisms, such as, but not limited to, through hydrolysis
in blood. In certain cases, a prodrug has improved physical and/or
delivery properties over the parent compound. Prodrugs are
typically designed to enhance pharmaceutically and/or
pharmacokinetically based properties associated with the parent
compound. Exemplary advantages of a prodrug can include, but are
not limited to, its physical properties, such as enhanced water
solubility for parenteral administration at physiological pH
compared to the parent compound, or it enhances absorption from the
digestive tract, or it can enhance drug stability for long-term
storage.
[0050] For example, if a disclosed compound or a pharmaceutically
acceptable form of the compound contains a carboxylic acid
functional group, a prodrug can comprise an ester formed by the
replacement of the hydrogen atom of the acid group with a group
such as (C.sub.1-C.sub.8)alkyl,
(C.sub.2-C.sub.12)alkanoyloxymethyl, 1-(alkanoyloxy)ethyl having
from 4 to 9 carbon atoms, 1-methyl-1-(alkanoyloxy)-ethyl having
from 5 to 10 carbon atoms, alkoxycarbonyloxymethyl having from 3 to
6 carbon atoms, 1-(alkoxycarbonyloxy)ethyl having from 4 to 7
carbon atoms, 1-methyl-1-(alkoxycarbonyloxy)ethyl having from 5 to
8 carbon atoms, N-(alkoxycarbonyl)aminomethyl having from 3 to 9
carbon atoms, 1-(N-(alkoxycarbonyl)amino)ethyl having from 4 to 10
carbon atoms, 3-phthalidyl, 4-crotonolactonyl,
gamma-butyrolacton-4-yl,
di-N,N--(C.sub.1-C.sub.2)alkylamino(C.sub.2-C.sub.3)alkyl (such as
(3-dimethylaminoethyl), carbamoyl-(C.sub.1-C.sub.2)alkyl,
N,N-di(C.sub.1-C.sub.2)alkylcarbamoyl-(C.sub.1-C.sub.2)alkyl and
piperidino-, pyrrolidino- or morpholino(C.sub.2-C.sub.3)alkyl.
[0051] Similarly, if a disclosed compound or a pharmaceutically
acceptable form of the compound contains an alcohol functional
group, a prodrug can be formed by the replacement of the hydrogen
atom of the alcohol group with a group such as
(C.sub.1-C.sub.6)alkanoyloxymethyl,
1-((C.sub.1-C.sub.6)alkanoyloxy)ethyl,
1-methyl-1-((C.sub.1-C.sub.6)alkanoyloxy)ethyl
(C.sub.1-C.sub.6)alkoxycarbonyloxymethyl,
N--(C.sub.1-C.sub.6)alkoxycarbonylaminomethyl, succinoyl,
(C.sub.1-C.sub.6)alkanoyl, .alpha.-amino(C.sub.1-C.sub.4)alkanoyl,
arylacyl and .alpha.-aminoacyl, or
.alpha.-aminoacyl-.alpha.-aminoacyl, where each .alpha.-aminoacyl
group is independently selected from the naturally occurring
L-amino acids, P(O)(OH).sub.2,
--P(O)(O(C.sub.1-C.sub.6)alkyl).sub.2 or glycosyl (the radical
resulting from the removal of a hydroxyl group of the hemiacetal
form of a carbohydrate).
[0052] If a disclosed compound or a pharmaceutically acceptable
form of the compound incorporates an amine functional group, a
prodrug can be formed by the replacement of a hydrogen atom in the
amine group with a group such as R-carbonyl, RO-carbonyl,
NRR'-carbonyl where R and R' are each independently
(C.sub.1-C.sub.10)alkyl, (C.sub.3-C.sub.7)cycloalkyl, benzyl, or
R-carbonyl is a natural .alpha.-aminoacyl or natural
.alpha.-aminoacyl-natural .alpha.-aminoacyl, C(OH)C(O)OY.sup.1
wherein Y.sup.1 is H, (C.sub.1-C.sub.6)alkyl or benzyl,
--C(OY.sup.2)Y.sup.3 wherein Y.sup.2 is (C.sub.1-C.sub.4) alkyl and
Y.sup.3 is (C.sub.1-C.sub.6)alkyl, carboxy(C.sub.1-C.sub.6)alkyl,
amino(C.sub.1-C.sub.4)alkyl or mono-N- or
di-N,N--(C.sub.1-C.sub.6)alkylaminoalkyl, --C(Y.sup.4)Y.sup.5
wherein Y.sup.4 is H or methyl and Y.sup.5 is mono-N- or
di-N,N--(C.sub.1-C.sub.6)alkylamino, morpholino, piperidin-1-yl or
pyrrolidin-1-yl.
[0053] In certain embodiments, the pharmaceutically acceptable form
thereof is a tautomer. As used herein, the term "tautomer" includes
two or more interconvertable compounds resulting from at least one
formal migration of a hydrogen atom and at least one change in
valency (e.g., a single bond to a double bond, a triple bond to a
single bond, or vice versa). The exact ratio of the tautomers
depends on several factors, including temperature, solvent, and pH.
Tautomerizations (i.e., the reaction providing a tautomeric pair)
can be catalyzed by acid or base, or can occur without the action
or presence of an external agent. Exemplary tautomerizations
include, but are not limited to, keto-to-enol; amide-to-imide;
lactam-to-lactim; enamine-to-imine; and enamine-to-(a different)
enamine tautomerizations.
[0054] In certain embodiments, the pharmaceutically acceptable form
thereof is an isomer. As used herein, the term "isomer" includes
any and all geometric isomers and stereoisomers. For example,
"isomers" include cis- and trans-isomers, E- and Z-isomers, R- and
S-enantiomers, diastereomers, (D)-isomers, (L)-isomers, racemic
mixtures thereof, and other mixtures thereof, as falling within the
scope of this disclosure. For instance, an isomer/enantiomer can,
in some embodiments, be provided substantially free of the
corresponding enantiomer, and can also be referred to as "optically
enriched." "Optically-enriched," as used herein, means that the
compound is made up of a significantly greater proportion of one
enantiomer. In certain embodiments, the compound provided herein is
made up of at least about 90% by weight of one enantiomer. In other
embodiments the compound is made up of at least about 95%, 98%, or
99% by weight of one enantiomer. Enantiomers can be isolated from
racemic mixtures by any method known to those skilled in the art,
including chiral high pressure liquid chromatography (HPLC), the
formation and crystallization of chiral salts, or prepared by
asymmetric syntheses. See, for example, Enantiomers, Racemates and
Resolutions (Jacques, Ed., Wiley Interscience, New York, 1981);
Wilen et al., Tetrahedron 33:2725 (1977); Stereochemistry of Carbon
Compounds (E. L. Eliel, Ed., McGraw-Hill, NY, 1962); and Tables of
Resolving Agents and Optical Resolutions p. 268 (E. L. Eliel, Ed.,
Univ. of Notre Dame Press, Notre Dame, Ind. 1972).
[0055] In certain embodiments, the pharmaceutically acceptable form
thereof is a polymorph. As used herein, "polymorph" refers to a
compound having more than one crystal structure, e.g., resulting
from differences in molecular packing and/or molecular conformation
of the compound in the solid state.
[0056] The disclosure also embraces isotopically labeled compounds
which are identical to those recited herein, except that one or
more atoms are replaced by an atom having an atomic mass or mass
number different from the atomic mass or mass number usually found
in nature. Examples of isotopes that can be incorporated into
disclosed compounds include isotopes of hydrogen, carbon, nitrogen,
oxygen, phosphorus, fluorine and chlorine, such as .sup.2H,
.sup.3H, .sup.13C.sub., .sup.14C, .sup.15N, .sup.18O, .sup.17O,
.sup.31P, .sup.32P, .sup.35S, .sup.18F, and .sup.36Cl,
respectively.
[0057] Certain isotopically-labeled disclosed compounds (e.g.,
those labeled with .sup.3H and .sup.14C) are useful in compound
and/or substrate tissue distribution assays. Tritiated (i.e.,
.sup.3H) and carbon-14 (i.e., .sup.14C) isotopes acan allow for
ease of preparation and detectability. Further, substitution with
heavier isotopes such as deuterium (i.e., .sup.2H) can afford
certain therapeutic advantages resulting from greater metabolic
stability (e.g., increased in vivo half-life or reduced dosage
requirements). Isotopically labeled disclosed compounds can
generally be prepared by following procedures analogous to those
disclosed in the Exemplification section herein by substituting an
isotopically labeled reagent for a non-isotopically labeled
reagent.
DETAILED DESCRIPTION
1. Brief Description of Figures
[0058] FIG. 1 illustrates a schematic diagram of subcutaneous mouse
xenograft model for assaying papillomaviruses.
[0059] FIG. 2 illustrates a schematic diagram of cutaneous mouse
xenograft model for assaying papillomaviruses.
2. Compounds
[0060] Without limited by a particular theory, the present
disclosure is based on the discovery that tetrazolones are
inhibitors of human fatty acid synthase (FASN) and thus are useful
in the treatment of FASN-mediated diseases, disorders or
conditions. Further without limited by a particular theory, in
certain embodiments, the compounds provided herein can inhibit long
chain fatty acid elongase (ELOVL) such as ELOVL 6. Thus, in some
embodiments compounds provided herein are useful in the treatment
of ELOVL-mediated diseases, disorders or conditions.
[0061] For example, in one aspect, provided herein is a compound of
formula (I):
##STR00003##
[0062] or a pharmaceutically acceptable form thereof;
wherein:
[0063] R.sup.A is selected C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl, and
hydrogen;
[0064] X is selected from hydrogen, --CN, --CHO,
--C(.dbd.O)R.sup.X1, --C(.dbd.O)N(R.sup.X2).sub.2, --CO.sub.2H,
CO.sub.2R.sup.X1, --SO.sub.2R.sup.X1, --C(.dbd.NR.sup.X2)OR.sup.X1,
--C(.dbd.NR.sup.X2)N(R.sup.X2).sub.2, --SO.sub.2N(R.sup.X2).sub.2,
--SO.sub.2R.sup.X1, --SO.sub.3H, --SO.sub.2OR.sup.X1, --SOR.sup.X1,
--C(.dbd.S)N(R.sup.X2).sub.2, --C(.dbd.O)SR.sup.X1,
--C(.dbd.S)SR.sup.X1, --P(.dbd.O).sub.2R.sup.X1,
--P(.dbd.O)(R.sup.X1).sub.2, --P(.dbd.O).sub.2N(R.sup.X2).sub.2,
--P(.dbd.O)(NR.sup.X2).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl; or
[0065] R.sup.A and X, together with the carbon atoms to which each
is attached, are joined to form a 5-10 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring;
[0066] R.sup.B is selected from C.sub.6-14 aryl, 5-14 membered
heteroaryl, C.sub.1-10 alkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, and
3-14 membered heterocyclyl;
[0067] R.sup.C is selected from hydrogen, --OH, --OR.sup.C1,
--ON(R.sup.C2).sub.2, --N(R.sup.C2).sub.2, --C(.dbd.O)R.sup.C1,
--CHO, --CO.sub.2R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2,
--C(.dbd.NR.sup.C2)OR.sup.cl, --C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2,
--SO.sub.2R.sup.C1, --S(.dbd.O)R.sup.C1, --Si C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; or
[0068] R.sup.B and R.sup.C together with the nitrogen (N) atom to
which each is attached are joined to form a 5-14 membered
carbocyclyl, heterocyclyl, aryl or heteroaryl ring;
[0069] each R.sup.C1 and R.sup.X1 is, independently, selected from
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl;
[0070] each R.sup.C2 is, independently, selected from hydrogen,
--OH, --OR.sup.C1, --N(R.sup.c3).sub.2, --CN, --C(.dbd.O)R.sup.C1,
--C(.dbd.O)N(R.sup.C3).sub.2, CO.sub.2R.sup.C1, --SO.sub.2R.sup.C1,
--C(.dbd.NR.sup.C3)OR.sup.C1, --C(.dbd.NR.sup.C3)N(R.sup.C3).sub.2,
--SO.sub.2N(R.sup.C3).sub.2, --SO.sub.2R.sup.C3,
--SO.sub.2OR.sup.C3, --SOR.sup.C1, --C(.dbd.S)N(R.sup.C3).sub.2,
--C(.dbd.O)SR.sup.C3, --C(.dbd.S)SR.sup.C3,
--P(.dbd.O).sub.2R.sup.C1, --P(.dbd.O)(R.sup.C1).sub.2,
--P(.dbd.O).sub.2N(R.sup.C3).sub.2, --P(.dbd.O)(NR.sup.C3).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl;
[0071] each R.sup.X2 is, independently, selected from hydrogen,
--OH, --OR.sup.X1, --N(R.sup.X3).sub.2, --CN, --C(.dbd.O)R.sup.X1,
--C(.dbd.O)N(R.sup.X3).sub.2, --CO.sub.2R.sup.X1,
--SO.sub.2R.sup.X1, --C(.dbd.NR.sup.X3)OR.sup.X1,
--C(.dbd.NR.sup.X3)N(R.sup.X3).sub.2, --SO.sub.2N(R.sup.X3).sub.2,
--SO.sub.2R.sup.X3, --SO.sub.2OR.sup.X3, --SOR.sup.X1,
--C(.dbd.S)N(R.sup.X3).sub.2, --C(.dbd.O)SR.sup.X3,
--C(.dbd.S)SR.sup.X3, --P(.dbd.O).sub.2R.sup.X1,
--P(.dbd.O)(R.sup.X1).sub.2, --P(.dbd.O).sub.2N(R.sup.X3).sub.2,
--P(.dbd.O)(NR.sup.X3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl;
and
[0072] each R.sup.C3 and R.sup.X3 is, independently, selected from
hydrogen, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic,
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, and 5-14 membered heteroaryl.
Group R.sup.A
[0073] As described generally above, R.sup.A is selected from
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14
aryl, 5-14 membered heteroaryl, and hydrogen; or R.sup.A and X,
together with the carbon atoms to which each is attached, are
joined to form a 5-10 membered ring.
[0074] In certain embodiments, R.sup.A is selected from C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, 5-14
membered heteroaryl, and hydrogen. In certain embodiments, R.sup.A
is selected from C.sub.6-14 aryl and 5-14 membered heteroaryl.
[0075] In certain embodiments, R.sup.A is C.sub.3-10 carbocyclyl.
Exemplary carbocyclyl groups include, but are not limited to,
cyclopropyl (C.sub.3), cyclobutyl (C.sub.4), cyclopentyl (C.sub.5),
cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl
(C.sub.6), cyclohexadienyl (C.sub.6), cycloheptyl (C.sub.7),
cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7) and
cyclooctyl (C.sub.8).
[0076] In certain embodiments, R.sup.A is 3-14 membered
heterocyclyl. Exemplary heterocyclyl groups include, but are not
limited to, azirdinyl, oxiranyl, thiorenyl, azetidinyl, oxetanyl,
thietanyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, dioxolanyl,
oxathiolanyl and dithiolanyl, piperidinyl, tetrahydropyranyl,
dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl,
dioxanyl, azepanyl, oxepanyl thiepanyl, azocanyl, oxecanyl and
thiocanyl.
[0077] In certain embodiments, R.sup.A is C.sub.6-14 aryl.
Exemplary aryl groups include, but are not limited to, phenyl,
naphthyl and anthracyl. In certain embodiments, R.sup.A is phenyl
(C.sub.6 aryl). In certain embodiments, R.sup.A is naphthyl
(C.sub.10 aryl).
[0078] In certain embodiments, R.sup.A is 5-14 membered heteroaryl.
In certain embodiments, R.sup.A is 5-10 membered heteroaryl. In
certain embodiments, R.sup.A is 5-6 membered heteroaryl. In certain
embodiments, R.sup.A is 5,6-bicyclic heteroaryl. In certain
embodiments, R.sup.A is 6,6-bicyclic heteroaryl.
[0079] In certain embodiments, R.sup.A is a 5-membered heteroaryl
group. Exemplary 5-membered heteroaryl groups include, but are not
limited to, pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl,
oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl,
oxadiazolyl, thiadiazolyl and tetrazolyl.
[0080] In certain embodiments, R.sup.A is a 6-membered heteroaryl
group. Exemplary 6-membered heteroaryl groups include, but are not
limited to, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl,
triazinyl and tetrazinyl.
[0081] In certain embodiments, R.sup.A is a 5,6-bicyclic heteroaryl
group. Exemplary 5,6-bicyclic heteroaryl groups include, without
limitation, indolyl, isoindolyl, indazolyl, benztriazolyl,
benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl,
benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl,
benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and
purinyl.
[0082] In certain embodiments, R.sup.A is a 6,6-bicyclic heteroaryl
group. Exemplary 6,6-bicyclic heteroaryl groups include, but are
not limited to, naphthyridinyl, pteridinyl, quinolinyl,
isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and
quinazolinyl.
[0083] In certain embodiments, R.sup.A is a group of the formula
(i):
##STR00004##
[0084] wherein each group W--R.sup.1, W--R.sup.2, W--R.sup.3,
W--R.sup.4, and W--R.sup.5 independently represents either a
nitrogen atom (N) or C--R.sup.1, C--R.sup.2, C--R.sup.3,
C--R.sup.4, or C--R.sup.5, respectively; and
[0085] wherein R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.A1,
--ON(R.sup.A2).sub.2, --N(R.sup.A2).sub.2, --N(OR.sup.A3)R.sup.A3,
--SH, --SR.sup.A1, --SSR.sup.A3, --C(.dbd.O)R.sup.A1, --CO.sub.2H,
--CHO, --C(OR.sup.A3).sub.2, --CO.sub.2R.sup.A1,
--OC(.dbd.O)R.sup.A1, --OCO.sub.2R.sup.A1,
--C(.dbd.O)N(R.sup.A2).sub.2, --OC(.dbd.O)N(R.sup.A2).sub.2,
--NR.sup.A2C(.dbd.O)R.sup.A1, --NR.sup.A2CO.sub.2R.sup.A1,
--NR.sup.A2C(.dbd.O)N(R.sup.A2).sub.2,
--C(.dbd.NR.sup.A2)OR.sup.A1, --OC(.dbd.NR.sup.A2)R.sup.A1,
OC(.dbd.NR.sup.A2)OR.sup.A1, --C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--OC(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--NR.sup.A2C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--C(.dbd.O)NR.sup.A2SO.sub.2R.sup.A1, --NR.sup.A2SO.sub.2R.sup.A1,
--SO.sub.2N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1,
--SO.sub.2OR.sup.A1, --OSO.sub.2R.sup.A1, --S(.dbd.O)R.sup.A1,
--OS(.dbd.O)R.sup.B1, --Si(R.sup.B1).sub.3,
--OSi(R.sup.A1).sub.3--C(.dbd.S)N(R.sup.A2).sub.2,
--C(.dbd.O)SR.sup.A1, --C(.dbd.S)SR.sup.A1, --SC(.dbd.S)SR.sup.A1,
--P(.dbd.O).sub.2R.sup.A1, --OP(.dbd.O).sub.2R.sup.A1,
--P(.dbd.O)(R.sup.A1).sub.2, --OP(.dbd.O)(R.sup.A1).sub.2,
--OP(.dbd.O)(OR.sup.A3).sub.2, --P(.dbd.O).sub.2N(R.sup.A2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.A2).sub.2, --P(.dbd.O)(NR.sup.A2).sub.2,
--OP(.dbd.O)(NR.sup.A2).sub.2,
--NR.sup.A2P(.dbd.O)(OR.sup.A3).sub.2,
--NR.sup.A2P(.dbd.O)(NR.sup.A2).sup.2, --P(R.sup.A3).sup.2,
P(R.sup.A3).sub.3, --OP(R.sup.A3).sub.2, --OP(R.sup.A3).sub.3,
--B(OR.sup.A3).sub.2, --BR.sup.A1(OR.sup.A3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; or one or more of R.sup.1 and R.sup.2, R.sup.2 and
R.sup.3, R.sup.3 and R.sup.4 or R.sup.4 and R.sup.5 are joined to
form a C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl or 5-14 membered heteroaryl ring;
[0086] each R.sup.A1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0087] each R.sup.A2 is, independently, selected from hydrogen,
--OH, --OR.sup.A1, --N(R.sup.A3).sub.2, --CN, --C(.dbd.O)R.sup.A1,
--C(.dbd.O)N(R.sup.A3).sub.2, --CO.sub.2R.sup.A1,
--SO.sub.2R.sup.A1, --C(.dbd.NR.sup.A3)OR.sup.A1,
--C(.dbd.NR.sup.A3)N(R.sup.A3).sub.2, --SO.sub.2N(R.sup.A3).sub.2,
--SO.sub.2R.sup.A3, --SO.sub.2OR.sup.A3, --SOR.sup.A1,
--C(.dbd.S)N(R.sup.A3).sub.2, --C(.dbd.O)SR.sup.A3,
--C(.dbd.S)SR.sup.A3, --P(.dbd.O).sub.2R.sup.A1,
--P(.dbd.O)(R.sup.A1).sub.2, --P(.dbd.O).sub.2N(R.sup.A3).sub.2,
--P(.dbd.O)(NR.sup.A3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.A2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and
[0088] each R.sup.A3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.A3 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring.
[0089] In certain embodiments, the group of formula (I) represents
a C.sub.6-14 aryl group or a 6-14 membered heteroaryl group. In
certain embodiments, the group of formula (I) represents a 6-14
membered heteroaryl group. In certain embodiments, the group of
formula (I) represents a C.sub.6-14 aryl group. In certain
embodiments, the C.sub.6-14 aryl group of formula (I) represents a
phenyl group.
[0090] As used herein, when one or more of R.sup.1, R.sup.2,
R.sup.3, R.sup.4 and R.sup.5 is referred to as "not hydrogen", it
is meant that one or more of R.sup.1, R.sup.2, R.sup.3, R.sup.4 and
R.sup.5 is independently selected from halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.A1,
--ON(R.sup.A2).sub.2, --N(R.sup.A2).sub.2, --N(OR.sup.A3)R.sup.A3,
--SH, --SR.sup.A1, --SSR.sup.A3, --C(.dbd.O)R.sup.A1, --CO.sub.2H,
--CHO, --C(OR.sup.A3).sub.2, --CO.sub.2R.sup.A1,
--OC(.dbd.O)R.sup.A1, --OCO.sub.2R.sup.A1,
--C(.dbd.O)N(R.sup.A2).sub.2, --OC(.dbd.O)N(R.sup.A2).sub.2,
--NR.sup.A2C(.dbd.O)R.sup.A1, --NR.sup.A2CO.sub.2R.sup.A1,
--NR.sup.A2C(.dbd.O)N(R.sup.A2).sub.2,
--C(.dbd.NR.sup.A2)OR.sup.A1, --OC(.dbd.NR.sup.A2) R.sup.A1,
--OC(.dbd.O)R.sup.A1, --C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--OC(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--NR.sup.A2C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--C(.dbd.O)NR.sup.A2SO.sub.2R.sup.A1, --NR.sup.A2SO.sub.2R.sup.A1,
--SO.sub.2N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1,
--SO.sub.2OR.sup.A1, --OSO.sub.2R.sup.A1, --S(.dbd.O)R.sup.A1,
--OS(.dbd.O)R.sup.A1, --Si(R.sup.A1).sub.3, --OSi(R.sup.A1).sub.3,
--C(.dbd.S)N(R.sup.A2).sub.2, --C(.dbd.O)SR.sup.A1,
--C(.dbd.S)SR.sup.A1, --SC(S)SR.sup.A1, --P(.dbd.O).sub.2R.sup.A1,
--OP(.dbd.O).sub.2R.sup.A1, --P(.dbd.O)(R.sup.A1).sub.2,
--OP(.dbd.O)(R.sup.A1).sub.2, --OP(.dbd.O)(OR.sup.A3).sub.2,
--P(.dbd.O).sub.2N(R.sup.A2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.A2).sub.2, --P(.dbd.O)(NR.sup.A2).sub.2,
--OP(.dbd.O)(NR.sup.A2).sub.2,
--NR.sup.A2P(.dbd.O)(OR.sup.A3).sub.2,
--NR.sup.A2P(.dbd.O)(NR.sup.A2).sub.2, --P(R.sup.A3).sub.2,
--P(R.sup.A3).sub.3, --OP(R.sup.A3).sub.2, --OP(R.sup.A3).sub.3,
--B(OR.sup.A3).sub.2, or --BR.sup.A1(OR.sup.A3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; or one or more of R.sup.1 and R.sup.2, R.sup.2 and
R.sup.3, R.sup.3 and R.sup.4 or R.sup.4 and R.sup.5 are joined to
form a C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl or 5-14 membered heteroaryl ring.
[0091] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen,
--CN, --NO.sub.2, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.A1,
--N(R.sup.A2).sub.2, --C(.dbd.O)R.sup.A1, --CO.sub.2H, --CHO,
--C(OR.sup.A3).sub.2, --CO.sub.2R.sup.A1, --OC(.dbd.O)R.sup.A1,
--OCO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--OC(.dbd.O)N(R.sup.A2).sub.2, --NR.sup.A2C(.dbd.O)R.sup.A1,
--NR.sup.A2CO.sub.2R.sup.A1, --NR.sup.A2C(.dbd.O)N(R.sup.A2).sub.2,
--C(NR.sup.A2)OR.sup.A1, --OC(.dbd.NR.sup.A2)R.sup.A1,
--OC(.dbd.NR.sup.A2)OR.sup.A1,
--C(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--OC(.dbd.NR.sup.A2)N(R.sup.A2).sub.2,
--NR.sup.A2)N(R.sup.A2).sub.2,
--C(.dbd.O)NR.sup.A2SO.sub.2R.sup.A1, --NR.sup.A2SO.sub.2R.sup.A1,
--SO.sub.2N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1,
--SO.sub.2OR.sup.A1, --OSO.sub.2R.sup.A1, --S(.dbd.O)R.sup.A1,
--OS(.dbd.O)R.sup.A1, C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl; or one
or more of R.sup.1 and R.sup.2, R.sup.2 and R.sup.3, R.sup.3 and
R.sup.4 or R.sup.4 and R.sup.5 are joined to form a C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl or 5-14
membered heteroaryl ring.
[0092] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen,
--CN, --OR.sup.A1, --N(R.sup.A2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--SO.sub.2R.sup.A1, C.sub.1-10 alkyl, C.sub.2-10 alkynyl, 3-14
membered heterocyclyl, and C.sub.6-14 aryl; or one or more of
R.sup.1 and R.sup.2, R.sup.2 and R.sup.3, R.sup.3 and R.sup.4 or
R.sup.4 and R.sup.5 are joined to form a 5-14 membered heteroaryl
ring.
[0093] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen,
--OR.sup.A1, --N(R.sup.A2).sub.2, --CO.sub.2H,
--C(.dbd.O)N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1, C.sub.1-10 alkyl,
3-14 membered heterocyclyl; or R.sup.4 and R.sup.5 are joined to
form a 5-14 membered heteroaryl ring.
[0094] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen,
--OR.sup.A1, C.sub.1-10 alkyl, and --C(.dbd.O)N(R.sup.A2).sub.2; or
R.sup.4 and R.sup.5 are joined to form a 5-14 membered heteroaryl
ring.
[0095] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen,
--OR.sup.A1, and --C(.dbd.O)N(R.sup.A2).sub.2; or R.sup.4 and
R.sup.5 are joined to form a 5-14 membered heteroaryl ring.
[0096] In certain embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4
and R.sup.5 are independently selected from hydrogen, halogen, and
--OR.sup.A1. In certain embodiments, R.sup.1, R.sup.2, R.sup.3,
R.sup.4 and R.sup.5 are independently selected from hydrogen,
fluoro, chloro, and --OR.sup.A1. In certain embodiments, R.sup.1,
R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are independently selected
from hydrogen, fluoro, chloro, and --OMe. In certain embodiments,
R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are independently
selected from hydrogen, fluoro and --OR.sup.A1. In certain
embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
independently selected from hydrogen, fluoro and --OMe. In certain
embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
independently selected from hydrogen and fluoro. In certain
embodiments, R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
independently selected from hydrogen and chloro.
[0097] In certain embodiments, R.sup.4 and R.sup.5 are joined to
form a 5-14 membered heteroaryl ring.
[0098] In other embodiments, R.sup.A is a group of the formula
(ii):
##STR00005##
[0099] wherein R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
as defined above and herein.
[0100] In certain embodiments, the group of formula (ii) represents
a C.sub.6-14 aryl group or a 6-14 membered heteroaryl group. In
certain embodiments, the group of formula (ii) represents a 6-14
membered heteroaryl group. In certain embodiments, the group of
formula (ii) represents a C.sub.6-14 aryl group. In certain
embodiments, the C.sub.6-14 aryl group of formula (ii) represents a
phenyl group.
[0101] In certain embodiments, R.sup.A is a monosubstituted,
disubstituted or trisubstituted group of the formula (ii). In
certain embodiments, R.sup.A is a monosubstituted or disubstituted
group of the formula (ii).
[0102] In certain embodiments, R.sup.A is a monosubstituted group
of the formula (ii).
[0103] For example, in certain embodiments, R.sup.A is an
ortho-substituted group of the formula (ii), e.g., wherein
R.sup.1-R.sup.4 are hydrogen, and R.sup.5 is not hydrogen, e.g., of
the formula (ii-a).
[0104] In certain embodiments, R.sup.A is a meta-substituted group
of the formula (ii), e.g., wherein R.sup.1-R.sup.3 and R.sup.5 are
hydrogen and R.sup.4 is not hydrogen, e.g., of the formula
(ii-b).
[0105] In certain embodiments, R.sup.A is a para-substituted group
of the formula (ii), e.g., wherein R.sup.1, R.sup.2, R.sup.4 and
R.sup.5 are hydrogen and R.sup.3 is not hydrogen, e.g., of the
formula (ii-c).
##STR00006##
[0106] In certain embodiments, R.sup.A is a disubstituted group of
the formula (ii).
[0107] For example, in certain embodiments, R.sup.A is a
2,6-disubstituted group of the formula (ii), e.g., wherein R.sup.2,
R.sup.3 and R.sup.4 are hydrogen, and R.sup.1 and R.sup.5 are not
hydrogen, e.g., of the formula (ii-d).
[0108] In certain embodiments, R.sup.A is a 2,5-disubstituted group
of the formula (ii), e.g., wherein R.sup.2, R.sup.3 and R.sup.5 are
hydrogen, and R.sup.1 and R.sup.4 are not hydrogen, e.g., of the
formula (ii-e).
[0109] In certain embodiments, R.sup.A is a 2,4-disubstituted group
of the formula (ii), e.g., wherein R.sup.2, R.sup.3 and R.sup.5 are
hydrogen, and R.sup.1 and R.sup.3 are not hydrogen, e.g., of the
formula (ii-f).
[0110] In certain embodiments, R.sup.A is a 2,3-disubstituted group
of the formula (ii), e.g., wherein R.sup.1, R.sup.2 and R.sup.3 are
hydrogen, and R.sup.4 and R.sup.5 are not hydrogen, e.g., of the
formula (ii-g).
[0111] In certain embodiments, R.sup.A is a 3,4-disubstituted group
of the formula (ii), e.g., wherein R.sup.1, R.sup.4 and R.sup.5 are
hydrogen, and R.sup.2 and R.sup.3 are not hydrogen, e.g., of the
formula (ii-h).
[0112] In certain embodiments, R.sup.A is a 3,5-disubstituted group
of the formula (ii), e.g., wherein R.sup.1, R.sup.3 and R.sup.5 are
hydrogen, and R.sup.2 and R.sup.4 are not hydrogen, e.g., of the
formula (ii-i).
##STR00007##
[0113] For example, in certain embodiments, R.sup.A is a
2,6-disubstituted group as described herein, e.g., of the formula
(ii-d):
##STR00008##
[0114] wherein R.sup.1 and R.sup.5 are as defined above and
herein.
[0115] In certain embodiments, one of R.sup.1 and R.sup.5 is
halogen, --CN, --OR.sup.A1, --N(R.sup.A2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.A1, --C(.dbd.O)N(R.sup.A2).sub.2,
--SO.sub.2R.sup.A1, C.sub.1-10 alkyl, C.sub.2-10 alkynyl, 3-14
membered heterocyclyl, and C.sub.6-14 aryl, and the other of
R.sup.1 and R.sup.5 is halogen, --CN, --OR.sup.A1,
--N(R.sup.A2).sub.2, --CO.sub.2H, --CO.sub.2R.sup.A1,
--C(.dbd.O)N(R.sup.A2).sub.2, --SO.sub.2R.sup.A1, C.sub.1-10 alkyl,
C.sub.2-10 alkynyl, 3-14 membered heterocyclyl, and C.sub.6-14
aryl.
[0116] In certain embodiments, one of R.sup.1 and R.sup.5 is
halogen, --OR.sup.A1, C.sub.1-10 alkyl, or
--C(.dbd.O)N(R.sup.A2).sub.2, and the other of R.sup.1 and R.sup.5
is halogen, --OR.sup.A1, C.sub.1-10 alkyl, or
--C(.dbd.O)N(R.sup.A2).sub.2.
[0117] In certain embodiments, each of R.sup.1 and R.sup.5 is
independently halogen. For example, each of R.sup.1 and R.sup.5 is
independently selected from fluoro and chloro.
[0118] In certain embodiments, R.sup.A is a trisubstituted group of
the formula (ii).
[0119] For example, in certain embodiments, R.sup.A is a
2,4,6-trisubstituted group of the formula (ii), e.g., wherein
R.sup.2 and R.sup.4 are hydrogen, and R.sup.1, R.sup.3 and R.sup.5
are not hydrogen, e.g., of the formula (ii-j).
[0120] In certain embodiments, R.sup.A is a 2,3,6-trisubstituted
group of the formula (ii), e.g., wherein R.sup.2 and R.sup.3 are
hydrogen, and R.sup.1, R.sup.4 and R.sup.5 are not hydrogen, e.g.,
of the formula (ii-k).
[0121] In certain embodiments, R.sup.A is a 2,4,5-trisubstituted
group of the formula (ii), e.g., wherein R.sup.2 and R.sup.5 are
hydrogen, and R.sup.1, R.sup.3 and R.sup.4 are not hydrogen, e.g.,
of the formula (ii-l).
[0122] In certain embodiments, R.sup.A is a 2,3,4-trisubstituted
group of the formula (ii), e.g., wherein R.sup.4 and R.sup.5 are
hydrogen, and R.sup.1, R.sup.2 and R.sup.3 are not hydrogen, e.g.,
of the formula (ii-m).
[0123] In certain embodiments, R.sup.A is a 3,4,5-trisubstituted
group of the formula (ii), e.g., wherein R.sup.1 and R.sup.5 are
hydrogen, and R.sup.2, R.sup.3 and R.sup.4 are not hydrogen, e.g.,
of the formula (ii-n).
##STR00009##
[0124] In certain embodiments, R.sup.A is heteroaryl selected from
a 5-6-membered heteroaryl, a 5,6-bicyclic heteroaryl or a
6,6-bicyclic heteroaryl.
[0125] In certain embodiments, R.sup.A is a 6-membered heteroaryl.
In certain embodiments, R.sup.A is a 6-membered heteroaryl selected
from pyridinyl. In certain embodiments, R.sup.A is 2-pyridinyl,
3-pyridinyl or 4-pyridinyl.
[0126] In certain embodiments, R.sup.A is a 2-pyridinyl wherein
W--R.sup.1 is N, and W--R.sup.2, W--R.sup.3, W--R.sup.4, and
W--R.sup.5 are C--R.sup.2, C--R.sup.3, C--R.sup.4 and C--R.sup.5,
respectively, e.g., of the formula (iii).
[0127] In certain embodiments, R.sup.A is a 3-pyridinyl wherein
W--R.sup.2 is N, and W--R.sup.1, W--R.sup.3, W--R.sup.4, and
W--R.sup.5 are C--R.sup.1, C--R.sup.3, C--R.sup.4 and C--R.sup.5,
respectively, e.g., of the formula (Iv).
[0128] In certain embodiments, R.sup.A is a 4-pyridinyl wherein
W--R.sup.3 is N, and W--R.sup.1, W--R.sup.2, W--R.sup.4, and
W--R.sup.5 are C--R.sup.1, C--R.sup.2, C--R.sup.4 and C--R.sup.5,
respectively, e.g., of the formula (v).
##STR00010##
[0129] wherein R.sup.1, R.sup.2, R.sup.3, R.sup.4 and R.sup.5 are
as defined above and herein.
[0130] In certain embodiments, R.sup.A is a monosubstituted or
disubstituted pyridinyl.
[0131] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl.
[0132] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (iii) wherein R.sup.3, R.sup.4, R.sup.5
are hydrogen and R.sup.2 is not hydrogen, e.g., of the formula
(iii-a).
[0133] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (iii) wherein R.sup.2, R.sup.4, R.sup.5
are hydrogen and R.sup.3 is not hydrogen, e.g., of the formula
(iii-b).
[0134] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (iii) wherein R.sup.2, R.sup.3, R.sup.5
are hydrogen and R.sup.4 is not hydrogen, e.g., of the formula
(iii-c).
[0135] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (iii) wherein R.sup.2, R.sup.3, R.sup.4
are hydrogen and R.sup.5 is not hydrogen, e.g., of the formula
(iii-d).
##STR00011##
[0136] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (Iv) wherein R.sup.3, R.sup.4, R.sup.5 are
hydrogen and R.sup.1 is not hydrogen, e.g., of the formula
(iv-a).
[0137] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (Iv) wherein R.sup.1, R.sup.4, R.sup.5 are
hydrogen and R.sup.3 is not hydrogen, e.g., of the formula
(iv-b).
[0138] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (Iv) wherein R.sup.1, R.sup.3, R.sup.5 are
hydrogen and R.sup.4 is not hydrogen, e.g., of the formula
(iv-c).
[0139] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (Iv) wherein R.sup.1, R.sup.3, R.sup.4 are
hydrogen and R.sup.5 is not hydrogen, e.g., of the formula
(iv-d).
##STR00012##
[0140] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (v) wherein R.sup.2, R.sup.4, R.sup.5 are
hydrogen and R.sup.1 is not hydrogen, e.g., of the formula
(v-a).
[0141] In certain embodiments, R.sup.A is a monosubstituted
pyridinyl of the formula (v) wherein R.sup.1, R.sup.4, R.sup.5 are
hydrogen and R.sup.2 is not hydrogen, e.g., of the formula
(v-b).
##STR00013##
[0142] In certain embodiments, R.sup.A is a disubstituted
pyridinyl.
[0143] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.3 and R.sup.4 are hydrogen and
R.sup.2 and R.sup.5 are not hydrogen, e.g., of the formula
(iii-e).
[0144] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.2 and R.sup.4 are hydrogen and
R.sup.3 and R.sup.5 are not hydrogen, e.g., of the formula
(iii-f).
[0145] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.2 and R.sup.3 are hydrogen and
R.sup.4 and R.sup.5 are not hydrogen, e.g., of the formula
(iii-g).
[0146] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.3 and R.sup.5 are hydrogen and
R.sup.2 and R.sup.4 are not hydrogen, e.g., of the formula
(iii-h).
[0147] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.4 and R.sup.5 are hydrogen and
R.sup.2 and R.sup.3 are not hydrogen, e.g., of the formula
(iii-i).
[0148] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (iii) wherein R.sup.2 and R.sup.5 are hydrogen and
R.sup.3 and R.sup.4 are not hydrogen, e.g., of the formula
(iii-j).
##STR00014##
[0149] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.3 and R.sup.4 are hydrogen and
R.sup.1 and R.sup.5 are not hydrogen, e.g., of the formula
(iv-e).
[0150] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.3 and R.sup.5 are hydrogen and
R.sup.1 and R.sup.4 are not hydrogen, e.g., of the formula
(iv-f).
[0151] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.4 and R.sup.5 are hydrogen and
R.sup.1 and R.sup.3 are not hydrogen, e.g., of the formula
(iv-g).
[0152] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.1 and R.sup.4 are hydrogen and
R.sup.3 and R.sup.5 are not hydrogen, e.g., of the formula
(iv-h).
[0153] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.1 and R.sup.5 are hydrogen and
R.sup.3 and R.sup.4 are not hydrogen, e.g., of the formula
(iv-i).
[0154] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (Iv) wherein R.sup.1 and R.sup.3 are hydrogen and
R.sup.4 and R.sup.5 are not hydrogen, e.g., of the formula
(iv-j).
##STR00015##
[0155] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (v) wherein R.sup.2 and R.sup.4 are hydrogen and
R.sup.1 and R.sup.5 are not hydrogen, e.g., of the formula
(v-c).
[0156] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (v) wherein
[0157] R.sup.4 and R.sup.5 are hydrogen and R.sup.1 and R.sup.2 are
not hydrogen, e.g., of the formula (v-d).
[0158] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (v) wherein
[0159] R.sup.2 and R.sup.5 are hydrogen and R.sup.1 and R.sup.4 are
not hydrogen, e.g., of the formula (v-e).
[0160] In certain embodiments, R.sup.A is a disubstituted pyridinyl
of the formula (v) wherein
[0161] R.sup.1 and R.sup.5 are hydrogen and R.sup.2 and R.sup.4 are
not hydrogen, e.g., of the formula (v-f).
##STR00016##
[0162] In certain embodiments, R.sup.A is a 5,6-bicyclic
heteroaryl.
[0163] For example, in certain embodiments, R.sup.A is a
5,6-bicyclic heteroaryl group of the formula (vi) (which is a
subset of a group of the formula (ii-g)):
##STR00017##
[0164] wherein R.sup.1, R.sup.2, R.sup.3 are as defined above and
herein and R.sup.4 and R.sup.5 are joined to form a 5-membered
heteroaryl ring;
[0165] V, Y and Z are independently selected from CR.sup.A4, O, S,
N, or NR.sup.A5;
[0166] each R.sup.A4 is, independently, selected from hydrogen,
halogen, --CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H,
--OH, --OR.sup.A6, --ON(R.sup.A7).sub.2, --N(R.sup.A7).sub.2,
--N(OR.sup.A6)R.sup.A8, --SH, --SR.sup.A6, --SSR.sup.A8,
--C(.dbd.O)R.sup.A6, --CO.sub.2H, --CHO, --C(OR.sup.A8).sub.2,
--CO.sub.2R.sup.A6, --OC(.dbd.O)R.sup.A6, --OCO.sub.2R.sup.A6,
--C(.dbd.O)N(R.sup.A7).sub.2, --OC(.dbd.O)N(R.sup.A7).sub.2,
--NR.sup.A7C(.dbd.O)R.sup.A6,
--NR.sup.A6NR.sup.A6C(.dbd.NR.sup.A7)OR.sup.A6,
--OC(.dbd.NR.sup.A7)R.sup.A6, --OC(.dbd.NR.sup.A7)OR.sup.A6,
--C(.dbd.NR.sup.A)N(R.sup.A7).sub.2,
--OC(.dbd.NR.sup.A)N(R.sup.A7).sub.2,
--NR.sup.A7C(.dbd.NR.sup.A7)N(R.sup.A7).sub.2,
--C(.dbd.O)NR.sup.A7SO.sub.2R.sup.A6, --NR.sup.A7SO.sub.2R.sup.A6,
--SO.sub.2N(R.sup.A7).sub.2, --SO.sub.2R.sup.A6,
--SO.sub.2OR.sup.A6, --OSO.sub.2R.sup.A6, --S(.dbd.O)R.sup.A6,
--OS(.dbd.O)R.sup.A6, --Si(R.sup.A6).sub.3,
--OSi(R.sup.A6).sub.3--C(.dbd.S)N(R.sup.A7).sub.2,
--C(.dbd.O)SR.sup.A6, --C(.dbd.S)SR.sup.A6, --SC(.dbd.S)SR.sup.A6,
--P(.dbd.O).sub.2R.sup.A6, --OP(.dbd.O).sub.2R.sup.A6,
--P(.dbd.O)(R.sup.A6).sub.2, --OP(.dbd.O)(R.sup.A6).sub.2,
--OP(.dbd.O)(OR.sup.A8).sub.2, --P(.dbd.O).sub.2N(R.sup.A7).sub.2,
--OP(.dbd.O).sub.2N(R.sup.A7).sub.2, --P(.dbd.O)(NR.sup.A7).sub.2,
--OP(.dbd.O)(NR.sup.A7).sub.2,
--NR.sup.A7P(.dbd.O)(OR.sup.A8).sub.2,
--NR.sup.A7P(.dbd.O)(NR.sup.A7).sub.2, --P(R.sup.A8).sub.2,
--P(R.sup.A8).sub.3, --OP(R.sup.A8).sub.2, --OP(R.sup.A8).sub.3,
--B(OR.sup.A8).sub.2, or --BR.sup.A6(OR.sup.A8), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0167] each R.sup.A6 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0168] each R.sup.A5 and R.sup.A7 is, independently, selected from
hydrogen, --OH, --OR.sup.A6, --N(R.sup.A7).sub.2, --CN,
--C(.dbd.O)R.sup.A6, --C(.dbd.O)N(R.sup.A7).sub.2,
--CO.sub.2R.sup.A6, --SO.sub.2R.sup.A7,
--C(.dbd.NR.sup.A3)OR.sup.A6, --C(.dbd.NR.sup.A7)N(R.sup.A7).sub.2,
--SO.sub.2N(R.sup.A3).sub.2, --SO.sub.2R.sup.A6,
--SO.sub.2OR.sup.A8, --SOR.sup.A6, --C(.dbd.S)N(R.sup.A7).sub.2,
--C(.dbd.O)SR.sup.A8, --C(.dbd.S)SR.sup.A8,
--P(.dbd.O).sub.2R.sup.A6, --P(.dbd.O)(R.sup.A6).sub.2,
--P(.dbd.O).sub.2N(R.sup.A8).sub.2, --P(.dbd.O)(NR.sup.A8).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.A7 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0169] each R.sup.A8 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.A8 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring; and
the dashed line represents a double or single bond.
[0170] In certain embodiments, R.sup.1 is hydrogen. In certain
embodiments, R.sup.2 is hydrogen. In certain embodiments, R.sup.3
is hydrogen. In certain embodiments, R.sup.1, R.sup.2 and R.sup.3
are hydrogen.
[0171] In certain embodiments, R.sup.A is a heteroaryl group of the
formulae (vi-a) or (vi-b):
##STR00018##
[0172] wherein R.sup.1, R.sup.2, R.sup.3 are as defined above and
herein and Vand Z are independently selected from O, S and
NR.sup.A5.
[0173] In certain embodiments, wherein R.sup.A is a heteroaryl
group of the formulae (vi-a) or (vi-b), V and Z are 0 (i.e.,
benzoxazolyl). In certain embodiments, V and Z are S (i.e.,
benzthiazolyl). In certain embodiments, V and Z are NR.sup.A5
(i.e., imidazolyl).
[0174] In certain embodiments, R.sup.A is a heteroaryl group of the
formulae (vi-c) or (vi-d):
##STR00019##
[0175] wherein R.sup.1, R.sup.2, R.sup.3 are as defined above and
herein and V is independently selected from O, S and NR.sup.A5.
[0176] In certain embodiments, wherein R.sup.A is a heteroaryl
group of the formulae (vi-c) or (vi-d), V is O (i.e.,
benzisoxazolyl). In certain embodiments, V is S (i.e.,
benzisothiazolyl). In certain embodiments, V is NR.sup.A5 (i.e.,
indazolyl).
[0177] In certain embodiments, R.sup.A is a heteroaryl group of the
formulae (vi-e), (vi-f) or (vi-g):
##STR00020##
[0178] wherein R.sup.1, R.sup.2, R.sup.3 and R.sup.A4 are as
defined above and herein and V, Y and Z are independently selected
from O, S and NR.sup.A5.
[0179] In certain embodiments, wherein R.sup.A is a heteroaryl
group of the formulae (vi-e), (vi-f) or (vi-g), Y is O (i.e.,
benzofuranyl or isobenzofuranyl). In certain embodiments, Y is S
(i.e., benzothiophenyl or isobenzothiophenyl). In certain
embodiments, Y is NR.sup.A5 (i.e., indolyl or isoindolyl).
[0180] In certain embodiments, R.sup.A is a heteroaryl group of the
formula (vi-h):
##STR00021##
[0181] wherein R.sup.1, R.sup.2, R.sup.3 are as defined above and
herein and Y is independently selected from O, S and NR.sup.A5.
[0182] In certain embodiments, wherein R.sup.A is a heteroaryl
group of the formula (vi-e), Y is O (i.e., benzoxadiazolyl). In
certain embodiments, Y is S (i.e., benzthiadiazolyl). In certain
embodiments, Y is NR.sup.A5 (i.e., benztriazolyl).
Group X
[0183] As described generally above, X is selected from hydrogen,
--CN, --CHO, --C(.dbd.O)R.sup.X1, --C(.dbd.O)N(R.sup.X2).sub.2,
--CO.sub.2H, CO.sub.2R.sup.X1, --SO.sub.2R.sup.X1,
--C(.dbd.NR.sup.X2)OR.sup.X1, --C(.dbd.NR.sup.X2)N(R.sup.X2).sub.2,
--SO.sub.2N(R.sup.X2).sub.2, --SO.sub.2R.sup.X1, --SO.sub.3H,
--SO.sub.2OR.sup.X1, --SOR.sup.X1, --C(.dbd.S)N(R.sup.X2).sub.2,
--C(.dbd.O)SR.sup.X1, --C(.dbd.S)SR.sup.X1,
--P(.dbd.O).sub.2R.sup.X1, --P(.dbd.O)(R.sup.X1).sub.2,
P(.dbd.O).sub.2N(R.sup.X2).sub.2, --P(.dbd.O)(NR.sup.X2).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.1-10 alkenyl,
C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl; or X
and R.sup.A, together with the carbon atoms to which each is
attached, are joined to form a 5-10 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring;
[0184] each R.sup.X1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0185] each R.sup.X2 is, independently, selected from hydrogen,
--OH, --OR.sup.X1, --N(R.sup.X3).sub.2, --CN, --C(.dbd.O)R.sup.X1,
--C(.dbd.O)N(R.sup.X3).sub.2, --CO.sub.2R.sup.X1,
--SO.sub.2R.sup.X1, --C(.dbd.NR.sup.X3)OR.sup.X1,
--C(.dbd.NR.sup.X3)N(R.sup.X3).sub.2, --SO.sub.2N(R.sup.X3).sub.2,
--SO.sub.2R.sup.X3, --SO.sub.2OR.sup.X3, --SOR.sup.X1,
--C(.dbd.S)N(R.sup.X3).sub.2, --C(.dbd.O)SR.sup.X3,
--C(.dbd.S)SR.sup.X3, --P(.dbd.O).sub.2R.sup.X1,
--P(.dbd.O)(R.sup.X1).sub.2, P(.dbd.O).sub.2N(R.sup.X3).sub.2,
--(.dbd.O)(NR.sup.X3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl;
and
[0186] each R.sup.X3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl.
[0187] In certain embodiments, X is selected from hydrogen, --CN,
--CHO, --C(.dbd.O)R.sup.X1, --C(.dbd.O)N(R.sup.X2).sub.2,
--CO.sub.2H, CO.sub.2R.sup.X1, --SO.sub.2R.sup.X1,
--C(.dbd.NR.sup.X2)OR.sup.X1, --C(.dbd.NR.sup.X2)N(R.sup.X2).sub.2,
--SO.sub.2N(R.sup.X2).sub.2, --SO.sub.2R.sup.X1, --SO.sub.3H,
--SO.sub.2OR.sup.X1, --SOR.sup.X1, --C(.dbd.S)N(R.sup.X2).sub.2,
--C(.dbd.O)SR.sup.X1, --C(.dbd.S)SR.sup.X1,
--P(.dbd.O).sub.2R.sup.X1, --P(.dbd.O)(R.sup.X1).sub.2,
--P(.dbd.O).sub.2N(R.sup.X2).sub.2, --P(.dbd.O)(NR.sup.X2).sub.2,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
[0188] In certain embodiments, X is selected from hydrogen, --CN,
--CHO, --C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2,
--CO.sub.2H, --CO.sub.2R.sup.C1, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2, --C(.dbd.S)N(R.sup.C2).sub.2,
--C(.dbd.O)SR.sup.C1, --C(.dbd.S)SR.sup.C1, C.sub.1-10
perhaloalkyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
[0189] In certain embodiments, X is selected from hydrogen, --CN,
--C(.dbd.O)N(R.sup.X2).sub.2, --CO.sub.2R.sup.X1, and, C.sub.6-14
aryl.
[0190] In certain embodiments, X is selected from --CN,
--C(.dbd.O)N(R.sup.X2).sub.2, and --CO.sub.2R.sup.X1.
[0191] In certain embodiments, X is --CN.
Joined Groups R.sup.A and X
[0192] As described generally above, in certain embodiments,
R.sup.A and X, together with the carbon atoms to which each is
attached, are joined to form a 5-10 membered ring.
[0193] For example, in certain embodiments, R.sup.A and X, together
with the carbon atoms to which each is attached, are joined to form
a ring of the formula (I-b):
##STR00022##
[0194] wherein each group W--R.sup.70, W--R.sup.71, W--R.sup.72,
and W--R.sup.73 independently represents either a nitrogen atom (N)
or C--R.sup.70, C--R.sup.71, C--R.sup.72, or C--R.sup.73,
respectively; and
[0195] wherein R.sup.70, R.sup.71, R.sup.72 and R.sup.73 are
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.A9,
--ON(R.sup.A10).sub.2, --N(R.sup.A10).sub.2,
--N(OR.sup.A11)R.sup.A11, --SH, --SR.sup.A9, --SSR.sup.A11,
--C(.dbd.O)R.sup.A9, --CO.sub.2H, --CHO, --C(OR.sup.A11).sub.2,
--CO.sub.2R.sup.A9, --OC(.dbd.O)R.sup.A9, --OCO.sub.2R.sup.A9,
--C(.dbd.O)N(R.sup.A10).sub.2, --OC(.dbd.O)N(R.sup.A10).sub.2,
--NR.sup.10C(.dbd.O)R.sup.A9, --NR.sup.A10CO.sub.2R.sup.A9,
--NR.sup.A10C(.dbd.O)N(R.sup.A10).sub.2,
--C(.dbd.NR.sup.A10)OR.sup.A9, --OC(.dbd.NR.sup.A10)R.sup.A9,
--OC(.dbd.NR.sup.A10)OR.sup.A9,
--C(.dbd.NR.sup.A10)N(R.sup.A10).sub.2,
OC(.dbd.NR.sup.A10)N(R.sup.A10).sub.2,
--NR.sup.A10C(.dbd.NR.sup.A10)N(R.sup.A10).sub.2,
--C(.dbd.O)NR.sup.A10SO.sub.2R.sup.A9,
--NR.sup.A10SO.sub.2R.sup.A9, --SO.sub.2N(R.sup.A10).sub.2,
--SO.sub.2R.sup.A9, --SO.sub.2OR.sup.A9, --OSO.sub.2R.sup.A9,
--S(.dbd.O)R.sup.A9, --OS(.dbd.O)R.sup.A9, --Si(R.sup.A9).sub.3,
--OSi(R.sup.A9).sub.3--C(.dbd.S)N(R.sup.A10).sub.2,
--C(.dbd.O)SR.sup.A9, --C(.dbd.S)SR.sup.A9, --SC(.dbd.S)SR.sup.A9,
--P(.dbd.O).sub.2R.sup.A9, --OP(.dbd.O).sub.2R.sup.A9,
--P(.dbd.O)(R.sup.A9).sub.2, --OP(.dbd.O)(R.sup.A9).sub.2,
--OP(.dbd.O)(OR.sup.A11).sub.2,
--P(.dbd.O).sub.2N(R.sup.A10).sub.2,
--OP(.dbd.O).sub.2N(R.sup.A10).sub.2,
--P(.dbd.O)(NR.sup.A10).sub.2, --OP(.dbd.O)(NR.sup.A10).sub.2,
--NR.sup.A10P(.dbd.O)(OR.sup.A11).sub.2,
--NR.sup.A10P(.dbd.O)(NR.sup.A10).sub.2, --P(R.sup.A11).sub.2,
--P(R.sup.A11).sub.3, --OP(R.sup.A11).sub.2, --OP(R.sup.A11).sub.3,
--B(OR.sup.A11).sub.2, or --BR.sup.A9(OR.sup.A11), C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; or one or more of R.sup.1 and R.sup.2, R.sup.2 and
R.sup.3, R.sup.3 and R.sup.4 or R.sup.4 and R.sup.5 are joined to
form a C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl or 5-14 membered heteroaryl ring;
[0196] each R.sup.A9 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0197] each R.sup.A10 is, independently, selected from hydrogen,
--OH, --OR.sup.A9, --N(R.sup.A11).sub.2, --CN, --C(.dbd.O)R.sup.A9,
--C(.dbd.O)N(R.sup.A11).sub.2, --CO.sub.2R.sup.A9,
--SO.sub.2R.sup.A9, --C(.dbd.NR.sup.A11)OR.sup.A9,
--C(.dbd.NR.sup.A11)N(R.sup.A11).sub.2, SO.sub.2N(R.sup.A11).sub.2,
--SO.sub.2R.sup.A11, --SO.sub.2OR.sup.A11, --SOR.sup.A9,
--C(.dbd.S)N(R.sup.A11).sub.2, --C(.dbd.O)SR.sup.A11,
--C(.dbd.S)SR.sup.A11, --P(.dbd.O).sub.2R.sup.A9,
--P(.dbd.O)(R.sup.A9).sub.2, --P(.dbd.O).sub.2N(R.sup.A11).sub.2,
--P(.dbd.O)(NR.sup.A11).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.A10 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and
[0198] each R.sup.A11 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two RAIL groups are joined to form a 3-14
membered heterocyclyl or 5-14 membered heteroaryl ring.
[0199] In certain embodiments, each group W--R.sup.70, W--R.sup.71,
W--R.sup.72, and W--R.sup.73 independently represents C--R.sup.70,
C--R.sup.71, C--R.sup.72, or C--R.sup.73, respectively.
[0200] In certain embodiments, one of the groups W--R.sup.70,
W--R.sup.71, W--R.sup.72, and W--R.sup.73 represents a nitrogen
atom (N). For example, each group W--R.sup.70, W--R.sup.71, and
W--R.sup.72 represents C--R.sup.70, C--R.sup.71, C--R.sup.72,
respectively, and W--R.sup.73 represents a nitrogen atom (N).
Group R.sup.B
[0201] As described generally above, R.sup.B is selected from
C.sub.1-10 alkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14
membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl and 5-14 membered heteroaryl; or
R.sup.B and R.sup.C together with the nitrogen (N) atom to which
each is attached are joined to form a 5-14 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring.
[0202] In certain embodiments, R.sup.B is selected from C.sub.1-10
alkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl and 5-14 membered heteroaryl.
[0203] In certain embodiments, R.sup.B is an acyclic group, i.e.,
selected from C.sub.1-10 alkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl and 3-14 membered heteroaliphatic. In certain embodiments,
R.sup.B is C.sub.1-10 alkyl. In certain embodiments, R.sup.B is a
substituted C.sub.1-10 alkyl, e.g., a C.sub.1-10 aralkyl group. In
certain embodiments, R.sup.B is a C.sub.1-2 aralkyl, e.g., for
example, a substituted or unsubstituted benzyl group (C.sub.1
aralkyl) or substituted or unsubstituted phenylethyl group (C.sub.2
aralkyl). In certain embodiments, R.sup.B is a C.sub.1-10
heteroaralkyl. In certain embodiments, R.sup.B is alkenyl. In
certain embodiments, R.sup.B is alkynyl. In certain embodiments,
R.sup.B is 3-14 membered heteroaliphatic.
[0204] Alternatively, in certain embodiments, R.sup.B is a cyclic
group, i.e., selected from C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl and 5-14 membered heteroaryl.
[0205] In certain embodiments, R.sup.B is C.sub.3-10 carbocyclyl or
3-14 membered heterocyclyl.
[0206] In certain embodiments, R.sup.B is C.sub.3-10 carbocyclyl.
Exemplary carbocyclyl groups include, but are not limited to,
cyclopropyl (C.sub.3), cyclobutyl (C.sub.4), cyclopentyl (C.sub.5),
cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl
(C.sub.6), cyclohexadienyl (C.sub.6), cycloheptyl (C.sub.7),
cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7) and
cyclooctyl (C.sub.8).
[0207] In certain embodiments, R.sup.B is 3-14 membered
heterocyclyl. Exemplary heterocyclyl groups include, but are not
limited to, azirdinyl, oxiranyl, thiorenyl, azetidinyl, oxetanyl,
thietanyl, tetrahydrofuranyl, dihydrofuranyl, tetrahydrothiophenyl,
dihydrothiophenyl, pyrrolidinyl, dihydropyrrolyl, dioxolanyl,
oxathiolanyl and dithiolanyl, piperidinyl, tetrahydropyranyl,
dihydropyridinyl, thianyl, piperazinyl, morpholinyl, dithianyl,
dioxanyl, azepanyl, oxepanyl thiepanyl, azocanyl, oxecanyl and
thiocanyl.
[0208] In certain embodiments, R.sup.B is C.sub.6-14 aryl or 5-14
membered heteroaryl.
[0209] In certain embodiments, R.sup.B is C.sub.6-14 aryl.
Exemplary aryl groups include, but are not limited to, phenyl,
naphthyl and anthracyl. In certain embodiments, R.sup.B is phenyl
(C.sub.6 aryl). In certain embodiments, R.sup.B is unsubstituted
phenyl. In certain embodiments, R.sup.B is naphthyl (C.sub.10
aryl).
[0210] In certain embodiments, R.sup.B is 5-14 membered heteroaryl.
In certain embodiments, R.sup.B is 5-10 membered heteroaryl. In
certain embodiments, R.sup.B is 5-6 membered heteroaryl. In certain
embodiments, R.sup.B is a 5,6-bicyclic heteroaryl. In certain
embodiments, R.sup.B is a 6,6-bicyclic heteroaryl.
[0211] In certain embodiments, R.sup.B is a 5-membered heteroaryl
group. Exemplary 5-membered heteroaryl groups include, but are not
limited to, pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl,
oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl,
oxadiazolyl, thiadiazolyl and tetrazolyl.
[0212] In certain embodiments, R.sup.B is a 6-membered heteroaryl
group. Exemplary 6-membered heteroaryl groups include, but are not
limited to, pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl,
triazinyl and tetrazinyl.
[0213] In certain embodiments, R.sup.B is a 5,6-bicyclic heteroaryl
group. Exemplary 5,6-bicyclic heteroaryl groups include, but are
not limited to, indolyl, isoindolyl, indazolyl, benztriazolyl,
benzothiophenyl, isobenzothiophenyl, benzofuranyl, benzoisofuranyl,
benzimidazolyl, benzoxazolyl, benzisoxazolyl, benzoxadiazolyl,
benzthiazolyl, benzisothiazolyl, benzthiadiazolyl, indolizinyl, and
purinyl.
[0214] In certain embodiments, R.sup.B is a 6,6-bicyclic heteroaryl
group. Exemplary 6,6-bicyclic heteroaryl groups include, but are
not limited to, naphthyridinyl, pteridinyl, quinolinyl,
isoquinolinyl, cinnolinyl, quinoxalinyl, phthalazinyl and
quinazolinyl.
[0215] In certain embodiments, R.sup.B is substituted with the
group:
-L-R.sup.D
[0216] wherein:
[0217] L is a covalent bond or a divalent C.sub.1-10 hydrocarbon
chain, wherein one, two or three methylene units of L are
optionally and independently replaced with one or more --O--,
--S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--, --C(.dbd.O)--,
--C(.dbd.S)--, --S(.dbd.O)--, --S(.dbd.O).sub.2--, divalent
C.sub.3-10 carbocyclyl, divalent 3-14 membered heterocyclyl,
divalent C.sub.6-14 aryl or divalent 5-14 membered heteroaryl
group;
[0218] R.sup.D is selected from --CN, --NO.sub.2, --N.sub.3,
--SO.sub.2H, --SO.sub.3H, --C(.dbd.O)R.sup.B7, --CO.sub.2H, --CHO,
--C(OR.sup.B9).sub.2, --CO.sub.2R.sup.B7,
--OC(.dbd.O)R.sup.B7--OCO.sub.2R.sup.B7,
--C(.dbd.O)N(R.sup.B8).sub.2, --OC(.dbd.O)N(R.sup.B8).sub.2,
--NR.sup.B8C(.dbd.O)R.sup.B7, --NR.sup.B8CO.sub.2R.sup.B7,
--NR.sup.B8C(.dbd.O)N(R.sup.B8).sub.2,
--C(.dbd.NR.sup.B8)OR.sup.B7, --OC(--OC(.dbd.NR.sup.B8)OR.sup.B7,
--C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--OC(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--NR.sup.B8C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--C(.dbd.O)NR.sup.B8SO.sub.2R.sup.B7, --NR.sup.B8SO.sub.2R.sup.B7,
--SO.sub.2N(R.sup.B8).sub.2, --SO.sub.2R.sup.B7,
--SO.sub.2OR.sup.B7, --OSO.sub.2R.sup.B7, --S(.dbd.O)R.sup.B7,
--OS(.dbd.O)R.sup.B7, C(.dbd.S)N(R.sup.B8).sub.2,
--C(.dbd.O)SR.sup.B7, --C(.dbd.S)SR.sup.B7, --SC(.dbd.S)SR.sup.B7,
--P(.dbd.O).sub.2R.sup.B7, --OP(.dbd.O).sub.2R.sup.B7,
--P(.dbd.O)(R.sup.B7).sub.2, --OP(.dbd.O)(R.sup.B7).sub.2,
--OP(.dbd.O)(OR.sup.B9).sub.2, --P(.dbd.O).sub.2N(R.sup.B8).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B8).sub.2, --P(.dbd.O)(NR.sup.B8).sub.2,
--OP(.dbd.O)(NR.sup.B8).sub.2,
--NR.sup.B8P(.dbd.O)(OR.sup.B9).sub.2,
--NR.sup.B8P(.dbd.O)(NR.sup.B8).sub.2--B(OR.sup.B9).sub.2,
--BR.sup.B7(OR.sup.B9), and tetrazolyl;
[0219] each R.sup.B7 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0220] each R.sup.B8 is, independently, selected from hydrogen,
--OH, --OR.sup.B7, --N(R.sup.B9).sub.2, --CN, --C(.dbd.O)R.sup.B7,
--C(.dbd.O)N(R.sup.B9).sub.2, --CO.sub.2R.sup.B7,
--SO.sub.2R.sup.B7, --C(.dbd.NR.sup.B9)OR.sup.B7,
--C(.dbd.NR.sup.B9)N(R.sup.B9).sub.2, --SO.sub.2N(R.sup.B9).sub.2,
--SO.sub.2R.sup.B9, --SO.sub.2OR.sup.B9, --SOR.sup.B7,
--C(.dbd.S)N(R.sup.B9).sub.2, --C(.dbd.O)SR.sup.B9,
--C(.dbd.S)SR.sup.B9, --P(.dbd.O).sub.2R.sup.B7,
--P(.dbd.O)(R.sup.B7).sub.2, --P(.dbd.O).sub.2N(R.sup.B9).sub.2,
--P(.dbd.O)(NR.sup.B9).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B8 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and
[0221] each R.sup.B9 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B9 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring.
[0222] In certain embodiments, L is a covalent bond.
[0223] In certain embodiments, L is a divalent C.sub.1-10
hydrocarbon chain, wherein one, two or three methylene units of L
are optionally and independently replaced with one or more --O--,
--S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--, --C(.dbd.O)--,
--C(.dbd.S)--, --S(.dbd.O)--, --S(.dbd.O).sub.2--, divalent
carbocyclyl, divalent heterocyclyl, divalent aryl or divalent
heteroaryl group.
[0224] In certain embodiments, L is a divalent C.sub.1-10
hydrocarbon chain, wherein one, two or three methylene units of L
are optionally and independently replaced with one or more --O--,
--S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--, --C(.dbd.O)--,
--C(.dbd.S)--, --S(.dbd.O)--, --S(.dbd.O).sub.2--, divalent
C.sub.3-10 carbocyclyl, divalent 3-14 membered heterocyclyl,
divalent C.sub.6-14 aryl or divalent 5-14 membered heteroaryl
group.
[0225] As generally described above, R.sup.D is selected from --CN,
--NO.sub.2, --SO.sub.2H, --SO.sub.3H, --C(.dbd.O)R.sup.B7,
--CO.sub.2H, --CHO, --C(OR.sup.B9).sub.2, --CO.sub.2R.sup.B7,
--OC(.dbd.O)R.sup.B7, --OCO.sub.2R.sup.B7,
--C(.dbd.O)N(R.sup.B8).sub.2, --OC(.dbd.O)N(R.sup.B8).sub.2,
--NR.sup.B8C(.dbd.O)R.sup.B7, --NR.sup.B8CO.sub.2R.sup.B7,
--NR.sup.B8C(.dbd.O)N(R.sup.B8).sub.2, --C(NR.sup.B8)OR.sup.B7,
--OC(.dbd.NR.sup.B8)R.sup.B7, --OC(.dbd.NR.sup.B8)OR.sup.B7,
--C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--OC(.dbd.NR.sup.B8)N((R.sup.B8).sub.2,
--NR.sup.B8C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2),
--C(.dbd.O)NR.sup.B8SO.sub.2R.sup.B7, --NR.sup.B8SO.sub.2R.sup.B7,
--SO.sub.2N(R.sup.B8).sub.2, --SO.sub.2R.sup.B7,
--SO.sub.2R.sup.B7, --SO.sub.2OR.sup.B7, --OSO.sub.2R.sup.B7,
--S(.dbd.O)R.sup.B7, --OS(.dbd.O)R.sup.B7,
--C(.dbd.S)N(R.sup.B8).sub.2, --C(.dbd.O)SR.sup.B7,
--C(.dbd.S)SR.sup.B7, --SC(.dbd.S)SR.sup.B7,
--P(.dbd.O).sub.2R.sup.B7, --OP(.dbd.O).sub.2R.sup.B7,
--P(.dbd.O)(R.sup.B7).sub.2, --OP(.dbd.O)(R.sup.B7).sub.2,
--OP(.dbd.O)(OR.sup.B9).sub.2, --P(.dbd.O).sub.2N(R.sup.B8).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B8).sub.2, --P(.dbd.O)(NR.sup.B8).sub.2,
--OP(.dbd.O)(NR.sup.B8).sub.2,
--NR.sup.B8P(.dbd.O)(OR.sup.B9).sub.2,
--NR.sup.B8P(.dbd.O)(NR.sup.B8).sub.2, --B(OR.sup.B9).sub.2,
--BR.sup.B7(OR.sup.B9) and tetrazolyl.
[0226] However, in certain embodiments, R.sup.D is not
--CO.sub.2R.sup.B7 (e.g., CO.sub.2Me, CO.sub.2Et, CO.sub.2nPr,
CO.sub.2iPr, CO.sub.2tBu), but can be selected from any of the
other substituents listed above. In certain embodiments, R.sup.D is
not --C(.dbd.O)R.sup.B7, but can be selected from any of the other
substituents listed above. In certain embodiments, R.sup.D is not
--CHO, but can be selected from any of the other substituents
listed above. In certain embodiments, R.sup.D is not
--C(OR.sup.B9).sub.2, but can be selected from any of the other
substituents listed above. In certain embodiments, R.sup.D is not
--CN, but can be selected from any of the other substituents listed
above. In certain embodiments, R.sup.D is not --NO.sub.2, but can
be selected from any of the other substituents listed above. In
certain embodiments, R.sup.D is not any one of --SO.sub.2H,
--SO.sub.3H, --SO.sub.2N(R.sup.B8).sub.2,
--NR.sup.B8SO.sub.2R.sup.B7, --SO.sub.2R.sup.B7,
--SO.sub.2OR.sup.B7, --OSO.sub.2R.sup.B7, --S(.dbd.O)R.sup.B7 or
--OS(.dbd.O)R.sup.B7, but can be selected from any of the other
substituents listed above. In certain embodiments, R.sup.D is not
any one of -OC(.dbd.O)R.sup.B7, --OCO.sub.2R.sup.B7,
--OC(.dbd.O)N(R.sup.B8).sub.2, --NR.sup.B8C(.dbd.O)R.sup.B7,
--NR.sup.B8CO.sub.2R.sup.B7--OC(.dbd.NR.sup.B8)R.sup.B7,
--OC(.dbd.NR.sup.B8)OR.sup.B7, OC(NR.sup.B8)N(R.sup.B8).sub.2 or
--NR.sup.B8C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2, but can be selected
from any of the other substituents listed above. In certain
embodiments, R.sup.D is not any one of
--C(.dbd.S)N(R.sup.B8).sub.2, C(.dbd.O)SR.sup.B7,
--C(.dbd.S)SR.sup.B7 or --SC(.dbd.S)SR.sup.B7, but can be selected
from any of the other substituents listed above. In certain
embodiments, R.sup.D is not any one of --P(.dbd.O).sub.2R.sup.B7,
--OP(.dbd.O).sub.2R.sup.B7, --P(.dbd.O)(R.sup.B7).sub.2,
OP(.dbd.O)(R.sup.B7).sub.2, --OP(.dbd.O)(OR.sup.B9).sub.2,
--P(.dbd.O).sub.2N(R.sup.B8).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B8).sub.2, --P(.dbd.O)(NR.sup.B8).sub.2,
--OP(.dbd.O)(NR.sup.B8).sub.2,
--NR.sup.B8P(.dbd.O)(OR.sup.B9).sub.2 or
--NR.sup.B8P(.dbd.O)(NR.sup.B8).sub.2, but can be selected from any
of the other substituents listed above. In certain embodiments,
R.sup.D is not any one of --B(OR.sup.B9).sub.2 or
--BR.sup.B7(OR.sup.B9), but can be selected from any of the other
substituents listed above. In certain embodiments, R.sup.D is not
tetrazolyl, but can be selected from any of the other substituents
listed above.
[0227] In certain embodiments, R.sup.D is selected from --CN,
--NO.sub.2, --SO.sub.2H, --SO.sub.3H, --C(.dbd.O)R.sup.B7,
--CO.sub.2H, --CHO, --CO.sub.2R.sup.B7,
--C(.dbd.O)N(R.sup.B8).sub.2, --C(.dbd.NR.sup.B8)OR.sup.B7,
--C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--C(.dbd.O)NR.sup.B8SO.sub.2R.sup.B7, --SO.sub.2N(R.sup.B8).sub.2,
--SO.sub.2R.sup.B7, --SO.sub.2OR.sup.B7, --S(.dbd.O)R.sup.B7,
--C(.dbd.S)N(R.sup.B8).sub.2, --C(.dbd.O)SR.sup.B7,
--C(.dbd.S)SR.sup.B7, --P(.dbd.O).sub.2R.sup.B7,
--P(.dbd.O)(R.sup.B7).sub.2, --P(.dbd.O).sub.2N(R.sup.B8).sub.2,
--P(.dbd.O)(NR.sup.B8).sub.2, --B(OR.sup.B9).sub.2,
--BR.sup.B7(OR.sup.B9) and tetrazolyl. In certain embodiments, L is
a covalent bond.
[0228] In certain embodiments, R.sup.D is selected from
--C(.dbd.O)R.sup.B7, --CO.sub.2H, --CHO, --CO.sub.2R.sup.B7,
--C(.dbd.O)N(R.sup.B8).sub.2, --C(.dbd.NR.sup.B8)OR.sup.B7,
--C(.dbd.NR.sup.B8)N(R.sup.B8).sub.2,
--C(.dbd.O)NR.sup.B8SO.sub.2R.sup.B7, --C(.dbd.S)N(R.sup.B8).sub.2,
--C(.dbd.O)SR.sup.B7 and --C(.dbd.S)SR.sup.B7.
[0229] In certain embodiments, R.sup.D is selected from
--C(.dbd.O)R.sup.B7, --CO.sub.2H, --CHO, and
--CO.sub.2R.sup.B7.
[0230] In certain embodiments, R.sup.D is --CO.sub.2H.
[0231] In certain embodiments, L is a divalent C.sub.1-10
hydrocarbon chain, wherein one, two or three methylene units of L
are optionally and independently replaced with one or more --O--,
--S--, --NR.sup.B8--, --(C.dbd.NR.sup.B8)--, --C(.dbd.O)--,
--C(.dbd.S)--, --S(.dbd.O)--, --S(.dbd.O).sub.2--, divalent
C.sub.3-10 carbocyclyl, divalent 3-14 membered heterocyclyl,
divalent C.sub.6-14 aryl or divalent 5-14 membered heteroaryl
group; and
[0232] R.sup.D is selected from --C(.dbd.O)R.sup.B7, --CO.sub.2H,
--CHO, and --CO.sub.2R.sup.B7; wherein R.sup.B7 is selected from
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl.
[0233] In certain embodiments, wherein R.sup.B is substituted with
-L-R.sup.D, R.sup.B is further substituted with the group:
--R.sup.E
[0234] wherein:
[0235] R.sup.E is selected from halogen, --OH, --OR.sup.B10,
--ON(R.sup.11).sub.2, --N(R.sup.B11).sub.2,
--N(OR.sup.B12)R.sup.B12, --SH, --SR.sup.B10, --SSR.sup.B12,
--OC(.dbd.O)R.sup.B10, --OCO.sub.2R.sup.B10,
--OC(.dbd.O)N(R.sup.B11).sub.2, --NR.sup.B11C(.dbd.O)R.sup.B10,
--NR.sup.B11CO.sub.2R.sup.B10,
NR.sup.B11C(.dbd.O)N(R.sup.B11).sub.2,
--OC(.dbd.NR.sup.B11)R.sup.B10, --OC(.dbd.NR.sup.B11)OR.sup.B10,
--OC(.dbd.NR.sup.B11)N(R.sup.B11).sup.2,
--NR.sup.B11C(NR.sup.B11)N(R.sup.B11).sub.2,
NR.sup.B11SO.sub.2R.sup.B10, --OSO.sub.2R.sup.B10,
--OS(.dbd.O)R.sup.B10, Si(R.sup.B10).sup.3, --OSi(R.sup.B10).sub.3,
--SC(S)SR.sup.B10, --OP(.dbd.O).sub.2R.sup.B10,
--OP(.dbd.O)(R.sup.B10).sub.2, --OP(.dbd.O)(OR.sup.B12).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B11).sub.2,
--OP(.dbd.O)(NR.sup.B11).sub.2,
--NR.sup.B11P(.dbd.O)(OR.sup.B12).sub.2,
--NR.sup.B11P(.dbd.O)(NR.sup.B11).sub.2, --P(R.sup.B12).sub.2,
P(R.sup.B12).sub.3, --OP(R.sup.B12).sub.2, OP(R.sup.B12).sub.3),
3-14 membered heterocyclyl and 5-14 membered heteroaryl, wherein
the point of attachment of the 3-14 membered heterocyclyl or 5-14
membered heteroaryl group is on a nitrogen atom;
[0236] each R.sup.B10 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0237] each R.sup.B11 is, independently, selected from hydrogen,
--OH, --OR.sup.B10, --N(R.sup.B12).sup.2, --CN,
--C(.dbd.O)R.sup.B10, --C(.dbd.O)N(R.sup.B12).sub.2,
--CO.sub.2R.sup.B10, --SO.sub.2R.sup.B10,
--C(.dbd.NR.sup.B12)OR.sup.B10,
C(.dbd.NR.sup.B12N(R.sup.B12).sub.2, --SO.sub.2N(R.sup.B12).sub.2,
--SO.sub.2R.sup.B12, --SO.sub.2OR.sup.B12, --SOR.sup.B10,
--C(.dbd.S)N(R.sup.B12).sub.2, --C(.dbd.O)SR.sup.B12,
--C(.dbd.S)SR.sup.B12, P(O).sub.2R.sup.B10,
--P(.dbd.O)(R.sup.B10).sub.2, --P(O).sub.2N(R.sup.B12).sub.2,
--P(.dbd.O)NR.sup.B12).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B11 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and
[0238] each R.sup.B12 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B12 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring.
[0239] In certain embodiments, R.sup.E is selected from halogen,
--OH, --OR.sup.B10, ON(R.sup.B11).sup.2, --N(R.sup.B11).sub.2),
--N(OR.sup.B12)R.sup.B12, --SH, --SR.sup.B10, --SSR.sup.B12,
--Si(R.sup.B10).sub.3, OSi(R.sup.B10).sub.3, --P(R.sup.B12).sub.2,
--P(R.sup.B12).sub.3, --OP(R.sup.B12).sub.2, --OP(R.sup.B12).sub.3,
3-14 membered heterocyclyl and 5-14 membered heteroaryl, wherein
the point of attachment of the 3-14 membered heterocyclyl or 5-14
membered heteroaryl group is on a nitrogen atom.
[0240] In certain embodiments, R.sup.E is selected from halogen,
--OH, --OR.sup.B10, --N(R.sup.B11).sub.2, 3-14 membered
heterocyclyl and 5-14 membered heteroaryl, wherein the point of
attachment of the 3-14 membered heterocyclyl or 5-14 membered
heteroaryl group is on a nitrogen atom.
[0241] In certain embodiments, R.sup.E is selected from halogen,
--OR.sup.B10 and --N(R.sup.B11).sub.2. In certain embodiments,
R.sup.E is halogen. In certain embodiments, R.sup.E is
--OR.sup.B10. In certain embodiments, R.sup.E is
--N(R.sup.B11).sub.2.
[0242] In certain embodiments, -L-R.sup.D and --R.sup.E are vicinal
R.sup.B substituents (i.e., attached to two adjacent atoms on the
group R.sup.B; e.g., ortho to each other). In certain embodiments,
-L-R.sup.D and --R.sup.E are ortho to each other.
[0243] In certain embodiments, -L-R.sup.D and --R.sup.E are not
vicinal R.sup.B substituents (i.e., not attached to two adjacent
atoms on the group R.sup.B; e.g., meta or para to each other). In
certain embodiments, -L-R.sup.D and --R.sup.E are meta to each
other. In certain embodiments, -L-R.sup.D and --R.sup.E are para to
each other.
[0244] In certain embodiments, the R.sup.B is a group of the
formula (vii):
##STR00023##
[0245] wherein each group W--R.sup.6, W--R.sup.7, W--R.sup.8,
W--R.sup.9, and W--R.sup.10 independently represents either a
nitrogen atom (N) or C--R.sup.6, C--R.sup.7, C--R.sup.8,
C--R.sup.9, or C--R.sup.10, respectively; and
[0246] wherein R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 are
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.B1,
--ON(R.sup.B2).sub.2, --N(R.sup.B2).sub.2, --N(OR.sup.B3)R.sup.B3,
--SH, --SR.sup.B1, --SSR.sup.B3, --C(.dbd.O)R.sup.B1, --CO.sub.2H,
--CHO, --C(OR.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--OC(.dbd.O)R.sup.B1, --OCO.sub.2R.sup.B1,
--C(.dbd.O)N(R.sup.B2).sub.2, --OC(.dbd.O)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.O)R.sup.B1, --NR.sup.B2CO.sub.2R.sup.B1,
--NR.sup.B2--C(.dbd.O)N(R.sup.B2).sub.2,
--C(.dbd.NR.sup.B2)OR.sup.B1, --OC(.dbd.NR.sup.B2)R.sup.B1,
--OC(.dbd.NR.sup.B2)OR.sup.B1,
--C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--OC(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--C(.dbd.O)NR.sup.B2SO.sub.2R.sup.B1, --NR.sup.B2SO.sub.2R.sup.B1,
--SO.sub.2N(R.sup.B2).sub.2, --SO.sub.2R.sup.B1,
--SO.sub.2OR.sup.B1, --OSO.sub.2R.sup.B1, --S(.dbd.O)R.sup.B1,
--OS(.dbd.O)R.sup.B1, --Si(R.sup.B1).sub.3,
--OSi(R.sup.B1).sub.3--C(.dbd.S)N(R.sup.B2).sub.2,
--C(.dbd.O)SR.sup.B1, --C(.dbd.S)SR.sup.B1, --SC(S)SR.sup.B1,
--P(.dbd.O).sub.2R.sup.B1, --OP(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --OP(.dbd.O)(R.sup.B1).sub.2,
--OP(.dbd.O)(OR.sup.B3).sub.2, --P(.dbd.O).sub.2N(R.sup.B2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B2).sub.2, --P(.dbd.O)(NR.sup.B2).sub.2,
--OP(.dbd.O)(NR.sup.B2).sub.2,
--NR.sup.B2P(.dbd.O)(OR.sup.B3).sub.2,
--NR.sup.B2P(.dbd.O)(NR.sup.B2).sub.2, --P(R.sup.B3).sub.2,
--P(R.sup.B3).sub.3, --OP(R.sup.B3).sub.2, --OP(R.sup.B3).sub.3,
--B(OR.sup.B3).sub.2, or --BR.sup.B1(OR.sup.B3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl,
-L-R.sup.D and --R.sup.E; or one or more of R.sup.6 and R.sup.7,
R.sup.7 and R.sup.8, R.sup.8 and R.sup.9 or R.sup.9 and R.sup.10
are joined to form a C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl or 5-14 membered heteroaryl ring; or
R.sup.10 and R.sup.C are joined to form a 3-14 membered
heterocyclyl or 5-14 membered heteroaryl ring;
[0247] each R.sup.B1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0248] each R.sup.B2 is, independently, selected from hydrogen,
--OH, --OR.sup.B1, --N(R.sup.B3).sub.2, --CN, --C(.dbd.O)R.sup.B1,
--C(.dbd.O)N(R.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--SO.sub.2R.sup.B1, --C(.dbd.NR.sup.B3)OR.sup.B1,
--C(.dbd.NR.sup.B3)N(R.sup.B3).sub.2, --SO.sub.2N(R.sup.B3).sub.2,
--SO.sub.2R.sup.B3, --SO.sub.2OR.sup.B3, --SOR.sup.B1,
--C(.dbd.S)N(R.sup.B3).sub.2, --C(.dbd.O)SR.sup.B3,
--C(.dbd.S)SR.sup.B3, --P(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --P(.dbd.O).sub.2N(R.sup.B3).sub.2,
--P(.dbd.O)(NR.sup.B3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring;
[0249] each R.sup.B3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B3 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0250] and L, R.sup.D and R.sup.E are as defined above and
herein.
[0251] In certain embodiments, the group of formula (vii)
represents a 6-14 membered heteroaryl group. In certain
embodiments, the group of formula (vii) represents a C.sub.6-14
aryl group. In certain embodiments, the C.sub.6-14 aryl group of
formula (vii) represents a phenyl group.
[0252] As used herein, when one or more of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 is referred to as "not hydrogen", it
is meant that one or more of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and
R.sup.10 is independently selected from halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.B1,
--ON(R.sup.B2).sub.2, --N(R.sup.B2).sub.2, --N(OR.sup.B3)R.sup.B3,
--SH, --SR.sup.B1, --SSR.sup.B3, --C(.dbd.O)R.sup.B1, --CO.sub.2H,
--CHO, --C(OR.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--OC(.dbd.O)R.sup.B1, --OCO.sub.2R.sup.B1,
--C(.dbd.O)N(R.sup.B2).sub.2, OC(.dbd.O)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.O)R.sup.B1, --NR.sup.B2CO.sub.2R.sup.B1,
--NR.sup.B2C(.dbd.O)N(R.sup.B2).sub.2,
--C(.dbd.NR.sup.B2)OR.sup.B1, --OC(.dbd.NR.sup.B2)R.sup.B1,
--OC(.dbd.NR.sup.B2)OR.sup.B1, --C(NR.sup.B2)N(R.sup.B2).sub.2,
--OC(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--C(.dbd.O)NR.sup.B2SO.sub.2R.sup.B1, --NR.sup.B2SO.sub.2R.sup.B1,
--SO.sub.2N(R.sup.B2).sub.2, --SO.sub.2R.sup.B1,
--SO.sub.2OR.sup.B1, --OSO.sub.2R.sup.B1, --S(.dbd.O)R.sup.B1,
--OS(.dbd.O)R.sup.B1, --Si(R.sup.B1).sub.3,
--OSi(R.sup.B1).sub.3--C(.dbd.S)N(R.sup.B2).sub.2,
--C(.dbd.O)SR.sup.B1, --C(.dbd.S)SR.sup.B1, --SC(.dbd.S)SR.sup.B1,
--P(.dbd.O).sub.2R.sup.B1, --OP(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --OP(.dbd.O)(R.sup.B1).sub.2,
--OP(.dbd.O)(OR.sup.B3).sub.2, --P(.dbd.O).sub.2N(R.sup.B2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B2).sub.2, --P(.dbd.O)(NR.sup.B2).sub.2,
--P(.dbd.O)NR.sup.B2).sub.2, --OP(.dbd.O)(NR.sup.B2).sub.2,
--NR.sup.B2P(.dbd.O)(OR.sup.B3).sub.2,
--NR.sup.B2P(.dbd.O)(NR.sup.B2).sub.2, --P(R.sup.B3).sub.2,
--P(R.sup.B3).sub.3, --OP(R.sup.B3).sub.2, --OP(R.sup.B3).sub.3,
--B(OR.sup.B3).sub.2, or --BR.sup.B1(OR.sup.B3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl, -L-R.sup.D or --R.sup.E; or wherein one or more of
R.sup.6 and R.sup.7, R.sup.7 and R.sup.8, R.sup.8 and R.sup.9 or
R.sup.9 and R.sup.10 are joined to form a C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl or 5-14 membered
heteroaryl ring, or wherein R.sup.10 and R.sup.C are joined to form
a 3-14 membered heterocyclyl or 5-14 membered heteroaryl ring.
[0253] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 is the group -L-R.sup.D as defined
above and herein. In certain embodiments, at least one of R.sup.6,
R.sup.7, R.sup.8, R.sup.9, and R.sup.10 is the group --R.sup.E as
defined herein. In certain embodiments, each of R.sup.6, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 is hydrogen.
[0254] In certain embodiments, the group of formula (vii)
represents a C.sub.6-14 aryl or a 6-14 membered heteroaryl group.
In certain embodiments, the group of formula (vii) represents a
6-14 membered heteroaryl group. In certain embodiments, the group
of formula (vii) represents a C.sub.6-14 aryl group. In certain
embodiments, the group of formula (vii) represents a phenyl
group.
[0255] In certain embodiments, W--R.sup.6, W--R.sup.7, W--R.sup.8,
W--R.sup.9, and W--R.sup.10 represent C--R.sup.6, C--R.sup.7,
C--R.sup.8, C--R.sup.9, or C--R.sup.10, respectively. For example,
in certain embodiments, R.sup.B is a group of the formula
(viii):
##STR00024##
[0256] wherein R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 are
as defined above and herein.
[0257] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 is the group -L-R.sup.D as defined
above and herein. In certain embodiments, at least one of R.sup.6,
R.sup.7, R.sup.8, R.sup.9, and R.sup.10 is the group --R.sup.E as
defined herein. In certain embodiments, each of R.sup.6, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 is hydrogen.
[0258] In certain embodiments, the group of the formula (viii)
represents a C.sub.6-14 aryl or a 6-14 membered heteroaryl group.
In certain embodiments, the group of the formula (viii) represents
a 6-14 membered heteroaryl group. In certain embodiments, the group
of the formula (viii) represents a C.sub.6-14 aryl group. In
certain embodiments, the C.sub.6-14 aryl group of the formula
(viii) represents a phenyl group.
[0259] In certain embodiments, R.sup.B is a monosubstituted,
disubstituted or trisubstituted group of the formula (viii). In
certain embodiments, R.sup.B is a monosubstituted or disubstituted
group of the formula (viii).
[0260] In certain embodiments, R.sup.B is a monosubstituted group
of the formula (viii).
[0261] For example, in certain embodiments, R.sup.B is an
ortho-substituted group of formula (viii), e.g., wherein
R.sup.6-R.sup.9 are hydrogen, and R.sup.10 is not hydrogen, e.g.,
of the formula (viii-a).
[0262] In certain embodiments, R.sup.B is a meta-substituted group
of the formula (viii), e.g., wherein R.sup.6-R.sup.8 and R.sup.10
are hydrogen and R.sup.9 is not hydrogen, e.g., of the formula
(viii-b).
[0263] In certain embodiments, R.sup.B is a para-substituted group
of the formula (viii), e.g., wherein R.sup.6, R.sup.7, R.sup.9 and
R.sup.10 are hydrogen and R.sup.8 is not hydrogen, e.g., of the
formula (viii-c).
##STR00025##
[0264] In certain embodiments, R.sup.B is a disubstituted group of
the formula (viii).
[0265] For example, in certain embodiments, R.sup.B is a
2,6-disubstituted group of the formula (viii), e.g., wherein
R.sup.7, R.sup.8 and R.sup.9 are hydrogen, and R.sup.6 and R.sup.10
are not hydrogen, e.g., of the formula (viii-d).
[0266] In certain embodiments, R.sup.B is a 2,5-disubstituted group
of the formula (viii), e.g., wherein R.sup.6, R.sup.8 and R.sup.9
are hydrogen, and R.sup.7 and R.sup.10 are not hydrogen, e.g., of
the formula (viii-e).
[0267] In certain embodiments, R.sup.B is a 2,4-disubstituted group
of the formula (viii), e.g., wherein R.sup.6, R.sup.7 and R.sup.9
are hydrogen, and R.sup.8 and R.sup.10 are not hydrogen, e.g., of
the formula (viii-f).
[0268] In certain embodiments, R.sup.B is a 2,3-disubstituted group
of formula (viii), e.g., wherein R.sup.6, R.sup.7 and R.sup.8 are
hydrogen, and R.sup.9 and R.sup.10 are not hydrogen, e.g., of the
formula (viii-g).
[0269] In certain embodiments, R.sup.B is a 3,4-disubstituted group
of the formula (viii), e.g., wherein R.sup.6, R.sup.7 and R.sup.10
are hydrogen, and R.sup.8 and R.sup.9 are not hydrogen, e.g., of
the formula (viii-h).
[0270] In certain embodiments, R.sup.B is a 3,5-disubstituted group
of the formula (viii), e.g., wherein R.sup.6, R.sup.7 and R.sup.10
are hydrogen, and R.sup.7 and R.sup.9 are not hydrogen, e.g., of
the formula (viii-i).
##STR00026##
[0271] In certain embodiments, R.sup.B is a trisubstituted group of
the formula (viii).
[0272] For example, in certain embodiments, R.sup.B is a
2,4,6-trisubstituted group of formula (viii), e.g., wherein R.sup.7
and R.sup.9 are hydrogen, and R.sup.6, R.sup.8 and R.sup.10 are not
hydrogen, e.g., of the formula (viii-j).
[0273] In certain embodiments, R.sup.B is a 2,3,6-trisubstituted
group of the formula (viii), e.g., wherein R.sup.2 and R.sup.3 are
hydrogen, and R.sup.1, R.sup.4 and R.sup.5 are not hydrogen, e.g.,
of the formula (viii-k).
[0274] In certain embodiments, R.sup.B is a 2,4,5-trisubstituted
group of the formula (viii), e.g., wherein R.sup.8 and R.sup.9 are
hydrogen, and R.sup.6, R.sup.7 and R.sup.10 are not hydrogen, e.g.,
of the formula (viii-1).
[0275] In certain embodiments, R.sup.B is a 2,3,4-trisubstituted
group of the formula (viii), e.g., wherein R.sup.6 and R.sup.9 are
hydrogen, and R.sup.7, R.sup.8 and R.sup.10 are not hydrogen, e.g.,
of the formula (viii-m).
[0276] In certain embodiments, R.sup.B is a 3,4,5-trisubstituted
group of the formula (viii), e.g., wherein R.sup.6 and R.sup.10 are
hydrogen, and R.sup.7, R.sup.8 and R.sup.9 are not hydrogen, e.g.,
of the formula (viii-n).
##STR00027##
[0277] In certain embodiments, R.sup.B is heteroaryl selected from
a 5-6-membered heteroaryl or a 5,6-bicyclic heteroaryl.
[0278] In certain embodiments, R.sup.B is a 6-membered heteroaryl.
In certain embodiments, R.sup.A is a 6-membered heteroaryl selected
from pyridinyl. In certain embodiments, R.sup.B is 2-pyridinyl,
3-pyridinyl or 4-pyridinyl.
[0279] In certain embodiments, R.sup.B is a 2-pyridinyl wherein
W--R.sup.6 is N, and W--R.sup.7, W--R.sup.8, W--R.sup.9, and
W--R.sup.10 are C--R.sup.7, C--R.sup.8, C--R.sup.9 and C--R.sup.10,
respectively, e.g., of the formula (ix).
[0280] In certain embodiments, R.sup.B is a 3-pyridinyl wherein
W--R.sup.7 is N, and W--R.sup.6, W--R.sup.8, W--R.sup.9, and
W--R.sup.10 are C--R.sup.6, C--R.sup.8, C--R.sup.9 and C--R.sup.10,
respectively, e.g., of the formula (x).
[0281] In certain embodiments, R.sup.B is a 4-pyridinyl wherein
W--R.sup.8 is N, and W--R.sup.6, W--R.sup.7, W--R.sup.9, and
W--R.sup.10 are C--R.sup.6, C--R.sup.7, C--R.sup.9 and C--R.sup.10,
respectively, e.g., of the formula (xi).
##STR00028##
[0282] wherein R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 are
as defined above and herein.
[0283] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 is the group -L-R.sup.D as defined
above and herein. In certain embodiments, at least one of R.sup.6,
R.sup.7, R.sup.8, R.sup.9, and R.sup.10 is the group --R.sup.E as
defined herein.
[0284] In certain embodiments, R.sup.B is a monosubstituted or
disubstituted pyridinyl.
[0285] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl.
[0286] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (ix) wherein R.sup.8, R.sup.9, R.sup.10
are hydrogen and R.sup.7 is not hydrogen, e.g., of the formula
(ix-a).
[0287] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (ix) wherein R.sup.7, R.sup.9, R.sup.10
are hydrogen and R.sup.8 is not hydrogen, e.g., of the formula
(ix-b).
[0288] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (ix) wherein R.sup.7, R.sup.8, R.sup.10
are hydrogen and R.sup.9 is not hydrogen, e.g., of the formula
(ix-c).
[0289] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (ix) wherein R.sup.7, R.sup.8, R.sup.9 are
hydrogen and R.sup.10 is not hydrogen, e.g., of the formula
(ix-d).
##STR00029##
[0290] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (x) wherein R.sup.8, R.sup.9, R.sup.10 are
hydrogen and R.sup.6 is not hydrogen, e.g., of the formula
(x-a).
[0291] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (x) wherein R.sup.6, R.sup.9, R.sup.10 are
hydrogen and R.sup.8 is not hydrogen, e.g., of the formula
(x-b).
[0292] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (x) wherein R.sup.6, R.sup.8, R.sup.10 are
hydrogen and R.sup.9 is not hydrogen, e.g., of the formula
(x-c).
[0293] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (x) wherein R.sup.6, R.sup.8, R.sup.9 are
hydrogen and R.sup.10 is not hydrogen, e.g., of the formula
(x-d).
##STR00030##
[0294] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (xi) wherein R.sup.6, R.sup.7, R.sup.9 are
hydrogen and R.sup.10 is not hydrogen, e.g., of the formula
(xi-a).
[0295] In certain embodiments, R.sup.B is a monosubstituted
pyridinyl of the formula (v) wherein R.sup.6, R.sup.7, R.sup.10 are
hydrogen and R.sup.9 is not hydrogen, e.g., of the formula
(xi-b).
##STR00031##
[0296] In certain embodiments, R.sup.B is a disubstituted
pyridinyl.
[0297] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.8 and R.sup.9 are hydrogen and
R.sup.7 and R.sup.10 are not hydrogen, e.g., of the formula
(ix-e).
[0298] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.7 and R.sup.9 are hydrogen and
R.sup.8 and R.sup.10 are not hydrogen, e.g., of the formula
(ix-f).
[0299] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.7 and R.sup.8 are hydrogen and
R.sup.9 and R.sup.10 are not hydrogen, e.g., of the formula
(ix-g).
[0300] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.8 and R.sup.10 are hydrogen and
R.sup.7 and R.sup.9 are not hydrogen, e.g., of the formula
(ix-h).
[0301] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.9 and R.sup.10 are hydrogen and
R.sup.7 and R.sup.8 are not hydrogen, e.g., of the formula
(ix-i).
[0302] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (ix) wherein R.sup.7 and R.sup.10 are hydrogen and
R.sup.8 and R.sup.9 are not hydrogen, e.g., of the formula
(ix-j).
##STR00032##
[0303] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0304] R.sup.8 and R.sup.9 are hydrogen and R.sup.6 and R.sup.10
are not hydrogen, e.g., of the formula (x-e).
[0305] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0306] R.sup.8 and R.sup.10 are hydrogen and R.sup.6 and R.sup.9
are not hydrogen, e.g., of the formula (x-f).
[0307] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0308] R.sup.9 and R.sup.10 are hydrogen and R.sup.6 and R.sup.8
are not hydrogen, e.g., of the formula (x-g).
[0309] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0310] R.sup.6 and R.sup.9 are hydrogen and R.sup.8 and R.sup.10
are not hydrogen, e.g., of the formula (x-h).
[0311] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0312] R.sup.6 and R.sup.10 are hydrogen and R.sup.8 and R.sup.9
are not hydrogen, e.g., of the formula (x-i).
[0313] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (x) wherein
[0314] R.sup.6 and R.sup.8 are hydrogen and R.sup.9 and R.sup.10
are not hydrogen, e.g., of the formula (x-j).
##STR00033##
[0315] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (xi) wherein R.sup.7 and R.sup.9 are hydrogen and
R.sup.6 and R.sup.10 are not hydrogen, e.g., of the formula
(xi-c).
[0316] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (xi) wherein R.sup.6 and R.sup.7 are hydrogen and
R.sup.9 and R.sup.10 are not hydrogen, e.g., of the formula
(xi-d).
[0317] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (xi) wherein R.sup.6 and R.sup.8 are hydrogen and
R.sup.7 and R.sup.10 are not hydrogen, e.g., of the formula
(xi-e).
[0318] In certain embodiments, R.sup.B is a disubstituted pyridinyl
of the formula (xi) wherein R.sup.6 and R.sup.10 are hydrogen and
R.sup.7 and R.sup.9 are not hydrogen, e.g., of the formula
(xi-f).
##STR00034##
[0319] In certain embodiments, R.sup.B is C.sub.5-10 carbocyclyl or
5-10 membered heterocyclyl of the formula (xii):
##STR00035##
[0320] wherein:
[0321] V is N, NR.sup.30, O, S or CR.sup.31R.sup.32;
[0322] p is 0, 1 or 2;
[0323] each R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25,
R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.31 and R.sup.32 is
independently selected from hydrogen, halogen, hydrogen, halogen,
--CN, --NO.sub.2, --N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH,
--OR.sup.B1, --ON(R.sup.B2).sub.2, --N(R.sup.B2).sub.2,
--N(OR.sup.B3)R.sup.B3, --SH, --SR.sup.B1, --SSR.sup.B3,
--C(.dbd.O)R.sup.B1, --CO.sub.2H, --CHO, --C(OR.sup.B3).sub.2,
--CO.sub.2R.sup.B1, --OC(.dbd.O)R.sup.B1, --OCO.sub.2R.sup.B1,
--C(.dbd.O)N(R.sup.B2).sub.2, --OC(.dbd.O)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.O)R.sup.B1, --NR.sup.B2CO.sub.2R.sup.B1,
--NR.sup.B2C(.dbd.O)N(R.sup.B2).sub.2,
--C(.dbd.NR.sup.B2)OR.sup.B1, --OC(.dbd.NR.sup.B2)R.sup.B1,
OC(.dbd.NR.sup.B2)OR.sup.B1, --C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--OC(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--C(.dbd.O)NR.sup.B2SO.sub.2R.sup.B1, --NR.sup.B2SO.sub.2R.sup.B1,
--SO.sub.2N(R.sup.B2).sub.2, --SO.sub.2R.sup.B1,
--SO.sub.2OR.sup.B1, --OSO.sub.2R.sup.B1, --S(.dbd.O)R.sup.B1,
--OS(.dbd.O)R.sup.B1, --Si(R.sup.B1).sub.3,
--OSi(R.sup.B1).sub.3--C(.dbd.S)N(R.sup.B2).sub.2,
--C(.dbd.O)SR.sup.B1, --C(.dbd.S)SR.sup.B1, --SC(.dbd.S)SR.sup.B1,
--P(.dbd.O).sub.2R.sup.B1, --OP(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --OP(.dbd.O)(R.sup.B1).sub.2,
--OP(.dbd.O)(OR.sup.B3).sub.2, --P(.dbd.O).sub.2N(R.sup.B2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B2).sub.2, --P(.dbd.O)(NR.sup.B2).sub.2,
--OP(.dbd.O)(NR.sup.B2).sub.2,
--NR.sup.B2P(.dbd.O)(OR.sup.B3).sub.2,
--NR.sup.B2P(.dbd.O)(NR.sup.B2).sup.2, --P(R.sup.B3).sup.2,
P(R.sup.B3).sub.3, --OP(R.sup.B3).sub.2, --OP(R.sup.B3).sub.3,
--B(OR.sup.B3).sub.2, or --BR.sup.B1(OR.sup.B3), C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl, -L-R.sup.D
and --R.sup.E; or one or more of R.sup.29 and R.sup.21, R.sup.22
and R.sup.23, R.sup.24 and R.sup.31, R.sup.32 and R.sup.25,
R.sup.26 and R.sup.27, R.sup.28 and R.sup.29, or R.sup.26 and
R.sup.29, are joined to form a double bond or a C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl or 5-14
membered heteroaryl ring; optionally wherein X is N, then N and
R.sup.23 or N and R.sup.25 are joined to form a double bond;
[0324] R.sup.30 is selected from hydrogen, --OH, --OR.sup.B1,
--N(R.sup.B3).sub.2, --CN, --C(.dbd.O)R.sup.B1,
--C(.dbd.O)N(R.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--SO.sub.2R.sup.B1, --C(.dbd.NR.sup.B3)OR.sup.B1,
--C(.dbd.NR.sup.B3)N(R.sup.B3).sub.2, --SO.sub.2N(R.sup.B3).sub.2,
--SO.sub.2R.sup.B3, --SO.sub.2OR.sup.B3, --S(.dbd.O)R.sup.B1,
--C(.dbd.S)N(R.sup.B3).sub.2, --C(.dbd.O)SR.sup.B3,
--C(.dbd.S)SR.sup.B3, --P(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --P(.dbd.O).sub.2N(R.sup.B3).sub.2,
--P(.dbd.O)(NR.sup.B3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl,
optionally wherein R.sup.24 and R.sup.30 or R.sup.30 and R.sup.25
are joined to form a 3-14 membered heterocyclyl or 5-14 membered
heteroaryl ring;
[0325] wherein:
[0326] each R.sup.B1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0327] each R.sup.B2 is, independently, selected from hydrogen,
--OH, --OR.sup.B1, --N(R.sup.B3).sub.2, --CN, --C(.dbd.O)R.sup.B1,
--C(.dbd.O)N(R.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--SO.sub.2R.sup.B1, --C(.dbd.NR.sup.B3)OR.sup.B1,
--C(.dbd.NR.sup.B3)N(R.sup.B3).sub.2, --SO.sub.2N(R.sup.B3).sub.2,
--SO.sub.2R.sup.B3, --SO.sub.2OR.sup.B3, --SOR.sup.B3,
--C(.dbd.S)N(R.sup.B3).sub.2, --C(.dbd.O)SR.sup.B3,
--C(.dbd.S)SR.sup.B3, --P(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2), --P(.dbd.O).sub.2N(R.sup.B3).sub.2,
--P(.dbd.O)(NR.sup.B3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring;
[0328] each R.sup.B3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B3 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0329] and L, R.sup.D and R.sup.E are as defined above and
herein.
[0330] In certain embodiments, at least one of R.sup.21, R.sup.22,
R.sup.23, R.sup.24, R.sup.25, R.sup.26, R.sup.27, R.sup.28,
R.sup.29, R.sup.30, R.sup.31, and R.sup.32 is the group -L-R.sup.D
as defined above and herein. In certain embodiments, at least one
of R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25, R.sup.26,
R.sup.27, R.sup.28, R.sup.29, R.sup.30, R.sup.31, and R.sup.32 is
selected from the group --R.sup.E as defined herein.
[0331] In certain embodiments, p is 0. In certain embodiments, p is
1. In certain embodiments, p is 2.
[0332] In certain embodiments, V is N. In certain embodiments, V is
NR.sup.30. In certain embodiments, V is O. In certain embodiments,
V is S. In certain embodiments, V is CR.sup.31R.sup.32.
[0333] In certain embodiments, R.sup.B is C.sub.5-10 carbocyclyl or
5-10 membered heterocyclyl of the formula (xiii).
##STR00036##
[0334] wherein:
[0335] V is N, NR.sup.30, O, S or CR.sup.31R.sup.32;
[0336] p is 0, 1 or 2;
[0337] each R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25,
R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.31 and R.sup.32 is
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.B1,
--ON(R.sup.B2).sub.2, --N(R.sup.B2).sub.2, --N(OR.sup.B3)R.sup.B3,
--SH, --SR.sup.B1, --SSR.sup.B3, --C(.dbd.O)R.sup.B1, --CO.sub.2H,
--CHO, --C(OR.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--OC(.dbd.O)R.sup.B1, --OCO.sub.2R.sup.B1,
--C(.dbd.O)N(R.sup.B2).sub.2, --OC(.dbd.O)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.O)R.sup.B1--NR.sup.B2CO.sub.2R.sup.B1,
--NR.sup.B2C(.dbd.O)N(R.sup.B2).sub.2,
--C(.dbd.NR.sup.B2)OR.sup.B1, --OC(.dbd.NR.sup.B2)R.sup.B1,
--OC(.dbd.NR.sup.B2)OR.sup.B1,
--C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--OC(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--NR.sup.B2C(.dbd.NR.sup.B2)N(R.sup.B2).sub.2,
--C(.dbd.O)NR.sup.B2SO.sub.2R.sup.B1, --NR.sup.B2SO.sub.2R.sup.B1,
--SO.sub.2N(R.sup.B2).sub.2, --SO.sub.2R.sup.B1,
--SO.sub.2OR.sup.B1, --OSO.sub.2R.sup.B1, --S(.dbd.O)R.sup.B1,
--OS(.dbd.O)R.sup.B1, --Si(R.sup.B1).sub.3,
--OSi(R.sup.B1).sub.3--C(.dbd.S)N(R.sup.B2).sub.2,
--C(.dbd.O)SR.sup.B1, --C(.dbd.S)SR.sup.B1, --SC(.dbd.S)SR.sup.B1,
--P(.dbd.O).sub.2R.sup.B1, --OP(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --OP(.dbd.O)(R.sup.B1).sub.2,
--OP(.dbd.O)(OR.sup.B3).sub.2, --P(.dbd.O).sub.2N(R.sup.B2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.B2).sub.2, --P(.dbd.O)(NR.sup.B2).sub.2,
--OP(.dbd.O)(NR.sup.B2).sub.2,
--NR.sup.B2P(.dbd.O)(OR.sup.B3).sub.2,
--NR.sup.B2P(.dbd.O)(NR.sup.B2).sup.2, --P(R.sup.B3).sup.2,
P(R.sup.B3).sub.3, --OP(R.sup.B3).sub.2, --OP(R.sup.B3).sub.3,
--B(OR.sup.B3).sub.2, or --BR.sup.B1(OR.sup.B3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl,
-L-R.sup.D and --R.sup.E; or one or more of R.sup.29 and R.sup.21,
R.sup.22 and R.sup.31, R.sup.32 and R.sup.23, R.sup.24 and
R.sup.25, R.sup.26 and R.sup.27, R.sup.28 and R.sup.29, and
R.sup.26 and R.sup.29, are joined to form a double bond or a
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl
or 5-14 membered heteroaryl ring; optionally wherein X is N, then N
and R.sup.21 or N and R.sup.23 are joined to form a double
bond;
[0338] R.sup.30 is selected from hydrogen, --OH, --OR.sup.B1,
--N(R.sup.B3).sub.2, --CN, --C(.dbd.O)R.sup.B1,
--C(.dbd.O)N(R.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--SO.sub.2R.sup.B1, --C(.dbd.NR.sup.B3)OR.sup.B1,
--C(.dbd.NR.sup.B3)N(R.sup.B3).sub.2, --SO.sub.2N(R.sup.B3).sub.2,
--SO.sub.2R.sup.B3, --SO.sub.2OR.sup.B3, --S(.dbd.O)R.sup.B1,
--C(.dbd.S)N(R.sup.B3).sub.2, --C(.dbd.O)SR.sup.B3,
--C(.dbd.S)SR.sup.B3, --P(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --P(.dbd.O).sub.2N(R.sup.B3).sub.2,
--P(.dbd.O)(NR.sup.B3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or
R.sup.22 and R.sup.30 or R.sup.30 and R.sup.23 are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0339] wherein:
[0340] each R.sup.B1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl, and 5-14 membered heteroaryl;
[0341] each R.sup.B2 is, independently, selected from hydrogen,
--OH, --OR.sup.B1, --N(R.sup.B3).sub.2, --CN, --C(.dbd.O)R.sup.B1,
--C(.dbd.O)N(R.sup.B3).sub.2, --CO.sub.2R.sup.B1,
--SO.sub.2R.sup.B1, --C(.dbd.NR.sup.B3)OR.sup.B1,
--C(.dbd.NR.sup.B3)N(R.sup.B3).sub.2, --SO.sub.2N(R.sup.B3).sub.2,
--SO.sub.2R.sup.B3, --SO.sub.2OR.sup.B3, --SOR.sup.B1,
--C(.dbd.S)N(R.sup.B3).sub.2, --C(.dbd.O)SR.sup.B3,
--C(.dbd.S)SR.sup.B3, --P(.dbd.O).sub.2R.sup.B1,
--P(.dbd.O)(R.sup.B1).sub.2, --P(.dbd.O).sub.2N(R.sup.B3).sub.2,
--P(.dbd.O)(NR.sup.B3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.B2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring;
[0342] each R.sup.B3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.B3 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0343] and L, R.sup.D and R.sup.E are as defined above and
herein.
[0344] In certain embodiments, at least one of R.sup.21, R.sup.22,
R.sup.23, R.sup.24, R.sup.25, R.sup.26, R.sup.27, R.sup.28,
R.sup.29, R.sup.30, R.sup.31, and R.sup.32 is the group -L-R.sup.D
as defined above and herein. In certain embodiments, at least one
of at least one of R.sup.21, R.sup.22, R.sup.23, R.sup.24,
R.sup.25, R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.30,
R.sup.31, and R.sup.32 is selected from --R.sup.E as defined
herein.
[0345] In certain embodiments, p is 0. In certain embodiments, p is
1. In certain embodiments, p is 2.
[0346] In certain embodiments, V is N. In certain embodiments, V is
NR.sup.30. In certain embodiments, V is O. In certain embodiments,
V is S. In certain embodiments, V is CR.sup.31R.sup.32.
[0347] For example, in certain embodiments, V is O. In certain
embodiments, R.sup.B is a 5-10 membered heterocyclyl of the
formulae (xii-a) or (xiii-a):
##STR00037##
[0348] wherein p, R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25,
R.sup.26, R.sup.27, R.sup.28 and R.sup.29 are as defined above and
herein.
[0349] In certain embodiments, X is NR.sup.30. For example, in
certain embodiments, R.sup.B is heterocyclyl of the formulae
(xii-b) or (xiii-b):
##STR00038##
[0350] wherein p, R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25,
R.sup.26, R.sup.27, R.sup.28, R.sup.29 and R.sup.30 are as defined
above and herein.
[0351] In certain embodiments, V is CR.sup.31R.sup.32. For example,
in certain embodiments, R.sup.B is C.sub.5-10 carbocyclyl of the
formula (xii-c):
##STR00039##
[0352] wherein p, R.sup.21, R.sup.22, R.sup.23, R.sup.24, R.sup.25,
R.sup.26, R.sup.27, R.sup.28, R.sup.29, R.sup.31 and R.sup.32 are
as defined above and herein.
Joined Groups R.sup.B and R.sup.C
[0353] As described generally above, in certain embodiments,
R.sup.B and R.sup.C together with the nitrogen (N) atom to which
each is attached are joined to form a 5-14 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring.
[0354] For example, in certain embodiments, R.sup.B and R.sup.C
together with the nitrogen (N) atom to which each is attached are
joined to form a 5-14 membered ring of the formula (xiv):
##STR00040##
wherein:
[0355] Q is N, NR.sup.40, O, S, or CR.sup.41R.sup.42
[0356] M is 0, 1 or 2; and
[0357] each R.sup.41, R.sup.42, R.sup.43, R.sup.44, R.sup.45,
R.sup.46, R.sup.47, R.sup.48, R.sup.49 and R.sup.50 is
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.F1,
--ON(R.sup.F2).sub.2, --N(R.sup.F2).sub.2,
--N(OR.sup.N(OR.sup.F3)R.sup.F3, --SH, --SR.sup.F1, --SSR.sup.F3,
--C(.dbd.O)R.sup.F1, --CO.sub.2H, --CHO, --C(OR.sup.F3).sub.2,
--CO.sub.2R.sup.F1, OC(.dbd.O)R.sup.F1, --OCO.sub.2R.sup.F1,
C(.dbd.O)N(R.sup.F2).sub.2, --OC(.dbd.O)N(R.sup.F2).sub.2,
--NR.sup.F2, --NR.sup.F2C(.dbd.O)R.sup.F1,
--NR.sup.F2C(.dbd.O)N(R.sup.F2).sub.2,
--C(.dbd.NR.sup.F2)OR.sup.F1, --OC(.dbd.NR.sup.F2)R.sup.F1,
--OC(.dbd.NR.sup.F2)OR.sup.F1,
--C(.dbd.NR.sup.F2)N(R.sup.F2).sub.2,
--OC(.dbd.NR.sup.F2)N(R.sup.F2).sub.2,
--NR.sup.F2C(.dbd.NR.sup.F2N(R.sup.F2).sub.2,
--C(.dbd.O)NR.sup.F2SO.sub.2R.sup.BC1, --NR.sup.F2SO.sub.2R.sup.F1,
--SO.sub.2N(R.sup.F2).sub.2, --SO.sub.2R.sup.F1,
--SO.sub.2OR.sup.F1, --OSO.sub.2R.sup.F1, --S(.dbd.O)R.sup.F1,
--OS(.dbd.O)R.sup.F1, --Si(R.sup.F1).sub.3, --OSi(R.sup.F1).sub.3,
--C(.dbd.S)N(R.sup.F2).sub.2, --C(.dbd.O)SR.sup.F1,
--C(.dbd.S)SR.sup.F1, --SC(.dbd.S)SR.sup.F1,
--P(.dbd.O).sub.2R.sup.F1, --OP(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --OP(.dbd.O)(R.sup.F1).sub.2,
--OP(.dbd.O)(OR.sup.F3).sub.2, --P(.dbd.O).sub.2N(R.sup.F2).sub.2,
--OP(.dbd.O).sub.2N(R.sup.F2).sub.2, --P(.dbd.O)(NR.sup.F2).sub.2,
--OP(.dbd.O)(NR.sup.F2).sub.2,
--NR.sup.F2P(.dbd.O)(OR.sup.F3).sub.2,
--NR.sup.F2(.dbd.O)(NR.sup.F2).sub.2, --P(R.sup.F3).sub.2,
--P(R.sup.F3).sub.3, --OP(R.sup.F3).sub.2, --OP(R.sup.F3).sub.3,
--B(OR.sup.F3).sub.2, or --BR.sup.F1(OR.sup.F3), C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl,
-L-R.sup.D and --R.sup.E; or one or more of R.sup.47 and R.sup.49,
R.sup.48 and R.sup.50, R.sup.49 and R.sup.41, R.sup.50 and
R.sup.42, R.sup.41 and R.sup.45, R.sup.42 and R.sup.46, R.sup.45
and R.sup.43, and R.sup.46 and R.sup.44, are joined to form a
double bond or a C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl or 5-14 membered heteroaryl ring;
optionally wherein Q is N, then N and R.sup.49 or N and R.sup.46
are joined to form a double bond;
[0358] R.sup.40 is selected from hydrogen, --OH, --OR.sup.F1,
--N(R.sup.F3).sub.2, --CN, --C(.dbd.O)R.sup.F1,
--C(.dbd.O)N(R.sup.F3).sub.2, --CO.sub.2R.sup.F1,
--SO.sub.2R.sup.F1, --C(.dbd.NR.sup.F3)OR.sup.F1,
--C(.dbd.NR.sup.F3)N(R.sup.F3).sub.2, --SO.sub.2N(R.sup.F3).sub.2,
--SO.sub.2R.sup.F3, --SO.sub.2OR.sup.F3, --SOR.sup.F1,
--C(.dbd.S)N(R.sup.F3).sub.2, --C(.dbd.O)SR.sup.F3,
--C(.dbd.S)SR.sup.F3, --P(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --P(.dbd.O).sub.2N(R.sup.F3).sub.2,
--P(.dbd.O)(NR.sup.F3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl,
optionally wherein R.sup.49 and R.sup.40 or R.sup.40 and R.sup.45
are joined to form a 3-14 membered heterocyclyl, or 5-14 membered
heteroaryl ring;
[0359] each R.sup.F1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl, and 5-14 membered heteroaryl;
[0360] each R.sup.F2 is, independently, selected from hydrogen,
--OH, --OR.sup.F1, --N(R.sup.F3).sub.2, --CN, --C(.dbd.O)R.sup.F1,
--C(.dbd.O)N(R.sup.F3).sub.2, --CO.sub.2R.sup.F1,
--SO.sub.2R.sup.F1, --C(.dbd.NR.sup.F3)OR.sup.F1,
--C(.dbd.NR.sup.F3)N(R.sup.F3).sub.2, --SO.sub.2N(R.sup.F3).sub.2,
--SO.sub.2R.sup.F3, --SO.sub.2OR.sup.F3, --S(.dbd.O)R.sup.F1,
--C(.dbd.S)N(R.sup.F3).sub.2, --C(.dbd.O)SR.sup.F3,
--C(.dbd.S)SR.sup.F3, --P(.dbd.O).sub.2R.sup.F1,
--P(.dbd.O)(R.sup.F1).sub.2, --P(.dbd.O).sub.2N(R.sup.F3).sub.2,
--P(.dbd.O)(NR.sup.F3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.F2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring;
[0361] each R.sup.F3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.F3 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring;
[0362] and L, R.sup.D and R.sup.E are as defined above and
herein.
[0363] In certain embodiments, at least one of R.sup.40, R.sup.41,
R.sup.42, R.sup.43, R.sup.44, R.sup.45, R.sup.46, R.sup.47,
R.sup.48, R.sup.49 and R.sup.50 is the group -L-R.sup.D as defined
above and herein. In certain embodiments, at least one of R.sup.40,
R.sup.41, R.sup.42, R.sup.43, R.sup.44, R.sup.45, R.sup.46,
R.sup.47, R.sup.48, R.sup.49 and R.sup.50 is selected from
--R.sup.E as defined herein. In certain embodiments, each of
R.sup.40, R.sup.41, R.sup.42, R.sup.43, R.sup.44, R.sup.45,
R.sup.46, R.sup.47, R.sup.48, R.sup.49 and R.sup.50 is
hydrogen.
[0364] In certain embodiments, m is 0. In certain embodiments, m is
1. In certain embodiments, m is 2.
[0365] In certain embodiments, Q is N. In certain embodiments, Q is
NR.sup.40. In certain embodiments, Q is O. In certain embodiments,
Q is S. In certain embodiments, Q is CR.sup.41R.sup.42.
[0366] In certain embodiments, R.sup.47 and R.sup.49 or R.sup.48
and R.sup.50 are joined to form a C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl or 5-14 membered heteroaryl
ring.
[0367] For example, in certain embodiments, R.sup.47 and R.sup.49
are joined to form a C.sub.3-10 carbocyclyl and Q is
CR.sup.41R.sup.42. In certain embodiments, each R.sup.41, R.sup.42,
R.sup.43, R.sup.44, R.sup.45, R.sup.46, R.sup.48 and R.sup.50 are
hydrogen; and R.sup.47 and R.sup.49 are joined to form a C.sub.3-10
carbocyclyl. In certain embodiments, m is 1. In certain
embodiments, R.sup.B and R.sup.C together with the nitrogen (N)
atom to which each is attached are joined to form a group of the
formula (xiv-a):
##STR00041##
[0368] In certain embodiments, R.sup.47 and R.sup.49 are joined to
form a double bond and R.sup.48 and R.sup.50 are joined to form a
C.sub.6-14 aryl or 5-14 membered heteroaryl. For example, in
certain embodiments, R.sup.B and R.sup.C together with the nitrogen
(N) atom to which each is attached are joined to form a 5-14
membered ring of the formula (xv):
##STR00042##
[0369] wherein Q, m, R.sup.41, R.sup.42, R.sup.43, R.sup.44,
R.sup.45, R.sup.46, R.sup.6, R.sup.7, R.sup.8 and R.sup.9 are as
defined above and herein.
[0370] In certain embodiments, Q is CR.sup.41R.sup.42, R.sup.49 and
R.sup.41 are joined to form a double bond and R.sup.50 and R.sup.42
are joined to form a C.sub.6-14 aryl or 5-14 membered heteroaryl.
For example, in certain embodiments, R.sup.B and R.sup.C together
with the nitrogen (N) atom to which each is attached are joined to
form a group of the formula (xvi):
##STR00043##
[0371] wherein m, R.sup.43, R.sup.44, R.sup.45, R.sup.46, R.sup.47
and R.sup.48 are as defined above and herein; and
[0372] wherein R.sup.66, R.sup.67, R.sup.68 and R.sup.69 are
independently selected from hydrogen, halogen, --CN, --NO.sub.2,
--N.sub.3, --SO.sub.2H, --SO.sub.3H, --OH, --OR.sup.F4,
--ON(R.sup.F5).sub.2, --N(R.sup.F5).sub.2, --N(OR.sup.F6)R.sup.F6,
--SH, --SR.sup.E4, --SSR.sup.F6, --C(.dbd.O)R.sup.F4, --CO.sub.2H,
--CHO, --C(OR.sup.F6).sub.2, --CO.sub.2R.sup.F4,
--OC(.dbd.O)R.sup.F4, --OCO.sub.2R.sup.F4,
--C(.dbd.O)N(R.sup.F5).sub.2, --OC(.dbd.O)N(R.sup.F5).sub.2,
--NR.sup.F5C(.dbd.O)R.sup.F4, --NR.sup.F5CO.sub.2R.sup.F4,
--NR.sup.F5C(.dbd.O)N(R.sup.F5).sub.2,
--C(.dbd.NR.sup.F5)OR.sup.F4, --OC(.dbd.NR.sup.F5)R.sup.F4,
--OC(.dbd.NR.sup.F5)OR.sup.F4,
--C(.dbd.NR.sup.F5)N(R.sup.F5).sub.2,
--OC(.dbd.NR.sup.F5)N(R.sup.F5).sub.2,
--NR.sup.F5C(.dbd.NR.sup.F5)N(R.sup.F5).sub.2,
--C(.dbd.O)NR.sup.F5SO.sub.2R.sup.F4, --NR.sup.F5SO.sub.2R.sup.F4,
--SO.sub.2N(R.sup.F5).sub.2, --SO.sub.2R.sup.F4,
--SO.sub.2OR.sup.F4, --OSO.sub.2R.sup.F4, --S(.dbd.O)R.sup.F4,
--OS(.dbd.O)R.sup.F4, --Si(R.sup.F4).sub.3,
--OSi(R.sup.E4).sub.3--C(.dbd.S)N(R.sup.F5).sub.2,
--C(.dbd.O)SR.sup.F4, --C(.dbd.S)SR.sup.F4, --SC(S)SR.sup.F4,
--P(.dbd.O).sub.2R.sup.F4, --OP(.dbd.O).sub.2R.sup.F4,
P(.dbd.O)(R.sup.F4).sub.2, --OP(.dbd.O)(R.sup.F4).sub.2,
--OP(.dbd.O)(OR.sup.F6).sub.2, --P(.dbd.O).sub.2N(R.sup.F5).sub.2,
--OP(.dbd.O).sub.2N(R.sup.F5).sub.2, --P(.dbd.O)(NR.sup.F5).sub.2,
--OP(.dbd.O)(NR.sup.F5).sub.2,
--NR.sup.F5P(.dbd.O)(OR.sup.F6).sub.2,
--NR.sup.F5P(.dbd.O)(NR.sup.F5).sub.2,
--P(R.sup.F6).sub.2P(R.sup.F6).sup.3, --OP(R.sup.F6).sub.2,
--OP(R.sup.F6).sub.3, --B(OR.sup.F6).sub.2, or
--BR.sup.F4(OR.sup.F6), C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl,
C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, 5-14 membered heteroaryl, -L-R.sup.D
and --R.sup.E; or one or more of R.sup.66 and R.sup.67, R.sup.67
and R.sup.68, and R.sup.68 and R.sup.69 are joined to form a
C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl
or 5-14 membered heteroaryl ring;
[0373] each R.sup.F4 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0374] each R.sup.F5 is, independently, selected from hydrogen,
--OH, --OR.sup.F4, --N(R.sup.F6).sub.2, --CN, --C(.dbd.O)R.sup.F4,
--C(.dbd.O)N(R.sup.F6).sub.2, --CO.sub.2R.sup.F4,
--SO.sub.2R.sup.F4, --C(.dbd.NR.sup.F6)OR.sup.F4,
--C(.dbd.NR.sup.F6)N(R.sup.F6).sub.2, --SO.sub.2N(R.sup.F6).sup.2,
SO.sub.2R.sup.F6, --SO.sub.2OR.sup.F6, --SOR.sup.F4,
--C(.dbd.S)N(R.sup.F6).sub.2, --C(.dbd.O)SR.sup.F6,
--C(.dbd.S)SR.sup.F6, --P(.dbd.O).sub.2R.sup.F4,
--P(.dbd.O)(R.sup.F4).sub.2, --P(.dbd.O).sub.2N(R.sup.F6).sub.2,
--P(.dbd.O)(NR.sup.F6).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.F5 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring; and
[0375] each R.sup.F6 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl, or two R.sup.F6 groups are joined to form a
3-14 membered heterocyclyl or 5-14 membered heteroaryl ring.
[0376] In certain embodiments, at least one of R.sup.43, R.sup.44,
R.sup.45, R.sup.46, R.sup.47, R.sup.48, R.sup.66, R.sup.67,
R.sup.68 and R.sup.69 is the group -L-R.sup.D as defined above and
herein. In certain embodiments, at least one of R.sup.43, R.sup.44,
R.sup.45, R.sup.46, R.sup.47, R.sup.48, R.sup.66, R.sup.67,
R.sup.68 and R.sup.69 is selected from --R.sup.E as defined
herein.
In certain embodiments, m is 0. In certain embodiments, m is 1. In
certain embodiments, m is 2.
Group R.sup.C
[0377] As described generally above, R.sup.C is selected from
hydrogen, --OH, --OR.sup.C1, --ON(R.sup.C2).sub.2,
--N(R.sup.C2).sub.2, C(.dbd.O)R.sup.C1, --CHO, --CO.sub.2R.sup.C1,
--C(.dbd.O)N(R.sup.C2).sub.2, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(--NR.sup.C2)N(R.sup.C2).sub.2, --SO.sub.2R.sup.C,
--S(.dbd.O)R.sup.C1, --Si(R.sup.C1).sub.3, C.sub.1-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl;
[0378] wherein:
[0379] each R.sup.C1 is, independently, selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl; and
[0380] each R.sup.C2 is, independently, selected from hydrogen,
--OH, --OR.sup.C1, --N(R.sup.C3).sub.2, --CN, --C(.dbd.O)R.sup.C1,
--C(.dbd.O)N(R.sup.C3).sub.2, --CO.sub.2R.sup.C1,
--SO.sub.2R.sup.C1, --C(.dbd.NR.sup.C3)OR.sup.C1,
--C(.dbd.NR.sup.C3)N(R.sup.C3).sub.2, --SO.sub.2N(R.sup.C3).sub.2,
--SO.sub.2R.sup.C3, --SO.sub.2OR.sup.C3, --SOR.sup.C1,
--C(.dbd.S)N(R.sup.C3).sub.2, --C(.dbd.O)SR.sup.C3,
--C(.dbd.S)SR.sup.C3, --P(.dbd.O).sub.2R.sup.C1,
--P(.dbd.O)(R.sup.C1).sub.2, --P(.dbd.O).sub.2N(R.sup.C3).sub.2,
--P(.dbd.O)(NR.sup.C3).sub.2, --C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl, or two
R.sup.C2 groups are joined to form a 3-14 membered heterocyclyl or
5-14 membered heteroaryl ring;
[0381] each R.sup.C3 is, independently, selected from hydrogen,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl;
[0382] or R.sup.B and R.sup.C together with the nitrogen (N) atom
to which each is attached are joined to form a 5-14 membered
carbocyclyl, heterocyclyl, aryl or heteroaryl ring.
[0383] In certain embodiments, each R.sup.C1 is, independently,
selected from C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10
alkenyl, C.sub.2-10 alkynyl, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
[0384] In certain embodiments, each R.sup.C2 is, independently,
selected from hydrogen, --OH, --OR.sup.C1, --N(R.sup.c3).sub.2,
--CN, --C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C3).sub.2,
CO.sub.2R.sup.C1, --SO.sub.2R.sup.C1, --C(.dbd.NR.sup.C3)OR.sup.C1,
--C(.dbd.NR.sup.C3)N(R.sup.C3).sub.2, --SO.sub.2N(R.sup.C3).sub.2,
--SO.sub.2R.sup.C3, --SO.sub.2OR.sup.C3, --SOR.sup.C1,
--C(.dbd.S)N(R.sup.C3).sub.2, --C(.dbd.O)SR.sup.C3,
--C(.dbd.S)SR.sup.C3, --P(.dbd.O).sub.2R.sup.C1,
--P(.dbd.O)(R.sup.C1).sub.2, --P(.dbd.O).sub.2N(R.sup.C3).sub.2,
--P(.dbd.O)(NR.sup.C3).sub.2, C.sub.1-10 alkyl, C.sub.1-10
perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl, 3-14 membered
heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14 membered
heterocyclyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
[0385] However, in certain embodiments, R.sup.C is not any one of
hydrogen, --OH, --OR.sup.C1, --ON(R.sup.C2).sub.2,
--N(R.sup.C2).sub.2C(.dbd.O)R.sup.C1, --CHO, --CO.sub.2R.sup.C1,
--C(.dbd.O)N(R.sup.C2).sub.2, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2, --SO.sub.2R.sup.C1,
--S(.dbd.O)R.sup.C1, or --Si(R.sup.C1).sub.3.
[0386] In certain embodiments, R.sup.C is selected from C.sub.1-10
alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10
alkynyl, 3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl.
[0387] In certain embodiments, R.sup.C is selected from an
unsubstituted group, e.g., for example, selected from unsubstituted
C.sub.1-10 alkyl, unsubstituted C.sub.2-10 alkenyl, unsubstituted
C.sub.2-10 alkynyl, unsubstituted 3-14 membered heteroaliphatic,
unsubstituted C.sub.3-10 carbocyclyl, unsubstituted 3-14 membered
heterocyclyl, unsubstituted C.sub.6-14 aryl and unsubstituted 5-14
membered heteroaryl. However, in certain embodiments, R.sup.C is an
unsubstituted group wherein --CH.sub.3 and --CH.sub.2CH.sub.3 are
excluded.
[0388] In certain embodiments, R.sup.C is a group having 2 or more
carbon atoms, e.g., for example, selected from C.sub.2-10 alkyl,
C.sub.2-10 perhaloalkyl, C.sub.2-10 alkenyl, C.sub.2-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl. In certain embodiments, R.sup.C is an unsubstituted
group having 2 or more carbon atoms. However, in certain
embodiments, R.sup.C is a group having 2 or more carbon atoms
wherein --CH.sub.2CH.sub.3 is excluded.
[0389] In certain embodiments, R.sup.C is a group having 3 or more
carbon atoms, e.g., for example, selected from C.sub.3-10 alkyl,
C.sub.1-10 perhaloalkyl, C.sub.3-10 alkenyl, C.sub.3-10 alkynyl,
3-14 membered heteroaliphatic, C.sub.3-10 carbocyclyl, 3-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl. In certain embodiments, R.sup.C is an unsubstituted
group having 3 or more carbon atoms. However, in certain
embodiments, R.sup.C is a group having 3 or more carbon atoms
wherein --CH(CH.sub.3).sub.2 is excluded.
[0390] In certain embodiments, R.sup.C is a group having 4 or more
carbon atoms, e.g., for example, selected from C.sub.4-10 alkyl,
C.sub.4-10 perhaloalkyl, C.sub.4-10 alkenyl, C.sub.4-10 alkynyl,
5-14 membered heteroaliphatic, C.sub.5-10 carbocyclyl, 5-14
membered heterocyclyl, C.sub.6-14 aryl, and 5-14 membered
heteroaryl. In certain embodiments, R.sup.C is an unsubstituted
group having 4 or more carbon atoms.
[0391] In certain embodiments, R.sup.C is an acyclic group, e.g.,
for example, selected from C.sub.1-10 alkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl and 3-14 membered heteroaliphatic. In certain
embodiments, R.sup.C is an unsubstituted acyclic group, e.g., for
example, selected from unsubstituted C.sub.1-10 alkyl,
unsubstituted C.sub.2-10 alkenyl, unsubstituted C.sub.2-10 alkynyl
and unsubstituted 3-14 membered heteroaliphatic. However, in
certain embodiments, R.sup.C is an acyclic group wherein --CH.sub.3
and --CH.sub.2CH.sub.3 are excluded.
[0392] In certain embodiments, R.sup.C is C.sub.1-10 alkyl. In
certain embodiments, R.sup.C is an unsubstiuted C.sub.1-10 alkyl.
In certain embodiments, R.sup.C is C.sub.1-10 alkyl, wherein
--CH.sub.3 is excluded. In certain embodiments, R.sup.C is
C.sub.1-10 alkyl, wherein --CH.sub.2CH.sub.3 is excluded. In
certain embodiments, R.sup.C is C.sub.1-10 alkyl, wherein
--CH(CH.sub.3).sub.2 is excluded. In some embodiments, R.sup.C is
unsubstituted ethyl or unsubstituted isopropyl.
[0393] In certain embodiments, R.sup.C is C.sub.2-10 alkyl, e.g.,
for example, selected from ethyl, n-propyl, isopropyl, n-butyl,
tert-butyl, sec-butyl, iso-butyl, n-pentyl, pentan-3-yl, amyl,
neopentyl, 3-methyl-2-butanyl, tertiary amyl and n-hexyl. In
certain embodiments, R.sup.C is an unsubstituted C.sub.2-10 alkyl.
In certain embodiments, R.sup.C is C.sub.2-10 alkyl, wherein
--CH.sub.2CH.sub.3 is excluded. In certain embodiments, R.sup.C is
C.sub.2-10 alkyl, wherein --CH(CH.sub.3).sub.2 is excluded.
[0394] In certain embodiments, R.sup.C is C.sub.3-10 alkyl, e.g.,
for example, selected from n-propyl, isopropyl, n-butyl,
tert-butyl, sec-butyl, iso-butyl, n-pentyl, pentan-3-yl, amyl,
neopentyl, 3-methyl-2-butanyl, tertiary amyl and n-hexyl. In
certain embodiments, R.sup.C is an unsubstiuted C.sub.3-10 alkyl.
In certain embodiments, R.sup.C is C.sub.3-10 alkyl, wherein
--CH(CH.sub.3).sub.2 is excluded.
[0395] In certain embodiments, R.sup.C is C.sub.4-10 alkyl, e.g.,
for example, selected from n-butyl, tert-butyl, sec-butyl,
iso-butyl, n-pentyl, pentan-3-yl, amyl, neopentyl,
3-methyl-2-butanyl, tertiary amyl and n-hexyl. In certain
embodiments, R.sup.C is an unsubstiuted C.sub.4-10 alkyl.
[0396] In certain embodiments, R.sup.C is C.sub.2-10 alkenyl. In
certain embodiments, R.sup.C is an unsubstituted C.sub.2-10
alkenyl. In certain embodiments, R.sup.C is C.sub.2-10 alkenyl
selected from allyl.
[0397] In certain embodiments, R.sup.C is C.sub.2-10 alkynyl. In
certain embodiments, R.sup.C is an unsubstitued C.sub.2-10
alkynyl.
[0398] In certain embodiments, R.sup.C is 3-14 membered
heteroaliphatic. In certain embodiments, R.sup.C is an unsubstitued
3-14 membered heteroaliphatic.
[0399] In certain embodiments, R.sup.C is a cyclic group, e.g.,
selected from C.sub.3-10 carbocyclyl, 3-14 membered heterocyclyl,
C.sub.6-14 aryl and 5-14 membered heteroaryl. In certain
embodiments, R.sup.C is an unsubstiuted cyclic group, e.g.,
selected from unsubstituted C.sub.3-10 carbocyclyl, unsubstituted
3-14 membered heterocyclyl, unsubstituted C.sub.6-14 aryl and
unsubstituted 5-14 membered heteroaryl.
[0400] In certain embodiments, R.sup.C is C.sub.3-10 carbocyclyl.
In certain embodiments, R.sup.C is C.sub.4-10 carbocyclyl. In
certain embodiments, R.sup.C is C.sub.5-10 carbocyclyl. In certain
embodiments, R.sup.C is C.sub.5-8 carbocyclyl. In certain
embodiments, R.sup.C is C.sub.3-10 carbocyclyl selected from
cyclopropyl (C.sub.3), cyclobutyl (C.sub.4), cyclopentyl (C.sub.5),
cyclopentenyl (C.sub.5), cyclohexyl (C.sub.6), cyclohexenyl
(C.sub.6), cyclohexadienyl (C.sub.6), cycloheptyl (C.sub.7),
cycloheptadienyl (C.sub.7), cycloheptatrienyl (C.sub.7) and
cyclooctyl (C.sub.8). In certain embodiments, R.sup.C is C.sub.3-10
carbocyclyl selected from cyclopentyl and cyclohexyl. In certain
embodiments, R.sup.C is an unsubstituted C.sub.3-10
carbocyclyl.
[0401] In certain embodiments, R.sup.C is 3-14 membered
heterocyclyl. In certain embodiments, R.sup.C is 5-10 membered
heterocyclyl. In certain embodiments, R.sup.C is 5-6 membered
heterocyclyl. In certain embodiments, R.sup.C is 3-14 membered
heterocyclyl selected from azirdinyl, oxiranyl, thiorenyl,
azetidinyl, oxetanyl, thietanyl, tetrahydrofuranyl, dihydrofuranyl,
tetrahydrothiophenyl, dihydrothiophenyl, pyrrolidinyl,
dihydropyrrolyl, dioxolanyl, oxathiolanyl, dithiolanyl,
piperidinyl, tetrahydropyranyl, dihydropyridinyl, thianyl,
piperazinyl, morpholinyl, dithianyl, dioxanyl, azepanyl, oxepanyl
thiepanyl, azocanyl, oxecanyl and thiocanyl. In certain
embodiments, R.sup.C is 3-14 membered heterocyclyl selected from
tetrahydropyranyl. In certain embodiments, R.sup.C is an
unsubstituted 3-14 membered heterocyclyl.
[0402] In certain embodiments, R.sup.C is C.sub.6-14 aryl. In
certain embodiments, R.sup.C is a C.sub.6-14 aryl selected from
phenyl, naphthyl and anthracyl. In certain embodiments, R.sup.C a
C.sub.6-14 aryl selected from phenyl. In certain embodiments,
R.sup.C is an unsubstituted C.sub.6-14 aryl.
[0403] In certain embodiments, R.sup.C is 5-14 membered heteroaryl.
In certain embodiments, R.sup.C is 5-10 membered heteroaryl. In
certain embodiments, R.sup.C is 5-6 membered heteroaryl. In certain
embodiments, R.sup.C is a 5-membered heteroaryl, e.g., for example,
selected from pyrrolyl, furanyl, thiophenyl, imidazolyl, pyrazolyl,
oxazolyl, isoxazolyl, thiazolyl, isothiazolyl, triazolyl,
oxadiazolyl, thiadiazolyl and tetrazolyl. In certain embodiments,
R.sup.A is a 6-membered heteroaryl, e.g., for example, selected
from pyridinyl, pyridazinyl, pyrimidinyl, pyrazinyl, triazinyl and
tetrazinyl. In certain embodiments, R.sup.C is an unsubstituted
5-14 membered heteroaryl.
Exemplary Combinations of Groups R.sup.A, R.sup.B and R.sup.C
[0404] Various combinations of R.sup.A, X, R.sup.B, and/or R.sup.C
are contemplated herein, and are described in more detail below and
herein.
[0405] In certain embodiments, X is --CN.
[0406] For example, in certain embodiments, both R.sup.B and
R.sup.C are cyclic, i.e., R.sup.B is selected from C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl and 5-14
membered heteroaryl, and R.sup.C is selected from C.sub.3-10
carbocyclyl, 3-14 membered heterocyclyl, C.sub.6-14 aryl, and 5-14
membered heteroaryl. In certain embodiments, R.sup.C is a group
having 2 or more carbon atoms. In certain embodiments, R.sup.C is a
group having 3 or more carbon atoms. In certain embodiments,
R.sup.C is a group having 4 or more carbon atoms. In certain
embodiments, R.sup.C is an unsubstituted cyclic group.
[0407] In certain embodiments, R.sup.B is cyclic and R.sup.C is
acyclic, i.e., R.sup.B is selected from C.sub.3-10 carbocyclyl,
3-14 membered heterocyclyl, C.sub.6-14 aryl and 5-14 membered
heteroaryl and R.sup.C is selected from --OH, --OR.sup.C1,
--ON(R.sup.C2).sub.2, --N(R.sup.C2).sub.2, --C(.dbd.O)R.sup.C1,
--CHO, --CO.sub.2R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2,
--C(.dbd.NR.sup.C2)OR.sup.C1, --C(NR.sup.C2)N(R.sup.C2).sub.2,
SO.sub.2R.sup.C1, --S(.dbd.O)R.sup.C1, --Si(R.sup.C1).sub.3,
C.sub.1-10 alkyl, C.sub.1-10 perhaloalkyl, C.sub.2-10 alkenyl,
C.sub.2-10 alkynyl, 3-14 membered heteroaliphatic. In certain
embodiments, R.sup.C is an acyclic group having 2 or more carbon
atoms. In certain embodiments, R.sup.C is an acyclic group having 3
or more carbon atoms. In certain embodiments, R.sup.C is an acyclic
group having 4 or more carbon atoms. In certain embodiments,
R.sup.C is an unsubstituted acyclic group. For example, R.sup.B is
C.sub.6-14 aryl or 5-14 membered heteroaryl; and R.sup.C is
C.sub.1-10 alkyl, e.g., R.sup.B is C.sub.6-14 aryl; and R.sup.C is
C.sub.1-10 alkyl.
[0408] In certain embodiments, R.sup.A and R.sup.B are
independently selected from C.sub.6-14 aryl and 5-14 membered
heteroaryl. In certain embodiments, R.sup.A is C.sub.6-14 aryl and
R.sup.B is C.sub.6-14 aryl or 5-14 membered heteroaryl. In certain
embodiments, R.sup.A is 5-14 membered heteroaryl and R.sup.B is
C.sub.6-14 aryl or 5-14 membered heteroaryl. In certain
embodiments, R.sup.A is C.sub.6-14 aryl or 5-14 membered heteroaryl
and R.sup.B is C.sub.6-14 aryl. In certain embodiments, R.sup.A is
C.sub.6-14 aryl or 5-14 membered heteroaryl and R.sup.B is 5-14
membered heteroaryl.
[0409] In certain embodiments, both R.sup.A and R.sup.B are
C.sub.6-14 aryl. In certain embodiments, both R.sup.A and R.sup.B
are phenyl.
[0410] In certain embodiments, R.sup.A is C.sub.6-14 aryl and
R.sup.B is C.sub.3-10 carbocyclyl.
[0411] In certain embodiments, R.sup.A is C.sub.6-14 aryl and
R.sup.B is 5-14 membered heteroaryl.
[0412] In certain embodiments, R.sup.A is C.sub.6-14 aryl and
R.sup.B is 3-14 membered heterocyclyl.
[0413] In certain embodiments, R.sup.A is C.sub.6-14 aryl and
R.sup.B and R.sup.C together with the nitrogen (N) atom to which
each is attached are joined to form a 5-14 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring.
[0414] In certain embodiments, both R.sup.A and R.sup.B are 5-14
membered heteroaryl.
[0415] In certain embodiments, R.sup.A is 5-14 membered heteroaryl
and R.sup.B is C.sub.3-10 carbocyclyl.
[0416] In certain embodiments, R.sup.A is 5-14 membered heteroaryl
and R.sup.B is C.sub.6-14 aryl.
[0417] In certain embodiments, R.sup.A is 5-14 membered heteroaryl
and R.sup.B is 3-14 membered heterocyclyl.
[0418] In certain embodiments, R.sup.A is 5-14 membered heteroaryl
and R.sup.B and R.sup.C together with the nitrogen (N) atom to
which each is attached are joined to form a 5-14 membered
carbocyclyl, heterocyclyl, aryl or heteroaryl ring.
[0419] In certain embodiments, R.sup.A is C.sub.6-14 aryl; R.sup.B
and R.sup.C together with the nitrogen (N) atom to which each is
attached are joined to form a 5-14 membered carbocyclyl,
heterocyclyl, aryl or heteroaryl ring; and X is selected from
hydrogen, --CN, --CHO, --C(.dbd.O)R.sup.C1,
--C(.dbd.O)N(R.sup.C2).sub.2, --CO.sub.2H, --CO.sub.2R.sup.C1,
--C(.dbd.NR.sup.C2)OR.sup.C1, --C(.dbd.NR.sup.C2)N(R.sup.C2).sub.2,
--C(.dbd.S)N(R.sup.C2).sub.2, --C(.dbd.O)SR.sup.C1,
--C(.dbd.S)SR.sup.C1, C.sub.1-10 perhaloalkyl, C.sub.6-14 aryl, and
5-14 membered heteroaryl.
[0420] In certain embodiments, R.sup.A is C.sub.6-14 aryl; R.sup.B
is C.sub.6-14 aryl or 5-14 membered heteroaryl; R.sup.C is an
acyclic group; and X is selected from hydrogen, --CN, --CHO,
--C(.dbd.O)R.sup.C1, --C(.dbd.O)N(R.sup.C2).sub.2, --CO.sub.2H,
--CO.sub.2R.sup.C1, --C(.dbd.NR.sup.C2)OR.sup.C1,
--C(.dbd.NR.sup.C)N(R.sup.C2).sub.2, --C(S)N(R.sup.C2).sub.2,
--C(.dbd.O)SR.sup.C1, --C(.dbd.S)SR.sup.C1, C.sub.1-10
perhaloalkyl, C.sub.6-14 aryl, and 5-14 membered heteroaryl.
[0421] In certain embodiments, the compound is of the formula
(II):
##STR00044##
[0422] or a pharmaceutically acceptable form thereof;
[0423] wherein X, R.sup.C, W--R.sup.1, W--R.sup.2, W--R.sup.3,
W--R.sup.4, W--R.sup.5, W--R.sup.6, W--R.sup.7, W--R.sup.8,
W--R.sup.9, and W--R.sup.10 are as defined above and herein.
[0424] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 of the formula (II) is the group
-L-R.sup.D as defined above and herein. In certain embodiments, at
least one of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 of the
formula (II) is further selected from the group --R.sup.E as
defined above and herein.
[0425] In certain embodiments, the compound is of the formulae
(II-a), (II-b) or (II-c):
##STR00045##
[0426] or a pharmaceutically acceptable form thereof;
[0427] wherein X, R.sup.C, W--R.sup.1, W--R.sup.2, W--R.sup.3,
W--R.sup.4, W--R.sup.5, W--R.sup.7, W--R.sup.8, W--R.sup.9, and
W--R.sup.10 are as defined above and herein.
[0428] In certain embodiments, at least one of R.sup.7, R.sup.8,
R.sup.9 and R.sup.10 of the formulae (II-a), (II-b) or (II-c) is
the group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.7, R.sup.8, R.sup.9 and R.sup.10
of the formulae (II-a), (II-b) or (II-c) is further selected from
the group --R.sup.E as defined above and herein.
[0429] In certain embodiments, the compound is of the formula
(III):
##STR00046##
[0430] or a pharmaceutically acceptable form thereof;
[0431] wherein X, R.sup.C, R.sup.1, R.sup.2, R.sup.3, R.sup.4,
R.sup.5, W--R.sup.6, W--R.sup.7, W--R.sup.8, W--R.sup.9, and
W--R.sup.10 defined are as defined above and herein.
[0432] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 of the compound of formula (III) is
the group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and
R.sup.10 of the compound of formula (III) is further selected from
the group --R.sup.E as defined above and herein.
[0433] In certain embodiments, the compound is of the formulae
(III-a), (III-b) or (III-c):
##STR00047##
[0434] or a pharmaceutically acceptable form thereof;
[0435] wherein X, R.sup.C, R.sup.1, R.sup.2, R.sup.3, R.sup.4,
R.sup.5, W--R.sup.7, W--R.sup.8, W--R.sup.9, and W--R.sup.10 are as
defined above and herein.
[0436] In certain embodiments, at least one of R.sup.7, R.sup.8,
R.sup.9 and R.sup.10 of the formulae (III-a), (III-b) or (III-c) is
the group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.7, R.sup.8, R.sup.9 and R.sup.10
of formulae (III-a), (III-b) or (III-c) is further selected from
the group --R.sup.E as defined above and herein.
[0437] In certain embodiments, the compound is of the formula
(IV):
##STR00048##
[0438] or a pharmaceutically acceptable form thereof;
[0439] wherein X, R.sup.C, R.sup.1, R.sup.2, R.sup.3, R.sup.4,
R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are as
defined above and herein.
[0440] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 of the formula (IV) is the group
-L-R.sup.D as defined above and herein. In certain embodiments, at
least one of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 of the
formula (IV) is further selected from the group --R.sup.E as
defined above and herein. In certain embodiments, R.sup.1-R.sup.5
are independently H, C.sub.1-10 alkyl, C.sub.1-10 alkyloxy,
C.sub.6-14 aryloxy, CN, --SO.sub.2N(R.sup.A7).sub.2,
--SO.sub.2R.sup.A6, and --SO.sub.2OR.sup.A6; R.sup.C is
unsubstituted C.sub.1-10 alkyl or unsubstituted C.sub.3-10
carbocyclyl; and R.sup.6-R.sup.10 are independently selected from
H, C.sub.1-10 alkyl, C.sub.1-10 alkyloxy, C.sub.6-14 aryloxy, COOH,
and --CO.sub.2R.sup.A6. In certain embodiments, R.sup.1-R.sup.5 are
independently H, methyl, methoxy, CN, and SO.sub.2Me; R.sup.C is
unsubstituted C.sub.1-3 alkyl or unsubstituted C.sub.5-6
cycloalkyl; and R.sup.6-R.sup.10 are independently selected from H,
methyl, methoxy, phenoxy, COOH, and CO.sub.2Me.
[0441] In certain embodiments, the compound is of the formulae
(IV-a), (IV-b), (IV-c), or (IV-d):
##STR00049##
[0442] or a pharmaceutically acceptable form thereof;
[0443] wherein X, R.sup.C, R.sup.1, R.sup.2, R.sup.3, R.sup.4,
R.sup.5, R.sup.6, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are as
defined above and herein.
[0444] In certain embodiments, at least one of R.sup.7, R.sup.8,
R.sup.9 and R.sup.10 of the formulae (IV-a), (IV-b) or (IV-c) is
the group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.7, R.sup.8, R.sup.9 and R.sup.10
of the formulae (IV-a), (IV-b), (IV-c) or (IV-d) is further
selected from the group --R.sup.E as defined above and herein.
[0445] In one embodiment, provided herein is a compound of formula
(IV-d), or a pharmaceutically acceptable form thereof. In one
embodiment where the compound is of formula (IV-d), R.sup.C is
C.sub.1-10alkyl or C.sub.3-10-carbocyclyl. In one embodiment,
R.sup.C is ethyl, isopropyl, cyclopentyl or cyclohexyl.
[0446] In another embodiment where the compound is of formula
(IV-d), R.sup.1 and R.sup.2 are each independently hydrogen,
halogen, --CN, --OR.sup.A1 or --SO.sub.2R.sup.A1, wherein R.sup.A1
is C.sub.1-10alkyl. In another embodiment, R.sup.1 and R.sup.2 are
each independently hydrogen, fluoro, methoxy, --CN or
--SO.sub.2CH.sub.3.
[0447] In another embodiment where the compound is of formula
(IV-d), R.sup.6 and R.sup.7 are each independently hydrogen,
halogen or --O--R.sup.B1, wherein R.sup.B1 is C.sub.1-10alkyl or
C.sub.6-14aryl. In another embodiment, R.sup.6 and R.sup.7 are each
independently hydrogen, fluoro, methoxy or phenyloxy.
[0448] In certain embodiments, the compound is of the formula
(V):
##STR00050##
[0449] or a pharmaceutically acceptable form thereof;
[0450] wherein X, R.sup.C, V, Y, Z, R.sup.1, R.sup.2, R.sup.3,
R.sup.6, R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are as defined
above and herein.
[0451] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 of the formula (V) is the group
-L-R.sup.D as defined above and herein. In certain embodiments, at
least one of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 of the
formula (V) is further selected from the group --R.sup.E as defined
above and herein.
[0452] In certain embodiments, the compound is of the formulae
(V-a), (V-b) or (V-c):
##STR00051##
[0453] or a pharmaceutically acceptable form thereof;
[0454] wherein X, R.sup.C, V, Y, Z, R.sup.1, R.sup.2, R.sup.3,
R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are as defined above and
herein.
[0455] In certain embodiments, at least one of R.sup.7, R.sup.8,
R.sup.9 and R.sup.10 of the formulae (V-a), (V-b) or (V-c) is the
group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.7, R.sup.8, R.sup.9 and R.sup.10
of the formulae (V-a), (V-b) or (V-c) is further selected from the
group --R.sup.E as defined above and herein.
[0456] In certain embodiments, the compound is of the formula
(VI):
##STR00052##
[0457] or a pharmaceutically acceptable form thereof;
[0458] wherein R.sup.C, Y, R.sup.1, R.sup.2, R.sup.3, R.sup.6,
R.sup.7, R.sup.8, R.sup.9, and R.sup.10 are as defined above and
herein.
[0459] In certain embodiments, at least one of R.sup.6, R.sup.7,
R.sup.8, R.sup.9 and R.sup.10 of the formula (VI) is the group
-L-R.sup.D as defined above and herein. In certain embodiments, at
least one of R.sup.6, R.sup.7, R.sup.8, R.sup.9 and R.sup.10 of the
formula (VI) is further selected from the group --R.sup.E as
defined above and herein. In certain embodiments, R.sup.1-R.sup.3
are independently H, C.sub.1-10 alkyl, C.sub.1-10 alkyloxy,
C.sub.6-14 aryloxy, CN, --SO.sub.2N(R.sup.A7).sub.2,
--SO.sub.2R.sup.A6, and --SO.sub.2OR.sup.A6; R.sup.C is
unsubstituted C.sub.1-10 alkyl or unsubstituted C.sub.3-10
carbocyclyl; and R.sup.6-R.sup.10 are independently selected from
H, C.sub.1-10 alkyl, C.sub.1-10 alkyloxy, C.sub.6-14 aryloxy, COOH,
and --CO.sub.2R.sup.A6. In certain embodiments, R.sup.1-R.sup.3 are
independently H, methyl, methoxy, and CN; R.sup.C is unsubstituted
C.sub.5-6 cycloalkyl; and R.sup.6-R.sup.10 are independently
selected from H, methyl, methoxy, phenoxy, COOH, and
CO.sub.2Me.
[0460] In certain embodiments, the compound is of the formulae
(VI-a), (VI-b) or (VI-c):
##STR00053##
[0461] or a pharmaceutically acceptable form thereof;
[0462] wherein R.sup.C, Y, R.sup.1, R.sup.2, R.sup.3, R.sup.7,
R.sup.8, R.sup.9, and R.sup.10 are as defined above and herein.
[0463] In certain embodiments, at least one of R.sup.7, R.sup.8,
R.sup.9 and R.sup.10 of the formulae (VI-a), (VI-b) or (VI-c) is
the group -L-R.sup.D as defined above and herein. In certain
embodiments, at least one of R.sup.7, R.sup.8, R.sup.9 and R.sup.10
of the formulae (VI-a), (VI-b) or (VI-c) is further selected from
the group --R.sup.E as defined above and herein.
Exemplary Compounds
[0464] Exemplary compounds provided herein are set forth in the
Exemplification and listed in Table 1.
[0465] In certain embodiments, a compound of formula (I) is
selected from any of the compounds provided in Table 1. In certain
embodiments, a compound of formula (I) is selected from any of the
compounds provided in Table 1.
[0466] Activities provided from the FASN NADPH consumption Assay
are designated in Table 1, wherein "A" refers to compounds having
an IC.sub.50 of less than 200 .mu.M; "B" refers to compounds having
an IC.sub.50 of 200 .mu.M to 500 .mu.M, inclusive; "C" refers to
compounds having an IC.sub.50 of greater than 500 .mu.M to 1000
.mu.M, inclusive; and "D" refers to compounds having an IC.sub.50
of greater than 1000 .mu.M, as measured by the assay.
[0467] Activities provided from the FASN Scintillation Proximity
Flashplate Assay are provided in Table 1, wherein "A*" refers to
compounds having an IC.sub.50 of less than 200 .mu.M; "B*" refers
to compounds having an IC.sub.50 of 200 .mu.M to 500 .mu.M,
inclusive; "C*" refers to compounds having an IC.sub.50 of greater
than 500 .mu.M to 1000 .mu.M, inclusive; and "D*" refers to
compounds having an IC.sub.50 of greater than 1000 .mu.M, as
measured by the assay.
[0468] In certain embodiments, a compound of formula (I) is any of
the compounds provided in Table 1 having an activity of "A", "A*",
"B" or "B*". In certain embodiments, a compound of formula (I) is
any of the compounds provided in Table 1 having an activity of "A"
or "A*". In certain embodiments, a compound of formula (I) is any
of the compounds provided in Table 1 having an activity of "B" or
"B*".
[0469] For example, in certain embodiments, the compound of formula
(I) is a compound selected from the group consisting of:
##STR00054## ##STR00055## ##STR00056## ##STR00057## ##STR00058##
##STR00059##
or a pharmaceutically acceptable form thereof.
3. Pharmaceutically Acceptable Compositions and Formulations
[0470] In certain embodiments, provided herein is a pharmaceutical
composition comprising a compound of formula (I) or a
pharmaceutically acceptable form thereof, and one or more
pharmaceutically acceptable excipients.
[0471] In some embodiments, provided herein is a pharmaceutical
composition comprising a compound of formula (I) or a
pharmaceutically acceptable form thereof, as provided in Table 1
and a pharmaceutically acceptable excipient. In other embodiments,
provided herein is a pharmaceutical composition comprising a
compound of formula (I) or a pharmaceutically acceptable form
thereof, as provided in Table 1 having an activity of "A", "A*",
"B" or "B*," and a pharmaceutically acceptable excipient. In other
embodiments, provided herein is a pharmaceutical composition
comprising a compound of formula (I) or a pharmaceutically
acceptable form thereof, as provided in Table 1 having an activity
of "A" or "A*", and a pharmaceutically acceptable excipient.
[0472] As described above, the pharmaceutical compositions provided
herein can comprise a "pharmaceutically acceptable excipient",
which, as used herein, includes any and all solvents, diluents, or
other liquid vehicle, dispersion or suspension aids, surface active
agents, isotonic agents, thickening or emulsifying agents,
preservatives, solid binders, lubricants and the like, as suited to
the particular dosage form desired. Remington's Pharmaceutical
Sciences, 16th Ed., E. W. Martin (Mack Publishing Co., Easton, Pa.,
1980) discloses various pharmaceutically acceptable excipients used
in formulating pharmaceutically acceptable compositions and known
techniques for the preparation thereof. Except insofar as any
conventional excipient medium is incompatible with the compounds
provided herein, such as by producing any undesirable biological
effect or otherwise interacting in a deleterious manner with any
other component(s) of the pharmaceutically acceptable composition,
the excipient's use is contemplated to be within the scope of this
disclosure. Some examples of materials which can serve as
pharmaceutically acceptable excipients include, but are not limited
to, ion exchangers, alumina, aluminum stearate, lecithin, serum
proteins, such as human serum albumin, buffer substances such as
phosphates, glycine, sorbic acid, or potassium sorbate, partial
glyceride mixtures of saturated vegetable fatty acids, water, salts
or electrolytes, such as protamine sulfate, disodium hydrogen
phosphate, potassium hydrogen phosphate, sodium chloride, zinc
salts, colloidal silica, magnesium trisilicate, polyvinyl
pyrrolidone, polyacrylates, waxes,
polyethylene-polyoxypropylene-block polymers, wool fat, sugars such
as lactose, glucose and sucrose; starches such as corn starch and
potato starch; cellulose and its derivatives such as sodium
carboxymethyl cellulose, ethyl cellulose and cellulose acetate;
powdered tragacanth; malt; gelatin; talc; excipients such as cocoa
butter and suppository waxes; oils such as peanut oil, cottonseed
oil; safflower oil; sesame oil; olive oil; corn oil and soybean
oil; glycols; such a propylene glycol or polyethylene glycol;
esters such as ethyl oleate and ethyl laurate; agar; buffering
agents such as magnesium hydroxide and aluminum hydroxide; alginic
acid; pyrogen-free water; isotonic saline; Ringer's solution; ethyl
alcohol, and phosphate buffer solutions, as well as other non-toxic
compatible lubricants such as sodium lauryl sulfate and magnesium
stearate, as well as coloring agents, releasing agents, coating
agents, sweetening, flavoring and perfuming agents, preservatives
and antioxidants can also be present in the pharmaceutically
acceptable composition, according to the judgment of the
formulator.
[0473] In some embodiments, a compound of formula (I) is
administered at about 0.01 mg/kg to about 200 mg/kg, such as at
about 0.1 mg/kg to about 100 mg/kg, further such as at about 0.5
mg/kg to about 50 mg/kg.
[0474] A "subject" to which administration is contemplated
includes, but is not limited to, humans (i.e., a male or female of
any age group, e.g., a pediatric subject (e.g., infant, child,
adolescent) or adult subject (e.g., young adult, middle-aged adult
or senior adult)) and/or other primates (e.g., cynomolgus monkeys,
rhesus monkeys); mammals, including commercially relevant mammals
such as cattle, pigs, horses, sheep, goats, cats, and/or dogs;
and/or birds, including commercially relevant birds such as
chickens, ducks, geese, and/or turkeys.
[0475] The formulations of the pharmaceutically acceptable
compositions described herein can be prepared by any method known
or hereafter developed in the art of pharmacology. In general, such
preparatory methods include the step of bringing the compound of
formula (I) into association with one or more pharmaceutically
acceptable excipients and then, if necessary and/or desirable,
shaping and/or packaging the product into a desired single- or
multi-dose unit.
[0476] A pharmaceutical composition provided herein can be
prepared, packaged, and/or sold in bulk, as a single unit dose,
and/or as a plurality of single unit doses. As used herein, a "unit
dose" is a discrete amount of the pharmaceutical composition
comprising a predetermined amount of at least one compound of
formula (I). The amount of the compound of formula (I) is generally
equal to the dosage of the compound of formula (I) which would be
administered to a subject and/or a convenient fraction of such a
dosage such as, for example, one-half or one-third of such a
dosage.
[0477] The relative amounts of the compound of formula (I), the
pharmaceutically acceptable excipient, and/or any additional
ingredients in a pharmaceutical composition provided herein will
vary, depending upon the identity, size, and/or condition of the
subject treated and further depending upon the route by which the
composition is to be administered. By way of example, the
composition can comprise between 0.1% and 100% (w/w) of the
compound of formula (I).
[0478] In some embodiments, the pharmaceutically acceptable
excipient is at least 95%, 96%, 97%, 98%, 99%, or 100% pure. In
some embodiments, the excipient is approved for use in humans and
for veterinary use. In some embodiments, the excipient has been
approved by United States Food and Drug Administration. In some
embodiments, the excipient is pharmaceutical grade. In some
embodiments, the excipient meets the standards of the United States
Pharmacopoeia (USP), the European Pharmacopoeia (EP), the British
Pharmacopoeia, and/or the International Pharmacopoeia.
[0479] Pharmaceutically acceptable excipients used in the
manufacture of pharmaceutically acceptable compositions include,
but are not limited to, inert diluents, dispersing and/or
granulating agents, surface active agents and/or emulsifiers,
disintegrating agents, binding agents, preservatives, buffering
agents, lubricating agents, and/or oils. One or more such
excipients can optionally be included in the formulations.
Excipients such as cocoa butter and suppository waxes, coloring
agents, coating agents, sweetening, flavoring, and perfuming agents
can be present in the pharmaceutically acceptable composition,
according to the judgment of the formulator.
[0480] Exemplary pharmaceutically acceptable excipients include,
but are not limited to, diluents such as calcium carbonate, sodium
carbonate, calcium phosphate, dicalcium phosphate, calcium sulfate,
calcium hydrogen phosphate, sodium phosphate lactose, sucrose,
cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol,
inositol, sodium chloride, dry starch, cornstarch, powdered sugar,
etc., and combinations thereof.
[0481] Exemplary granulating and/or dispersing agents include, but
are not limited to, potato starch, corn starch, tapioca starch,
sodium starch glycolate, clays, alginic acid, guar gum, citrus
pulp, agar, bentonite, cellulose and wood products, natural sponge,
cation-exchange resins, calcium carbonate, silicates, sodium
carbonate, cross-linked poly(vinyl-pyrrolidone) (crospovidone),
sodium carboxymethyl starch (sodium starch glycolate),
carboxymethyl cellulose, cross-linked sodium carboxymethyl
cellulose (croscarmellose), methylcellulose, pregelatinized starch
(starch 1500), microcrystalline starch, water insoluble starch,
calcium carboxymethyl cellulose, magnesium aluminum silicate
(Veegum), sodium lauryl sulfate, quaternary ammonium compounds,
etc., and combinations thereof.
[0482] Exemplary surface active agents and/or emulsifiers include,
but are not limited to, natural emulsifiers (e.g. acacia, agar,
alginic acid, sodium alginate, tragacanth, chondrux, cholesterol,
xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol,
wax, and lecithin), colloidal clays (e.g. bentonite [aluminum
silicate] and Veegum [magnesium aluminum silicate]), long chain
amino acid derivatives, high molecular weight alcohols (e.g.
stearyl alcohol, cetyl alcohol, oleyl alcohol, triacetin
monostearate, ethylene glycol distearate, glyceryl monostearate,
and propylene glycol monostearate, polyvinyl alcohol), carbomers
(e.g. carboxy polymethylene, polyacrylic acid, acrylic acid
polymer, and carboxyvinyl polymer), carrageenan, cellulosic
derivatives (e.g. carboxymethylcellulose sodium, powdered
cellulose, hydroxymethyl cellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, methylcellulose), sorbitan fatty
acid esters (e.g. polyoxyethylene sorbitan monolaurate [Tween 20],
polyoxyethylene sorbitan [Tween 60], polyoxyethylene sorbitan
monooleate [Tween 80], sorbitan monopalmitate [Span 40], sorbitan
monostearate [Span 60], sorbitan tristearate [Span 65], glyceryl
monooleate, sorbitan monooleate [Span 80]), polyoxyethylene esters
(e.g. polyoxyethylene monostearate [Myrj 45], polyoxyethylene
hydrogenated castor oil, polyethoxylated castor oil,
polyoxymethylene stearate, and Solutol), sucrose fatty acid esters,
polyethylene glycol fatty acid esters (e.g. Cremophor),
polyoxyethylene ethers, (e.g. polyoxyethylene lauryl ether [Brij
30]), poly(vinyl-pyrrolidone), diethylene glycol monolaurate,
triethanolamine oleate, sodium oleate, potassium oleate, ethyl
oleate, oleic acid, ethyl laurate, sodium lauryl sulfate, Pluronic
F 68, Poloxamer 188, cetrimonium bromide, cetylpyridinium chloride,
benzalkonium chloride, docusate sodium, etc. and/or combinations
thereof.
[0483] Exemplary binding agents include, but are not limited to,
starch (e.g. cornstarch and starch paste); gelatin; sugars (e.g.
sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol,
mannitol, etc.); natural and synthetic gums (e.g. acacia, sodium
alginate, extract of Irish moss, panwar gum, ghatti gum, mucilage
of isapol husks, carboxymethylcellulose, methylcellulose,
ethylcellulose, hydroxyethylcellulose, hydroxypropyl cellulose,
hydroxypropyl methylcellulose, microcrystalline cellulose,
cellulose acetate, poly(vinyl-pyrrolidone), magnesium aluminum
silicate (Veegum), and larch arabogalactan); alginates;
polyethylene oxide; polyethylene glycol; inorganic calcium salts;
silicic acid; polymethacrylates; waxes; water; alcohol; etc.; and
combinations thereof.
[0484] Exemplary preservatives can include antioxidants, chelating
agents, antimicrobial preservatives, antifungal preservatives,
alcohol preservatives, acidic preservatives, and other
preservatives. Exemplary antioxidants include, but are not limited
to, alpha tocopherol, ascorbic acid, acorbyl palmitate, butylated
hydroxyanisole, butylated hydroxytoluene, monothioglycerol,
potassium metabisulfite, propionic acid, propyl gallate, sodium
ascorbate, sodium bisulfite, sodium metabisulfite, and sodium
sulfite. Exemplary chelating agents include
ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate,
disodium edetate, dipotassium edetate, edetic acid, fumaric acid,
malic acid, phosphoric acid, sodium edetate, tartaric acid, and
trisodium edetate. Exemplary antimicrobial preservatives include,
but are not limited to, benzalkonium chloride, benzethonium
chloride, benzyl alcohol, bronopol, cetrimide, cetylpyridinium
chloride, chlorhexidine, chlorobutanol, chlorocresol,
chloroxylenol, cresol, ethyl alcohol, glycerin, hexetidine,
imidurea, phenol, phenoxyethanol, phenylethyl alcohol,
phenylmercuric nitrate, propylene glycol, and thimerosal. Exemplary
antifungal preservatives include, but are not limited to, butyl
paraben, methyl paraben, ethyl paraben, propyl paraben, benzoic
acid, hydroxybenzoic acid, potassium benzoate, potassium sorbate,
sodium benzoate, sodium propionate, and sorbic acid. Exemplary
alcohol preservatives include, but are not limited to, ethanol,
polyethylene glycol, phenol, phenolic compounds, bisphenol,
chlorobutanol, hydroxybenzoate, and phenylethyl alcohol. Exemplary
acidic preservatives include, but are not limited to, vitamin A,
vitamin C, vitamin E, beta-carotene, citric acid, acetic acid,
dehydroacetic acid, ascorbic acid, sorbic acid, and phytic acid.
Other preservatives include, but are not limited to, tocopherol,
tocopherol acetate, deteroxime mesylate, cetrimide, butylated
hydroxyanisol (BHA), butylated hydroxytoluened (BHT),
ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether
sulfate (SLES), sodium bisulfite, sodium metabisulfite, potassium
sulfite, potassium metabisulfite, Glydant Plus, Phenonip,
methylparaben, Germall 115, Germaben II, Neolone, Kathon, and
Euxyl. In certain embodiments, the preservative is an anti-oxidant.
In other embodiments, the preservative is a chelating agent.
[0485] Exemplary buffering agents include, but are not limited to,
citrate buffer solutions, acetate buffer solutions, phosphate
buffer solutions, ammonium chloride, calcium carbonate, calcium
chloride, calcium citrate, calcium glubionate, calcium gluceptate,
calcium gluconate, D-gluconic acid, calcium glycerophosphate,
calcium lactate, propanoic acid, calcium levulinate, pentanoic
acid, dibasic calcium phosphate, phosphoric acid, tribasic calcium
phosphate, calcium hydroxide phosphate, potassium acetate,
potassium chloride, potassium gluconate, potassium mixtures,
dibasic potassium phosphate, monobasic potassium phosphate,
potassium phosphate mixtures, sodium acetate, sodium bicarbonate,
sodium chloride, sodium citrate, sodium lactate, dibasic sodium
phosphate, monobasic sodium phosphate, sodium phosphate mixtures,
tromethamine, magnesium hydroxide, aluminum hydroxide, alginic
acid, pyrogen-free water, isotonic saline, Ringer's solution, ethyl
alcohol, etc., and combinations thereof.
[0486] Exemplary lubricating agents include, but are not limited
to, magnesium stearate, calcium stearate, stearic acid, silica,
talc, malt, glyceryl behanate, hydrogenated vegetable oils,
polyethylene glycol, sodium benzoate, sodium acetate, sodium
chloride, leucine, magnesium lauryl sulfate, sodium lauryl sulfate,
etc., and combinations thereof.
[0487] Exemplary oils include, but are not limited to, almond,
apricot kernel, avocado, babassu, bergamot, black current seed,
borage, cade, camomile, canola, caraway, carnauba, castor,
cinnamon, cocoa butter, coconut, cod liver, coffee, corn, cotton
seed, emu, eucalyptus, evening primrose, fish, flaxseed, geraniol,
gourd, grape seed, hazel nut, hyssop, isopropyl myristate, jojoba,
kukui nut, lavandin, lavender, lemon, litsea cubeba, macademia nut,
mallow, mango seed, meadowfoam seed, mink, nutmeg, olive, orange,
orange roughy, palm, palm kernel, peach kernel, peanut, poppy seed,
pumpkin seed, rapeseed, rice bran, rosemary, safflower, sandalwood,
sasquana, savoury, sea buckthorn, sesame, shea butter, silicone,
soybean, sunflower, tea tree, thistle, tsubaki, vetiver, walnut,
and wheat germ oils. Exemplary oils include, but are not limited
to, butyl stearate, caprylic triglyceride, capric triglyceride,
cyclomethicone, diethyl sebacate, dimethicone 360, isopropyl
myristate, mineral oil, octyldodecanol, oleyl alcohol, silicone
oil, and combinations thereof.
[0488] Liquid dosage forms for oral and parenteral administration
include, but are not limited to, pharmaceutically acceptable
emulsions, microemulsions, solutions, suspensions, syrups and
elixirs. In addition to the compound of formula (I), the liquid
dosage forms can comprise inert diluents commonly used in the art
such as, for example, water or other solvents, solubilizing agents
and emulsifiers such as ethyl alcohol, isopropyl alcohol, ethyl
carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate,
propylene glycol, 1,3-butylene glycol, dimethylformamide, oils (in
particular, cottonseed, groundnut, corn, germ, olive, castor, and
sesame oils), glycerol, tetrahydrofurfuryl alcohol, polyethylene
glycols and fatty acid esters of sorbitan, and mixtures thereof.
Besides inert diluents, the oral compositions can include adjuvants
such as wetting agents, emulsifying and suspending agents,
sweetening, flavoring, and perfuming agents. In certain embodiments
for parenteral administration, the conjugates provided herein are
mixed with solubilizing agents such as Cremophor, alcohols, oils,
modified oils, glycols, polysorbates, cyclodextrins, polymers, and
combinations thereof. For example, in certain embodiments, the oral
suspension can comprise at least one compound of formula (I) and
carboxymethylcellulose. In some embodiments, the oral suspension
can comprise at least one compound of formula (I),
carboxymethylcellulose, and DMSO. In one embodiment, the oral
suspension can comprise a compound of formula (I) and 0.5%
carboxymethylcellulose/5% DMSO/0.5% Tween (PKPD#5). In another
embodiment, the oral suspension can comprise a compound of formula
(I) and between about 0.1 and 2% carboxymethylcellulose.
[0489] Injectable preparations, for example, sterile injectable
aqueous or oleaginous suspensions can be formulated according to
the known art using suitable dispersing or wetting agents and
suspending agents. The sterile injectable preparation can be a
sterile injectable solution, suspension or emulsion in a nontoxic
parenterally acceptable diluent or solvent, for example, as a
solution in 1,3-butanediol. Among the acceptable vehicles and
solvents that can be employed are water, Ringer's solution, U.S.P.
and isotonic sodium chloride solution. In addition, sterile, fixed
oils are conventionally employed as a solvent or suspending medium.
For this purpose any bland fixed oil can be employed including
synthetic mono- or diglycerides. In addition, fatty acids such as
oleic acid are used in the preparation of injectables.
[0490] The injectable formulations can be sterilized, for example,
by filtration through a bacterial-retaining filter, or by
incorporating sterilizing agents in the form of sterile solid
compositions which can be dissolved or dispersed in sterile water
or other sterile injectable medium prior to use. Injectable
compositions can contain from about 0.1 to about 5% w/w of the
compound of formula (I).
[0491] In order to prolong the effect of a drug, it is often
desirable to slow the absorption of the drug from subcutaneous or
intramuscular injection. This can be accomplished by the use of a
liquid suspension of crystalline or amorphous material with poor
water solubility. The rate of absorption of the drug then depends
upon its rate of dissolution which, in turn, can depend upon
crystal size and crystalline form. Alternatively, delayed
absorption of a parenterally administered drug form can be
accomplished by dissolving or suspending the drug in an oil
vehicle.
[0492] Compositions for rectal or vaginal administration are
typically suppositories which can be prepared by mixing the
conjugates provided herein with suitable non-irritating excipients
such as cocoa butter, polyethylene glycol or a suppository wax
which are solid at ambient temperature but liquid at body
temperature and therefore melt in the rectum or vaginal cavity and
release the compound of formula (I).
[0493] Solid dosage forms for oral administration include capsules,
tablets, pills, powders, and granules. In such solid dosage forms,
the compound of formula (I) is mixed with at least one inert,
pharmaceutically acceptable excipient such as sodium citrate or
dicalcium phosphate and/or a) fillers or extenders such as
starches, lactose, sucrose, glucose, mannitol, and silicic acid, b)
binders such as, for example, carboxymethylcellulose, alginates,
gelatin, polyvinylpyrrolidinone, sucrose, and acacia, c) humectants
such as glycerol, d) disintegrating agents such as agar, calcium
carbonate, potato or tapioca starch, alginic acid, certain
silicates, and sodium carbonate, e) solution retarding agents such
as paraffin, f) absorption accelerators such as quaternary ammonium
compounds, g) wetting agents such as, for example, cetyl alcohol
and glycerol monostearate, h) absorbents such as kaolin and
bentonite clay, and i) lubricants such as talc, calcium stearate,
magnesium stearate, solid polyethylene glycols, sodium lauryl
sulfate, and mixtures thereof. In the case of capsules, tablets and
pills, the dosage form can comprise buffering agents. The unit dose
formulation, for example, a tablet, can contain from about 0.05% to
about 95% by weight of the compound of formula (I).
[0494] Solid compositions of a similar type can be employed as
fillers in soft and hard-filled gelatin capsules using such
pharmaceutically acceptable excipients as lactose or milk sugar as
well as high molecular weight polyethylene glycols and the like.
The solid dosage forms of tablets, dragees, capsules, pills, and
granules can be prepared with coatings and shells such as enteric
coatings and other coatings well known in the pharmaceutical
formulating art. They can optionally comprise opacifying agents and
can be of a composition that they release the compound of formula
(I) only. In some embodiments, the compound of formula (I) can be
released in a certain part of the intestinal tract, optionally, in
a delayed manner. Examples of embedding compositions which can be
used include polymeric substances and waxes. Solid compositions of
a similar type can be employed as fillers in soft and hard-filled
gelatin capsules using such excipients as lactose or milk sugar as
well as high molecular weight polethylene glycols and the like.
[0495] The compound of formula (I) can be in micro-encapsulated
form with one or more pharmaceutically acceptable excipients as
noted above. In such solid dosage forms, the compound of formula
(I) can be admixed with at least one inert diluent such as sucrose,
lactose or starch. Such dosage forms can comprise, as is normal
practice, additional substances other than inert diluents, e.g.,
tableting lubricants and other tableting aids such a magnesium
stearate and microcrystalline cellulose. In the case of capsules,
tablets and pills, the dosage forms can comprise buffering
agents.
[0496] Dosage forms for topical and/or transdermal administration
of a compound of formula (I) provided herein can include ointments,
pastes, creams, lotions, gels, powders, solutions, sprays,
inhalants and/or patches. Generally, the compound of formula (I) is
admixed under sterile conditions with one or more pharmaceutically
acceptable excipients and/or any needed preservatives and/or
buffers as may be required. Additionally, the use of transdermal
patches, which often have the added advantage of providing
controlled delivery of a compound of formula (I) to the body, is
contemplated herein. Such dosage forms can be prepared, for
example, by dissolving and/or dispensing the compound of formula
(I) in the proper medium. Alternatively or additionally, the rate
can be controlled by either providing a rate controlling membrane
and/or by dispersing the compound of formula (I) in a polymer
matrix and/or gel.
[0497] Suitable devices for use in delivering intradermal
pharmaceutically acceptable compositions described herein include
short needle devices such as those described in U.S. Pat. Nos.
4,886,499; 5,190,521; 5,328,483; 5,527,288; 4,270,537; 5,015,235;
5,141,496; and 5,417,662. Intradermal compositions can be
administered by devices which limit the effective penetration
length of a needle into the skin, such as those described in PCT
publication WO 99/34850 and functional equivalents thereof. Jet
injection devices which deliver liquid vaccines to the dermis via a
liquid jet injector and/or via a needle which pierces the stratum
corneum and produces a jet which reaches the dermis are suitable.
Jet injection devices are described, for example, in U.S. Pat. Nos.
5,480,381; 5,599,302; 5,334,144; 5,993,412; 5,649,912; 5,569,189;
5,704,911; 5,383,851; 5,893,397; 5,466,220; 5,339,163; 5,312,335;
5,503,627; 5,064,413; 5,520,639; 4,596,556; 4,790,824; 4,941,880;
4,940,460; and PCT publications WO 97/37705 and WO 97/13537.
Ballistic powder/particle delivery devices which use compressed gas
to accelerate vaccine in powder form through the outer layers of
the skin to the dermis are suitable. Alternatively or additionally,
conventional syringes can be used in the classical mantoux method
of intradermal administration.
[0498] Formulations suitable for topical administration include,
but are not limited to, liquid and/or semi liquid preparations such
as liniments, lotions, oil in water and/or water in oil emulsions
such as creams, ointments and/or pastes, and/or solutions and/or
suspensions. Topically-administrable formulations can, for example,
comprise from about 1% to about 10% (w/w) compound of formula (I),
although the concentration of the compound of formula (I) can be as
high as the solubility limit of the compound of formula (I) in the
solvent. In some embodiments, topically-administrable formulations
can, for example, comprise from about 1% to about 9% (w/w) compound
of formula (I), such as from about 1% to about 8% (w/w), further
such as from about 1% to about 7% (w/w), further such as from about
1% to about 6% (w/w), further such as from about 1% to about 5%
(w/w), further such as from about 1% to about 4% (w/w), further
such as from about 1% to about 3% (w/w), and further such as from
about 1% to about 2% (w/w) compound of formula (I). Formulations
for topical administration can further comprise one or more of the
additional pharmaceutically acceptable excipients described
herein.
[0499] A pharmaceutical composition provided herein can be
prepared, packaged, and/or sold in a formulation suitable for
pulmonary administration via the buccal cavity. Such a formulation
can comprise dry particles which comprise the compound of formula
(I) and which have a diameter in the range from about 0.5 to about
7 nanometers, such as from about 1 to about 6 nanometers, further
such as from about 2 to about 5 nanometers, and further such as
from about 3 to about 4 nanometers. Such pharmaceutical
compositions are conveniently in the form of dry powders for
administration using a device comprising a dry powder reservoir to
which a stream of propellant can be directed to disperse the powder
and/or using a self propelling solvent/powder dispensing container
such as a device comprising the compound of formula (I) dissolved
and/or suspended in a low-boiling propellant in a sealed container.
Such powders comprise particles wherein at least 98% of the
particles by weight have a diameter greater than 0.5 nanometers and
at least 95% of the particles by number have a diameter less than 7
nanometers. Alternatively, at least 95% of the particles by weight
have a diameter greater than 1 nanometer and at least 90% of the
particles by number have a diameter less than 6 nanometers. Dry
powder compositions can include a solid fine powder diluent such as
sugar and can be provided in a unit dose form.
[0500] Low boiling propellants generally include liquid propellants
having a boiling point of below 65.degree. F. at atmospheric
pressure. Generally, the propellant can constitute 50% to 99.9%
(w/w) of the pharmaceutical composition, and the active ingredient
can constitute 0.1% to 20% (w/w) of the pharmaceutical composition.
The propellant can further comprise additional excipients such as a
liquid non-ionic and/or solid anionic surfactant and/or a solid
diluent (which can have a particle size of the same order as
particles comprising the compound of formula (I)).
[0501] Pharmaceutical compositions provided herein formulated for
pulmonary delivery can provide the compound of formula (I) in the
form of droplets of a solution and/or suspension. Such formulations
can be prepared, packaged, and/or sold as aqueous and/or dilute
alcoholic solutions and/or suspensions, optionally sterile,
comprising the compound of formula (I), and can be administered
using any nebulization and/or atomization device. Such formulations
can further comprise one or more additional excipients including,
but not limited to, a flavoring agent such as saccharin sodium, a
volatile oil, a buffering agent, a surface active agent, and/or a
preservative such as methylhydroxybenzoate. The droplets provided
by this route of administration can have an average diameter in the
range from about 0.1 to about 200 nanometers.
[0502] The formulations described herein as being useful for
pulmonary delivery are useful for intranasal delivery of a
pharmaceutical composition provided herein. Another formulation
suitable for intranasal administration is a coarse powder
comprising the compound of formula (I) and having an average
particle from about 0.2 to 500 micrometers. Such a formulation is
administered, for example, by rapid inhalation through the nasal
passage from a container of the powder held close to the
nostrils.
[0503] Formulations suitable for nasal administration can, for
example, comprise from about as little as 0.1% (w/w) and as much as
100% (w/w) of the compound of formula (I), and can comprise one or
more of the additional excipients described herein. A
pharmaceutical composition provided herein can be prepared,
packaged, and/or sold in a formulation suitable for buccal
administration. Such formulations can, for example, be in the form
of tablets and/or lozenges made using conventional methods, and
can, for example, comprise 0.1 to 20% (w/w) of the compound of
formula (I), the balance comprising an orally dissolvable and/or
degradable composition and, optionally, one or more of the
additional pharmaceutically acceptable excipients described herein.
In some embodiments, formulations suitable for buccal
administration can comprise a powder and/or an aerosolized and/or
atomized solution and/or suspension comprising the compound of
formula (I). Such powdered, aerosolized, and/or aerosolized
formulations, when dispersed, can have an average particle and/or
droplet size in the range from about 0.1 to about 200 nanometers,
and can further comprise one or more of the additional
pharmaceutically acceptable excipients described herein.
[0504] A pharmaceutical composition provided herein can be
prepared, packaged, and/or sold in a formulation suitable for
ophthalmic administration. Such formulations can, for example, be
in the form of eye drops including, for example, a 0.1/1.0% (w/w)
solution and/or suspension of the compound of formula (I) in an
aqueous or oily liquid carrier. Such drops can further comprise
buffering agents, salts, and/or one or more other of the additional
pharmaceutically acceptable excipients described herein. Other
opthalmically-administrable formulations which are useful include
those which comprise the compound of formula (I) in
microcrystalline form and/or in a liposomal preparation. Ear drops
and/or eye drops are contemplated as being within the scope of this
disclosure.
[0505] General considerations in the formulation and/or manufacture
of pharmaceutical compositions can be found, for example, in
Remington: The Science and Practice of Pharmacy 21.sup.st Ed.,
(Lippincott Williams & Wilkins, 2005).
[0506] Although the descriptions of pharmaceutical compositions
provided herein are principally directed to pharmaceutical
compositions which are suitable for administration to humans, it
will be understood by the skilled artisan that such compositions
are generally suitable for administration to animals of all sorts.
Modification of pharmaceutical compositions suitable for
administration to humans in order to render the compositions
suitable for administration to various animals is well understood,
and the ordinarily skilled veterinary pharmacologist can design
and/or perform such modification with merely ordinary, if any,
experimentation.
[0507] Further provided herein are kits comprising one or more
compounds of formula (I) (or pharmaceutically acceptable forms
thereof), and/or an pharmaceutical composition as described above.
Kits are typically provided in a suitable container (e.g., for
example, a foil, plastic, or cardboard package). In certain
embodiments, a kit can include one or more pharmaceutically
acceptable excipients, pharmaceutical additives, therapeutically
active agents, and the like, as described herein. In certain
embodiments, a kit can include means for proper administration,
such as, for example, graduated cups, syringes, needles, cleaning
aids, and the like. In certain embodiments, a kit can include
instructions for proper administration and/or preparation for
proper administration.
[0508] The instructions would direct the consumer or medical
personnel to administer the dosage form according to administration
modes known to those skilled in the art. Such kits could be
packaged and sold in single or multiple kit units. An example of
such a kit is a so-called blister pack. Blister packs are well
known in the packaging industry and are being widely used for the
packaging of pharmaceutical unit dosage forms (tablets, capsules,
and the like). Blister packs generally consist of a sheet of
relatively stiff material covered with a foil of a preferably
transparent plastic material. During the packaging process,
recesses are formed in the plastic foil. The recesses have the size
and shape of the tablets or capsules to be packed. Next, the
tablets or capsules are placed in the recesses and the sheet of
relatively stiff material is sealed against the plastic foil at the
face of the foil which is opposite from the direction in which the
recesses were formed. As a result, the tablets or capsules are
sealed in the recesses between the plastic foil and the sheet. The
strength of the sheet is such that the tablets or capsules can be
removed from the blister pack by manually applying pressure on the
recesses whereby an opening is formed in the sheet at the place of
the recess. The tablet or capsule can then be removed via said
opening.
[0509] It can be desirable to provide a memory aid on the kit,
e.g., in the form of numbers next to the tablets or capsules
whereby the numbers correspond with the days of the regimen which
the tablets or capsules so specified should be ingested. Another
example of such a memory aid is a calendar printed on the card,
e.g., as follows "First Week, Monday, Tuesday, . . . etc. . . .
Second Week, Monday, Tuesday, . . . " etc. Other variations of
memory aids will be readily apparent. A "daily dose" can be a
single tablet or capsule or several pills or capsules to be taken
on a given day.
4. Uses and Methods of Treatment
4.1 Definitions
[0510] As used herein, and unless otherwise specified, the terms
"treat," "treating" and "treatment" contemplate an action that
occurs while a subject is suffering from the specified disease,
disorder or condition, which reduces the severity of the disease,
disorder or condition, or retards or slows the progression of the
disease, disorder or condition.
[0511] As used herein, unless otherwise specified, the terms
"prevent," "preventing" and "prevention" contemplate an action that
occurs before a subject begins to suffer from the specified
disease, disorder or condition, which inhibits or reduces the
severity of the disease, disorder or condition.
[0512] As used herein, and unless otherwise specified, the terms
"manage," "managing" and "management" encompass preventing the
recurrence of the specified disease, disorder or condition in a
subject who has already suffered from the disease, disorder or
condition, and/or lengthening the time that a subject who has
suffered from the disease, disorder or condition remains in
remission. The terms encompass modulating the threshold,
development and/or duration of the disease, disorder or condition,
or changing the way that a subject responds to the disease,
disorder or condition.
[0513] As used herein "inhibition", "inhibiting", "inhibit" and
"inhibitor", and the like, refer to the ability of a compound to
reduce, slow, halt or prevent activity of a particular biological
process (e.g., FASN activity) in a cell relative to vehicle. In
certain embodiments, the inhibition results in reduction of the
activity by 5%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 60%,
70%, 80%, 90% or more of the activity without such inhibition.
[0514] As used herein, and unless otherwise specified, a
"therapeutically effective amount" of a compound is an amount
sufficient to provide a therapeutic benefit in the treatment or
management of a disease, disorder or condition, or to delay or
minimize one or more symptoms associated with the disease, disorder
or condition. A therapeutically effective amount of a compound
means an amount of therapeutic agent, alone or in combination with
other therapies, which provides a therapeutic benefit in the
treatment or management of the disease, disorder or condition. The
term "therapeutically effective amount" can encompass an amount
that improves overall therapy, reduces or avoids symptoms or causes
of disease or condition, or enhances the therapeutic efficacy of
another therapeutic agent.
[0515] As used herein, and unless otherwise specified, a
"prophylactically effective amount" of a compound is an amount
sufficient to prevent a disease, disorder or condition, or one or
more symptoms associated with the disease, disorder or condition,
or prevent its recurrence. A prophylactically effective amount of a
compound means an amount of therapeutic agent, alone or in
combination with other agents, which provides a prophylactic
benefit in the prevention of the disease, disorder or condition.
The term "prophylactically effective amount" can encompass an
amount that improves overall prophylaxis or enhances the
prophylactic efficacy of another prophylactic agent.
4.2 Embodiments
[0516] In one embodiment, provided herein are methods for treating,
preventing and/or managing a FASN-mediated disorder, disease or
condition comprising administering to a subject in need thereof a
therapeutically or prophylactically effective amount of at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof.
[0517] In another embodiment, provided herein are methods for
inhibiting FASN in a subject comprising administering to a subject
in need thereof a therapeutically effective amount of at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof.
[0518] In another embodiment, provided herein is a method of
inhibiting activation of the FASN pathway in vitro or ex vivo,
comprising contacting a FASN protein with at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, in an
amount sufficient to reduce the activation of the FASN pathway.
[0519] In another embodiment, provided herein is the use of at
least one compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, for the treatment of a FASN-mediated disorder, disease or
condition in a subject.
[0520] In another embodiment, provided herein is the use of at
least one compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, in the manufacture of a medicament. In certain
embodiments, the medicament is useful for treating a FASN-mediated
disorder in a subject.
[0521] Compounds of formula (I) provided herein can be inhibitors
of FASN. A "FASN-mediated disorder" as used herein, refers to a
disease, disorder or condition which is treatable by inhibition of
FASN activity. FASN-mediated disorders include, but are not limited
to, hyperproliferative disorders; inflammatory disorders; obesity
related disorders, such as, but not limited to, Type II diabetes
mellitus and fatty liver disease; microbial infections, such as,
but not limited to, viral, bacterial, fungal, parasitic, and
protozoal infections; and complications thereof.
[0522] In certain embodiments, the FASN-mediated disorder is a
hyperproliferative disorder. In certain embodiments, the
hyperproliferative disorder is cancer. To date, aberrant FASN
activity has been observed in a variety of hyperproliferative
disorders which include, but are not limited to:
[0523] (i) bladder cancer (see Visca et al., Anticancer Res. (2003)
23:335-339);
[0524] (ii) brain cancer (e.g., meningioma, see: Haase et al.,
Neuro-Oncology (2010) Advance Access published Feb. 5, 2010, 1-11;
e.g., glioma: see Zhao et al., Br. J. Cancer (2006) 95:869-878;
e.g., meduloblastoma: see Slade et al., Anticancer Res. (2003)
23:1235-1243);
[0525] (iii) breast cancer (see Alo et al., Cancer (1996)
77:474-482; Pizer et al., Cancer Res. (1996) 56:2745-2747; Pizer et
al., Cancer Res. (2000) 60:213-218; Milgraum et al., Clin. Cancer
Res. (1997) 3:2115-2120; Lupu and Menendez, Endocrinology (2006)
147:4056-4066; Alo et al., Oncol. Rep. (2000) 7:1383-1388; Wang et
al., Cancer Lett. (2001) 167:99-104; Liu et al., Mol. Cancer. Ther.
(2008) 7:263-270; and Kuhajda et al., PNAS (2000) 97:3450-3454;
e.g., mammary cancer: see Hennigar et al., Biochim. Biophys. Acta
(1998) 1392:85-100 and Alli et al., Oncogene (2005) 24:39-46);
[0526] (iv) colorectal cancer (see Rashid et al., Am. J. Pathol.
(1997) 150:201-208; Huang et al., World J. Gastroenterol. (2000)
6:295-297; Zhan et al., Clin. Cancer Res. (2008) 14:5735-5742);
[0527] (v) esophageal cancer (see Nemoto et al., Pathobiology
(2001) 69:297-303);
[0528] (vi) endometrial cancer (see Pizer et al., Cancer (1998)
83:528-537; Pizer et al., Int. J. Gynecol. Pathol. (1997) 16:45-51;
Lupu and Menendez, Endocrinology (2006) 147:4056-406; and
Sebastiani et al., Gynecologic Oncology (2004) 92:101-105);
[0529] (viii) gastric cancer (see Kusakabe et al., Histopathology
(2002) 40:71-79);
[0530] (ix) gastrointestinal stromal tumor (see Rossi et al., J.
Pathol. (2006) 209:369-375);
[0531] (x) kidney cancer (e.g., nephroblastoma/Wilms' tumor: see
Camassei et al., Med. Pediatr. Oncol. (2003) 40:302-308);
[0532] (xi) liver cancer (see Evert et al., Lab. Invest. (2005)
85:99-108);
[0533] (xii) lung cancer (see Piyathilake et al., Human Pathol.
(2000) 31:1068-1073 and Visca et al., Anticancer Res. (2004)
24:4169-4173);
[0534] (xiii) mesothelioma (see Gabrielson et al., Clin. Cancer
Research (2001) 7:153-157);
[0535] (xiv) multiple myeloma (see Wang et al., J. Zhejiang Univ.
Sci B (2008) 9:441-447);
[0536] (xv) neuroblastoma (see Slade et al., Anticancer Res. (2003)
23:1235-1243);
[0537] (xvi) oral cancer (see Krontiras et al., Head Neck (1999)
21:325-329; and Agostini et al., Oral Oncol. (2004) 40:728-735; see
also e.g., oral squamous cell carcinoma (OSCC): Silva et al., Oral
Diseases (2007) 14:376-382);
[0538] (xvii) ovarian cancer (see Pizer et al., Cancer Res. (1996)
56:1189-1193; Alo et al., Oncol. Rep. (2000) 7:1383-1388; Wang et
al., Oncogene (2005) 24:3574-3582; Gansler et al., Hum. Pathol.
(1997) 28:686-692; and Zhou et al., Cancer Res. (2007)
2964-2971);
[0539] (xviii) pancreatic cancer (e.g., pancreatic andenocarcinoma,
intraductal papillary mucinous neoplasm (IPMN): see Walter et al.,
Cancer Epidemiol. Biomarkers Prey. (2009) 18:2380-2385);
[0540] (xix) Pagets disease of the vulva (see Alo et al., Int. J.
Gynecol. Pathol. (2005) 24:404-408);
[0541] (xx) prostate cancer (see Pizer et al., Proc Am. Assoc.
Cancer Res. (2000) 41:655; Swinnen et al., Int. J. Cancer (2002)
98:19-22; Epstein et al., Urology (1995) 45:81-86; De Schrijver et
al., Cancer Res. (2003) 63:3799-3804; Pizer et al., Prostate (2001)
47:102-110; Furuya et al., Anticancer Res. (1997) 17:4589-4593;
Shurbaji et al., Hum. Pathol. (1996) 27:917-921; Migita et al., J.
Nat. Cancer Inst. (2009) 101:519-532; Rossi et al., Mol.
Cancer.
[0542] Res. (2003) 1:707-715; and Shah et al., Hum. Pathol. (2006)
37:401-409);
[0543] (xxi) retinoblastoma (see Camassei et al., Investig.
Opthalmol. Vis. Sci. (2003) 44:2399-2403; and Slade et al.,
Anticancer Res. (2003) 23:1235-1243);
[0544] (xxii) soft tissue sarcoma (e.g., malignant fibrous
histiocytoma (MFH), liposarcoma, malignant peripheral nerve sheath
tumor (MPNST), chondrosarcoma: see Takahiro et al., Clin. Cancer
Res. (2003) 9:2204-2212);
[0545] (xxiii) skin cancer (e.g., melanoma: see Innocenzi et al.,
J. Cutan. Pathol. (2003) 30:23-28; Kapur et al., Modern Pathology
(2005) 18:1107-1112 and Carvalho et al., Int. J. Cancer (2008)
123:2557-2565); and
[0546] (xxiv) thyroid cancer (see Vald et al., Mod. Path. (1999)
12:70 A; Sekiguchi et al., Biomed. Pharmacother. (2001) 55:466-474;
e.g., papillary thyroid carcinoma (PTC): see Uddin et al., J. Clin.
Endocrinol. Metab. (2008) 93:4088-4097).
[0547] It is envisioned that aberrant FASN activity plays a role in
other hyperproliferative disorders. Exemplary hyperproliferative
diseases, disorders, conditions or cancers include, but are not
limited to, acoustic neuroma, adenocarcinoma, adrenal gland cancer,
angiosarcoma (e.g., lymphangiosarcoma, lymphangioendotheliosarcoma,
hemangiosarcoma), benign monoclonal gammopathy, biliary cancer
(e.g., cholangiocarcinoma), bladder cancer, breast cancer (e.g.,
adenocarcinoma of the breast, papillary carcinoma of the breast,
mammary cancer, medullary carcinoma of the breast), brain cancer
(e.g., meningioma; glioma, e.g., astrocytoma, oligodendroglioma;
medulloblastoma), bronchus cancer (e.g., bronchogenic carcinoma),
cervical cancer (e.g., cervical adenocarcinoma), choriocarcinoma,
chordoma, craniopharyngioma, colorectal cancer (e.g., colorectal
adenocarcinoma), epithelial carcinoma, ependymoma,
endotheliosarcoma (e.g., Kaposi's sarcoma, multiple idiopathic
hemorrhagic sarcoma), endometrial cancer, esophageal cancer (e.g.,
adenocarcinoma of the esophagus, Barrett's adenocarinoma), Ewing
sarcoma, familiar hypereosinophilia, gastric cancer (e.g., stomach
adenocarcinoma), gastrointestinal stromal tumor (GIST), head and
neck cancer, heavy chain disease (e.g., alpha chain disease, gamma
chain disease, mu chain disease), hemangioblastoma, inflammatory
myofibroblastic tumors, immunocytic amyloidosis, kidney cancer
(e.g., nephroblastoma a.k.a. Wilms' tumor, renal cell carcinoma),
liver cancer (e.g., hepatocellular cancer (HCC) such as
hepatocellular carcinoma, malignant hepatoma), lung cancer (e.g.,
small cell lung cancer (SCLC), non-small cell lung cancer (NSCLC),
adenocarcinoma of the lung), leukemia (e.g., acute lymphocytic
leukemia (ALL), acute myelocytic leukemia (AML), chronic myelocytic
leukemia (CML), chronic lymphocytic leukemia (CLL)), lymphoma
(e.g., Hodgkin lymphoma, non-Hodgkin lymphoma (NHL), follicular
lymphoma, diffuse large B-cell lymphoma (DLBCL), mantle cell
lymphoma (MCL)), leiomyosarcoma (LMS), mastocytosis (e.g., systemic
mastocytosis), multiple myeloma (MM), myelodysplastic syndrome
(MDS), mesothelioma, myeloproliferative disorder (MPD) (e.g.,
polycythemia Vera (PV), essential thrombocytosis (ET), agnogenic
myeloid metaplasia (AMM) a.k.a. myelofibrosis (MF), chronic
idiopathic myelofibrosis, chronic myelocytic leukemia (CML),
chronic neutrophilic leukemia (CNL), hypereosinophilic syndrome
(HES)), neuroblastoma, neurofibroma (e.g., neurofibromatosis (NF)
type 1 or type 2, schwannomatosis), neuroendocrine cancer (e.g.,
gastroenteropancreatic neuroendoctrine tumor (GEP--NET), carcinoid
tumor), osteosarcoma, oral cancer (e.g., oral squamous cell
carcinoma (OSCC)), ovarian cancer (e.g., cystadenocarcinoma,
ovarian embryonal carcinoma, ovarian adenocarcinoma), Paget's
disease of the vulva, Paget's disease of the penis, papillary
adenocarcinoma, pancreatic cancer (e.g., pancreatic
andenocarcinoma, intraductal papillary mucinous neoplasm (IPMN)),
pinealoma, primitive neuroectodermal tumor (PNT), prostate cancer
(e.g., prostate adenocarcinoma), rhabdomyosarcoma, retinoblastoma,
salivary gland cancer, skin cancer (e.g., squamous cell carcinoma
(SCC), keratoacanthoma (KA), melanoma, basal cell carcinoma), small
bowel cancer (e.g., appendix cancer), soft tissue sarcoma (e.g.,
malignant fibrous histiocytoma (MFH), liposarcoma, malignant
peripheral nerve sheath tumor (MPNST), chondrosarcoma,
fibrosarcoma, myxosarcoma), sebaceous gland carcinoma, sweat gland
carcinoma, synovioma, testicular cancer (e.g., seminoma, testicular
embryonal carcinoma), thyroid cancer (e.g., papillary carcinoma of
the thyroid, papillary thyroid carcinoma (PTC), medullary thyroid
cancer), and Waldenstrom's macroglobulinemia.
[0548] In certain embodiments, the hyperproliferative disorder is
selected from bladder cancer, brain cancer, breast cancer,
colorectal cancer, esophageal cancer, endometrial cancer, gastric
cancer, gastrointestinal stromal tumor, kidney cancer, liver
cancer, lung cancer, mesothelioma, multiple myeloma, neuroblastoma,
oral cancer, ovarian cancer, pancreatic cancer, prostate cancer,
Paget's disease of the vulva, retinoblastoma, soft tissue sarcoma,
skin cancer or thyroid cancer.
[0549] In certain embodiments, the cancer is selected from
mesothelioma, multiple myeloma, neuroblastoma, Paget's disease,
retinoblastoma, leukemia, myelodisplastic syndrome, or soft tissue
sarcoma.
[0550] In certain embodiments, the brain cancer is meningioma,
glioma or meduloblastoma.
[0551] In certain embodiments, the oral cancer is oral squamous
cell carcinoma.
[0552] In certain embodiments, the pancreatic cancer is pancreatic
andenocarcinoma or intraductal papillary mucinous neoplasm.
[0553] In certain embodiments, the soft tissue carcinoma is
malignant fibrous histiocytoma, liposarcoma, malignant peripheral
nerve sheath tumor, or chondrosarcoma.
[0554] In certain embodiments, the skin cancer is melanoma.
[0555] In certain embodiments, the thyroid cancer is papillary
thyroid carcinoma.
[0556] In certain embodiments, the FASN-mediated disorder is an
inflammatory disorder. The term "inflammatory disorder" refers to a
disease or condition characterized by one or more symptoms of pain,
heat, redness, swelling, and loss of function. Inflammatory
disorders are meant to encompass inflammation associated with
immune system disorders as well as inflammation associated with
non-immune system disorders. Inflammatory disorders are meant to
encompass acute inflammation and chronic inflammation. To date,
aberrant FASN activity has been observed in inflammatory bowel
diseases such as ulcerative colitis (see Consolazio et al.,
Anatomic Pathology (2006) 126:113-118; Rashid et al., Am. J.
Pathol. (1997) 150:201-208). It is envisioned that aberrant FASN
activity plays a role in other inflammatory disorders.
[0557] Exemplary inflammatory disorders include, but are not
limited to, inflammation associated with acne, anemia (e.g.,
aplastic anemia, haemolytic autoimmune anaemia), asthma, arteritis
(e.g., polyarteritis, temporal arteritis, periarteritis nodosa,
Takayasu's arteritis), arthritis (e.g., crystalline arthritis,
osteoarthritis, psoriatic arthritis, gouty arthritis, reactive
arthritis, rheumatoid arthritis and Reiter's arthritis), ankylosing
spondylitis, amylosis, amyotrophic lateral sclerosis, autoimmune
diseases, allergies or allergic reactions, Alzheimer's disease,
atherosclerosis, bronchitis, bursitis, cancer, chronic prostatitis,
conjunctivitis, Chagas disease, chronic obstructive pulmonary
disease, cermatomyositis, diverticulitis, diabetes (e.g., type I
diabetes mellitus, type 2 diabetes mellitus), dermatitis,
eosinophilic gastrointestinal disorders (e.g., eosinophilic
esophagitis, eosinophilic gastritis, eosinophilic gastroenteritis,
eosinophilic colitis), eczema, endometriosis, gastrointestinal
bleeding, gastritis, gastroesophageal reflux disease (GORD, or its
synonym GERD), Guillain-Barre syndrome, infection, ischaemic heart
disease, Kawasaki disease, glomerulonephritis, gingivitis,
hypersensitivity, headaches (e.g., migraine headaches, tension
headaches), ileus (e.g., postoperative ileus and ileus during
sepsis), idiopathic thrombocytopenic purpura, interstitial
cystitis, inflammatory bowel disease (IBD) (e.g., Crohn's disease,
ulcerative colitis, collagenous colitis, lymphocytic colitis,
ischaemic colitis, diversion colitis, Behcet's syndrome,
indeterminate colitis), inflammatory bowel syndrome (IBS), lupus,
multiple sclerosis, morphea, myeasthenia gravis, myocardial
ischemia, nephrotic syndrome, pemphigus vulgaris, pernicious
aneaemia, peptic ulcers, psoriasis, polymyositis, primary biliary
cirrhosis, Parkinson's disease, pelvic inflammatory disease,
reperfusion injury, regional enteritis, rheumatic fever, systemic
lupus erythematosus, schleroderma, scierodoma, sarcoidosis,
spondyloarthopathies, Sjogren's syndrome, thyroiditis,
transplantation rejection, tendonitis, trauma or injury (e.g.,
frostbite, chemical irritants, toxins, scarring, burns, physical
injury), vasculitis, vitiligo and Wegener's granulomatosis.
[0558] In some embodiment, the inflammatory disorder is selected
from anemia, asthma, arteritis, arthritis, chronic obstructive
pulmpnary disease, dermatitis, gastroesophageal reflux disease,
Crohn's disease, inflammatory bowel syndrome, multiple sclerosis,
psoriasis and an autoimmune disease.
[0559] Inhibition of FASN activity has also been observed to reduce
body weight (e.g., by blocking the body's ability to convert
carbohydrates to fat) and to suppress appetite (see Loftus et al.,
Science (2000) 288:2379-2381). Reduction of storage fat is expected
to provide various primary and/or secondary benefits in a subject
(e.g., in a subject diagnosed with a complication associated with
obesity) such as, for example, an increased insulin responsiveness
(e.g., in a subject diagnosed with Type II diabetes mellitus); a
reduction in elevated blood pressure; a reduction in elevated
cholesterol levels; and/or a reduction (or a reduced risk or
progression) of ischemic heart disease, arterial vascular disease,
angina, myocardial infarction, stroke, migraines, congestive heart
failure, deep vein thrombosis, pulmonary embolism, gall stones,
gastroesophagael reflux disease, obstructive sleep apnea, obesity
hypoventilation syndrome, asthma, gout, poor mobility, back pain,
erectile dysfunction, urinary incontinence, liver injury (e.g.,
fatty liver disease, liver cirrhosis, alcoholic cirrhosis,
endotoxin mediated liver injury) or chronic renal failure. Thus, In
some embodiments, disclosed methods are applicable to obese
subjects, diabetic subjects, and alcoholic subjects, and are
generally useful as part of a program to treat an obesity-related
disorder or a complication thereof.
[0560] An "obesity-related disorder" as used herein, includes, but
is not limited to, obesity, undesired weight gain (e.g., from
medication-induced weight gain, from cessation of smoking) and an
over-eating disorder (e.g., binge eating, bulimia, compulsive
eating, or a lack of appetite control each of which can optionally
lead to undesired weight gain or obesity).
[0561] "Obesity" and "obese" as used herein, refers to class I
obesity, class II obesity, class III obesity or pre-obesity (e.g.,
being "over-weight") as defined by the World Health
Organization.
[0562] In some embodiments, obesity-related disorder include, but
are not limited to, Type II diabetes mellitus, elevated blood
pressure, elevated cholesterol levels, ischemic heart disease,
arterial vascular disease, angina, myocardial infarction, stroke,
migraines, congestive heart failure, deep vein thrombosis,
pulmonary embolism, gall stones, gastroesophagael reflux disease,
obstructive sleep apnea, obesity hypoventilation syndrome, asthma,
gout, poor mobility, back pain, erectile dysfunction, urinary
incontinence, liver injury, fatty liver, and chronic renal
failure.
[0563] In some embodiments, treatment of an obesity-related
disorder or complication thereof involves reduction of body weight
in the subject. In some embodiments, treatment of an
obesity-related disorder or complication thereof involves appetite
control in the subject.
[0564] In other embodiments, provided herein are methods for
treating, preventing and/or managing a microbial infection (e.g.,
such as a bacterial infection, viral infection, fungal infection,
or parasitic or protozoal infection) comprising administering to a
subject a therapeutically or prophylactically effective amount of
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof, or a pharmaceutical composition comprising
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof.
[0565] Also provided herein is the use of at least one compound of
formula (I), or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, for the
treatment, prevention and/or management of a microbial infection in
a subject.
[0566] Also provided herein is the use of at least one compound of
formula (I), or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, in the
manufacture of a medicament useful for treating, preventing and/or
managing a microbial infection.
[0567] FASN has been identified as a target for treatment of
microbial infections, e.g., such as a viral infection, for example,
infection with an enveloped virus such as the herpes virus (e.g.,
human cytomegalomous virus (HCMV), herpes simplex virus 1 (HSV-1),
herpes simplex virus 2 (HSV-2), varicella zoster virus (VZV),
Epstein-Barr virus), influenza A virus and Heptatitis C virus (HCV)
(see Munger et al., Nature Biotechnology (2008) 26: 1179-1186; Syed
et al., Trends in Endocrinology and Metabolism (2009) 21:33-40;
Sakamoto et al., Nature Chemcial Biology (2005) 1:333-337; Yang et
al., Hepatology (2008) 48:1396-1403) or a picornavirus such as
Coxsackievirus B3 (CVB3) (see Rassmann et al., Anti-viral Research
(2007) 76:150-158). Other exemplary viruses include, but are not
limited to, the hepatitis B virus, HIV, poxvirus, hepadavirus,
retrovirus, and RNA viruses such as flavivirus, togavirus,
coronavirus, Hepatitis D virus, orthomyxovirus, paramyxovirus,
rhabdovirus, bunyavirus, and filovirus.
[0568] In some embodiments, the virus infects humans. In other
embodiments, the virus infects non-human animals. In another
embodiment, the virus infects primates (e.g., cynomolgus monkeys,
rhesus monkeys); mammals, including commercially relevant mammals
such as cattle, pigs, horses, sheep, goats, cats, and/or dogs;
and/or birds, including commercially relevant birds such as
chickens, ducks, geese, and/or turkeys.
[0569] In certain embodiments, the virus is an enveloped virus.
Examples include, but are not limited to, viruses that are members
of the hepadnavirus family, herpesvirus family, iridovirus family,
poxvirus family, flavivirus family, togavirus family, retrovirus
family, coronavirus family, filovirus family, rhabdovirus family,
bunyavirus family, orthomyxovirus family, paramyxovirus family, and
arenavirus family. Other examples include, but are not limited to,
Hepadnavirus hepatitis B virus (HBV), woodchuck hepatitis virus,
ground squirrel (Hepadnaviridae) hepatitis virus, duck hepatitis B
virus, heron hepatitis B virus, Herpesvirus herpes simplex virus
(HSV) types 1 and 2, varicella-zoster virus, cytomegalovirus (CMV),
human cytomegalovirus (HCMV), mouse cytomegalovirus (MCMV), guinea
pig cytomegalovirus (GPCMV), Epstein-Barr virus (EBV), human herpes
virus 6 (HHV variants A and B), human herpes virus 7 (HHV-7), human
herpes virus 8 (HHV-8), Kaposi's sarcoma-associated herpes virus
(KSHV), B virus Poxvirus vaccinia virus, variola virus, smallpox
virus, monkeypox virus, cowpox virus, camelpox virus, ectromelia
virus, mousepox virus, rabbitpox viruses, raccoonpox viruses,
molluscum contagiosum virus, orf virus, milker's nodes virus, bovin
papullar stomatitis virus, sheeppox virus, goatpox virus, lumpy
skin disease virus, fowlpox virus, canarypox virus, pigeonpox
virus, sparrowpox virus, myxoma virus, hare fibroma virus, rabbit
fibroma virus, squirrel fibroma viruses, swinepox virus, tanapox
virus, Yabapox virus, Flavivirus dengue virus, hepatitis C virus
(HCV), GB hepatitis viruses (GBV-A, GBV-B and GBV-C), West Nile
virus, yellow fever virus, St. Louis encephalitis virus, Japanese
encephalitis virus, Powassan virus, tick-borne encephalitis virus,
Kyasanur Forest disease virus, Togavirus, Venezuelan equine
encephalitis (VEE) virus, chikungunya virus, Ross River virus,
Mayaro virus, Sindbis virus, rubella virus, Retrovirus human
immunodeficiency virus (HIV) types 1 and 2, human T cell leukemia
virus (HTLV) types 1, 2, and 5, mouse mammary tumor virus (MMTV),
Rous sarcoma virus (RSV), lentiviruses, Coronavirus, severe acute
respiratory syndrome (SARS) virus, Filovirus Ebola virus, Marburg
virus, Metapneumoviruses (MPV) such as human metapneumovirus
(HMPV), Rhabdovirus rabies virus, vesicular stomatitis virus,
Bunyavirus, Crimean-Congo hemorrhagic fever virus, Rift Valley
fever virus, La Crosse virus, Hantaan virus, Orthomyxovirus,
influenza virus (types A, B, and C), Paramyxovirus, parainfluenza
virus (PIV types 1, 2 and 3), respiratory syncytial virus (types A
and B), measles virus, mumps virus, Arenavirus, lymphocytic
choriomeningitis virus, Junin virus, Machupo virus, Guanarito
virus, Lassa virus, Ampari virus, Flexal virus, Ippy virus, Mobala
virus, Mopeia virus, Latino virus, Parana virus, Pichinde virus,
Punta toro virus (PTV), Tacaribe virus and Tamiami virus.
[0570] In some embodiments, the virus is a non-enveloped virus,
i.e., the virus does not have an envelope and is naked. Examples
include, but are not limited to, viruses that are members of the
parvovirus family, circovirus family, polyoma virus family,
papillomavirus family, adenovirus family, iridovirus family,
reovirus family, birnavirus family, calicivirus family, and
picornavirus family. Specific examples include, but are not limited
to, canine parvovirus, parvovirus B19, porcine circovirus type 1
and 2, BFDV (Beak and Feather Disease virus, chicken anaemia virus,
Polyomavirus, simian virus 40 (SV40), JC virus, BK virus,
Budgerigar fledgling disease virus, human papillomavirus, bovine
papillomavirus (BPV) type 1, cotton tail rabbit papillomavirus,
human adenovirus (HAdV-A, HAdV-B, HAdV-C, HAdV-D, HAdV-E, and
HAdV-F), fowl adenovirus A, bovine adenovirus D, frog adenovirus,
Reovirus, human orbivirus, human coltivirus, mammalian
orthoreovirus, bluetongue virus, rotavirus A, rotaviruses (groups B
to G), Colorado tick fever virus, aquareovirus A, cypovirus 1, Fiji
disease virus, rice dwarf virus, rice ragged stunt virus,
idnoreovirus 1, mycoreovirus 1, Birnavirus, bursal disease virus,
pancreatic necrosis virus, Calicivirus, swine vesicular exanthema
virus, rabbit hemorrhagic disease virus, Norwalk virus, Sapporo
virus, Picornavirus, human polioviruses (1-3), human
coxsackieviruses A1-22, 24 (CA1-22 and CA24, CA23 (echovirus 9)),
human coxsackieviruses (B1-6 (CB1-6)), human echoviruses
1-7,9,11-27, 29-33, vilyuish virus, simian enteroviruses 1-18
(SEV1-18), porcine enteroviruses 1-11 (PEV1-11), bovine
enteroviruses 1-2 (BEV1-2), hepatitis A virus, rhinoviruses,
hepatoviruses, cardioviruses, aphthoviruses and echoviruses.
[0571] In certain embodiments, the virus is a herpes virus, e.g.,
HSV-I, HSV-2, and CMV. In another embodiment, the virus is HCMV. In
another embodiment, the virus is a liver trophic virus. In another
embodiment, the virus is an influenza virus. In some embodiments,
the virus is HIV. In certain embodiments, the virus is a hepatitis
B virus. In a specific embodiment, the virus is EBV. In some
embodiments, the virus is Kaposi's sarcoma-associated herpes virus
(KSHV). In certain embodiments the virus is a variola virus. In one
embodiment, the virus is a Dengue virus. In other embodiments, the
virus is a SARS virus. In one embodiment, the virus is an Ebola
virus. In some embodiments the virus is a Marburg virus. In certain
embodiments, the virus is a measles virus. In particular
embodiments, the virus is a vaccinia virus. In some embodiments,
the virus is varicella-zoster virus (VZV). In some embodiments, the
virus is a picornavirus. In certain embodiments the virus is a
rhinovirus. In certain embodiments the virus is not a rhinovirus.
In some embodiments, the virus is an adenovirus. In particular
embodiments, the virus is a coxsackievirus (e.g., coxsackievirus
B3). In some embodiments, the virus is a rhinovirus. In certain
embodiments, the virus is a human papillomavirus (HPV).
[0572] In certain embodiments, the virus is a DNA virus. In other
embodiments, the virus is an RNA virus. In one embodiment, the
virus is a DNA or a RNA virus with a single-stranded genome. In
another embodiment, the virus is a DNA or a RNA virus with a
double-stranded genome.
[0573] In some embodiments, the virus has a linear genome. In other
embodiments, the virus has a circular genome. In some embodiments,
the virus has a segmented genome. In other embodiments, the virus
has a non-segmented genome.
[0574] In some embodiments, the virus is a positive-stranded RNA
virus.
[0575] In other embodiments, the virus is a negative-stranded RNA
virus. In one embodiment, the virus is a segmented,
negative-stranded RNA virus. In another embodiment, the virus is a
non-segmented negative-stranded RNA virus.
[0576] In some embodiments, the virus is an icosahedral virus. In
other embodiments, the virus is a helical virus. In yet other
embodiments, the virus is a complex virus.
[0577] In some embodiments, the virus is a hepatitis C virus.
[0578] In certain embodiments, the virus is selected from: a herpes
virus such as HSV-1, HSV-2, VZV, EBV, CMV (HCMV, MCMV, GPCMV),
HMCV, CVB3, HHV-6 and HHV-8; an influenza virus such as influenza
type A and influenza type B; respiratory viruses such as RSV, PIV
(types 1, 2 and 3), measles virus, rhinovirus, adenovirus, HMPV and
SARS virus; orthopoxviruses such as vaccinia virus, cowpox virus,
ectromelia virus, monkeypox virus and rabbitpox virus; a hepatitis
virus such as HBV and HCV; a papova virus such as papillomavirus
(e.g., cotton tail rabbit papillomavirus and human papillomavirus)
and BK virus; or other viruses such as VEE virus, Rift Valley fever
virus, Tacaribe virus, Yellow fever virus, West Nile virus, dengue
virus, PTV and Pichinde virus.
[0579] In one embodiment, the virus is HSV-1. In another
embodiment, the virus is HSV-2. In another embodiment, the virus is
VZV. In another embodiment, the virus is EBV. In another
embodiment, the virus is HCMV. In another embodiment, the virus is
MCMV. In another embodiment, the virus is GPCMV. In another
embodiment, the virus is HHV-6. In another embodiment, the virus is
HHV-8.
[0580] In one embodiment, the virus is influenza type A virus. In
another embodiment, the virus is influenza type B virus.
[0581] In one embodiment, the virus is RSV. In another embodiment,
the virus is PIV-3.
[0582] In another embodiment, the virus is measles virus. In
another embodiment, the virus is rhinovirus. In another embodiment,
the virus is adenovirus. In another embodiment, the virus is HMPV.
In another embodiment, the virus is SARS virus.
[0583] In one embodiment, the virus is vaccinia virus. In another
embodiment, the virus is cowpox virus. In another embodiment, the
virus is ectromelia virus. In another embodiment, the virus is
monkeypox virus. In another embodiment, the virus is rabbitpox
virus.
[0584] In one embodiment, the virus is HBV. In another embodiment,
the virus is HCV.
[0585] In one embodiment, the virus is cotton tail rabbit
papillomavirus. In another embodiment, the virus is human
papillomavirus. In another embodiment, the virus is BK virus.
[0586] In one embodiment, the virus is VEE virus. In another
embodiment, the virus is Rift Valley fever virus. In another
embodiment, the virus is Tacaribe virus. In another embodiment, the
virus is Yellow fever virus. In another embodiment, the virus is
West Nile virus. In another embodiment, the virus is dengue virus.
In another embodiment, the virus is PTV. In another embodiment, the
virus is Pichinde virus.
[0587] In certain embodiments, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
an infection caused by one type of virus. In other embodiments, at
least one compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
two or more types of viruses at the same time. In other
embodiments, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by three or more types of viruses at
the same time. In other embodiments, at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof provided
herein can treat one or more infections caused by four or more
types of viruses at the same time. In other embodiments, at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
five or more types of viruses at the same time. In other
embodiments, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by six, seven, eight, nine, ten,
fifteen, twenty or more types of viruses at the same time.
[0588] In certain embodiments, the microbial infections can
encompass the disease related to infection by prions, e.g.,
scrapie, madcow disease, and any modified forms thereof. In certain
embodiments, the microbial infections encompass those prion
diseases that affect humans.
[0589] It is envisioned that a compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein will also
be useful in the treatment of other microbial infections, such as
bacterial infections, fungal infections, and parasitic
infections.
[0590] In certain embodiments, the microbial infection is a
bacterial infection. Examples of bacterial infections include, but
are not limited to, infections by mycobacteria (e.g., Mycobacteria
tuberculosis, M. bovis, M. avium, M. leprae, and M. africanum),
rickettsia, mycoplasma, chlamydia, and legionella. Other examples
of bacterial infections include, but are not limited to, infections
caused by Gram positive bacillus (e.g., Listeria, Bacillus such as
Bacillus anthracis, Erysipelothrix species), Gram negative bacillus
(e.g., Bartonella, Brucella, Campylobacter, Enterobacter,
Escherichia, Francisella, Hemophilus, Klebsiella, Morganella,
Proteus, Providencia, Pseudomonas, Salmonella, Serratia, Shigella,
Vibrio and Yersinia species), spirochete bacteria (e.g., Borrelia
species including Borrelia burgdorferi that causes Lyme disease),
anaerobic bacteria (e.g., Actinomyces and Clostridium species),
Gram positive and negative coccal bacteria, Enterococcus species,
Streptococcus species, Pneumococcus species, Staphylococcus
species, and Neisseria species.
[0591] Specific examples of infectious bacteria include, but are
not limited to: Helicobacter pyloris, Borelia burgdorferi,
Legionella pneumophilia, Mycobacteria tuberculosis, M. avium, M.
intracellulare, M. kansaii, M gordonae, Staphylococcus aureus,
Neisseria gonorrhoeae, Neisseria meningitidis, Listeria
monocytogenes, Streptococcus pyogenes (Group A Streptococcus),
Streptococcus agalactiae (Group B Streptococcus), Streptococcus
viridans, Streptococcus faecalis, Streptococcus bovis,
Streptococcus pneumoniae, Haemophilus influenzae, Bacillus
antracis, corynebacterium diphtheriae, Erysipelothrix
rhusiopathiae, Clostridium perfringens, Clostridium tetani,
Enterobacter aerogenes, Klebsiella pneumoniae, Pasturella
multocida, Fusobacterium nucleatum, Streptobacillus moniliformis,
Treponema pallidium, Treponema pertenue, Leptospira, Rickettsia,
and Actinomyces israelli.
[0592] In one embodiment, the bacterial infection is an infection
caused by Mycobacteria tuberculosis.
[0593] In certain embodiments, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
an infection caused by one type of bacteria. In other embodiments,
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof, or a pharmaceutical composition comprising
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof provided herein can treat one or more
infections caused by two or more types of bacteria at the same
time. In other embodiments, at least one compound of formula (I) or
a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by three or more types of bacteria at
the same time. In other embodiments, at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof provided
herein can treat one or more infections caused by four or more
types of bacteria at the same time. In other embodiments, at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
five or more types of bacteria at the same time. In other
embodiments, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by six, seven, eight, nine, ten,
fifteen, twenty or more types of bacteria at the same time.
[0594] In certain embodiments, provided herein are methods of
treating, preventing and/or managing diseases, disorders, or
conditions caused by fungal infection. Examples include, but are
not limited to, aspergilliosis, crytococcosis, sporotrichosis,
coccidioidomycosis, paracoccidioidomycosis, histoplasmosis,
blastomycosis, zygomycosis, and candidiasis.
[0595] In certain embodiments, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
an infection caused by one type of fungi. In other embodiments, at
least one compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
two or more types of fungi at the same time. In other embodiments,
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof, or a pharmaceutical composition comprising
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof provided herein can treat one or more
infections caused by three or more types of fungi at the same time.
In other embodiments, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by four or more types of fungi at the
same time. In other embodiments, at least one compound of formula
(I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof provided
herein can treat one or more infections caused by five or more
types of fungi at the same time. In other embodiments, at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
six, seven, eight, nine, ten, fifteen, twenty or more types of
fungi at the same time.
[0596] In certain embodiments, provided herein are methods of
treating, preventing and/or managing diseases, disorders, or
conditions caused by parasitic or protozoal infection. Examples of
parasitic or protozoal diseases and disorders include, but are not
limited to, diseases, disorders and conditions caused by parasites
such as, but not limited to, P. falcifarium, P. ovale, P. vivax, P.
malariae, L. donovari, L. infantum, L. aethiopica, L. major, L.
tropica, L. mexicana, L. braziliensis, T. Gondii, B. microti, B.
divergens, B. coli, B. hominis, C. parvum, C. cayetanensis, D.
fragilis, E. histolytica, I. belli, S. mansonii, S. haematobium,
Trypanosoma ssp., Toxoplasma ssp., and O. volvulus. Other diseases,
disorders and conditions include, but are not limited to, those
caused by Babesia bovis, Babesia canis, Banesia Gibsoni, Besnoitia
darlingi, Cytauxzoon felis, Eimeria ssp., Hammondia ssp., T. canis,
Cestoda (i.e., tapeworms) and Theileria ssp. Specific diseases,
disorders and conditions include, but are not limited to, malaria,
babesiosis, trypanosomiasis, American trypanosomiasis (i.e., Chagas
disease), leishmaniasis, toxoplasmosis, meningoencephalitis,
keratitis, amebiasis, giardiasis, cryptosporidiosis, isosporiasis,
cyclosporiasis, microsporidiosis, ascariasis, trichuriasis,
ancylostomiasis, strongyloidiasis, toxocariasis, trichinosis,
lymphatic filariasis, onchocerciasis, filariasis, schistosomiasis,
and dermatitis caused by animal schistosomes.
[0597] In one embodiment, the parasitic or protozoal disease is
malaria. In another embodiment, the parasitic or protozoal disease
is leishmaniasis. In another embodiment, the parasitic or protozoal
disease is babesiosis. In another embodiment, the parasitic or
protozoal disease is toxoplasmosis. In another embodiment, the
parasitic or protozoal disease is trypanosomiasis.
[0598] In certain embodiments, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
an infection caused by one type of parasite. In other embodiments,
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof, or a pharmaceutical composition comprising
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof provided herein can treat one or more
infections caused by two or more types of parasite at the same
time. In other embodiments, at least one compound of formula (I) or
a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by three or more types of parasite at
the same time. In other embodiments, at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof provided
herein can treat one or more infections caused by four or more
types of parasite at the same time. In other embodiments, at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof provided herein can treat one or more infections caused by
five or more types of parasite at the same time. In other
embodiments, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can treat
one or more infections caused by six, seven, eight, nine, ten,
fifteen, twenty or more types of parasite at the same time.
[0599] In some embodiments, compounds provided herein can treat
infection by any combination of viruses, bacteria, fungi and
parasites at the same time. For example, in certain embodiments,
compounds provided herein can treat the infection by one or more
viruses and one or more fungi. In other embodiments, compounds
provided herein can treat the infection by one or more viruses and
one or more bacteria. In other embodiments, compounds provided
herein can treat the infection by one or more fungi and one or more
bacteria. In other embodiments, compounds provided herein can treat
the infection by one or more viruses and one or more parasites. In
other embodiments, compounds provided herein can treat the
infection by one or more fungi and one or more parasites. In other
embodiments, compounds provided herein can treat the infection by
one or more bacteria and one or more prasites. In other
embodiments, compounds provided herein can treat the infection by
one or more viruses, one or more fungi and one or more bacteria. In
other embodiments, compounds provided herein can treat the
infection by one or more bacteria, one or more fungi and one or
more parasites. In other embodiments, compounds provided herein can
treat the infection by one or more viruses, one or more fungi and
one or more parasites. In other embodiments, compounds provided
herein can treat the infection by one or more viruses, one or more
bacteria and one or more parasites.
[0600] Compounds provided herein are inhibitors of FASN. Thus, in
certain embodiments, the compounds provided herein can be used to
treat and/or manage other FASN-related disorders, examples of which
include, but are not limited to, diabetes and general wellness of
liver such as treatment, prevention and/or management of fatty
liver.
[0601] In certain embodiments, the compound is an inhibitor of
palmitate synthesis. As used herein "inhibition", "inhibiting",
"inhibit" and "inhibitor", and the like, refer to the ability of a
compound to reduce, halt or prevent activity of a particular
biological process (e.g., FASN activity, palmitate synthesis) in a
cell relative to vehicle.
[0602] In other embodiments, provided herein are methods for
inhibiting ELOVL in a subject comprising administering to a subject
in need thereof a therapeutically effective amount of at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof.
[0603] In another embodiment, provided herein is use of at least
one compound of formula (I) for the treatment of a ELOVL-mediated
disorder in a subject.
[0604] In another embodiment, provided herein is use of at least
one compound of formula (I) in the manufacture of a medicament. In
certain embodiments, the medicament is useful for treating a
ELOVL-mediated disorder.
[0605] "ELOVL-mediated disorder" as used herein, refers to a
disease, disorder or condition which is treatable by inhibition of
ELOVL activity. Typically, ELOVL-mediated disorders are
substantially similar to those mediated by FASN. Thus,
ELOVL-mediated disorders include the FASN-mediated disorders
described herein above. Examples include, but are not limited to,
hyperproliferative disorders, inflammatory disorders,
obesity-related disorders and complications thereof, diabetes and
general wellness of liver such as treatment, prevention and/or
management of fatty liver.
[0606] In one embodiment, the ELOVL-mediated disorder is a
hyperproliferative disorder. In another embodiment, the
ELOVL-mediated disorder is an inflammatory disorder. In another
embodiment, the ELOVL-mediated disorder is obesity. In another
embodiment, the ELOVL-mediated disorder is diabetes mellitus. In
another embodiment, the ELOVL-mediated disorder is fatty liver.
[0607] In one embodiment, the ELOVL-mediated disorder is
ELOVL6-mediated disorder.
5. Administration
[0608] The compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof can be administered using any amount and any route of
administration effective for treatment. The compounds provided
herein are typically formulated in dosage unit form for ease of
administration and uniformity of dosage. It will be understood,
however, that the total daily usage of the compounds provided
herein will be decided by the attending physician within the scope
of sound medical judgment. The specific therapeutically effective
dose level for any particular subject will depend upon a variety of
factors including the disease, disorder, or condition being treated
and its severity; the activity of the specific compound employed;
the specific composition employed; the species, age, body weight,
general health, sex and diet of the subject; the time of
administration, route of administration, and rate of excretion of
the specific compound employed; the duration of the treatment;
drugs used in combination or coincidental with the specific
compound employed; and like factors well known in the medical
arts.
[0609] A therapeutically effective amount of at least one compound
of formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof disclosed
herein can be measured by the therapeutic effectiveness of the
compound. Compounds of formula (I) can be administered in a dose of
about 1 .mu.g/kg to about 200 mg/kg daily; such as from about 1
.mu.g/kg to about 150 mg/kg, from about 1 mg/kg to about 200 mg/kg,
from about 1 .mu.g/kg to about 100 mg/kg, from about 1 .mu.g/kg to
about 1 mg/kg, from about 50 .mu.g/kg to about 200 mg/kg, from
about 10 .mu.g/kg to about 1 mg/kg, from about 10 .mu.g/kg to about
100 .mu.g/kg, from about 100 .mu.g to about 10 mg/kg, and from
about 500 .mu.g/kg to about 50 mg/kg.
[0610] In certain embodiments, a therapeutically effective amount
of at least one compound of formula (I) or a pharmaceutically
acceptable form thereof, or a pharmaceutical composition comprising
at least one compound of formula (I) or a pharmaceutically
acceptable form thereof for administration one or more times a day
to a 70 kg adult human can comprise about 0.0001 mg to about 1000
mg of an compound per unit dosage form. It will be appreciated that
dose ranges as described herein provide guidance for the
administration of pharmaceutical compositions to an adult. The
amount to be administered to, for example, a child or an adolescent
can be determined by a medical practitioner or person skilled in
the art and can be lower or the same as that administered to an
adult.
[0611] The desired dosage can be delivered three times a day, two
times a day, once a day, every other day, every third day, every
week, every two weeks, every three weeks, or every four weeks. In
certain embodiments, the desired dosage can be delivered using
multiple administrations (e.g., two, three, four, five, six, seven,
eight, nine, ten, eleven, twelve, thirteen, fourteen, or more
administrations).
[0612] In one embodiment, the therapeutically effective amount of a
disclosed compound of formula (I) or a pharmaceutically acceptable
form thereof, or a pharmaceutical composition comprising at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof is sufficient to establish a maximal plasma concentration
ranging from about 0.001 .mu.M to about 100 .mu.M, e.g., from about
1 .mu.M to about 20 .mu.M. Preliminary doses as, for example,
determined according to animal tests, and the scaling of dosages
for human administration is performed according to art-accepted
practices.
[0613] The therapeutically effective dose can be estimated
initially from cell culture assays. A dose can be formulated in
animal models to achieve a circulating plasma concentration range
that includes the IC.sub.50 (i.e., the concentration of the
therapeutic which achieves a half-maximal inhibition of symptoms)
as determined in cell culture assays or animal models. Levels in
plasma can be measured, for example, by high performance liquid
chromatography. The effects of any particular dosage can be
monitored by a suitable bioassay. Examples of dosages are: about
0.1.times.IC.sub.50, about 0.5.times.IC.sub.50, about
1.times.IC.sub.50, about 5.times.IC.sub.50, 10.times.IC.sub.50,
about 50.times.IC.sub.50, and about 100.times.IC.sub.50.
[0614] Therapeutically effective dosages achieved in one animal
model can be converted for use in another animal, including humans,
using conversion factors known in the art (see, e.g., Freireich et
al., Cancer Chemother. Reports 50(4):219-244 (1966) and Table A for
Equivalent Surface Area Dosage Factors).
TABLE-US-00002 TABLE A To: Mouse Rat Monkey Dog Human From: (20 g)
(150 g) (3.5 kg) (8 kg) (60 kg) Mouse 1 1/2 1/4 1/6 1/12 Rat 2 1
1/2 1/4 1/7 Monkey 4 2 1 3/5 1/3 Dog 6 4 3/5 1 1/2 Human 12 7 3 2
1
[0615] In some embodiments, the compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof is administered via a
variety of routes, including oral, intravenous, intramuscular,
intra-arterial, intramedullary, intrathecal, subcutaneous,
intraventricular, transdermal, interdermal, rectal, intravaginal,
intraperitoneal, topical (as by powders, ointments, creams, and/or
drops), mucosal, nasal, bucal, enteral, sublingual; by
intratracheal instillation, bronchial instillation, and/or
inhalation; and/or as an oral spray, nasal spray, and/or aerosol.
Specifically contemplated routes are systemic intravenous
injection, regional administration via blood and/or lymph supply,
and/or direct administration to an affected site. In general the
most appropriate route of administration will depend upon a variety
of factors including the nature of the agent (e.g., its stability
in the environment of the gastrointestinal tract), the condition of
the subject (e.g., whether the subject is able to tolerate oral
administration), etc. At present the oral and/or nasal spray and/or
aerosol route is most commonly used to deliver therapeutic agents
directly to the lungs and/or respiratory system. However, the
delivery of the pharmaceutical composition by any appropriate
route, taking into consideration likely advances in the sciences of
drug delivery, is also encompassed herein.
[0616] It will be also appreciated that at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, as
described above and herein, can be administered in combination with
one or more additional therapeutically active agents.
[0617] By "in combination with," it is not intended to imply that
the agents must be administered at the same time and/or formulated
for delivery together, although these methods of delivery are
certainly within the scope of this disclosure. The compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof can be
administered concurrently with, prior to, or subsequent to, one or
more other additional therapeutically active agents. In general,
each agent will be administered at a dose and/or on a time schedule
determined for that agent. In will further be appreciated that the
additional therapeutically active agent utilized in this
combination can be administered together in a single composition or
administered separately in different compositions. The particular
combination to employ in a regimen will take into account
compatibility of the compound of formula (I) with the additional
therapeutically active agent and/or the desired therapeutic effect
to be achieved.
[0618] In some embodiments, additional therapeutically active
agents utilized in combination with at least one compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof will be
administered at levels that do not exceed the levels at which they
are utilized individually. In some embodiments, the levels utilized
in combination will be lower than those utilized individually.
[0619] By a "therapeutically active agent", "therapeutic agent",
"agent" or "active agent" refers to any substance that is useful
for therapy, including prophylactic and therapeutic treatment.
[0620] Also encompassed herein is the delivery of the
pharmaceutical compositions in combination with agents that can
improve their bioavailability, reduce and/or modify their
metabolism, inhibit their excretion, and/or modify their
distribution within the body. It will also be appreciated that the
therapy employed can achieve a desired effect for the same disorder
(for example, at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof can be administered in
combination with an anti-inflammatory, anti-anxiety and/or
anti-depressive agent, etc.), and/or they can achieve different
effects (e.g., control of any adverse side-effects).
[0621] Exemplary therapeutically active agents include, but are not
limited to, anti-cancer agents, antibiotics, anti-obesity drugs,
anti-viral agents, anesthetics, anti-coagulants, inhibitors of an
enzyme, steroidal agents, anti-inflammatory agents, antihistamine,
immunosuppressant agents, anti-neoplastic agents, antigens,
vaccines, antibodies, decongestants, sedatives, opioids,
pain-relieving agents, analgesics, anti-pyretics, enhancing agents,
hormones, prostaglandins, progestational agents, anti-glaucoma
agents, ophthalmic agents, anti-cholinergics, anti-depressants,
anti-psychotics, hypnotics, tranquilizers, anti-convulsants, muscle
relaxants, anti-spasmodics, muscle contractants, channel blockers,
miotic agents, anti-secretory agents, anti-thrombotic agents,
anticoagulants, anti-cholinergics, .beta.-adrenergic blocking
agents, diuretics, cardiovascular active agents, vasoactive agents,
vasodilating agents, anti-hypertensive agents, angiogenic agents,
modulators of cell-extracellular matrix interactions (e.g. cell
growth inhibitors and anti-adhesion molecules), or
inhibitors/intercalators of DNA, RNA, protein-protein interactions,
protein-receptor interactions, etc. Active agents include small
organic molecules such as drug compounds (e.g., compounds approved
by the Food and Drugs Administration as provided in the Code of
Federal Regulations (CFR)), antibodies, peptides, proteins,
carbohydrates, monosaccharides, oligosaccharides, polysaccharides,
nucleoproteins, mucoproteins, lipoproteins, synthetic polypeptides
or proteins, small molecules linked to proteins, glycoproteins,
steroids, nucleic acids, DNAs, RNAs, nucleotides, nucleosides,
oligonucleotides, antisense oligonucleotides, lipids, hormones,
antibodies, vitamins and cells, and combinations thereof.
[0622] In certain embodiments, the therapeutically active agent is
an anti-cancer agent. Exemplary anti-cancer agents, include, but
are not limited to, radiation therapy, interferon (e.g., interferon
.alpha., interferon .gamma.), antibodies (e.g., HERCEPTIN
(trastuzumab), T-DM1, AVASTIN (bevacizumab), ERBITUX (cetuximab),
VECTIBIX (panitumumab), RITUXAN (rituximab) BEXXAR (tositumomab)),
anti-estrogens (e.g., tamoxifen, raloxifene, and megestrol), LHRH
agonists (e.g., goscrclin and leuprolide), anti-androgens (e.g.,
flutamide and bicalutamide), photodynamic therapies (e.g.,
vertoporfin (BPD-MA), phthalocyanine, photosensitizer Pc4, and
demethoxy-hypocrellin A (2BA-2-DMHA)), nitrogen mustards (e.g.,
cyclophosphamide, ifosfamide, trofosfamide, chlorambucil,
estramustine, and melphalan), nitrosoureas (e.g., carmustine (BCNU)
and lomustine (CCNU)), alkylsulphonates (e.g., busulfan and
treosulfan), triazenes (e.g., dacarbazine, temozolomide), platinum
containing compounds (e.g., cisplatin, carboplatin, oxaliplatin),
vinca alkaloids (e.g., vincristine, vinblastine, vindesine, and
vinorelbine), taxoids (e.g., paclitaxel, albumin-bound paclitaxel
(ABRAXANE), nab-paclitaxel, docetaxel, taxol), epipodophyllins
(e.g., etoposide, etoposide phosphate, teniposide, topotecan,
9-aminocamptothecin, camptoirinotecan, irinotecan, crisnatol,
mytomycin C), anti-metabolites, DHFR inhibitors (e.g.,
methotrexate, dichloromethotrexate, trimetrexate, edatrexate), IMP
dehydrogenase Inhibitors (e.g., mycophenolic acid, tiazofurin,
ribavirin, and EICAR), ribonucleotide reductase inhibitors (e.g.,
hydroxyurea and deferoxamine), uracil analogs (e.g., 5-fluorouracil
(5-FU), floxuridine, doxifluridine, ratitrexed, tegafur-uracil,
capecitabine), cytosine analogs (e.g., cytarabine (ara C), cytosine
arabinoside, and fludarabine), purine analogs (e.g., mercaptopurine
and Thioguanine), Vitamin D3 analogs (e.g., EB 1089, CB 1093, and
KH 1060), isoprenylation inhibitors (e.g., lovastatin),
dopaminergic neurotoxins (e.g., 1-methyl-4-phenylpyridinium ion),
cell cycle inhibitors (e.g., staurosporine), actinomycin (e.g.,
actinomycin D, dactinomycin), bleomycin (e.g., bleomycin A2,
bleomycin B2, peplomycin), anthracycline (e.g., daunorubicin,
doxorubicin, pegylated liposomal doxorubicin, idarubicin,
epirubicin, pirarubicin, zorubicin, mitoxantrone), MDR inhibitors
(e.g., verapamil), Ca2+ ATPase inhibitors (e.g., thapsigargin),
imatinib, thalidomide, lenalidomide, tyrosine kinase inhibitors
tyrosine kinase inhibitors (e.g., axitinib (AG013736), bosutinib
(SKI-606), cediranib (RECENTIN.TM., AZD2171), dasatinib
(SPRYCEL.RTM., BMS-354825), erlotinib (TARCEVA.RTM.), gefitinib
(IRESSA.RTM.), imatinib (Gleevec.RTM., CGP57148B, STI-571),
lapatinib (TYKERB.RTM., TYVERB.RTM.), lestaurtinib (CEP-701),
neratinib (HKI-272), nilotinib (TASIGNA.RTM.), semaxanib
(semaxinib, SU5416), sunitinib (SUTENT.RTM., SU11248), toceranib
(PALLADIA.RTM.), vandetanib (ZACTIMA.RTM., ZD6474), vatalanib
(PTK787, PTK/ZK), trastuzumab (HERCEPTIN.RTM.), bevacizumab
(AVASTIN.RTM.), rituximab (RITUXAN.RTM.), cetuximab (ERBITUX.RTM.),
panitumumab (VECTIBIX.RTM.), ranibizumab (Lucentis.RTM.), nilotinib
(TASIGNA.RTM.), sorafenib (NEXAVAR.RTM.), everolimus
(AFINITOR.RTM.), alemtuzumab (CAMPATH.RTM.), gemtuzumab ozogamicin
(MYLOTARG.RTM.), temsirolimus (TORISEL.RTM.), ENMD-2076, PCI-32765,
AC220, dovitinib lactate (TKI258, CHIR-258), BIBW 2992 (TOVOK.TM.),
SGX523, PF-04217903, PF-02341066, PF-299804, BMS-777607, ABT-869,
MP470, BIBF 1120 (VARGATEF.RTM.), AP24534, JNJ-26483327, MGCD265,
DCC-2036, BMS-690154, CEP-11981, tivozanib (AV-951), OSI-930,
MM-121, XL-184, XL-647, and/or XL228), proteasome inhibitors (e.g.,
bortezomib (VELCADE)), mTOR inhibitors (e.g., rapamycin,
temsirolimus (CCI-779), everolimus (RAD-001), ridaforolimus,
AP23573 (Ariad), AZD8055 (AstraZeneca), BEZ235 (Novartis), BGT226
(Norvartis), XL765 (Sanofi Aventis), PF-4691502 (Pfizer), GDC0980
(Genetech), SF1126 (Semafoe) and OSI-027 (OSI)), oblimersen,
gemcitabine, caminomycin, leucovorin, pemetrexed, cyclophosphamide,
dacarbazine, procarbizine, prednisolone, dexamethasone,
campathecin, plicamycin, asparaginase, aminopterin, methopterin,
porfiromycin, melphalan, leurosidine, leurosine, chlorambucil,
trabectedin, procarbazine, discodermolide, caminomycin,
aminopterin, and hexamethyl melamine.
[0623] Exemplary combinations of therapeutically active agents
useful for the treatment of cancer (a.k.a. an "anti-cancer
treatment regimen") which can be used in combination with at least
one compound of formula (I) or a pharmaceutically acceptable form
thereof, or a pharmaceutical composition comprising at least one
compound of formula (I) or a pharmaceutically acceptable form
thereof includes, but is not limited to: [0624] ABVD Adriamycin
(doxorubicin), bleomycin, vinblastine, dacarbazine [0625] AC
Adriamycin (doxorubicin), cyclophosphamide [0626] BEACOPP
Bleomycin, etoposide, Adriamycin (doxorubicin), cyclophosphamide,
Oncovin (vincristine), procarbazine, prednisone [0627] BEP
Bleomycin, etoposide, platinum agent (cisplatin) [0628] CA
Cyclophosphamide, Adriamycin (doxorubicin) (same as AC) [0629] CAF
Cyclophosphamide, Adriamycin (doxorubicin), fluorouracil (5-FU)
[0630] CAV Cyclophosphamide, Adriamycin (doxorubicin), vincristine
[0631] CBV Cyclophosphamide, BCNU (carmustine), VP-16 (etoposide)
[0632] ChlVPP/EVA Chlorambucil, vincristine (Oncovin),
procarbazine, prednisone, etoposide, vinblastine, Adriamycin
(doxorubicin) [0633] CHOP Cyclophosphamide, hydroxydoxorubicin
(doxorubicin), vincristine (Oncovin), prednisone [0634] CHOP-R or
R-CHOP CHOP+rituximab [0635] COP or CVP Cyclophosphamide, Oncovin
(vincristine), prednisone [0636] CMF Cyclophosphamide,
methotrexate, fluorouracil (5-FU) [0637] COPP Cyclophosphamide,
Oncovin (vincristine), procarbazine, prednisone [0638] EC
Epirubicin, cyclophosphamide [0639] ECF Epirubicin, cisplatin,
fluorouracil (5-FU) [0640] EP Etoposide, platinum agent (cisplatin)
[0641] EPOCH Etoposide, prednisone, Oncovin, cyclophosphamide, and
hydroxydaunorubicin [0642] FEC Fluorouracil (5-FU), epirubicin,
cyclophosphamide [0643] FL (Also known as Mayo) Fluorouracil
(5-FU), leucovorin (folinic acid) [0644] FOLFOX Fluorouracil
(5-FU), leucovorin (folinic acid), oxaliplatin [0645] FOLFIRI
Fluorouracil (5-FU), leucovorin (folinic acid), irinotecan [0646]
ICE Ifosfamide, carboplatin, etoposide (VP-16) [0647] ICE-R
ICE+rituximab [0648] m-BACOD Methotrexate, bleomycin, Adriamycin
(doxorubicin), cyclophosphamide, Oncovin (vincristine),
dexamethasone [0649] MACOP-B Methotrexate, leucovorin (folinic
acid), Adriamycin (doxorubicin), cyclophosphamide, Oncovin
(vincristine), prednisone, bleomycin [0650] MOPP Mechlorethamine,
Oncovin (vincristine), procarbazine, prednisone [0651] PCV
Procarbazine, CCNU (lomustine), vincristine [0652] ProMACE-MOPP
Methotrexate, Adriamycin (doxorubicin), cyclophosphamide,
etoposide+MOPP Prednisone, doxorubicin (adriamycin),
cyclophosphamide, [0653] ProMACE-CytaBOM etoposide, cytarabine,
bleomycin, Oncovin (vincristine), methotrexate, leucovorin [0654]
R-FCM Rituximab, fludarabine, cyclophosphamide, mitoxantrone [0655]
Stanford V Doxorubicin, mechlorethamine, bleomycin, vinblastine,
vincristine, etoposide, prednisone [0656] Thal/Dex Thalidomide,
dexamethasone [0657] TIP Paclitaxel, ifosfamide, platinum agent
cisplatin [0658] VAC Vincristine, Actinomycin, Cyclophosphamide
[0659] VAD Vincristine, Adriamycin (doxorubicin), dexamethasone
[0660] VAPEC-B Vincristine, Adriamycin (doxorubicin), prednisone,
etoposide, cyclophosphamide, bleomycin [0661] VIP Etoposide,
ifosfamide, platinum agent cisplatin
[0662] In other embodiments, the therapeutically effective agent is
an anti-vial agent. Exemplary anti-viral agents include, but are
not limited to, Abacavir, Aciclovir, Acyclovir, Adefovir,
Amantadine, Amprenavir, Ampligen, Arbidol, Atazanavir, Atripla,
BI201335, Boceprevir, BMS-858 (see, e.g., Gao et al., Nature,
465(6): 96-102 (2010)), BMS-790052 ((see, e.g., Gao et al., Nature,
465(6): 96-102 (2010)), Cidofovir, Combivir, Danoprivir (ITMN-191;
RG-7227), Darunavir, Delavirdine, Didanosine, Docosanol, Edoxudine,
EI-1 to EI-12 (see, e.g., Baldick et al., PLoS Pathogens,
6(9)e1001086: 1-14 (2010)), Elvitegravir, Efavirenz, Emtricitabine,
Enfuvirtide, Entecavir, Etravirine, Famciclovir, Fosamprenavir,
Foscarnet, Fosfonet, Ganciclovir, GSK-572, Ibacitabine, Immunovir,
Idoxuridine, Imiquimod, Indinavir, Inosine, Interferon (e.g.,
Interferon type III, Interferon type II, Interferon type I,
Peginterferon alfa-2a, Peginterferon alpha-2b, standard interferon
alfa-2a, standard interferon alfa-2b, consensus interferon,
interferon alfacon-1, ALBUFERON, omega interferon, interferon
gamma-1b, lymphoblastoid interferon tau), Lamivudine, Lopinavir,
Loviride, Maraviroc, Moroxydine, Methisazon, MK-2048, Nelfinavir,
Nevirapine, Nexavir, Oseltamivir (Tamiflu), Penciclovir, Peramivir,
Pleconaril, Podophyllotoxin, Raltegravir, Ribavirin, Rimantadine,
Ritonavir, Pyramidine, Saquinavir, Stavudine, Tenofovir (e.g.,
Tenofovir disoproxil), Telaprivir, Tipranavir, Trifluridine,
Trizivir, Tromantadine, Truvada, Valaciclovir (Valtrex),
Valganciclovir, vaccines (e.g., VZV vaccines such as Varivax and
Zostavax), Vicriviroc, Vidarabine, Viramidine, Zalcitabine,
Zanamivir (Relenza), Zidovudine, and other small moelcule
anti-viral agents described, for example, in Herker et al., Nature
Medicine, Advance Online Publication doi:10.1038/nm2238: 1-4 (Oct.
10, 2010), and combinations thereof.
[0663] Examples of additional anti-viral agents include, but are
not limited to, interleukin 2, interleukin 6, inteleukin 12, a
compound that enhances the development of a type 1 helper T cell
response, interfering RNA, anti-sense RNA, Imiqimod, an inosine
5'-phosphate dehydrogenase inhibitor, amantadine and
rimantadine.
[0664] Other examples include, but are not limited to, those
described in WO 2009/023059, the entirety of which is incorporated
herein by reference.
[0665] In one embodiment, the anti-viral agent is interferon. In
another embodiment, the anti-viral agent is telaprivir. In one
embodiment, combinations of two or more anti-viral agents are used
in further combination with a compound provided herein.
[0666] In certain embodiments, the anti-viral agent is a protease
inhibitor. Exemplary protease inhibitors include, but are not
limited to, Saquinavir, Ritonavir, Indinavir, Nelfinavir,
Amprenavir, Lopinavir, Atazanavir, Fosamprenavir, Tipranavir and
Darunavir.
[0667] In certain embodiments, the anti-viral agent is an integrase
inhibitor. Exemplary integrase inhibitors include, but are not
limited to, Raltegravir, Elvitegravir and MK-2048, GSK-572.
[0668] In certain embodiments, the anti-viral agent is a reverse
transcriptase inhibitor (e.g., a nucleoside analog reverse
trascriptase inhibitor (NRTI), a nucleotide analog reverse
trascriptase inhibitor (NtRTI), a non-nucleoside reverse
transcripase inhibitor (NNRTI)).
[0669] Exemplary nucleoside analog reverse trascriptase inhibitors
(NRTIs) include, but are not limited to, Zidovudine, Didanosine,
Zalcitabine, Stavudine, Lamivudine, Abacavir, Emtricitabine,
Entecavir and Aciclovir (partial nucleoside structure).
[0670] Exemplary nucleotide analog reverse trascriptase inhibitors
(NtRTIs) include, but are not limited to, Tenofovir and
Adefovir.
[0671] Exemplary non-nucleoside reverse transcripase inhibitors
(NNRTIs) include, but are not limited to, Efavirenz, Nevirapine,
Delavirdine and Etravirine. In certain embodiments, the compound of
formula (I) or a pharmaceutically acceptable form thereof, or a
pharmaceutical composition comprising at least one compound of
formula (I) or a pharmaceutically acceptable form thereof provided
herein and/or the anti-viral agent is further used in combination
with an enhancing agent. An "enhancing agent", used in this
context, is an agent which, when used in combination with a
compound provided herein and/or an anti-viral agent, improves
treatment, prevention or management of the microbial infection
relative to treatment with the compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein and/or an
anti-viral agent without the enhancing agent. Exemplary enhancing
agents include, but are not limited to, chloroquine, a quinoline
antimalarial, grapefruit juice, hydroxyurea, leflunomide,
myucophenolic acid, resveratrol and Ritonavir.
[0672] In one embodiment, the anti-viral agent is an anti-viral
agent described in U.S. Pub. No. 2011/0064698, which is
incorporated herein by reference in its entirety. Exemplary
anti-viral agents include, but are not limited to, IP-501,
Merimebodib VX-497, IDN-6556, XTL-002, HCV/MF59, CIVACIR, ZADAXIN,
CEPLENE, VX 950/LY 570310, ISIS 14803, JTK 003, Tarvacin, HCV-796,
CH-6, ANA971, ANA245, CPG 10101, Rituximab, NM 283, HepX.TM.-C,
IC41, Medusa interferon, E-1, multiferon, BILN 2061, TMC435350,
Telaprevir, Boceprevir, ACH-1625, ABT-450, BI-201335, PHX-1766,
VX-500, MK-7009, R7227, Narlaprevir, Alinia, ABT-072, ABT-333,
Filibuvir, VCH-916, R7128, IDX 184, R7128, R1626, MK-3281,
PSI-7851, ANA 598, BI-207127, GS9190, VCH-759, Clemizole, A-832,
BMS-790052, ITX 5061, GS-9450, ANA773, CYT 107, SPC3649, Debio 25,
SCY-635 and a combination thereof.
[0673] Other examples include, but are not limited to, AZD-7295,
BI207127, BIT225, BM824383, BMS65032, BMS791325, GS-9256, IDX 375,
INX-189, PPI-461, PSI-938, PSI-7977, TMC435, TMC649128, VX-222,
VX-759, VX-916 and a combination thereof. These agents are
currently in various stages of clinical trials and information is
readily available to those in the art.
[0674] In one embodiment, provided herein is a method of treating,
preventing and/or managing hepatitis C virus (HCV) infection
comprising administering a therapeutically or prophylactically
effective amount of at least one compound of formula (I) or a
pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein in
combination with one or more other therapeutic agents provided
herein.
[0675] Examples of such therapeutic agents include compounds having
anti-HCV activity, for example, by inhibiting the function of a
target such as, but not limited to, HCV metalloprotease, HCV serine
protease, HCV polymerase, HCV helicase, SCV NS4B protein, HCV
entry, HCV assembly, HCV egress, HCV NS5A protein and IMPDH.
[0676] In other embodiments, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can be
used in combination with at least one additional therapeutic agent
having anti-HCV activity, including, but not limited to, Alinia
(Nitazoxanide), Bavituximab, Belerofon, Chronvac-C, Civacir,
Clemizole, Fluvastatin, Glycoferon, Hepavaxx C, HuMax-HepC, Lenocta
(sodium stibogluconate SSG), Locteron, peginterferon, Ribavirin,
Suvus, Telaprevir (VX-950), Zadaxin-thymalfasin, ZALBIN (Albuferon
albinterferon alfa-2b), A-837093, ABT-072, ABT-333, ABT-450,
ACH-1095, ACH-1625, ACH-2684, ACH-2928, AN 025-1, ANA598, ANA773,
ATI-0810 (formerly PG301029), AVL-181, AVL-192, AZD7295, BI 201335,
BI 207127, BIT225, BMS-650032, BMS-790052, BMS-791325, BMS-824393,
CB5300, CB-183872 (formerly IB657), CF102, CSL123, CTS-1027,
CYT107, Debio 025, ECH18, EDP-239, GEA007.1, GI 5005, GNI-103,
GNI-104, GS 9190, GS 9256, GSK625433, IC41, ID-12, IDX184, IDX320,
IDX375, IMO-2125, IMMU 105, ITMN-191 R7227 (RO5190591), ITX2155,
ITX4520, ITX5061NS5A inhibitors, JKB-122, KPE02001003, KPE00001113,
MBL-HCV1, MDX-1106 (ONO-4538), Mito-Q, MK-0608, MX3235 Celgosivir,
NOV-205, PF-868554, PF-4878691, PHX1766, PYN17, PYN18, PPI-461,
PPI-1301, PRO-206, PSI-7977, PSI-9381NX08189, R7128 (RO5024048),
REP 9C, RG7348, SCV-07, SCY-635, SD-101, SIRNA-034, SP-30, SPC3649,
TG4040, TT033, VCH-759, VX-222, VX-500, VX-813, and VX-985.
[0677] In one embodiment, the other therapeutic agent is an
interferon. In one embodiment, the interferon is Interferon type
III, Interferon type II, Interferon type I, Peginterferon alfa-2a,
Peginterferon alpha-2b, standard interferon alfa-2a, standard
interferon alfa-2b, consensus interferon, interferon alfacon-1,
ALBUFERON, omega interferon, interferon gamma-1b, lymphoblastoid
interferon tau or a combination thereof. In another embodiment, the
interferon is interferon alfa-2a, interferon alfa-2b, peginterferon
alfa-2a, peginterferon alpha-2b, consensus interferon or
lymphoblastoid interferon tau.
[0678] In another embodiment, the other therapeutic agent is
ribavirin.
[0679] In another embodiment, at least one compound of formula (I)
or a pharmaceutically acceptable form thereof, or a pharmaceutical
composition comprising at least one compound of formula (I) or a
pharmaceutically acceptable form thereof provided herein can be
used in combination with ribavirin and an interferon. In one
embodiment, the interferon is Interferon type III, Interferon type
II, Interferon type I, Peginterferon alfa-2a, Peginterferon
alpha-2b, standard interferon alfa-2a, standard interferon alfa-2b,
consensus interferon, interferon alfacon-1, ALBUFERON, omega
interferon, interferon gamma-1b, lymphoblastoid interferon tau or a
combination thereof. In another embodiment, the interferon is
interferon alfa-2a, interferon alfa-2b, peginterferon alfa-2a,
peginterferon alpha-2b, consensus interferon or lymphoblastoid
interferon tau.
6. Anti-Viral Assays
[0680] Anti-viral assays used to screen compounds having efficacy
for a specific virus are well-known in the art and described, for
example, in WO 2009/023059, the entirety of which is incorporated
herein by reference. Exemplary anti-viral assays are provided
herein below.
6.1 Herpes Simplex Virus (HSV)
[0681] Mouse models of herpes simplex virus type 1 or type 2 (HSV-1
or HSV-2) can be employed to assess the anti-viral activity of test
compounds in vivo. BALB/c mice are commonly used, but other
suitable mouse strains that are susceptible can also be used. Mice
are inoculated by various routes with an appropriate multiplicity
of infection of HSV, followed by administration of test compounds
and placebo. For i.p. inoculation, HSV-1 replicates in the gut,
liver, and spleen and spreads to the CNS. For i.n. inoculation,
HSV-1 replicates in the nasaopharynx and spreads to the CNS. Any
appropriate route of administration (e.g., oral, topical, systemic
and nasal), frequency and dose of administration can be tested to
determine the optimal dosages and treatment regimens using test
compounds, optionally in combination with other therapies.
[0682] In a mouse model of HSV-2 genital disease, intravaginal
inoculation of female Swiss Webster mice with HSV-1 or HSV-2 is
carried out, and vaginal swabs are obtained to evaluate the effect
of therapy on viral replication. (See, e.g., Crute et al., Nature
Medicine, 2002, 8:386-391). For example, viral titers by plaque
assays are determined from the vaginal swabs. A mouse model of
HSV-1 using SKH-1 mice, a strain of immunocompetent hairless mice,
to study cutaneous lesions is also described in the art. (See,
e.g., Crute et al., Nature Medicine, 2002, 8:386-391 and Bolger et
al., Antiviral Res., 1997, 35:157-165). Guinea pig models of HSV
have also been described. (See, e.g., Chen et al., Virol. J., 2004
Nov. 23, 1:11). Statistical analysis is typically carried out to
calculate significance of the anti-viral activity.
6.2 Human Cytomegalovirus (HCMV)
[0683] Since HCMV does not generally infect laboratory animals,
mouse models of infection with murine CMV (MCMV) can be used to
assay anti-viral activity of test compounds in vivo. For example, a
MCMV mouse model with BALB/c mice can be used to assay the
anti-viral activities of test compounds in vivo when administered
to infected mice, which is described, for example, in Kern et al.,
Antimicrob. Agents Chemother., 2004, 48:4745-4753. Tissue
homogenates isolated from infected mice treated or untreated with
test compounds are tested using standard plaque assays with mouse
embryonic fibroblasts (MEFs). Statistical analysis is then
typically carried out to calculate significance of the anti-viral
activity.
[0684] Alternatively, human tissue (i.e., retinal tissue or fetal
thymus and liver tissue) is implanted into SCID mice, and the mice
are subsequently infected with HCMV, preferably at the site of the
tissue graft. (See, e.g., Kern et al., Antimicrob. Agents
Chemother., 2004, 48:4745-4753). The pfu of HCMV used for
inoculation can vary depending on the experiment and virus strain.
Any appropriate routes of administration (e.g., oral, topical,
systemic and nasal), frequency and dose of administration can be
tested to determine the optimal dosages and treatment regimens
using test compounds, optionally in combination with other
therapies. Implant tissue homogenates isolated from infected mice
treated or untreated with test compounds at various time points are
tested using standard plaque assays with human foreskin fibroblasts
(HFFs). Statistical analysis is then typically carried out to
calculate significance of the anti-viral activity.
[0685] Guinea pig models of CMV to study anti-viral agents have
also been described, for example, in Bourne et al., Antiviral Res.,
2000, 47:103-109; Bravo et al., Antiviral Res., 2003, 60:41-49; and
Bravo et al, J. Infectious Diseases, 2006, 193:591-597.
6.3 Influenza Virus
[0686] Animal models, such as ferret, mouse and chicken, developed
for use to test anti-viral agents against influenza virus have been
described, for example, in Sidwell et al., Antiviral Res., 2000,
48: 1-16 and McCauley et al., Antiviral Res., 1995, 27: 179-186.
For mouse models of influenza, non-limiting examples of parameters
that can be used to assay anti-viral activity of test compounds
administered to the influenza-infected mice include
pneumonia-associated death, serum al-acid glycoprotein increase,
animal weight, lung virus assayed by hemagglutinin, lung virus
assayed by plaque assays, and histopathological change in the lung.
Statistical analysis is typically carried out to calculate
significance of the anti-viral activity.
[0687] Nasal turbinates and trachea can be examined for epithelial
changes and subepithelial inflammation. The lungs can be examined
for bronchiolar epithelial changes and peribronchiolar inflammation
in large, medium, and small or terminal bronchioles. The alveoli
are also evaluated for inflammatory changes. The medium bronchioles
are graded on a scale of 0 to 3+ as follows: 0 (normal: lined by
medium to tall columnar epithelial cells with ciliated apical
borders and basal pseudostratified nuclei; minimal inflammation);
1+ (epithelial layer columnar and even in outline with only
slightly increased proliferation; cilia still visible on many
cells); 2+ (prominent changes in the epithelial layer ranging from
attenuation to marked proliferation; cells disorganized and layer
outline irregular at the luminal border); and 3+ (epithelial layer
markedly disrupted and disorganized with necrotic cells visible in
the lumen; some bronchioles attenuated and others in marked
reactive proliferation).
[0688] The trachea is graded on a scale of 0 to 2.5+ as follows: 0
(normal: Lined by medium to tall columnar epithelial cells with
ciliated apical border, nuclei basal and pseudostratified.
Cytoplasm evident between apical border and nucleus. Occasional
small focus with squamous cells); 1+ (focal squamous metaplasia of
the epithelial layer); 2+ (diffuse squamous metaplasia of much of
the epithelial layer, cilia can be evident focally); and 2.5+
(diffuse squamous metaplasia with very few cilia evident).
[0689] Virus immunohistochemistry is performed using a
viral-specific monoclonal antibody (e.g., NP-, N- or HN-sepcific
monoclonal antibodies). Staining is graded 0 to 3+ as follows: 0
(no infected cells); 0.5+ (few infected cells); 1+ (few infected
cells, as widely separated individual cells); 1.5+ (few infected
cells, as widely separated singles and in small clusters); 2+
(moderate numbers of infected cells, usually affecting clusters of
adjacent cells in portions of the epithelial layer lining
bronchioles, or in small sublobular foci in alveoli); and 3+
(numerous infected cells, affecting most of the epithelial layer in
bronchioles, or widespread in large sublobular foci in
alveoli).
6.4 Hepatitis Type B Virus (HBV)
[0690] A HBV transgenic mouse model, lineage 1.3.46 (official
designation, Tg[HBV 1.3 genome] Chi46) has been described
previously and can be used to test the in vivo anti-viral
activities of test compounds as well as the dosing and
administration regimen. (See, e.g., Cavanaugh et al., J. Virol.,
1997, 71:3236-3243; and Guidotti et al., J. Virol., 1995,
69:6158-6169). In these HBV transgenic mice, a high level of viral
replication occurs in liver parenchymal cells and in the proximal
convoluted tubules in the kidneys of these transgenic mice at
levels comparable to those observed in the infected liver of
patients with chronic HBV hepatitis. HBV transgenic mice that have
been matched for age (i.e., 6-10 weeks), sex (i.e., male), and
levels of hepatitis B surface antigen (HBsAg) in serum can be
treated with test compounds or placebo followed by anti-viral
activity analysis to assess the activity of test compounds.
Non-limiting examples of assays that can be performed on these mice
treated and untreated with test compounds include southern analysis
to measure HBV DNA in the liver, quantitative reverse transcriptase
PCR (qRT-PCR) to measure HBV RNA in the liver, immunoassays to
measure hepatitis e antigen (HBeAg) and HBV surface antigen (HBsAg)
in the serum, immunohistochemistry to measure HBV antigens in the
liver, and quantitative PCR (qPCR) to measure serum HBV DNA. Gross
and microscopic pathological examinations can be performed as
needed.
6.5 Human Immunodeficiency Virus (HIV)
[0691] The safety and efficacy of test compounds against HIV can be
assessed in vivo with established animal models well-known in the
art. For example, a Trimera mouse model of HIV-1 infection has been
developed by reconstituting irradiated normal BALB/c mice with
murine SCID bone marrow and engrafted human peripheral blood
mononuclear cells. (See Ayash-Rashkovsky et al., FASEB J., 2005,
19:1149-1151). These mice are injected intraperitoneally with T-
and M-tropic HIV-1 laboratory strains. After HIV infection, rapid
loss of human CD4.sup.+T cells, decrease in CD4/CD8 ratio, and
increased T cell activation can be observed. A test compound can be
administered to these mice and standard assays known in the art can
be used to determine the viral replication capacity in animals
treated or untreated with the compound. Non-limiting examples of
such assays include the COBAS AMPLICOR.TM. RT-PCR assay (Roche
Diagnostics, Branchberg, N.J.) to determine plasma viral load
(HIV-1 RNA copies/ml); active HIV-1 virus replication assay where
human lymphocytes recovered from infected Trimera mice were
cocultured with target T cells (MT-2 cells) and HIV-dependent
syncytia formation was examined; and human lymphocytes recovered
from infected Trimera mice were cocultured with cMAGI indicator
cells, where HIV-1 LTR driven trans-activation of
.beta.-galactosidase was measured. Levels of anti-HIV-1 antibodies
produced in these mice can also be measured by ELISA. Other
established mouse models described in the art can also be used to
test the anti-viral activity of test compounds in vivo. (See, e.g.,
Mosier et al., Semin. Immunol., 1996, 8:255-262; Mosier et al.,
Hosp. Pract. (Off Ed)., 1996, 31:41-48, 53-55, 59-60; Bonyhadi et
al., Mol. Med. Today, 1997, 3:246-253; Jolicoeur et al., Leukemia,
1999, 13:S78-S80; Browning et al., Proc. Natl. Acad. Sci. USA,
1997, 94:14637-14641; and Sawada et al., J. Exp. Med., 1998,
187:1439-1449). A simian immunodeficiency virus (SIV) nonhuman
primate model has also been described, for example, in Schito et
al., Curr. HIV Res., 2006, 4:379-386.
6.6 In Vitro Screening Assays
6.6.1 General Procedures for Assays for Herpes Viruses
[0692] To quickly screen out samples that do not have activity
against any of the herpes viruses, or are too toxic to evaluate, an
inexpensive, rapid assay such as a CPE-inhibition assay that is
semi-automated is commonly used initially to screen out the
negatives. Typically, all screening assays are conducted in low
passage human cells, and each assay system contains a positive
control (ACV, GCV, CDV) and a negative control (AZT). Efficacy is
demonstrated by at least two different assay systems that detect
functional biologic activity and should be confirmed using low
passaged clinical isolates and drug resistant mutants whenever
available. In the case of EBV, efficacy against EBV is confirmed
using a hybridization assay that quantifies DNA synthesis. Toxicity
is determined using both resting and proliferating human fibroblast
cells and proliferating lymphoblastic cells, and for selected
compounds, toxicity in human myeloid and erythroid progenitor cells
is assessed.
6.6.1.1 HSV-1, HSV-2, CMV and VZV
[0693] All the screening assay systems utilized are selected to
show specific inhibition of a biologic function, i.e., cytopathic
effect (CPE) in susceptible human cells. In the CPE-inhibition
assay, a test compound is added 1 hour prior to infection so the
assay system will have maximum sensitivity and detect inhibitors of
early replicative steps, such as adsorption or penetration, as well
as later events. To rule out non-specific inhibition of virus
binding to cells, all compounds that show reasonable activity in
the CPE assay are confirmed using a classical plaque reduction
assay in which the compound is added 1 hour after infection. In the
case where a compound blocks attachment, a positive result will
appear in the CPE assay, but can be negative by plaque assay. In
this case, the plaque assay is repeated with compound being added
prior to viral infection. These assay systems also can be
manipulated by increasing the pretreatment time in order to
demonstrate anti-viral activity with oligodeoxynucleotides and/or
peptides and by delaying addition of drug after infection.
Information regarding which step in the virus life cycle is
inhibited (i.e., early vs. late functions) can be gained.
[0694] In all the assays used for primary screening, a minimum of
six compound concentrations is contemplated to cover a range of,
e.g., 100 .mu.g/ml to 0.03 .mu.g/ml, in 5-fold increments to
determine efficacy. Dose response curves are obtained from these
data. The dose that inhibits viral replication by 50% (effective
concentration 50; EC.sub.50) is typically calculated using a
computer software program, for example, MacSynergy II by M. N.
Prichard, K. R. Asaltine, and C. Shipman, Jr., University of
Michigan, Ann Arbor, Mich.
[0695] The same compound concentrations used to determine efficacy
are also used on uninfected cells in each assay to determine
toxicity of each experimental compound. The compound concentration
that is cytotoxic to cells as determined by their failure to take
up a vital stain, neutral red (cytotoxic concentration 50;
CC.sub.50), is determined as described above.
[0696] In some embodiments, compounds to treat herpes virus
infections are for systemic diseases, such as neonatal herpes, CMV,
and disseminated VZV, and can need to be given parenterally.
Therefore, the toxicity of test compounds on dividing cells is
determined at a very early stage of testing. In this regard, a cell
proliferation assay using HFF cells can be a very sensitive assay
for detecting compound toxicity to dividing cells, and the compound
concentration that inhibits cell growth by 50% (IC.sub.50) can be
calculated as described above. In comparison with four human
diploid cell lines and vero cells, HFF cells are the most sensitive
and predictive of toxicity for bone marrow cells.
[0697] To determine if each compound has sufficient anti-viral
activity that exceeds its level of toxicity, a selectivity index
(SI) is calculated according to CC.sub.50/EC.sub.50. This index,
also referred to as a therapeutic index, is used to determine if a
compound warrants further study. Typically, a compound that had an
SI of 10 or greater is evaluated in additional assay systems.
[0698] For HSV-1 and HSV-2, compounds that show activity in the
CPE-inhibition assay are confirmed using the plaque reduction
assay. Susceptibility of additional virus strains, including both
lab passaged and clinical isolates, is determined for selected
compounds. A battery of ACV resistant HSV strains can be also
utilized. For CMV, compounds that show activity in the
CPE-inhibition assay are confirmed using the plaque reduction assay
in HFF cells. A variety of laboratory, clinical, and GCV resistant
isolates are also available for testing. For VZV, compounds with
activity in a CPE assay are evaluated further in a plaque reduction
assay.
6.6.1.2 Epstein-Barr Virus (EBV)
[0699] The initial system to be used to determine anti-viral
activity against EBV can be VCA production in Daudi cells using an
ELISA assay. Six concentrations of drug covering a range of, e.g.,
50 .mu.g/ml to 0.03 .mu.g/ml are utilized. Using the results
obtained from untreated and drug treated cells, an EC.sub.50 can be
calculated. Selected compounds that have good activity against EBV
VCA production without toxicity are tested for their ability to
inhibit EBV DNA synthesis.
[0700] In each assay system utilized, drug treatment of uninfected
cells is incorporated to obtain as much toxicity data as possible.
In some embodiments, for calculation of the SI, the data on
toxicity is at least as reliable as the results for efficacy. An
example of a toxicity assay is a colormetric method using MTS.
[0701] All compounds that have an SI of, for example, greater than
10 in the screening assay are confirmed in a hybridization assay
that measures the amount of EBV DNA produced by P3HR-1 infected
cells. A wide range of compound concentrations can be utilized so
an accurate EC.sub.50 can be calculated. Uninfected control cells
treated with compound are also utilized as another measure of drug
toxicity. In some cases, it is possible that results obtained using
assays for VCA production and DNA synthesis may not correlate since
the two events may be independent.
6.6.1.3 Human Herpes Virus HHV-6 and HHV-8
[0702] Cord Blood Lymphocytes (CBL) and the Human T cell
lymphoblastoid lines, HSB-2 and SupT-1, are used in screening
assays for HHV-6. CBL are isolated from fresh heparinized umbilical
cord blood and are infected with the Z29 strain of HHV-6. The body
cavity based B-cell lymphoma cell line, BCBL-1, are used for
screening against HHV-8.
[0703] There are two variants of HHV-6 known as type A variants or
type B variants. The HHV-6 type A variant is, for example, the GS
strain which is propagated in HSB-2 or SupT-1 cells. The HHV-6 type
B variant is, for example, Z29 (ATCC, Rockville, Md.) which is
grown as a stock in CBL. The HHV-8 is propagated in a latent state
in the BCBL-1 cell line. Lytic growth of the HHV-8 can be induced
by the addition of the phorbol ester, TPA.
[0704] Six concentrations of each drug ranging from, e.g., 100
.mu.g/ml to 0.03 .mu.g/ml drug are tested to obtain the EC.sub.50,
EC.sub.90, CC.sub.50, and IC.sub.50 values. The initial assay for
HHV-6 is a flow cytometric analysis of HHV-6 antigens in either
HSB-2 cells (HHV-6A), CBL (HHV-6B), or SupT-1 (6A or 6B). For
HHV-8, yytic infection of virus in BCBL-1 cells will be carried out
as described above. The initial assay for HHV-8 is a flow
cytometric analysis of HHV-8 antigens in BCBL-1 cells. As with the
other herpes virus assays, these assays contain the positive
(infected and untreated cells) and negative (uninfected or
uninduced and compound treated cells) controls needed for effective
analysis and cytotoxicity determinations.
6.6.2 In Vitro Laboratory Procedures for Assays for Herpes
Viruses
6.6.2.1 Efficacy Screening for HSV-1, HSV-2, CMV and VZV
[0705] Preparation of Human Foreskin Fibroblast Cells:
[0706] Newborn human foreskins can be obtained from the University
of Alabama School of Medicine (UAB) or Brookwood Hospital,
Birmingham, Ala., as soon as possible after circumcisions are
performed and placed in minimal essential medium (MEM) containing
vancomycin, fungizone, penicillin, and gentamicin, at the usual
concentrations, for four hours at room temperature. The medium is
then removed, the foreskin minced into small pieces and washed
repeatedly until red cells are no longer present. The tissue is
then trypsinized using trypsin at 0.25% with continuous stirring
for 15 minutes at 37.degree. C. in a CO.sub.2 incubator. At the end
of each 15 minute period, the tissue is allowed to settle to the
bottom of the flask. The supernatant containing cells is poured
through sterile cheesecloth into a flask containing MEM and 10%
fetal bovine serum (FBS). The flask containing the medium is kept
on ice throughout the trypsinizing procedure. After each decanting
of cells, the cheese cloth is washed with a small amount of MEM
containing serum. Fresh trypsin is added each time to the foreskin
pieces and the procedure repeated until no more cells become
available. The cell-containing medium is then centrifuged at 1000
RPM at 4.degree. C. for 10 minutes. The supernatant liquid is
discarded and the cells are resuspended in a small amount of MEM
with 10% FBS. The cells are counted using a Coulter Counter and
then placed in an appropriate number of 25 cm.sup.2 tissue culture
flasks. As cells become confluent and need trypsinization, they are
gradually expanded into 175 cm.sup.2 flasks. The cells are
maintained on vancomycin and fungizone to passage three. Cell lines
are tested periodically for the presence of mycoplasma
contamination using the Hoechst fluorescent stain for mycoplasma
DNA. Cells are utilized usually only until passage 10.
[0707] Cytopathic Effect Inhibition Assay:
[0708] Low passage (3-10) human foreskin fibroblast (HFF) cells are
trypsinized, counted, and seeded into 96 well tissue culture plates
at a cell concentration of 2.5.times.104 cells in 0.1 ml of MEM
supplemented with 10% FBS. The cells are then incubated for 24
hours at 37.degree. C. in a 5% CO.sub.2-95% air, 90% humidified
atmosphere. The media is then removed and 100 .mu.l of MEM
containing 2% FBS is added to all but the first row. In the first
row, 125 .mu.l of media containing the experimental compound is
added in triplicate wells. Media alone is added to both cell and
virus control wells. The compound in the first row of wells is then
diluted serially 1:5 throughout the remaining wells by transferring
25 .mu.l using a Beckman Bio-Mek Liquid Handling Machine. The
plates are then incubated for 60 minutes and 100 .mu.A of an
appropriate virus concentration added to each well, excluding cell
control wells which received 100 .mu.A of MEM. For HSV-1 and HSV-2
assays, the virus concentration utilized is 1000 Plaque Forming
Units (PFU) per well. For CMV and VZV assays, the virus
concentration added is 2500 and 1000 PFU per well, respectively.
The plates are then incubated at 37.degree. C. in a CO.sub.2
incubator for three days for HSV-1 and HSV-2, 10 days for VZV, or
14 days for CMV. After the incubation period, the media is
aspirated and the cells are stained with a 0.1% crystal violet in
formalin solution for 4 hours. The stain is then removed and the
plates rinsed using tap water until all excess stain is removed.
The plates are allowed to dry for 24 hours and the amount of CPE in
each row determined using a BioTek Multiplate Autoreader. EC.sub.50
and IC.sub.50 values are determined by comparing compound treated
and untreated cells using a computer program.
[0709] Plaque Production Assay for HSV-1 and HSV-2:
[0710] Two days prior to use, HFF cells are trypsinized, counted,
and plated into six well plates and incubated at 37.degree. C. with
5% CO.sub.2 and 90% humidity. On the date of assay, the compound is
made up at twice the desired concentration in 2.times.MEM and then
serially diluted 1:5 in 2.times.MEM to give six concentrations of
compound. The compound concentrations utilized are usually 200
.mu.g/ml down to 0.06 .mu.g/ml. The virus to be used is diluted in
MEM containing 10% FBS to a desired concentration which will give
20-30 plaques per well. The media is then aspirated from the wells
and 0.2 ml of virus is added to each well in triplicate with 0.2 ml
of media being added to drug toxicity wells. The plates are then
incubated for 1 hour with shaking every 15 minutes. After the
incubation period, an equal amount of 1% agarose is added to an
equal volume of each compound dilution. This provides final
compound concentrations beginning with 100 .mu.g/ml and ending with
0.03 .mu.g/ml and a final agarose overlay concentration of 0.5%.
The compound agarose mixture is applied to each well in a 2 ml
volume and the plates are incubated for three days, after which the
cells are stained with a 1.5% solution of neutral red. At the end
of the 4-6 hours incubation period, the stain is aspirated, and
plaques counted using a stereomicroscope at 10.times.
magnification.
[0711] Plaque Production Assay for CMV:
[0712] The procedures are nearly identical to those provided for
HSV with a few minor changes. The agarose used for both the initial
overlay and the two subsequent overlays is 0.8% rather than 1%. The
assay is incubated for 14 days with the additional 1 ml overlays
being applied on days 4 and 8.
[0713] Plaque Production Assay for VZV:
[0714] The procedures are essentially identical to those described
for the HSV plaque assay with the following possible exceptions:
after addition of the compound, the plates are incubated for ten
days; on days 3 and 6, an additional 1 ml overlay with equal
amounts of 2.times.MEM and 1% agarose are added.
[0715] Plaque Reduction Assay:
[0716] In certain cases, some large or highly charged molecules
that are active in the CPE inhibition assay can be inactive in the
plaque assay because the compound failed to diffuse through the
agarose overlay. Therefore, a modified plaque assay can be used for
confirmation, wherein the overlay medium is liquid rather than
semi-solid. The procedure for the liquid overlay plaque assay is
similar to that using the agarose overlay. The procedure for adding
the virus is the same as for the regular plaque assay. The
compounds are made up at the desired concentrations in MEM with 2%
FBS. For HSV-1 and HSV-2 assays, an antibody preparation obtained
from, e.g., Baxter Health Care Corporation is diluted 1:500 and
added to the media that the compound is diluted in to limit
extracellular spread of virus through the media. For VZV and CMV,
no antibody in the overlay is necessary. For the CMV and VZV
assays, additional medium without the new compound is added on day
five and allowed to incubate for a total of 8 and 10 days,
respectively. At the end of the incubation period for all of the
assays, 2 ml of a 6.0% neutral red solution is added to each well
and incubated for 6 hours. The liquid is then aspirated off and
plaques enumerated using a stereomicroscope.
6.6.2.2 Efficacy Screening for EBV
[0717] Cells:
[0718] The two lymphoid cell lines, Raji and Daudi derived from
Burkitt's lymphoma, are used. The Raji cell line is a non-producer
of viral gene products associated with the productive viral cycle.
The Daudi cell line is a low level producer, i.e., fewer than 1% of
the cells express EA spontaneously. These cells are equally
susceptible to superinfection by the P3HR-1 virus as determined by
EBV VCA expression. The cells are maintained at 37.degree. C. in a
humidified atmosphere with 5% CO.sub.2, in culture with RPMI-1640
medium containing 10% heat inactivated FBS, 100 u/ml Penicillin, 25
.mu.g/ml gentamicin and 2 mM L-glutamine. The cells are passaged
twice weekly and the cell concentration adjusted to
2.times.10.sup.6/ml for use.
[0719] Virus:
[0720] The following prototypes of infectious EBV can be used: (1)
one derived from supernatant fluids of the P3HR-1 cell line, which
produces non-transforming virus that induces the production of VCA
after primary infection or superinfection of B cell lines; and (2)
B95-8 virus, which immortalizes cord blood lymphocytes and induces
tumors in marmosets, but does not induce an abortive productive
infection even in cell lines harboring EBV genome copies. As an
example, for virus production, P3HR-1 cells are cultured at a
concentration of 2.times.10.sup.5/ml for two weeks in medium
containing 2% FCS at 34.degree. C. in a humidified atmosphere with
5% CO.sub.2. Concentrated virus then is prepared from the
supernatant of the culture by centrifugation at 12,000 g for 90
minutes in a Sorvall Centrifuge. The pellets are resuspended in
RPMI-1640 medium at 1/100 of the original volume and stored at
-70.degree. C.
[0721] Antibodies:
[0722] Murine monoclonal antibody to EBV VCA (Chemicon
International, Inc., Temecula, Calif.), is used in
immunofluorescence assays and ELISA. Optimal monoclonal antibody
concentration is determined by antibody titration for each assay
system. For single fluorochrome analyses FITC-labelled goat
anti-mouse total IgG (Southern Biotechnology Associates,
Birmingham, Ala.) is used as the second antibody.
[0723] EBV Superinfection and Compound Treatment:
[0724] Superinfection is initiated by the incubation of 0.5 ml of
an appropriate concentration of EBV with 106 cells/tube in a total
of 1 ml/tube. In most cases, this amounts to a multiplicity of
infection (MOI) of 0.1-0.2 based on VCA induction in Daudi cells.
After adsorption at 37.degree. C. for 1 hour, 3 ml of RPMI-1640
medium is added. The cells are pelleted by centrifugation and
supernatants discarded. Compound concentrations (0.08, 0.4, 2, 10,
50 .mu.g/ml) in 4 ml of RPMI-1640 are added to the appropriate
tubes. RPMI-1640 is added to positive and negative control tubes
and each compound concentration is added to Daudi cells without
virus for toxicity controls. After incubation, the cells in each
tube are counted using a Coulter Counter and washed three times
with phosphate buffered saline solution (PBS) (without Ca and Mg).
Each cell suspension is adjusted to a concentration of
4.0.times.10.sup.6 cells/ml in PBS. For EBV IFA and DNA
hybridization assays, two sets of slides are prepared with
4.times.10.sup.4 cells/spot for each cell suspension, and air-dried
overnight.
[0725] Immunifluorescence Assay:
[0726] The infected and compound treated cells are counted and
washed three times with PBS. Cells, 4.times.10.sup.4 in PBS, are
spotted on multiwell slides and air dried. The cells are then fixed
for 10 minutes in acetone, washed in PBS and stained for
immunofluorescence with the mouse monoclonal antibodies and
FITC-labeled goat anti-mouse IgG. EBV VCA specific antibodies are
used in the immunofluorescence assays. FITC-labeled goat anti-mouse
IgG (Southern Biotechnology Associates, Birmingham, Ala.) is used
as the second antibody. The slides are counterstained with 0.1%
Evan's blue for 5 minutes and mounted with 10% glycerin in PBS. The
number of FITC-positive cells on each smear is determined using a
Nikon fluorescence microscope. Five hundred cells are counted in
each spot. The number of cells expressing EBV VCA is calculated by
multiplying the fraction of antigen positive cells by the number of
cells/ml in the culture at the time of harvest. The compound
concentration is plotted against the number of antigen positive
cells/ml using a computer program, and EC.sub.50 and EC.sub.90
values are calculated.
[0727] ELISA:
[0728] Daudi cells infected with P3HR-1 virus and treated with drug
are harvested by centrifugation and washed three times with PBS.
The cells are pelleted and suspended to a concentration of
4.times.10.sup.6 cells/ml in PBS. One hundred .mu.l of each
suspension is dispensed in triplicate into a 96-well plate,
air-dried and fixed with 95% ethanol and 5% acetic acid. Uninfected
cells are prepared in the same manner and used as controls. After
washing the plate, primary and secondary antibodies diluted in 1%
bovine serum albumin containing 0.05% Tween-20 are added
sequentially to each well and incubated at room temperature.
Antibody additions are separated by 3 washes with PBS containing
0.005% Tween-20. O-phenyldiamine (OPD) substrate is added and the
reaction stopped with 3NH.sub.2SO.sub.4 after about 10 minutes. The
optical density is measured at 492 nm and the EC.sub.50
extrapolated using the computer software program described
herein.
[0729] Evaluation of Anti-Viral Agents Against EBV DNA
Replication:
[0730] The Enzo Simply Sensitive Horseradish Peroxidase-AEC In Situ
Detection System for EBV (Enzo Diagnostics, Farmingdale, N.Y.) is
used to determine anti-viral activity against DNA synthesis.
Detection and staining are performed according to the
manufacturer's instructions. Three days after superinfection and
compound treatment, slides are prepared with 4.times.10.sup.4
cells/spot for each cell suspension, and air-dried overnight. The
slides are fixed in acetone for 10 minutes. A biotin labelled EBV
probe is added to each spot of fixed cells and the slide is covered
with a glass coverslip. The slide is then heated on a hot plate at
95.degree. C. for 5 minutes. After heating, the slide is placed at
37.degree. C. on a slide warmer for 30-60 minutes for the DNAs to
anneal. The coverslips are then removed and the Post Hybridization
Reagent is added to each spot. After incubation for 10 minutes and
rinsing with washing buffer, Detection Reagent is applied. The
Detection Reagent is left on the slide for 30-60 minutes on a slide
warmer and then washed off with washing buffer. Chromogen Substrate
Solution is added and incubated for 20 minutes on a slide warmer.
The slides are washed and counter stained with Blue Counterstain.
The slides are then rinsed with deionized water and mounted with
water. The slides are viewed in a light microscope under a
magnification of 400.times.. Positive cells appear as red spots.
All the cells are counted in several fields. The fraction of red
spots in the total number of cells counted multiplied by 100
reflects the percent hybridization.
[0731] Primary Infection Assay:
[0732] The primary infection of umbilical cord blood lymphocytes
with the transforming strain B95-8 of EBV induces the expression of
the virus-associated nuclear antigen (EBNA) in the cell. It is also
known that B95-8 virus induces cellular DNA synthesis after
infection of CBL. The availability of EBNA virus-infected cells in
culture allows for the identification and quantitation of
EBV-positive cell antigens by indirect IFA staining and FACS. Cord
blood lymphocytes separated by ficoll-hypaque gradient are cultured
in complete RPMI-1640. The EBV-B95-8 is produced by incubating the
B95-8 cell line in RPMI-1640 plus 10% fetal calf serum for 10-14
days. The supernatant is collected and stored at 0-4.degree. C. One
million CBL are infected by incubation with 1 ml of the B95-8
supernant for 1 hour. The virus is removed by centrifugation. After
one wash with RPMI-1640, the infected cells are treated with
anti-viral compounds as described earlier for P3HR-1
superinfection. The cell cultures are incubated for 4-6 days. Cell
harvesting and immunofluorescent staining is the same as described
above.
6.6.2.3 Efficacy Screening for HHV-6 and HHV-8
[0733] Cord Blood Lymphocytes (CBL) Cells:
[0734] Fresh heparinized umbilical cord blood can be obtained,
e.g., from the University of Alabama at Birmingham Hospital, and
diluted 1:1 with Hank's balanced salt solution and layered on a
Histopaque 1077 (Sigma Chemical Co., St. Louis, Mo.) gradient. The
tubes are centrifuged at 1600 rpm for 30 minutes at room
temperature and serum is carefully aspirated off The lymphocytes
are removed, washed with Hank's balanced salt solution and
centrifuged at 1200 rpm for 10 minutes. The supernatant is
aspirated, and the cells are resuspended in RPMI 1640 containing
10% heat-inactivated FBS, 2 mM L-glutamine, 100 U/ml penicillin,
0.25 .mu.g/ml fungizone, 25 .mu.g/ml gentamicin, 0.1 U/ml
Interleukin-2 (Sigma, St. Louis, Mo.) and 0.5 .mu.g/ml Phaseolus
Vulagaris agglutinin protein (PHAP). CBLs are used in the HHV-6,
Z-29 (Variant B) assays.
[0735] Human T Cell Lymphoblastoid Line HSB-2:
[0736] The HSB-2 cells can be obtained through, e.g., the NIH AIDS
Research and Reference Reagent Program (Rockville, Md.), and are
propagated in RPMI 1640 containing 10% heat-inactivated FBS, 100
U/ml penicillin, 25 .mu.g/ml gentamicin and 2 mM L-glutamine. The
cells are split 1:5 in a 175 cm.sup.2 flask every 3-4 days and used
in the HHV-6, GS (Variant A) assays.
[0737] Body Cavity-Based Lymphoma (BCBL-1) Cells:
[0738] BCBL-1 cells (NIH AIDS Research and Reference Program,
Rockville, Md.) propagated in RPMI 1640 media containing 10% FBS, 2
mM L-Glutamine, 10 .mu.M .beta.-Mercaptoethanol 100 .mu./l
penicillin, and 25 .mu.g/ml gentamicin are utilized in the HHV-8
assay.
[0739] Viruses:
[0740] There are two variants of HHV-6 known as type A variants or
type B variants. An example of HHV-6 type A variant is the GS
strain which is propagated in the HSB-2 cells and can be obtained
through, e.g., the AIDS Research and Reference Reagent Program,
Division of AIDS, NIAID, NIH. These cells, referred to as
HSB-2/HHV-6GS, are maintained at 5.times.10.sup.5 cells/ml under
the same conditions and in the same media as the uninfected HSB-2
cells. The cells are split every 3-4 days by addition of uninfected
cells at 9 parts to 1 part infected cells. Stock titers of this
virus of 1.times.10.sup.5 both in cell-associated and cell-free
virus can be obtained by growth for 5 days. An example of HHV-6
type B variant is Z29 (ATCC, Rockville, Md.) which is grown as a
stock in CBL by incubation for 10 days followed by collection,
centrifugation and freezing of the supernatant. HHV-8, latently
expressed in the primary effusion lymphoma derived BCBL-1 cell line
(NIH AIDS Research and Reference Program, Rockville, Md.) is
induced into lytic HHV-8 expression by addition of 100 ng/ml
phorbol 12-myristate 13-acetate. BCBL-1 cells are cultured in RPMI
1640 media containing 10% FBS, 2 mM L-glutamine, 10 .mu.M
(3-mercaptoethanol 100 U/ml penicillin and 25 .mu.g/ml
gentamicin.
[0741] Primary Antibodies:
[0742] The primary antibodies used for the indirect IFA and FACS
are selected for their antigen specificity, low cross-reactivity
with other herpes viruses and fluorescence intensity as monitored
by FACS. Monoclonal antibodies selected for use in the HHV-6 assay
systems are screened for variant specificity and demonstrated no A
or B variant cross-reactivity in the assay systems. Monoclonal
antibody 8532 (Chemicon, Temecula, Calif.) targets HHV-6 induced
early nuclear proteins and is used as a primary antibody in the
HHV-6GS assay systems at a 5 .mu.g/ml concentration. Monoclonal
antibody 8535 (Chemicon, Temecula, Calif.) which targets a B
variant 101 kDa virion protein is used as a primary antibody in the
HHV-6Z-29 assay system at a 5 .mu.g/ml concentration. The HHV-8
monoclonal antibody KS8.1 (Bala Chandran, University of Kansas
Department of Microbiology, Molecular Genetics and Immunology)
targets the HHV-8 viral envelope associated glycoprotein 8.1
expressed in the late lytic phase of HHV-8 replication (Zoeteweij
et al., 1999) and is used at approximately 5 .mu.g/ml. Monoclonal
antibody to the EBV VCA glycoprotein 125 (Chemicon, Temecula,
Calif.) is used at a concentration of 2.5 .mu.g/ml for ELISA and 5
.mu.g/ml for IFA.
[0743] Efficacy Against HHV-6:
[0744] Serial 5-fold dilutions of drug starting at 50 .mu.g/ml are
prepared in media. CDV is used as a positive control. Samples for
determining anti-viral efficacy are prepared by incubating
1.times.10.sup.6 cells for one hour with sufficient virus to infect
approximately 35% of the cells. After infection, the appropriate
dilution of compound is added and cells incubated for 4 to 6 days
at 37.degree. C. Virus free controls are prepared by incubating
1.times.10.sup.6 cells in compound-free media for the designated
period and virus controls are prepared by incubating
1.times.10.sup.6 cells for one hour with sufficient virus to infect
35% of the cells followed by incubation in compound-free media for
the designated period. After incubation, the cells are rinsed with
PBS and permeabilized overnight in methanol at -80 C for use in
FACS.
[0745] FACS Assay:
[0746] Cells are rinsed thoroughly with PBS and a blocking solution
containing 5% FBS, 4% Normal goat serum (NGS) and 0.5% DMSO. Cells
are then incubated with the appropriate monoclonal antibody (HHV-6
early nuclear proteins (Chemicon, Temecula, Calif.) for HHV-6, GS
variant A, a 101 kDa virion protein (Chemicon, Temecula, Calif.)
for HHV-6, Z-29 variant B, and KS8.1 for HHV-8 (Bala Chandran,
University of Kansas, Department of Microbiology, Molecular
Genetics and Immunology).
6.6.2.4 Toxicity Screening for Herpes Viruses
[0747] Neutral Red Uptake Assay--HFF Cells:
[0748] Twenty-four hours prior to assay, HFF cells are plated into
96 well plates at a concentration of 2.5.times.10.sup.4 cells per
well. After 24 hours, the media is aspirated and 125 .mu.l of each
compound concentration is added to the first row of wells and then
diluted serially 1:5 using the automated Bio-Mek Liquid Handling
System in a manner similar to that used in the CPE assay. The
plates are then incubated in a CO.sub.2 incubator at 37.degree. C.
for seven days. At this time the media/compound is aspirated and
200 .mu.l/well of 0.01% neutral red in DPBS is added. This mixture
is incubated in the CO.sub.2 incubator for 1 hour. The compound is
aspirated and the cells are washed using a Nunc Plate Washer. After
removing the DPBS wash, 200 .mu.l/well of 50% ETOH/1% glacial
acetic acid (in H.sub.2O) is added. The plates are rotated for 15
minutes and the optical densities are read at 550 nm on a plate
reader. CC.sub.50 values are calculated using a computer
program.
[0749] Cell Proleferation Assay--HFF Cells:
[0750] Twenty-four hours prior to assay, HFF cells are seeded in
6-well plates at a concentration of 2.5.times.10.sup.4 cells per
well in MEM containing 10% FBS. On the day of the assay, test
compounds are diluted serially in MEM containing 10% FBS at
increments of 1:5 covering a range from 100 .mu.g/ml to 0.03
.mu.g/ml. For compounds that have to be solubilized in DMSO,
control wells receive MEM containing 1.0% DMSO. The media from the
wells is then aspirated and 2 ml of each compound concentration is
then added to each well. The cells are then incubated in a CO.sub.2
incubator at 37.degree. C. for 72 hours. At the end of this time,
the media-compound solution is removed and the cells are washed.
One ml of 0.25% trypsin is added to each well and incubated until
the cells start to come off of the plate. The cell-media mixture is
then pipetted up and down vigorously to break up the cell
suspension, and 0.2 ml of the mixture is added to 9.8 ml of Isoton
III and counted using a Coulter Counter. Each sample is counted 3
times with 2 replicate wells per sample.
[0751] MTS Tetrazolium Cytotoxicity Assay:
[0752] Serial 5-fold dilutions of test compound starting at 50
.mu.g/ml are prepared in media and added to 1.times.10.sup.6 cells.
Controls are prepared by incubating 1.times.10.sup.6 cells in
compound-free media. After an incubation period of 3-6 days
depending on the assay system, 200 .mu.l is transferred to a 96
well plate in duplicate. 20 .mu.l of MTS is added, and the plate is
wrapped in foil and incubated at 37.degree. C. for 4 hours. MTS is
bioreduced by dehydrogenase enzymes found in metabolically active
cells into an aqueous soluble formazan. The quantity of formazan
product as measured by the amount of 490 nm absorbance is directly
proportional to the number of living cells in culture. Compound
concentration is plotted against the optical density of each sample
and CC.sub.50 values were calculated using MacSynergy II.
[0753] Cell Proliferation Assay--HSB-2 and Daudi Cells:
[0754] Serial 5-fold dilutions of compound starting at 50 .mu.g/ml
are prepared in media and added to 1.times.10.sup.6 cells. Controls
are prepared by incubating 1.times.10.sup.6 cells in compound-free
media. After an incubation period of 3-4 days depending on the
assay system, a Coulter Counter is used to determine the total
number of cells for each sample (HSB-2 and Daudi cell lines).
Compound concentration is plotted against the total concentration
of cells for each sample and IC.sub.50 values are calculated using
MacSynergy II.
[0755] Bone Marrow Assay: In vitro toxicity can be determined by
inhibition of myeloid [colony-forming units granulocyte/macrophage
(CFU-GM)] and erythroid [burst-forming unit-erythroid (BFU-E)]
colony formation in soft agar clonal assays. Using a 21-23 gauge
needle attached to a syringe, rodent bone marrow cells are
collected from the leg bone of rats or mice by flushing with
Isocoves' Modified Dulbecco's medium (IMDM). A single cell
suspension is obtained by repeated aspiration through the needle.
Nucleated cells are enumerated with a hemacytometer and adjusted to
the desired cell concentration in IMDM. Murine CFU-GM assays are
prepared with 2.5.times.10.sup.5 nucleated cells/ml, 20% FBS, 10
ng/ml rmGM-CSF, and 0.2% agarose. BFU-E cultures include 30% FBS,
1% deionized BSA, 0.1 mM 2-ME, 4 U/ml rhEpo, 10 ng/ml rmIL-3,
2.5.times.10.sup.5 nucleated cells/ml and 0.2% agarose (140).
Triplicate wells (in 6 well plates) containing 0.1 ml of compound
(10.times.) receive 1 ml of either culture mixture for each
concentration group and slowly mixed. The cultures are allowed to
gel at 4.degree. C. and then incubated for 7 (CFU-GM) or 9 (BFU-E)
days at 37.degree. C. in a humidified atmosphere of 5% CO.sub.2 in
air. Colonies are counted using an inverted microscope. CFU-GM
colonies are identified as cell clones containing at least 40
cells. BFU-E cultures are stained with dianisidine, and aggregates
of greater than 60 hemoglobin-containing cells are counted as
erythroid colonies. The median inhibitory concentration (IC.sub.50)
and the 90% inhibitory concentration (IC.sub.90) are derived from
linear regression analysis of the logarithm of compound
concentration versus CFU-GM or BFU-E survival fraction.
6.6.3 In Vitro Laboratory Procedures for Assays for Influenza,
Respiratory and Other Viruses
6.6.3.1 Screening Efficacy for RSV, PIV and Flu, Measles, Rhino,
Adeno, SARS, VEE, Yellow Fever, West Nile, Pichinde, Punta Toro and
Dengue Viruses
[0756] Rapid Screening Assay:
[0757] When relatively large numbers (10 or more) of test compounds
are available, the compounds are evaluated in a 2-concentration
test. In this procedure, two concentrations (e.g., 200 and 20
.mu.g/ml) are tested. Compounds are diluted 1:2 when virus is
added, making final concentrations 100 and 10 .mu.g/ml. The
standard CPE test uses an 18 hour monolayer (80-100% confluent) of
the appropriate cells, medium is drained and each of the
concentrations of test compound or placebo are added, followed
within 15 minutes by virus or virus diluent. Two wells are used for
each concentration of compound for both anti-viral and cytotoxicity
testing. The plate is sealed and incubated the standard time period
required to induce near-maximal viral CPE. The plate is then
stained with neutral red by the method described below, and the
percentage of uptake indicating viable cells read on a microplate
autoreader at dual wavelengths of 405 and 540 nm, with the
difference taken to eliminate background. An approximated
virus-inhibitory concentration, 50% endpoint (EC.sub.50) and
cell-inhibitory concentration, 50% endpoint (IC.sub.50) are
determined from which a general selectivity index is calculated:
SI.dbd.(IC.sub.50)/(EC.sub.50). An SI of 3 or greater typically
indicates confirmatory testing is needed.
[0758] Inhibition of Cytopathic Effect (CPE): This test, run in 96
well flat-bottomed microplates, is used for the initial anti-viral
evaluation of all new test compounds. In this CPE inhibition test,
four log.sub.10 dilutions of each test compound (e.g., 1000, 100,
10, 1 .mu.g/ml) are added to 3 cups containing the cell monolayer;
within 5 minutes, the virus is then added and the plate sealed,
incubated at 37.degree. C. and CPE read microscopically when
untreated infected controls develop a 3 to 4+ CPE (approximately 72
to 120 hours). A known positive control compound is evaluated in
parallel with test compounds in each test. The positive control
compound, for example, is: ribavirin for dengue, influenza,
measles, RSV, PIV, Pichinde, Punta Toro and VEE viruses; cidofovir
for adenovirus; pirodovir for rhinovirus; 6-azauridine for West
Nile and yellow fever viruses; and alferon (interferon alfa-n3) for
SARS virus. Follow-up testing with compounds that are found active
in initial screening tests are run in the same manner except 8
one-half log.sub.10 dilutions of each compound are used in 4 cups
containing the cell monolayer per dilution. The data are expressed
as 50% effective concentrations (EC.sub.50).
[0759] Increase in Neutral Red (NR) Dye Uptake:
[0760] This test is run to validate the CPE inhibition seen in the
initial test, and utilizes the same 96-well micro plates after the
CPE has been read. Neutral red is added to the medium; cells not
damaged by virus take up a greater amount of dye, which is read on
a computerized micro plate autoreader. For example, the method as
described by McManus, Appl. Environment. Microbiol. 1976, 31:35-38,
can be used. An EC.sub.50 is determined from this dye uptake.
[0761] Decrease in Virus Yield:
[0762] Compounds considered active by CPE inhibition and by NR dye
uptake are re-tested if additional, fresh material is available,
using both CPE inhibition and, using the same plate, the effect on
reduction of virus yield by assaying frozen and thawed eluates from
each cup for virus titer by serial dilution onto monolayers of
susceptible cells. Development of CPE in these cells is the
indication of presence of infectious virus. As in the initial
tests, a known active compound is run in parallel as a positive
control. The 90% effective concentration (EC.sub.90), which is that
test compound concentration that inhibits virus yield by 1 log 10,
is determined from these data.
6.6.3.2 Screening Toxocity for RSV, PIV and Flu, Measles, Rhino,
Adeno, SARS, VEE, Yellow Fever, West Nile, Pichinde, Punta Toro and
Dengue Viruses
[0763] Visual Observation:
[0764] In the CPE inhibition tests, two wells of uninfected cells
treated with each concentration of test compound are run in
parallel with the infected, treated wells. At the time CPE is
determined microscopically, the toxicity control cells are also
examined microscopically for any changes in cell appearance
compared to normal control cells run in the same plate. These
changes can be enlargement, granularity, cells with ragged edges, a
filmy appearance, rounding, detachment from the surface of the
well, or other changes. These changes are given a designation of T
(100% toxic), PVH (partially toxic--very heavy-80%), PH (partially
toxic--heavy-60%), P (partially toxic-40%), Ps (partially
toxic--slight-20%), or 0 (no toxicity-0%), conforming to the degree
of cytotoxicity seen. A 50% cell inhibitory (cytotoxic)
concentration (IC.sub.50) is determined by regression analysis of
these data.
[0765] Neutral Red Uptake:
[0766] In the neutral red dye uptake phase of the anti-viral test
described above, the two toxicity control wells also receive
neutral red and the degree of color intensity is determined
spectrophotometrically. A neutral red IC.sub.50 (NR IC.sub.50) is
subsequently determined.
[0767] Viable Cell Count:
[0768] Compounds considered to have significant anti-viral activity
in the initial CPE and NR tests are re-tested for their effects on
cell growth. In this test, 96-well tissue culture plates are seeded
with cells (sufficient to be approximately 20% confluent in the
well) and exposed to varying concentrations of the test drug while
the cells are dividing rapidly. The plates are then incubated in a
CO.sub.2 incubator at 37.degree. C. for 72 hours, at which time
neutral red is added and the degree of color intensity indicating
viable cell number is determined spectrophotometrically; an
IC.sub.50 is determined by regression analysis.
[0769] Data Analysis:
[0770] Each test compound's anti-viral activity is expressed as a
selectivity index (SI), which is the IC.sub.50 or IC.sub.90 divided
by the EC.sub.50. Generally, an SI of 10 or greater is indicative
of positive anti-viral activity, although other factors, such as a
low SI for the positive control, are also taken into consideration.
Compounds having SI values of 10 or greater can be evaluated
against additional strains of the original virus inhibited in order
to more fully determine the spectrum of anti-viral activity of the
compound.
6.6.4 General Procedures for Assays for Orthopoxviruses
[0771] To quickly screen out compounds that do not have activity
against any of the herpes viruses, or are too toxic to evaluate, an
assay such as a CPE-inhibition assay that is semi-automated is
commonly used initially to screen out the negative compounds.
Typically, all screening assays are conducted in low passage human
cells, and each assay system contains a positive control (CDV) and
a negative control (ACV). Efficacy is demonstrated by at least two
different assay systems that detect functional biologic activity
and should be confirmed using low passaged clinical isolates and
drug resistant mutants whenever available. In the case of Vaccinia
virus (VV) and Cowpox virus (CV), efficacy against VV and CV is
confirmed using other isolates. Toxicity is determined using both
resting and proliferating human fibroblast cells and proliferating
lymphoblastic cells, and for selected compounds, toxicity in rodent
myeloid and erythroid progenitor cells is assessed.
6.6.4.1 Screening Assays for VV and CV
[0772] Compounds are initially screened for activity using the CPE
assay in HFF cells. Further testing in two other cells lines, Vero
and MRC-5, and against other strains of virus is possible for
compounds that demonstrate activity in other assay systems. The
screening assay systems utilized are selected to show specific
inhibition of a biologic function, i.e., cytopathic effect (CPE) in
susceptible human cells. In the CPE-inhibition assay, test compound
is added 1 hour prior to infection so the assay system will have
maximum sensitivity and detect inhibitors of early replicative
steps such as adsorption or penetration as well as later events. To
rule out non-specific inhibition of virus binding to cells, all
compounds that show reasonable activity in the CPE assay are
confirmed using a classical plaque reduction assay in which the
drug is added 1 hour after infection. These assay systems also can
be manipulated by increasing the pre-treatment time in order to
demonstrate anti-viral activity with oligodeoxynucleotides and/or
peptides. By delaying the time of addition of compound after
infection, information regarding which step in the virus life cycle
is inhibited (i.e., early vs. late functions) can be gained. A
direct inactivation assay can be employed to determine the
virucidal activity of selected compounds.
[0773] Efficacy:
[0774] In the assays used for primary screening, a minimum of six
compound concentrations is typically used, covering a range of,
e.g., 100 mg/ml to 0.03 mg/ml, in 5-fold increments. These data
allow for creating dose response curves. From these data, the dose
that inhibited viral replication by 50% (effective concentration
50; EC.sub.50) is usually calculated using a computer software
program, for example, MacSynergy II by M. N. Prichard, K. R.
Asaltine, and C. Shipman, Jr., University of Michigan, Ann Arbor,
Mich.
[0775] Toxicity:
[0776] The same compound concentrations used to determine efficacy
are also used on uninfected cells in each assay to determine
toxicity of each experimental compound. The compound concentration
that is cytotoxic to cells as determined by their failure to take
up a vital stain, neutral red (cytotoxic concentration 50;
CC.sub.50), is determined as described above. A neutral red uptake
assay can be used. The assay is reproducible and allows
quantitation of toxicity based on the number of viable cells rather
than cellular metabolic activity. In some cases, the toxicity of
new compounds on dividing cells is determined at a very early stage
of testing. A cell proliferation assay using HFF cells is a
sensitive assay for detecting compound toxicity to dividing cells.
The compound concentration that inhibits cell growth by 50%
(IC.sub.50) is calculated as described above. In comparison with
four human diploid cell lines and Vero cells, HFF cells are known
to be very sensitive and predictive of toxicity for bone marrow
cells.
6.6.4.2 Confirmation Assays for VV and CV
[0777] Anti-viral Activity:
[0778] Compounds that show activity in the CPE-inhibition assay are
confirmed using the plaque reduction assay. Susceptibility of
additional virus strains of VV, CV and activity in other cell types
can also be determined for selected compounds.
Toxicity:
[0779] In addition to the toxicity component incorporated into each
assay system, a standardized cell cytotoxicity assay using a vital
stain uptake (Neutral Red) is performed using 7 days of compound
exposure to confluent non-dividing cells. This assay measures
direct cell cytotoxicity (CC.sub.50). In this regard, a neutral red
uptake assay is reproducible and allows for quantitation of
toxicity based on the number of viable cells rather than cellular
metabolic activity. In some cases, the toxicity of new compounds on
dividing cells is determined at a very early stage of testing. A
cell proliferation assay using HFF cells is a sensitive assay for
detecting compound toxicity to dividing cells, and the compound
concentration that inhibits cell growth by 50% (IC.sub.50) is
calculated as described above.
6.6.5 In Vitro Laboratory Procedures for Assays for
Orthopoxviruses
6.6.5.1 Efficacy Screening for VV and CV
[0780] Preparation of Human Foreskin Fibroblast (HFF) Cells:
[0781] Newborn human foreskins are obtained as soon as possible
after circumcision and placed in minimal essential medium (MEM)
containing vancomycin, fungizone, penicillin, and gentamicin at the
usual concentrations, for 4 hours. The medium is then removed, the
foreskin minced into small pieces and washed repeatedly with
phosphate buffered saline (PBS) deficient in calcium and magnesium
(PD) until red cells are no longer present. The tissue is then
trypsinized using trypsin at 0.25% with continuous stirring for 15
minutes at 37.degree. C. in a CO.sub.2 incubator. At the end of
each 15-minute period, the tissue is allowed to settle to the
bottom of the flask. The supernatant containing cells is poured
through sterile cheesecloth into a flask containing MEM and 10%
fetal bovine serum. The flask containing the medium is kept on ice
throughout the trypsinizing procedure. After each addition of
cells, the cheesecloth is washed with a small amount of MEM
containing serum. Fresh trypsin is added each time to the foreskin
pieces and the procedure repeated until all the tissue is digested.
The cell-containing medium is then centrifuged at 1000 RPM at
4.degree. C. for 10 minutes. The supernatant liquid is discarded
and the cells are resuspended in a small amount of MEM with 10%
FBS. The cells are then placed in an appropriate number of 25
cm.sup.2 tissue culture flasks. As cells become confluent and need
trypsinization, they are expanded into larger flasks. The cells are
kept on vancomycin and fungizone to passage four, and maintained on
penicillin and gentamicin. Typically, cells are used only through
passage 10.
[0782] Cytopathic Effect Inhibition Assay:
[0783] Low passage HFF cells are seeded into 96 well tissue culture
plates 24 hours prior to use at a cell concentration of
2.5.times.10.sup.5 cells per ml in 0.1 ml of MEM supplemented with
10% FBS. The cells are then incubated for 24 hours at 37.degree. C.
in a CO.sub.2 incubator. After incubation, the medium is removed
and 125 ml of experimental compound is added to the first row in
triplicate wells, all other wells having 100 ml of MEM containing
2% FBS. The compound in the first row of wells is then diluted
serially 1:5 throughout the remaining wells by transferring 25 ml
using the BioMek 2000 Laboratory Automation Workstation. After
dilution of the compound, 100 ml of the appropriate virus
concentration is added to each well, excluding cell control wells,
which received 100 ml of MEM. The virus concentration utilized is
1000 PFU's per well. The plates are then incubated at 37.degree. C.
in a CO.sub.2 incubator for 7 days. After the incubation period,
media is aspirated and the cells stained with a 0.1% crystal violet
in 3% formalin solution for 4 hours. The stain is removed and the
plates rinsed using tap water until all excess stain is removed.
The plates are allowed to dry for 24 hours and then read on a
BioTek Multiplate Autoreader at 620 nm. The EC.sub.50 values are
determined by comparing compound treated and untreated cells using
a computer program.
[0784] Plaque Reduction Assay:
[0785] Two days prior to use, HFF cells are plated into 6 well
plates and incubated at 37.degree. C. with 5% CO.sub.2 and 90%
humidity. On the date of assay, the compound is made up at twice
the desired concentration in 2.times.MEM and then serially diluted
1:5 in 2.times.MEM using 6 concentrations of compound. The initial
starting concentration is usually 200 mg/ml down to 0.06 mg/ml. The
virus to be used is diluted in MEM containing 10% FBS to a desired
concentration which will give 20-30 plaques per well. The media is
then aspirated from the wells, and 0.2 ml of virus is added to each
well in duplicate with 0.2 ml of media being added to drug toxicity
wells. The plates are then incubated for 1 hour with shaking every
15 minutes. After the incubation period, an equal amount of 1%
agarose is added to an equal volume of each compound dilution. This
addition gives final compound concentrations beginning with 100
mg/ml and ending with 0.03 mg/ml and a final agarose overlay
concentration of 0.5%. The compound/agarose mixture is applied to
each well in 2 ml volume and the plates are incubated for 3 days,
after which the cells are stained with a 0.01% solution of neutral
red in phosphate buffered saline. After a 5-6 hours incubation
period, the stain is aspirated, and plaques counted using a
stereomicroscope at 10.times. magnification.
6.6.5.2 Toxicity Screening for VV and CV
[0786] Neutral Red Uptake Assay:
[0787] Twenty-four hours prior to assay, HFF cells are plated into
96 well plates at a concentration of 2.5.times.10.sup.4 cells per
well. After 24 hours, the media is aspirated and 125 ml of compound
is added to the first row of wells and then diluted serially 1:5
using the BioMek 2000 Laboratory Automation Workstation in a manner
similar to that used in the CPE assay. After compound addition, the
plates are incubated for 7 days in a CO.sub.2 incubator at
37.degree. C. At this time, the media/compound mixture is aspirated
and 200 ul/well of 0.01% neutral red in PBS is added. This mixture
is incubated in the CO.sub.2 incubator for 1 hour. The dye is
aspirated and the cells are washed using a Nunc Plate Washer. After
removing the PBS, 200 mg/well of 50% ETOH/1% glacial acetic acid
(in H.sub.2O) is added. The plates are rotated for 15 minutes and
the optical densities read at 540 nm on a plate reader. The
EC.sub.50 values are determined by comparing compound treated and
untreated cells using a computer program.
[0788] Cell Proliferation Assay:
[0789] Twenty-four hours prior to assay, HFF cells are seeded in
6-well plates at a concentration of 2.5.times.10.sup.4 cells per
well in MEM containing 10% FBS. On the day of the assay, compounds
are diluted serially in MEM containing 10% FBS at increments of 1:5
covering a range from 100 mg/ml to 0.03 mg/ml. For drugs that have
to be solubilized in DMSO, control wells receive MEM containing 1%
DMSO. The media from the wells is aspirated, and 2 ml of each drug
concentration is then added to each well. The cells are incubated
in a CO.sub.2 incubator at 37.degree. C. for 72 hours. At the end
of this time, the media-compound solution is removed and the cells
washed. One ml of 0.25% trypsin is added to each well and incubated
until the cells start to come off of the plate. The cell-media
mixture is then pipetted up and down vigorously to break up the
cell suspension and 0.2 ml of the mixture is added to 9.8 ml of
Isoton III and counted using a Coulter Counter. Each sample is
counted 3 times with 2 replicate wells per sample.
[0790] Bone Marrow Clonogenic Assay:
[0791] In vitro toxicity to bone marrow progenitor cells can be
determined by inhibition of myeloid [colony-forming units
granulocyte/macrophage (CFU-GM)] and erythroid [burst-forming
unit-erythroid (BFU-E)] colony formation in soft agar clonal
assays. Using a 21-23 gauge needle attached to a syringe, rodent
bone marrow cells are collected from the leg bone of rats or mice
by flushing with Isocoves' Modified Dulbecco's medium (IMDM). A
single cell suspension is obtained by repeated aspiration through
the needle. Nucleated cells are enumerated with a hemacytometer and
adjusted to the desired cell concentration in IMDM. Murine CFU-GM
assays are prepared with 2.5.times.10.sup.5 nucleated cells/ml, 20%
FBS, 10 ng/ml rmGM-CSF, and 0.2% agarose. BFU-E cultures include
30% FBS, 1% deionized BSA, 0.1 mM 2-ME, 4 U/ml rhEpo, 10 ng/ml
rmIL-3, 2.5.times.10.sup.5 nucleated cells/ml and 0.2% agarose.
Triplicate wells (in 6 well plates) containing 0.1 ml of compound
(10.times.) receive 1 ml of either culture mixture for each
concentration group and slowly mixed. The cultures are allowed to
gel at 4.degree. C. and then incubated for 7 (CFU-GM) or 9 (BFU-E)
days at 37.degree. C. in a humidified atmosphere of 5% CO.sub.2 in
air. Colonies are counted using an inverted microscope. CFU-GM
colonies are identified as cell clones containing at least 40
cells. BFU-E cultures are stained with dianisidine, and aggregates
of greater than 60 hemoglobin-containing cells are counted as
erythroid colonies. The median inhibitory concentration (IC.sub.50)
and the 90% inhibitory concentration (IC.sub.90) are derived from
linear regression analysis of the logarithm of compound
concentration versus CFU-GM or BFU-E survival fraction.
6.6.6 Assays for Hepatitis Viruses
6.6.6.1 Hepatitis B Virus (HBV)
[0792] A variety of cell-culture based anti-HBV analyses are
available. Candidate compounds are initially assayed in a primary
screening assay. Compounds demonstrating reasonable anti-viral and
cytotoxicity profiles are then candidates for several additional
follow-up analyses. For the primary screening assay, routinely 2-3
mg are required for compounds with molecular weights in the range
of standard nucleosides (e.g., 300-500). Additional compound may be
required for follow-up analyses. Molecular weights and solubility
information are provided if available. If no preferred solvent is
specified, 100% tissue culture DMSO will be used. Compounds are
typically solubilized in aqueous solutions (normal pH range) at a
minimum of a 10.times. final testing concentration or in DMSO at a
minimum 50.times. test concentration. EtOH is generally not well
tolerated by the cell lines used for these studies, but final
concentrations of EtOH of less than 0.03% are usually acceptable.
Compounds which need to be tested in other solvents should be
accompanied by a small amount of solvent (under a separate
accession number) to control for cytotoxicity. For compounds in
solution, approximately 0.25 ml of a 100.times. stock is minimally
required.
[0793] Primary Assay:
[0794] HBV anti-viral assays (Korba & Gerin, Antivir. Res.
1992, 19:55) are conducted using confluent cultures of 2.2.15 cells
maintained on 96-well flat-bottomed tissue culture plates
(confluence in this culture system is required for active, high
levels of HBV replication equivalent to that observed in
chronically-infected individuals (Sells et al., J. Virol. 1988,
62:2836; Korba and Gerin, Antivir. Res. 1992, 19:55). HepG2-2.2.15
is a stable cell line containing the hepatitis B virus (HBV) ayw
strain genome. Anti-viral compounds blocking any late step of viral
replication such as transcription, translation, pregenome
encapsidation, reverse transcription, particle assembly and release
can be identified and characterized using this cell line.
[0795] Cultures are treated with nine consecutive daily aliquots of
the test compounds. Typically, 4 doses (10-fold or 3-fold steps),
in triplicate are used. HBV DNA levels in the culture medium
(representing HBV virion production) are assessed by quantitative
blot hybridization 24 hours after the last treatment.
Alternatively, whether a compound reduces the production of
secreted HBV from cells can be initially assessed utilizing real
time quantitative PCR (TaqMan) assay to directly and accurately
measure HBV DNA copies. Cytotoxicity is assessed by uptake of
neutral red dye 24 hours following the last treatment. Lamivudine
(LMV) is used as the standard assay control, but other control
compounds are also available.
[0796] EC.sub.50, EC.sub.90 and CC.sub.50 values are calculated by
linear regression analysis (MS EXCEL.RTM., QuattroPro.RTM.) using
data combined from all treated cultures (Korba & Gerin,
Antivir. Res. 1992, 19:55; Okuse et al., Antivir. Res. 2005,
65:23). Standard deviations for EC.sub.50 and EC.sub.90 values are
calculated from the standard errors generated by the regression
analyses. EC.sub.50 and EC.sub.90 are compound concentrations at
which a 2-fold, or a 10-fold depression of HBV DNA (relative to the
average levels in untreated cultures), respectively, is observed.
CC.sub.50 is the compound concentration at which a 2-fold lower
level of neutral red dye uptake (relative to the average levels in
untreated cultures) is observed. The Selectivity index (S.I.) is
calculated as CC.sub.50/EC.sub.90 since at least a 3-fold
depression of HBV DNA levels is typically required to achieve
statistical significance in this assay system (Korba & Gerin,
Antivir. Res. 1992, 19:55).
[0797] Secondary Assay:
[0798] Confluent cultures of 2.2.15 cells maintained on 48-well
flat-bottomed tissue culture plates are treated as described for
the primary assay. HBV virion DNA levels in the culture medium and
cytotoxicity are assessed as described for the primary assay. In
addition, intracellular HBV DNA replication is measured by
quantitative Southern blot hybridization analysis (Korba &
Gerin, Antivir. Res. 1992, 19:55). EC.sub.50, EC.sub.90 and S.I.
values are calculated for both virion DNA and intracellular HBV DNA
replication intermediates. In certain cases, additional assays
(tertiary assays) can be conducted.
[0799] Combination Studies:
[0800] Compounds are mixed at approximately equipotent
concentrations and this molar ratio is maintained during serial
dilution (Korba, Antivir. Res. 1996, 29:49; Iyer et al. 2004). To
compensate for potential unforeseen interactions (e.g., changes in
uptake, metabolism, etc.), the concentration of one compound is
altered approximately 3-fold higher of lower relative to the second
compound so that three different ratios are used in one experiment.
Cultures are treated with 6-8 serial dilutions of the mixtures, as
with the corresponding monotherapies, as described for the primary
assay. Evaluation of compound interactions in the combination
treatments is conducted against the corresponding monotherapies in
the same experiments using the Combostat.RTM. (Biosoft, Inc.)
analysis software. For combination treatments, EC.sub.50,
EC.sub.90, CC.sub.50 and S.I. (CC.sub.50/EC.sub.90) are presented
for the first compound listed. The molar ratio of the compounds in
each combination is also indicated.
[0801] Alternatively, after the anti-viral activity of test
compounds against HBV is confirmed, the interactions of the
compounds with 3TC, IFN.alpha. and other compounds in terms of
efficacy (synergy, additivity, antagonism) and toxicity
(combination toxicity) can be evaluated with the 2.2.15 cells using
the quantitative HBV TaqMan PCR assay.
[0802] Drug Resistant HBV:
[0803] Activity against recombinant HBV carrying clinically
relevant mutations that confer resistance to licensed drugs is
performed using transient transfection of HBV DNA (Tatti et al.,
Antivi. Res. 2002, 55:27; Iyer et al., AAC 2004, 48:2199). Cultures
are transfected in 48-well culture plates with Lipofectamine
2000.TM. (Gibco, Inc) following the manufacturer's procedure.
Beginning three days post-transfection, cultures are treated for 5
days with anti-viral compounds. Anti-viral activity is determined
by quantitative Southern Blot hybridization of intracellular HBV
DNA replication intermediates. Currently, the following mutants are
available: lamviudine (LMV)-resistant, polM204V, polM204I,
polL180M, polM204V/L180M (Allen et al., Hepatology 1998, 27:1670);
adefovir dipovoxil (ADV)-resistant, polN236T (Angus et al.,
Gastroenterology 2003, 125:292). Standardized nomenclature is used
for HBV polymerase assignment (Stuyver et al., Hepatology 2001,
33:751). Additional mutants (TNFR, ETVR) are under
construction.
[0804] Other tests can be conducted in order to evaluate the
ability of compounds to inhibit the known 3TC-- and
penciclovir-resistant mutants of HBV. Stable cell lines with
control wild-type HBV and the following mutations known to be
associated with resistance of HBV to these agents can be used: (1)
L526M (rtL180M) of Domain B & YMDD M550V (rtM204V) of Domain C
(the most common mutation pattern observed during HBV breakthrough
viremia); (2) L526M alone (the most common mutation associated with
penciclovir resistance; also associated with some resistance
against 3TC); and control wild-type HBV.
[0805] HBV Protein Production and RNA Transcription:
[0806] Semi-quantitative ELISA-based analysis of HBV proteins is
performed (Korba & Gerin, Antivir. Res. 1995, 28:225; Korba et
al., Antivir. Res. 2008, 77:56) using samples diluted (2 to
10-fold) to bring levels into the dynamic response ranges of the
assays. Qualitative analysis of HBV proteins is also performed
using standard Western blot techniques (Muller et al., J. Infect.
Dis. 1992, 165:929). HBV surface (HBsAg) and HBV e (HBeAg) antigens
are analyzed from culture medium samples, and HBV core (HBcAg) is
analyzed from intracellular lysates (normalized for total cell
protein content in each culture sample). Intracellular HBV RNA
(normalized to the level of cellular B-actin RNA in each culture
sample) is assessed by quantitative northern blot hybridization
(Korba & Gerin, Antivir. Res. 1995, 28:225).
[0807] HBV Mechanism of Action Studies:
[0808] A variety of assays can be used to pinpoint the mechanism of
action of anti-viral compounds. Examples include the following:
[0809] Extracellular HBV virions: In addition to the quantitative
PCR analysis, a Southern blot of the HBV particles secreted from
compound-treated cells can be performed; [0810] Intracellular HBV
particles: HBV particles can be isolated from the treated 2.2.15
cells and the pregenomic RNA examined by Southern blot analysis.
This can be helpful in identifying the site of action of a
late-acting compound; [0811] Intracellular HBV replicative
intermediates: Nucleic acids isolated from the cells can be
examined by Southern blots to assess the distribution of circular
partially double-stranded HBV DNA, linear partially double-stranded
DNA and single stranded HBV DNA; [0812] HBV transcription: Effects
on HBV genomic and subgenomic viral RNA synthesis are studied by
Northern blot and primer extension analysis; [0813] HBsAg and HBeAg
release assay: ELISAs are used to quantify the amounts of the HBV
envelope protein, surface antigen (HBsAg), and of secreted
e-antigen (HBeAg) released from cultures; [0814] Western blot
analysis: Western blots are conducted to study HBV core and
envelope protein expression; [0815] Novel mechanism of action
studies: Specific effects on HBV transcription and replication can
arise from alterations in DNA-protein interactions, sometimes
affected by cellular growth factors, at the HBV enhancers,
promoters or through the transcriptional transactivator X-protein;
and [0816] Endogenous Polymerase Assay: Extracellular HBV virions
contain partially double-stranded circular DNA genomes. Purified
virions are used to assay the ability of anti-viral drugs to
inhibit the endogenous polymerase activity of HBV. Normally, this
activity functions to complete (+) strand synthesis following the
infection of new cells by HBV virions.
6.6.6.2 Hepatitis C Virus (HCV) Protocol I
[0817] Cell line Huh7 ET (luc-ubi-neo/ET), which contains a new HCV
RNA replicon with a stable luciferase (LUC) reporter, is used. It
is similar to the cell line 5-2 (Krieger et al., J. Virol. 2001,
75:4614-4624.), but contains additional modifications that make the
cell line more robust and provide stable LUC expression for
anti-viral screening. The composition of the replicon is shown
diagrammatically below:
##STR00060##
[0818] The HCV RNA replicon ET contains the 5' NTR (IRES) of HCV 5'
which drives the production of a firefly luciferase (Luc),
ubiquitin (Ubiq), and neomycin phosphotransferase (Neo) fusion
protein. Ubiquitin cleavage releases the LUC and Neo genes. The
EMCV IRES element (E-I) controls the translation of the HCV
structural proteins NS3-NS5. The NS3 protein cleaves the HCV
polyprotein to release the mature NS3, NS4A, NS4B, NS5A and NS5B
proteins that are required for HCV replication. At the 3' end of
the replicon is the authentic 3' NTR of HCV.
[0819] The LUC reporter is used as an indirect measure of HCV
replication. The activity of the LUC reporter is directly
proportional to HCV RNA levels and positive control anti-viral
compounds behave comparably using either LUC or RNA endpoints. The
use of the LUC endpoint is more economical than HCV RNA and can be
used for high-throughput applications to screen libraries of
compounds.
[0820] Primary HCV RNA Replicon Assay:
[0821] First, the effect of compounds added in triplicate at a
single high-test concentration of 20 mM on HCV RNA-derived LUC
activity and cytotoxicity is examined. Human interferon alpha-2b is
included in each run as a positive control compound. Subconfluent
cultures of the ET line are plated out into 96-well plates that are
dedicated for the analysis of cell numbers (cytotoxicity) or
anti-viral activity, and test compounds are added to the
appropriate wells the next day. Cells are processed 72 hours later
when the cells are still subconfluent. Compounds that reduced the
LUC signal by 50% or more relative to the untreated cell controls
move forward to the next screening steps. A compound's cytotoxicity
is assessed as the percent viable cells relative to the untreated
cell controls.
[0822] HCV RNA Replicaon Confirmation Assay:
[0823] The HCV RNA replicon comfirmatory assay is then used to
examine the effects of compounds at, for example, five half-log
concentrations each. Human interferon alpha-2b is included in each
run as a positive control compound. Subconfluent cultures of the ET
line are plated out into 96-well plates that are dedicated for the
analysis of cell numbers (cytotoxicity) or anti-viral activity and
the next day test compounds are added to the appropriate wells.
Cells are processed 72 hours later when the cells are still
subconfluent. Compound EC.sub.50 and EC.sub.90 values (anti-viral
activity) are derived from HCV RNA levels assessed as either HCV
RNA replicon-derived LUC activity or as HCV RNA using TaqMan
RT-PCR. Compound IC.sub.50 and IC.sub.90 values (cytotoxicity) are
calculated using CytoTox-1 (Promega), a colorimetric assay used as
an indicator of cell numbers and cytotoxicity when the LUC assay
system is employed, while ribosomal (rRNA) levels determined via
TaqMan RT-PCR are used as an indication of cell numbers in the
RNA-based assay. Compound selectivity indices SI.sub.50 and
SI.sub.90 values are also calculated.
6.6.6.3 Hepatitis C Virus (HCV) Protocol II
[0824] A variety of cell-culture based anti-HCV analyses are
available. Candidate compounds are initially assayed in a primary
screening assay. Compounds demonstrating reasonable anti-viral and
cytotoxicity profiles are then candidates for several additional
follow-up analyses. For the primary screening assay, routinely 2-3
mg are required for compounds with molecular weights in the range
of standard nucleosides (e.g., 300-500). Additional compound may be
required for follow-up analyses. Molecular weights and solubility
information are provided if available. If no preferred solvent is
specified, 100% tissue culture DMSO is used. Compounds are
solubilized in aqueous solutions (normal pH range) at a minimum of
a 10.times. final testing concentration or in DMSO at a minimum
50.times. test concentration. EtOH is generally not well tolerated
by the cell lines used for these studies, but final concentrations
of EtOH of less than 0.03% are acceptable. Compounds which need to
be tested in other solvents should be accompanied by a small amount
of solvent (under a separate accession number) to control for
cytotoxicity. For compounds in solution, approximately 0.25 ml of a
100.times. stock is minimally required.
[0825] Primary Assay:
[0826] Anti-viral activity against HCV is assessed in a 3-day assay
(Okuse et al., Antivir. Res. 2005, 65:23; Korba et al., Antivir.
Res. 2008, 77:56) using the stably-expressing HCV replicon cell
line, AVA5 (sub-genomic (CON1), genotype 1b) (Blight et al.,
Science 2000, 290:1972) maintained as sub-confluent cultures on
96-well plates. Anti-viral activity is determined by blot
hybridization analysis of intracellular HCV RNA (normalized to the
level of cellular B-actin RNA in each culture sample). Cytotoxicity
is assessed by neutral red dye uptake in cultures maintained in
parallel plates.
[0827] EC.sub.50, EC.sub.90 and CC.sub.50 values are calculated by
linear regression analysis (MS EXCEL.RTM., QuattroPro.RTM.) using
data combined from all treated cultures (Korba & Gerin,
Antivir. Res. 1992, 19:55; Okuse et al., Antivir. Res. 2005,
65:23). Standard deviations for EC.sub.50 and EC.sub.90 values are
calculated from the standard errors generated by the regression
analyses. EC.sub.50 and EC.sub.90 are compound concentrations at
which a 2-fold, or a 10-fold depression of intracellular HCV RNA
(relative to the average levels in untreated cultures),
respectively, is observed. CC.sub.50 is the compound concentration
at which a 2-fold lower level of neutral red dye uptake (relative
to the average levels in untreated cultures) is observed. The
Selectivity index (S.I.) is calculated as CC.sub.50/EC.sub.90.
Recombinant human interferon 2b (PBL laboratories, Inc.) is used as
an assay control. Compounds currently in clinical trials that are
directed against NS3 and NS5B can also be used.
[0828] Secondary Assay:
[0829] This assay assesses activity against additional genotypes
using the format described for the primary assay. Activity against
the genotype 1b HCV is included for comparison. One exemplary
replicon cell line contains H/FL-Neo (genotype 1a (H77), full
length construct) (Blight et al., J. Virol. 2003, 77:3181). A
genotype 2a construct (J6/JFH-1, full length) can be used to assess
for future inclusion. EC.sub.50, EC.sub.90, CC.sub.50 and S.I.
values are calculated for each replicon cell line. In some
instances, additional assays (tertiary assays) can also be
conducted.
[0830] Combination Studies:
[0831] Compounds are mixed at approximately equipotent
concentrations and this molar ratio is maintained during serial
dilution (Korba, Antivir. Res. 1996, 29:49; Iyer et al., 2004).
Usually, three different ratios are used in one experiment.
Cultures are treated with 6-8 serial dilutions of the mixtures, as
with the corresponding monotherapies, as described for the primary
assay. Evaluation of compound interactions in the combination
treatments is conducted against the corresponding monotherapies in
the same experiments using the Combostat.RTM. (Biosoft, Inc.)
analysis software. For combination treatments, EC.sub.50,
EC.sub.90, CC.sub.50 and S.I. (CC.sub.50/EC.sub.90) are presented
for the first compound listed. The molar ratio of the compounds in
each combination is also indicated.
[0832] Drug-Resistant HCV:
[0833] Since no licensed anti-HCV drugs for which resistance
mutations have yet been identified, a panel of mutants conferring
resistance to compounds in mid to late phase clinical trials is
compiled. Some availablestable replicon-containing cell lines
(Korba et al., Antivir. Res. 2008, 77:56) are genotype 1 B NS5B
S282T (Perra et al., Nucleosides Nucleotides Nucleic Acids 2005,
24:767), and NS3 A156S and NS3 A156V (Courcambeck et al., Antivir.
Ther. 2006, 11:847) drug-resistant mutants. The genetic background
is the same as that in the BB7 replicon (AVA5 cells) used in the
primary assay. Activity against these mutants is assessed as
described in the primary assay, except that semi-quantitative
real-time PCR is used for the analysis of HCV RNA due to reduced
replication levels.
[0834] The genotype 1b mutants can also be assessed in this manner.
For this assay, Huh7.5 cells are transfected with HCV RNA using
Liofectamine 2000.TM. (Gibco, Inc.) in 6-well culture plates. Three
days post-transfection, cultures are exposed to 125 .mu.g/mL G418
and test compounds. After 10-14 days, surviving colonies are fixed,
stained, and counted. EC.sub.50 and EC.sub.90 values are calculated
for each transfected RNA.
6.6.7 Assays for Papilloma Viruses
[0835] Assays for Human Papilloma Virus (HPV) 11 and 40:
[0836] A431 cells are plated 2.times.10.sup.5 cells/well in 6-well
cluster dishes. Replicate aliquots of HPV-11 (or HPV-40) are added
to each well representing an MOI of 150 particles per cell.
Dilutions of compound are added to triplicate cultures. Control
wells without virus are included and receive media alone. Positive
control compound can be, e.g., HPMPC (cidofovir) at 300 .mu.g/ml.
Cell cultures are harvested, lysed with Trizol reagent (GIBCO/BRL)
and RNA prepared. QRT-PCR is conducted to quantitate the proportion
of viral E1-E4 transcripts and a cellular reference RNA for the
TATA-binding protein (TBP). Anti-viral effects of compounds are
assessed as an EC.sub.50 value representing a 50% reduction in the
amount of E1-E4 viral transcript when compared with cultures
infected with HPV-11 (or HPV-40) alone. CC.sub.50 toxicity is
calculated as the compound dose at which 50% of total cellular RNA
is recovered. From these two values, the Selectivity Index (SI) is
determined from CC.sub.50/EC.sub.50. Usually, SI>5 would be
significant for the detection of an anti-viral activity.
[0837] The assay procedure can be modified to test compounds with
microbicidal activity if necessary. This modification is
represented by drug addition to A431 cells at the same time as
infectious virus.
[0838] Assays for Bovine Papilloma Virus (BPV) 1:
[0839] C127 cells are plated 3.times.10.sup.3 cells/well into wells
of a 96-well flat-bottomed microculture plate. Replicate aliquots
of BPV-1 are added to each well, representing approximately 100
focus-forming units. Control wells without virus are included.
Dilutions of drug are added to triplicate cultures of both
BPV-1-infected and uninfected cultures. Control wells receive media
without compound. Positive control compound can be, e.g., cidofovir
at 5 .mu.g/ml. Cell cultures are fed with medium and compound every
3-4 days. Cell numbers and viability are assessed using the MTS
assay. Anti-viral effects of compounds are calculated using the
following formula to obtain % anti-viral activity:
B&A/B&C.times.100%=% Anti-viral activity [0840] A=O.D. of
BPV-1-containing, compound-treated cultures [0841] B=O.D. of BPV-1
containing cell cultures [0842] C=O.D. of cultures of cells alone.
The EC.sub.50 value represents a 50% reduction in the amount of
O.D. values (MTS signal) of compound-treated virus-infected
cultures when compared with cultures containing BPV-1 alone and
cultures containing cells alone. The Selectivity Index (SI) is
determined from CC.sub.50/EC.sub.50. Usually, SI>5 would be
significant for the detection of an anti-viral activity.
[0843] The assay procedure can be modified to test compounds with
microbicidal activity if necessary. This modification is
represented by drug addition to C127 cells at the same time as
infectious virus.
[0844] Assays for Human Papilloma Virus (HPV) 31b:
[0845] Cultures of CIN612, clone 9E cells are prepared from known
protocols. Individual rafts are developed containing multi-layers
of 9E cells growing on a collagen matrix impregnated with mitomycin
C-treated fibroblast cells. Rafts are treated with compound
delivered into the cell culture media that can diffuse into the 9E
multulayer. Treatments are continuous for the culture duration,
which is typically a period of 10 days. After 10 days culture, the
9E rafts are harvested and assayed for HPV-31b DNA (measure of
viral DNA replication) and E 1-E4 viral transcription (viral
function) using the QRT-PCR assay described for the HPV-11
monolayer assay system. Primers are prepared to quantitate HPV-31B
DNA and RNA (E1-E4) and the quantitation compared to TBP.
Anti-viral activity is measured quantitatively as either or both a
reduction in viral DNA and RNA when compared to placebo-treated 9E
rafts. A portion of each raft is removed for histology (H&E,
immunostaining for specific marker keratins [keratin 10,
involucrin]). Viral DNA and RNA levels are plotted against compound
concentrations to determine EC.sub.50 (50% reduction in viral DNA
and/or RNA), CC.sub.50 (50% reduction in yield of total RNA/DNA).
The Selectivity Index (SI) is determined from CC.sub.50/EC.sub.50.
Usually, SI>5 would be significant for the detection of an
anti-viral activity.
6.6.8 Assays for BK Virus (BKV)
[0846] Assays for BK virus (BKV) can be conducted by following the
procedures described in, e.g., Farasati et al., Transplantation,
2005, 79(1):116-118. Generally, the principle of the assay is to
measure the effect of test compounds on the rate of viral
replication by quantitative real-time PCR for BKV viral capsid
protein 1 DNA. Simultaneous quantification of a housekeeping gene
such as aspartoacylase (ACY) DNA permits monitoring of host-cell
replication. Regression analysis of dose-response curve allows for
determination of EC.sub.50, which is defined as the compound
concentration that reduces the yield of BKV DNA by 50%. The ratio
of IC.sub.50 to EC.sub.50 (selectivity index) is used to compare
the anti-viral effect of different test compounds in relation to
their safety.
[0847] For example, anti-viral testing can be performed using BKV,
Gardner strain (available from ATCC). The cells are expanded, e.g.,
in human embryonic lung fibroblasts (WI-38 cells), using DMEM
medium supplemented by 10% fetal bovine serum and L-glutamine,
incubated at 37.degree. C. under 5% CO.sub.2. Each test compound is
typically tested at least three times using a broad range of
concentrations covering 4-5 orders of magnitude. Experiments
usually include a negative control consisting of cells exposed only
to the diluents.
[0848] Each compound sensitivity experiment requires inoculation of
50,000 log-phase WI-38 cells in six-well culture plates. After
plating the cells, viral infection is achieved by the addition of
2.times.10.sup.3 to 2.times.10.sup.6 BKV particles to each culture
well in a volume of 0.5 mL. After a 2 hours of 37.degree. C.
incubation, unbound virus is washed off with tissue culture medium.
The cultures are maintained in DMEM medium, supplemented by 10%
fetal bovine serum and L-Glutamine, at 37.degree. C., under 5%
CO.sub.2, for 7 days. Cells are harvested by 0.25% trypsin-1 mM
Na-EDTA digestion at 37.degree. C. for 10 minutes and viability
assessed by Trypan blue dye exclusion test. DNA extraction on the
cell lysates is performed with a commercially available kit (QIAamp
DNA Mini kit, Qiagen, Valencia, Calif.). BKV VP-1 DNA is amplified
from the total DNA by a TaqMan quantitative PCR reaction performed
in an ABI Prism 7700 Sequence Detector (ABI, Foster City, Calif.).
To keep track of variable input of cellular DNA in different
cell-culture experiments, each cell lysate is subjected to
simultaneous TaqMan PCR for ACY.
6.6.9 Assays for Dengue Virus (DENV)
[0849] In vitro assays for DENV can be conducted using procedures
substantially similar to those described, for example, in Heaton et
al., Proc. Natl. Acad. Sci., 2010, 107(40): 17345-17350. Huh-7.5
cells (a subline derived from the hepatocyte Huh7 cell line) are
maintained in DMEM-high glucose supplemented with 0.1 mM
nonessential aminid acids, 5% v/v FBS, and penicillin-streptomycin.
In certain cases, DENV-luciferase replicon RNAs are introduced in
Huh-7.5 cells by electroporation. At 24 hour post-electroporation,
the cells are treated with varying concentrations of test
compounds, maintained for another 24 hours, and assayed for
luciferase activity.
[0850] In other cases, Huh-7.5 cells are infected with DENV
(multiplicity of infection=1) for 4 hours and then treated with
test compounds at varying concentrations. Twenty four hours
post-infection, viral RNA levels or released virus are quantified
along with cellular ATP levels.
[0851] Three types of in vitro assays for DENV include those
described in Chen et al., Antimicrobial Agents and Chemotherapy,
2010, 54(8):3255-3261.
[0852] Type 1:
[0853] The assays measure viral titer reduction in the presence of
test compounds. Vero cells are seeded in a 12-well plate
(4.times.10.sup.5 cells per well). At 24 hours post-seeding, the
cells are infected with DENV at a multiplicity of infection of 0.1
and treated immediately with the test compounds. Culture medium are
collected at an appropriate time, and viral titers are determined
using plaque assays.
[0854] Type 2:
[0855] Cell-based flavivirus immunodetection (CFI) is used to
measure the amount of viral E protein in infected cells. A549 cells
are seeded to a 96-well plate (2.times.10.sup.4 cells per well).
The cells are infected with DENV on the following day. During the
infection, the cells are incubated with a test compound/virus
mixture for 1 hour, with shaking every 10 to 15 minutes. The
culture fluid is then replenished with fresh medium containing test
compounds. On day 2 post-infection, the cells are washed with PBS,
fixed with 100% methanol at 4.degree. C. for 10 minutes, and
detected for intracellular viral E protein by ELISA. The ELISA uses
mouse monoclonal antibody 4G2 against the DENV E protein and goat
anti-mouse IgG conjugated with hoseradish peroxidase as the primary
and secondary antibodies, respectively.
[0856] Type 3:
[0857] The assay uses Huh-7 cells and luciferase-reporting replicon
of DENV. The procedures are similar to those described above.
6.7 In Vivo Assays
6.7.1 In Vivo Assays for Herpes Viruses
6.7.1.1 HSV-1 and HSV-2
[0858] Animal Models of Herpes Encephalitis:
TABLE-US-00003 Virus Species Route Disease HSV-1 BALB/c Mice i.p.
Encephalitis i.n. Encephalitis HSV-2 BALB/c Mice i.p. Encephalitis
i.n. Disseminated infection of newborns and encephalitis HSV-1 Rat
i.n. Encephalitis HSV-1 SKH-1 Mice i.cut. Herpes labialis
[0859] New compounds are screened initially for HSV activity in
BALB/c mice (Charles River Laboratories) inoculated i.p. with HSV-1
or HSV-2. Following i.p. inoculation with HSV-1 or HSV-2, virus
replicates in the gut, liver, and spleen and spreads to the CNS by
viremia and likely peripheral nerves as well. Virus is detected
first in the brain around day five, thus allowing time for
compounds to demonstrate anti-viral effects. This model system one
of the most sensitive for determining efficacy of a new anti-viral
compound. Although it does not simulate a natural route of
infection, it allows for screening new compounds to determine
optimal dosages and treatment regimens. This screening is followed
by testing in mice inoculated i.n. which more closely simulates
human infections. If the experimental compound exhibits activity in
mice inoculated i.p., it is next evaluated in mice inoculated by
the i.n. route.
[0860] I.n. inoculation of three-week-old BALB/c mice with HSV-1
provides a model for herpes encephalitis of humans utilizing a
natural route of infection. After inoculation of approximately 105
pfu of HSV-1, strain E-377, virus replicates in the nasopharynx and
spreads to the CNS by way of olfactory and trigeminal nerves.
Untreated animals generally die by days 6-10. The use of i.n.
inoculation is known as a natural route of infection for herpes
encephalitis. I.n. inoculation of three-week-old BALB/c mice with
about 4.times.10.sup.4 pfu of HSV-2, strain MS, provides a model of
disseminated neonatal herpes with CNS involvement. After viral
inoculation, virus replicates in nasopharyngeal and lung tissue,
and disseminates to the liver, spleen, and kidney. In addition,
virus spreads to the CNS via olfactory and trigeminal nerves.
Acyclovir, ACV, given parenterally or orally is effective in all
the experimental infections mentioned above and is utilized as a
positive control.
[0861] The SKH-1 strain of immunocompetent hairless mice is used to
facilitate scoring of cutaneous lesions. Orofacial inoculation of
HSV-1 in these mice provides an appropriate model for testing new
anti-viral therapies. In this model, mice are anesthetized with a
ketamine/xylazine mixture and injected subcutaneously with an
electronic microchip for individual identification. Prior to
inoculation, the snout, composed of the triangular shaped area over
the nasal bones from the nose bridge to the eyes, is lightly
abraded with a #113 tungsten-carbide engraving bit Dremmel tool.
This procedure is performed carefully to prevent bleeding. This
area is then swabbed for 10 seconds with a dacron swab soaked with
HSV-1. Following this procedure, animals are returned to their
cages and observed until recovery.
[0862] Animals infected with HSV-1 in the orofacial area exhibit
lesions that begin to appear on days 4-6 and are usually cleared by
day 15. To determine the effect of treatment on cutaneous viral
replication, severity of lesions is scored from days 4-21 and swabs
of the snout area are taken on days 3-10. The samples are placed in
2.0 mls of media and frozen at -70.degree. C. until titrated for
HSV-1 on rabbit kidney fibroblast cells in a CPE microtiter plate
assay. All experimental drug efficacy studies are placebo or
vehicle controlled and also the positive control, Zovirax, is
administered topically.
[0863] Mouse Model of Primary HSV-1/HSV-2 Challenge:
[0864] The primary screening model provides a rapid initial
evaluation of anti-viral efficacy against HSV primary infection
with both clinical and virological endpoints. This model utilizes
intravaginal inoculation of female Swiss Webster mice (25 g) with
HSV-1 or HSV-2 to evaluate potential anti-viral therapies as well
as vaccine/adjuvant candidates. Animals are followed daily for
signs and systems of herpes disease and vaginal swabs are obtained
to evaluate the effect of therapy on viral replication. Single or
combined anti-viral therapies can be administered topically, orally
or systemically and can be given at varying intervals begun before
or after viral challenge. Dose range studies can also be performed.
Dose and route of administration are individualized for each
experimental compound. Treatment group size is typically 12-16
mice.
[0865] Microbicide Screening Model of Primary HSV-2 Challenge in
Mice:
[0866] This model is designed to evaluate the protection afforded
by a microbicide candidate against infection with HSV-2. The model
utilizes intravaginal inoculation of female Swiss Webster mice for
evaluation. The initial trial is usually performed by applying
compound 5 minutes prior to challenge with HSV-2. Further
evaluation of microbicides in this model either extend the time
between microbicide administration and challenge or examine dose
range. Compounds can be advanced to a secondary species evaluation
in the guinea pig model of genital infection. Evaluation includes
daily evaluation for signs and symptoms of genital herpes and viral
examination of vaginal secretions. Treatment group size is
typically 12-16 mice.
[0867] Guinea Pig Model of Primary Genital HSV-2 Infection:
[0868] Because genital herpes disease in the guinea pig more
closely resembles human disease, this animal is used as a second
species for therapies with demonstrated efficacy against HSV in
mice. As with humans, genital HSV infection in guinea pigs is a
self limited vesiculoulcerative disease which is followed by
healing, the establishment of latency, and then both spontaneous
and inducible symptomatic and asymptomatic recurrences. An
exemplary model utilizes intravaginal inoculation of female Hartley
guinea pigs and provides both clinical and virologic indices to
assess both the effect of treatment on primary disease as well as
on the frequency or severity of subsequent recurrent infections.
Anti-viral therapy can be administered orally, topically or
systemically and can be given at varying intervals beginning before
or after virus challenge. Following intravaginal inoculation,
animals are followed daily for the development of genital herpes
using a validated genital herpes scoring system. Vaginal swabs are
also obtained to evaluate the effect against viral replication.
Because this is a non lethal model, animals can be sacrificed at
the conclusion of the experiment to evaluate the effects of
treatment on latency. This model can be adapted to evaluate
anti-viral activity against available drug resistant strains (ACV
and Foscarnet). Dose, route of administration and duration of
treatment are individualized for each experimental agent. Treatment
group size is typically 10-15 animals.
[0869] Guinea Pig Model of Recurrent Genital HSV-2 Infection:
[0870] The guinea pig model of genital herpes is unique in that
after recovery from primary genital infection, animals experience
spontaneous recurrent genital lesions as well as viral shedding in
the absence of lesions. This allows a candidate compound to be
evaluated for efficacy in controlling recurrent disease. Female
Hartley guinea pigs who have recovered from symptomatic primary
genital infection are randomized into treatment groups for
anti-viral treatments beginning on day 21 PI and continued for 21
days after. Treatments can be given orally, topically or
systemically. The indices for these studies include quantification
and severity assessment of recurrent episodes during treatment and
for 21 days following cessation of treatment. Additionally, vaginal
swabs are collected to evaluate any impact on shedding. Dose, route
of administration are individualized for each experimental agent.
Treatment group size is typically 10-15 animals, and duration of
treatment is typically 21 days.
[0871] Model of Neonatal HSV-2 Infection in Guinea Pigs:
[0872] An exemplary model of neonatal HSV infection mimics the
natural history of infection in the human newborn. This model is
available to evaluate candidate anti-viral compounds and combined
therapeutic approaches including combination of anti-virals or
anti-virals and immune modulators. Additionally, this model can be
used to evaluate the efficacy of candidate vaccines by measuring
the protection afforded by transplacental antibody. In this model,
newborn Hartley guinea pigs are inoculated intranasally with HSV-2
within 48 hours of delivery. Newborn animals are then randomized to
receive experimental compound, placebo or ACV (control). A positive
control of ACV (60 mg/kg/day) BID is typically used. Animals are
evaluated daily for evidence of cutaneous herpetic disease and
weight gain as well as pulmonary, CNS symptoms and death. Surviving
animal are followed for 45 days to assess the effectiveness of
therapy on the incidence and frequency of cutaneous herpetic
recurrences. Dose and route of administration are individualized
for each experimental agent. Duration of treatment is typically 10
days or more.
6.7.1.2 Cytomegaloviruses
[0873] Animal Models for Cytomegalovirus Infections:
TABLE-US-00004 Virus Species Route Disease MCMV BALB/c mice i.p.
Disseminated CMV acute, chronic SCID-mice i.p. Disseminated CMV
acute HCMV SCID-hu-Ret i.oc. HCMV replication in Retinal tissue
SCID-hu-thy/liv i.im. HCMV replication in thymus/liver tissue
[0874] Human CMV does not generally infect laboratory animals. For
this reason, it is necessary to use surrogate models, that is, a
similar but different virus in its natural host. While there are
cytomegalovirus strains in a number of animal species, two that
have been studied include the murine and guinea pig CMVs. The
murine model is predictive of efficacy for anti-viral drugs, such
as Foscarnet (PFA), ganciclovir (GCV), and cidofovir (CDV) that
have been evaluated in humans.
[0875] I.p. inoculation of three-week-old BALB/c mice with
approximately 2.0.times.10.sup.5 pfu of MCMV results in an acute,
lethal infection with rapid virus replication in the lung, liver,
spleen, kidney, intestine, salivary gland, and other visceral and
glandular tissue. Animals die on approximately days 5-7. Since this
is a lethal infection, the model can be used for rapid
identification of potential anti-viral compounds. Reduction of the
virus inoculum to 10.sup.4 pfu of MCMV results in a non-lethal,
chronic, generalized infection, which has many similarities to
human CMV infections. At various times after inoculation, virus can
be readily isolated from blood, lung, liver, spleen, kidney, urine,
intestine, and salivary gland. Virus replication persists in these
target organs for 45-60 days and in the salivary gland for months.
The nature of the chronic infection allows for evaluating long term
or maintenance therapy.
[0876] Severe combined immunodeficient (SCID) mice, which lack
functional T and B cells, are extremely sensitive to infection with
MCMV and are utilized as models for CMV infections in an
immunocompromised host. SCID mice that are inoculated with a range
of 1.0-10.sup.5 pfu of MCMV, and are left untreated, eventually die
in a dose dependent manner. Animals that receive 10.sup.5 pfu have
a mean day of death of about 14 days, whereas, those inoculated
with 10 pfu survive an average of 25 days. With each log 10
increase in virus inoculum, survival time is decreased by about
three days. To determine the pathogenesis of MCMV in SCID mice,
mice are inoculated with 10 pfu. On each of various days post
infection, three mice are euthanized, their tissues removed,
homogenized, and assayed for MCMV. Virus is first detected in
salivary gland by day six followed by lung, spleen, kidney,
adrenals, and pancreas on days 9-12. Liver, which is one of the
most permissive organs in normal mice, does not exhibit detectable
virus until day 18. In addition, brain is infected by day 18. These
data indicate that inoculation of SCID mice with low concentrations
of MCMV results in a disseminated infection with viral replication
in the same target organs as observed in immunodeficient humans.
These animals demonstrate high levels of virus in their tissues for
2-3 weeks, thus allowing adequate time to document an anti-viral
response in treated animals compared with placebo animals.
[0877] Human CMV infections can cause a wide range of clinical
manifestations, especially in the immunocompromised host. Few
models exist to study HCMV infection since the virus is
host-specific, and infection and replication are limited to human
cells. In this regard, a model that involves HCMV infection of
fetal human retinal tissue implanted in the eyes of severe combined
immunodeficient (SCID) mice can be utilized. Small fragments of
fetal human retinas are implanted into the anterior chamber, and
four to six weeks after transplantation are inoculated with 2,000
to 10,000 pfu of HCMV. Animals are euthanized and eyes enucleated
at various time points after infection. Eyes are prepared for
microscopy by sectioning fixed tissue, or are homogenized for
detection of infectious HCMV by plaque assay. The model has been
validated using GCV, CDV, and other anti-viral therapies. In
addition, this model can also be utilized to study and identify the
virulence characteristics of HCMV by examining the growth of
various HCMV mutants.
[0878] The SCID-hu thy/liv implant model can also be used in
compound efficacy studies. In this model, small fragments of human
fetal thymus and liver are implanted under the kidney capsule in
the SCID mouse. Approximately 12-16 weeks later, implants that are
fully vascularized and quite large (10-50% the size of the kidney)
are inoculated with 10.sup.3-10.sup.4 pfu of HCMV. At various time
points after infection, implants are biopsied and homogenized, and
HCMV replication is quantified by plaque assay. As with the SCID-hu
mouse ocular model, this model can be useful in determining the
efficacy of various anti-viral therapies.
[0879] Immunocompromised GPCMV Model:
[0880] This guinea pig model mimics CMV infection of the
immunocompromised host, a common target population of
cytomegalovirus infections. Young Hartley guinea pigs are
immunossuppressed with cylcophosphamide administered 1 and 7 days
prior to viral inoculation with .about.10.sup.5 pfu salivary gland
passaged guinea pig cytomegalovirus (GPCMV). In a typical
experiment, two groups of 12 animals each receive the experimental
compound or placebo beginning 24 hours after infection. Animals are
followed daily for evidence of disease and death which usually
occurs by day 14 as described in Bourne et al., Antiviral Research
2000, 47:103-09. Effects on viral replication are measured by
sacrificing animals and quantitating virus in specific organs and
blood by Real-Time PCR and/or culture. The amount of compound is
typically based on an average guinea pig weight of 350-500 g.
[0881] Neonatal GPCMV Model:
[0882] CMV infection of premature newborns can be a
life-threatening disease if untreated. The neonatal guinea pig
model resembles perinatal CMV infection and allows systematic
evaluation of anti-viral compounds in a relatively immature host.
In this model, newborn Hartley guinea pigs are infected with
.about.10.sup.6 pfu of salivary gland derived GPCMV 24-48 hours
after birth. Anti-viral or placebo treatments, administered orally
or by intraperitoneal injection are begun at 0-24 hours after
infection. Infection results in decreased weight gain and mortality
as high as 70% due to dissemination to target organs such as the
liver, spleen and brain by day 10 post-infection (Bravo et al.,
Antiviral Research 2003, 60:41-49). Animals are followed daily for
signs of disease and death. The effects on viral replication are
assessed by sacrificing animals and comparing viral titers in
various target organs and blood by Real-Time PCR and/or culture.
Dosing is typically based on an average newborn guinea pig weight
of 100 g.
[0883] Congenital GPCMV Model:
[0884] CMV is the most common congenital infection. The guinea pig
is a small mammal in which virus crosses the placenta to cause
fetal infection and disease, thus allowing the study of new
anti-virals and unique therapies that can target placental and
congenital infection. In this model, Hartley pregnant guinea pigs
are infected with .about.10.sup.5 pfu GPCMV at approximately 45 to
55 days of a 70 day gestation. Animals can be treated by systemic
or oral routes. Endpoints include prevention of premature delivery,
survival of the offspring and PCR analysis of placenta, and other
maternal tissues (blood, liver and spleen) and pup organs (liver
and spleen) harvested 3, 5 or 10 days post infection (Bravo et al.,
Journal of Infectious Diseases 2006, 193:591-7). The dose is
typically based on a pregnant guinea pig weight of about 1200
g.
[0885] CMV Model of Hearing Loss:
[0886] Hearing loss is the most common manifestation of congenital
CMV infection. Using direct inoculation of GPCMV (.about.10.sup.5
pfu) into the cochlea through the round window, hearing loss can be
induced in guinea pigs as measured by ABR. Animals can then be
treated to prevent the hearing loss. Test compounds can be
administered either systemically, orally and possibly direct
intratympanic administration. Dose is typically based on the weight
of the animals, approximately 350 g.
[0887] Murine CMV Model:
[0888] The murine CMV model is used to study CMV pathogenesis and
to evaluate new anti-CMV compounds. In this model, 5-week old
female mice are infected with 1.times.10.sup.6 pfu of MCMV by
intraperitoneal injection. Treatment can begin before or following
infection and lasts 3-5 days. Animals are sacrificed at 3 to 5 days
after infection and viral titers of the spleen and liver are
determined by plaque assay. Other tissues such as salivary gland
and lungs can be analyzed as well. Ganciclovir (50 mg/kg, twice
daily) serves as a control drug and inhibits MCMV replication in
this model. Dosing depends on the weight of the animals, typically
about 25 g.
6.7.2 In Vivo Assays for Influenza Viruses
[0889] Efficacy:
[0890] The influenza animal model consists of an infection of
laboratory mice with various strains of influenza A (H1N1, H3N2,
H5N1) and B viruses, with the employment of several parameters to
measure disease severity. The parameters which can be used include
the following: (a) monitoring of blood oxygen saturation
(SaO.sub.2) levels in live animals at frequent intervals utilizing
pulse oximetry; (b) measuring of infectious pulmonary virus titers
using in vitro endpoint dilution assay of homogenates of lungs
taken at designated intervals during the infection; (c) assay of
the degree of pulmonary consolidation using lungs taken in as
determined both by score of lung discoloration and by weight of the
lung; (d) death of the animal due to viral pneumonia; (e) mean
survival time of the animals; and (f) selected histopathological
analysis of lung sections. Where appropriate, studies are conducted
to determine the development of viruses resistant to significant
anti-viral drugs.
[0891] Toxocity:
[0892] One or more toxicity determinations are performed on the
test compounds under evaluation. These determinations include: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be investigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as an
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.3 In Vivo Assays for Respiratory Viruses
6.7.3.1 RSV, PIV-3, MV and hMPV
[0893] Respiratory syncytial virus (RSV), parainfluenza virus type
3 (PIV-3), measles virus (MV) and human metapneumovirus (hMPV) are
human pathogens where there is a lack of licensed vaccines for
preventing illnesses caused by RSV, PIV-3, or hMPV, although
efficacious MV vaccines are available. Ribavirin, immune serum
globulins and the humanized monoclonal antibody have been approved
for use against some of these paramyxoviruses. However, all of
these agents have limitations and can be expensive. Thus, the
elucidation and development of new compounds, reagents or vaccines
with activity against these viruses are needed. Potential
anti-virals and vaccines that can be effective against RSV, PIV-3,
MV or hMPV are evaluated in cotton rats. In addition, studies are
performed to characterize, enhance or further develop the different
paramyxovirus-cotton rat models. Evidence obtained in numerous
studies support the usefulness of the different
paramyxovirus-cotton rat models for preclinical evaluation of
potential paramyxovirus anti-virals and vaccines.
6.7.3.2 SARS Virus
[0894] Efficacy:
[0895] The SARS virus animal model utilizes weanling mice infected
intranasally with the virus. A moderate lung infection is
manifested by occasional lung hemorrhaging but primarily by
infectious virus recovered from the lungs Inhibition of development
of virus in the lungs of the mice is used as parameters for
evaluation of test agents.
[0896] Toxicity:
[0897] One or more toxicity determinations are performed on the
test compounds under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be investigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.4 In Vivo Assays for Orthopoxviruses
6.7.4.1 Vaccinia and Cowpox Viruses (Smallpox Assay)
[0898] The smallpox animal model is an intranasal infection of
laboratory mice by the cowpox and vaccinia viruses, which induce an
infection of the nose and lungs resulting in a smallpox-like
toxemia-associated death. Parameters used in evaluating test
compounds in this model include: (a) death of the animal; (b) mean
survival time of the animals; (c) lung and nose virus titers; and
(d) host weight loss. Other parameters can include: (a) monitoring
SaO.sub.2 levels; (b) assay of degree of pulmonary consolidation
both by lung score and lung weight increase; and (c)
histopathological analysis of lungs and other organs.
[0899] Also utilized is a cutaneous infection in immunocompromised
hairless mice that can be induced by vaccinia virus. This infection
is progressive and leads to the death of the mice. It is now also
being used in selected anti-viral experiments. Parameters used in
evaluating test agents in this cutaneous infection model include:
(a) death of the animal; (b) severity score in initially induced
lesions; (c) size of initially induced lesions; (d) number of
spontaneous "satellite" lesions; and (e) virus titer in various
organs in the animal.
[0900] Animal Models for Vaccinia and Cowpox Virus Infections:
TABLE-US-00005 Virus Species Route Disease Cowpox Virus BALB/c Mice
i.p. Death--Rapid (BR) Liver--Visceral Involvement BALB/c Mice i.n.
Death--Slower Lung--respiratory involvement Vaccinia Virus SKH-1
mice i.d. Skin lesions (WR) SCID Mice i.p. Disseminated disease
BALB/c Mice i.n. Death Disseminated Disease Vaccinia Virus BALB/c
Mice i.n. Death (IHD) Disseminated Disease Vaccinia Virus SCID Mice
i.p. Death (WR) Disseminated Disease Vaccinia Virus SCID Mice i.p.
Death (NYC)
[0901] The causative agent of smallpox, variola virus, cannot be
utilized outside a BSL-4 containment area and does not cause
disease in adult mice. Various orthopoxviruses can be utilized as
surrogate viruses for smallpox including VV and CV. They can be
inoculated i.p. or i.n. into SCID mice with an endpoint of death.
In normal mice, CV, VV-WR, or VV-IHD, but not VV-Copenhagen Strain,
will produce mortality when inoculated by variety of routes.
Intranasal inoculation of mice with CV produced an infection with
features similar to systemic or disseminated smallpox. Other routes
of inoculation such as i.p. or i.v. with VV or CV result in less
bronchial involvement and more skin lesions. The IHD strain of VV
is less virulent in BALB/c mice than the WR strain. The WR strain
of VV produces mortality in BALB/c mice by i.n. inoculation and
SCID mice by i.p. inoculation. SKH-1 hairless mice can also be
inoculated with VV and CV by inoculation of abraded orofacial
areas, similar to the HSV techniques. Mice can be treated
systemically or topically with anti-viral compounds for evaluation
of efficacy against disease (lesion scores) or viral replication
(viral titers).
6.7.4.2 Ectromelia (Mousepox Assay)
[0902] Ectromelia virus is the causative agent of mousepox, an
acute exanthematous disease of mouse colonies in Europe, Japan,
China, and the USA. Laboratory studies have shown ECTV to have a
very narrow host range, infecting only certain mouse species. A
number of different strains of ECTV have been isolated which have
been shown to differ in their virulence for the mouse. The Moscow,
Hampstead, and NIH79 strains have been studied, with the Moscow
strain being one of the most infectious and virulent for the mouse.
Studies in the last five decades have resulted in a detailed
description of the virologic and pathologic disease course in
genetically susceptible (A, BALB/c, DBA/2, and C3H/He; death
.about.7 days post-infection) and resistant (C57BL/6 and AKR)
inbred and out-bred mice; identification and characterization of
the important cell-mediated and innate responses for recovery from
infection; and the discovery of rmp-1, rmp-2, rmp-3 and rmp-4 loci
which govern resistance to severe mousepox. Varying mouse genotype,
virus strain, and dose of virus result in distinct disease patterns
for a given route of infection.
[0903] Mousepox differs from smallpox in at least two features
following a respiratory tract infection. First, the disease course
in mousepox is shorter as compared to smallpox. The eclipse period
in mousepox and smallpox are 6 and 10 days, respectively. Fatal
cases of mousepox usually occur 7 to 14 days post-infection (p.i.),
whereas deaths in ordinary smallpox occur from .about.18 to 22 days
p.i. Second, the major lesions in mousepox are observed in the
liver and spleen, whereas these organs are relatively uninvolved in
smallpox. A feature of mousepox that is similar to smallpox is the
relatively small dose of virus that is required to initiate disease
in the upper and lower respiratory tract. Another similarity is the
detection of virus in respiratory gases during the preexanthem
period. Additionally, both diseases present with a characteristic
exanthematous rash. In the case of mousepox, the development of
rash is dependent on a number of parameters including mouse strain,
virus strain, route of inoculation and virus dose.
[0904] Efficacy:
[0905] An important use of the mousepox model is the evaluation of
orthopoxvirus compounds and vaccines. The ECTV aerosol model
provides a broad dynamic range for evaluating compounds. An aerosol
lethal dose of 100 PFU can be used, which is .about.3-fold greater
that the LD.sub.50 value of 32 PFU, and is likely in the range of
the infectious dose for aerosolized smallpox. Alternatively, a dose
1000 to 10,000 times the LD.sub.50 can be used to fully examine the
robustness of the test compound.
6.7.4.3 Monkeypox Virus (MPXV)
[0906] Animal assays for monkeypox virus (MPXV) can be performed by
following the procedures described in, e.g., Americo et al.,
Journal of Virology, 2010, 84(16): 8172-8180. Generally, the assay
is based on an intranasal or intraperitonial infection of CAST/EiJ
mice with MPXV, for example, an isolate of Congo Basin Glade of
MPXV or West African Glade of MPXV. Upon infection, the animals
exhibit loss of weight, morbidity and death in a dose dependent
manner. In addition, MPX replication is observed in the lung,
spleen and liver of the tested animals.
[0907] Consequently, anti-viral efficacy of the test compounds can
be assessed by following the criteria such as weight loss,
morbidity and death in the presence and absence of the test
compounds upon infection with MPXV. Further, replication in organs
such as lung, spleen and liver of the animals in the presence and
absence of the test compounds upon infection can also be examined
to assess the anti-viral efficacy.
6.7.4.4 Rabbitpox Virus (RPV)
[0908] Animal assays for rabbitpox virus (RPV) can be performed by
following the procedures described in, e.g., Rice et al., Viruses,
2011, 3:63-82, and Adams et al., J. Virol., 2007, 81:11084-11095.
Generally, the model is based on bilateral, intrademal infection of
New Zealand White rabbits with 100-1000 pfu of RPV. Upon infection,
the animals exhibit weight loss, elevated body temperature (fever),
severe respiratory distress, swelling of primary and secondary
lesions, eye and nasal discharge and inoculation site necrosis. In
addition, viral replication is observed in the respiratory tract.
If untreated, the animals are eventually subjected to death
(euthanasia) according to euthanasia guidelines.
[0909] Consequently, anti-viral efficacy of the test compounds can
be assessed by following the criteria described above, including
length of survival upon injection and viral replication. In
addition, an overall clinical score can be examined to assess the
anti-viral efficacy.
[0910] Alternatively, animal assays can be based on the procedures
described, e.g., in Roy et al., Viruses, 2010, 2:2096-2107, in
which similar clinical criteria are examined following an infection
through aerosol containing RPV. In this model, experimental
infection with RPV initiates with exposure to aerosols with a
particle size distribution that is preferential for penetration to
the tracheobronchial and pulmonary regions of the lung, with
emphasis on the lower respiratory tract.
6.7.5 In Vivo Assays for Papillomaviruses
6.7.5.1 Cottontail Rabbit Papillomavirus (CRPV) Model
[0911] The procedures substantially similar to those described, for
example, in Christensen, Antiviral Chemistry & Chemotherapy,
2005, 16:283-294 are followed in connection with cottontail rabbit
papillomavirus (CRPV) model. In short, topical formulations of the
test compound are tested at three doses in groups of 5 rabbits at 4
sites per rabbit. One additional rabbit group includes a placebo
treatment. Alternative deliveries include interalesional and
systemic treatments depending on the nature of the compound to be
tested (e.g., anti-viral, immunomodulator).
[0912] Adult New Zealand White rabbits can be purchased from, for
example, CoVance, Inc. Rabits are of both genders. Rabbits are
quarantined and cleared (14 days). Each rabbit is inoculated with
10.sup.-2 wtCRPV (4 sites: 2 on the left side of the back (L1 and
L2) and 2 on the right side of the back (R1 and R2)) CRPV stock.
Combinations of L1, R1, L2 and R2 sites receive treatments.
Exemplary treatment schemes are provided below. [0913] Group A: all
4 sites=placebo ointment; [0914] Group B: L1 and L2=GS327422
(0.1%); R1 and R2=GS327422 (0.03%) Treatments are once/week
(Monday) for 8 weeks; [0915] Group C: L1 and L2=GS327422 (0.1%); R1
and R2=GS327422 (0.03%) Treatments are three times/week (MWF) for 8
weeks; and [0916] Group D: L1 and L2=GS327422 (0.1%); R1 and
R2=GS327422 (0.03%) Treatments are five times/week (MTWTF) for 8
weeks.
[0917] The experiment contains 20 rabbits. Most experiments include
4-5 groups of rabbits (Groups A-E). A placebo group serves as
controls to assess local effects of treatment in treated Groups B
to D. Vehicle consists of placebo. Groups B-D represents test
compound comparisons vs placebo negative control. Doses of
compounds are chosen based on various criteria including the past
experience. Treatments (topical) begin at a time when the
papillomas are visible but not greater than a GMD of 5.0 mm. This
time point allows effects on visible papillomas to be assessed, and
is a clinically relevant situation. Treatment is once weekly (Group
B), 3 times weekly (group C--MWF), and 5 times weekly (MTWTF), for
eight weeks with a dose of 0.1 ml per site. Alternatively,
treatments can begin 14 days after infection at a time when there
are no visible papillomas to maximize the effectiveness of the
treatments. Body weights are taken weekly, and sera collected at
the end of the treatment period for blood chemistries as needed.
Papillomas are measured weekly in 3 axes
(length.times.width.times.height) in mm. Data are entered into a
spread sheet and calculations conducted of the geometric mean
diameter of each papilloma, mean.+-.SEM for each group, t-test
between each paired groups and plots made of papilloma size vs
time. Plots of weight changes are also conducted. At termination,
kidney and liver samples are retrieved for histology and toxicity
assessment. Skin/papilloma sites are monitored photographically and
biopsies assessed for histology at experiment/treatment
termination. Serum samples can be collected to conduct blood
chemistries to assess any toxicities of the compound under
treatment.
6.7.5.2 Mouse Xenograft Model
[0918] Subcutanoues and cutaneous mouse xenograft models are
schematically described in FIGS. 1 and 2.
6.7.6 In Vivo Assays for Other Viruses
6.7.6.1 Punta Toro Virus
[0919] Efficacy:
[0920] The Punta Toro virus infection is achieved in C57BL/6 mice
and in Syrian golden hamsters, with a generalized disease
resembling that induced by Rift Valley fever. Parameters used for
anti-viral testing include: (a) death of the animal; (b) hepatic
icterus, seen as yellowed liver; (c) elevated ALT levels in serum;
(d) virus titers in liver and serum; and (e) host weight loss.
[0921] Toxicity:
[0922] One or more toxicity determinations are performed on the
test compounds under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be ivnestigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.6.2 Pichinde Virus
[0923] Efficacy:
[0924] The Pichinde virus model utilizes Syrian golden hamsters.
Parameters used for anti-viral testing include: (a) death of the
animal; (b) virus titers in brain, liver, spleen and serum; and (c)
elevated ALT levels in serum.
[0925] Toxicity:
[0926] One or more toxicity determinations are performed on the
test substances under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can
[0927] also be investigated: (a) increase in circulating serum
levels of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.6.3 VEE Virus
[0928] Efficacy:
[0929] The VEE virus animal model utilizes the TC-83 vaccine strain
of virus administered intranasally to C3H/Hen mice; the virus
progresses to the central nervous system causing high virus titers
in the brain and death of the animal. The Semliki Forest virus
model is very similar to that for the Banzi virus, with the same
disease parameters. The Semliki Forest virus is a BSL-3-rated
pathogen which requires special handling. Parameters for evaluation
include: (a) death of the animal; (b) prolongation in mean day to
death; (c) virus titers in the brains; and (d) host weight
loss.
[0930] Toxicity:
[0931] One or more toxicity determinations are performed on the
test substances under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be ivnestigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.6.4 West Nile Virus
[0932] Efficacy:
[0933] The West Nile virus animal model currently utilizes both
mice and hamsters. In each, neurological signs are produced,
leading to eventual death of the animals. This virus is a
BSL-3-rated pathogen which is recovered from various tissues. Other
parameters such as functional abilities are also reviewed. Disease
parameters used for anti-viral evaluation include: (a) death of the
animal; (b) prolongation on mean day to death; (c) virus titers in
brain and other tissues; and (d) host weight loss.
[0934] Toxicity:
[0935] One or more toxicity determinations are performed on the
test substances under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be ivnestigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.6.5 Dengue Virus
[0936] In vivo assays for DENV can be conducted using procedures
substantially similar to those described, for example, in Guabiraba
et al., PLoS ONE, 2010, 5(12):e15680 and Souza et al., Proc. Natl.
Acad. Sci., 2009, 106(33):14138-14143. DENV virus stock solutions
are diluted in endotoxin-free PBS or DPBS to appropriate
concentrations. The virus is injected i.p. into mice. Test
compounds are given via appropriate routes at appropriate dosing
frequency (e.g., twice a day oral administration). Lethality rates
are evaluated every 12 hours and other parameters (body weight
loss, inflammation, etc.) are checked as appropriate. For tests
using knock-out mice, the control typically includes the same test
on the wild-type mice. Negative control usually involves the
administration of vehicle instead of test compound.
[0937] In the case of evaluation of vaccines for DENV virus, assays
can be conducted using procedures similar to those described, for
example, in Johnson et al., Journal of Virology, 1999,
73(1):783-786. The assay uses IFN deficient mice (e.g., A129 mice,
which lack alpha/bea IFN and gamma IFN receptor genes) and involves
intraperitoneal administration of DENV into such mice. Typically,
IFN deficient mice are universally lethal upon administration of
DENV regardless of age. Based on this, criteria such as changes in
survival time and rate can be monitored in IFN deficient mice
immunized with test vaccine to assess the efficacy of a test
vaccine in vivo.
6.7.7 In Vivo Assays for Prion Diseases
[0938] Efficacy:
[0939] The prion transgenic mouse model utilizes knockout mice for
endogenous mouse PrP-sen. These mice express high levels of hamster
PrP-sen in a wide range of tissues, including the brain. The
animals infected with hamster scrapie agent replace the Syrian
hamster model. The latter animals require approximately 120 days to
die of the scrapie infection, whereas the prion transgenic mice die
in approximately 82 days when infected with the same agent. Death
is used as the parameter for anti-prion evaluation.
[0940] Toxicity:
[0941] One or more toxicity determinations are performed on the
test substances under evaluation. These determinations are: (a)
lethality; and (b) host weight loss or failure to gain weight. As
needed and where applicable, the following additional parameters
can also be ivnestigated: (a) increase in circulating serum levels
of glutamic oxalic acid transaminase (SGOT) and pyruvic acid
transaminase (SGPT) in the serum as markers for possible liver
damage; (b) increase in circulating creatinine (CT) level as
indicator of possible renal impairment; and (c) increase in
circulating creatinine phosphokinase (CK) levels as indicator of
general tissue damage.
6.7.8 Other Follow-Up Tests
[0942] Follow-up determinations of promising anti-virals seen in
the original animal studies can include effect of the administered
test compounds on key immunologic components in infected and in
uninfected (toxicity control) mice. The immunologic effects studied
include: (a) cytotoxic T lymphocyte activity; (b) natural killer
cell activity; (c) total T, T-helper, T-suppressor/cytotoxic and B
cell enymeration; (d) response to the T-cell mitogen
phytohemagglutinin (PHA); (e) production of interferon; and (f)
production of neutralizing antibody. Where appropriate, studies are
conducted to determine the development of viruses resistant to
significant anti-viral drugs.
7. Assays for ELOVL
[0943] ELOVL assays can be conducted in vitro using procedures
substantially similar to those described in, for example, Shimamura
et al., European Journal of Pharmacology, 2010, 630: 34-41.
7.1 In vitro Assays
7.1.1 Elongation Enzyme Assay
[0944] Elongation is carried out using 30 .mu.l of substrate
reaction mixture containing 100 mM potassium phosphate buffer (pH
6.5), 200 .mu.M BSA (fatty acid free), 500 .mu.M NADPH, rotenone,
20 .mu.M malonyl-CoA, 833 kBq/ml [.sup.14C]malonyl-CoA (GH
Healthcare Science, Little Chalfont, UK) and acyl-CoA. The
following long chain acyl-CoAs are used as a preferential substrate
for each ELOVL: ELOVL1, 10 .mu.M stearoyl-CoA; ELOVL2, 10 .mu.M
arachidonoyl-CoA; ELOVL3, 10 .mu.M stearoyl-CoA; ELOVL5, 40 .mu.M
arachidonoyl-CoA; and ELOVL6, 40 .mu.M palmitoyl-CoA. To start the
reaction, 20 .mu.l of the ELOVL microsomal fraction is added to the
substrate mixture, and then incubated for 1 hour at 37.degree. C.
with gentle shaking in a 96-well plate. After 1 h incubation, 100
.mu.l of 5 M HCl is added to hydrolyze acyl-CoA, and then the
reaction mixture is filtered through a Unifilter-96, GF/C plate
(PerkinElmer, Waltham, Mass.) using a FilterMate cell harvester
(PerkinElmer, Waltham, Mass.). The 96-well GF/C filter plate is
subsequently washed with distilled water to remove excess
[.sup.14C] malonyl-CoA and dried, after which 25 .mu.l of
MICROSCINT 0 is added to each well and radioactivity
determined.
7.1.2 Fatty Add Elongation Assay in Mouse Hepatocytes
[0945] Mouse hepatoma H2.35 cells are grown on 24-well plates in
Dulbecco's modified Eagles medium (DMEM) (invitrogen, Carlsbad,
Calif.) supplemented with 200 nM dexamethason and 4%
heat-inactivated feta bovine serum (FBS) at 33.degree. C. under 5%
CO.sub.2 in a humidified. incubator. The test compound is dissolved
in medium and incubated with subconfluent H2.35 cells for 1 hour at
33.degree. C. [1-.sup.14C]palmitic acid (PerkinElmer Japan,
Kanagawa, Japan) is added to each well to a final concentration of
0.8 .mu.Ci/ml to detect elongase activity. After 4 hours of
incubation at 33.degree. C., the culture medium is removed, and the
labeled cells are washed with chilled PBS (3.times.0.5 Ml) and
dissolved in 250 .mu.A of 2M sodium hydroxide. The cell lysate is
incubated at 70.degree. C. for 1 hour to hydrolyze radiolabeled
cellular lipids. After acidification with 100 .mu.l of 5M HCl,
fatty acids are extracted with 300 .mu.l of acetonitrile.
Radiolabeled palmitic acid (16:0), palmitoleic acid (16:1), stearic
acid (18:0), and vaccenic acid:oleic acid (18:1) are quantified by
reversed-phase radio-HPLC(RI-HPLC). The identity of the labeled
fatty acids is determined by comparing the retention times with
known fatty acid standards. Elongation activity was monitored as
the elongation index (EI) which was the ratio of radiolabeled C18
(C18:0+C18:1) to C16 (C16:0+C16:1) estimated from each peak area
measured by RI-HPLC.
7.2 In Vivo Assays
7.2.1 [.sup.14C]Palmitate Assay in Mouse Liver
[0946] The in vivo efficacy of ELOVL6 inhibitor is determined by
following the conversion of radiolabeled 16:0 to 16:1, 18:0, and
18:1 in mice. Male C57BL/6J mice are orally administrated with
ELOVL6 inhibitor and 1 hour later, the radioactive tracer,
[1-.sup.14C]palmitic acid, is interperitoneally administered at 10
.mu.Ci/body. For time-course study of the pharmacodynamic effect,
[1-.sup.14C]palmitic acid is administered 1, 8 or 12 hours after
administration of test compounds. At 1 hour post-dosing of the
radioactive precursor, animals are anesthetized with isoflurane
(4%) and sacrificed for blood collection from the vena cava. Liver
(50 mg) is harvested and incubated in potassium hydroxide/ethanol
(2 ml/1.4 ml) at 70.degree. C. for 1 hour. The nonacid-lipid is
extracted by 4 ml of petroleum ether and discarded. Fatty acids are
extracted by 2 ml of petroleum ether following saponification by 2
ml of 6 M HCl. The ether phase containing the fatty acid fraction
is evaporated under nitrogen gas and reconstituted in methanol to
measure the radioactivity by RI-HPLC. The radioactivity
corresponding to each fatty acid is quantified to calculate the
EI.
7.2.2 In Vivo Efficacy in Diet-Induced Obesity (DIO) Mice
[0947] Male C57BL/6J mice are maintained on a high-fat diet with ad
libitum access to water (D12492, Research Diets, Inc., NJ) for 7
months. Mice are orally administered ELOVL6 inhibitor (dissolved in
0.5% methylcellulose) twice daily (09:30 and 18:30) for 14 days at
30 mg/kg dose. At day 13, body composition is determined and an
intraperitoneal glucose tolerance test (0.5 kg/g glucose) is
performed. At day 14, mice are sacrificed. At 4 hour post-final
dosing of ELOVL6 inhibitor, mice are anesthetized and the liver
tissues are immediately isolated, weighed, frozen in liquid
nitrogen and stored at -80.degree. C. until use. Plasma is prepared
and glucose, insulin and leptin are measured using commercially
available assay kits (Glucose, KyowaMedex, Tokyo, Japan; leptin and
insulin, Morinaga, Tokyo, Japan). Liver tissues are isolated for
the measurement of triglyceride contents and fatty acid
composition. For hepatic triglyceride contents, isolated tissues
are homogenized in 2 ml distilled water, followed by the addition
of 6 ml chloroform/methanol (2:1). After centrifugation, the
chloroform phase is transferred to a new glass tube containing 1 ml
of distilled water and then 3 ml chloroform is added. The lower
phase is collected after centrifugation and evaporated to dryness.
Extracts are dissolved in 2-propanol and the triglyceride
concentration is measured enzymatically (Determiner TGII, Kyowa
Medex. Tokyo Japan). For hepatic fatty acid composition, the liver
samples are incubated in 100-fold volume (w/v) of 5 M NaOH/ethanol
(1:1) at 60.degree. C.
[0948] After 2 hour incubation, 500 .mu.l of 5 MC17:0 (internal
standard) are added to all hydrolysates. The fatty acid
compositions are analyzed as following. The fatty acids in the
tissue hydrolysate are derivatized with 2-nitrophenylhydrazine
(2-NPH), and these derivatives are purified using an Oasis HLB
column. An aliquot (10 .mu.l) of the eluate is injected into the
HPLC apparatus for analysis. HPLC analysis is performed with a
Shimazu 10Avp system (Kyoto, Japan), equipped with a UV detector
(SPD-10Avp). two pumps (LC-10ADvp), an auto-sampler (SIL-10ADvp),
and a column oven (CTO-10ACvp). The mobile phase consist of
CH.sub.3CN-water (80:20, flow rate: 0.6 ml/min). The separation is
performed with a CAPCELL PAK C18 MGII (2.0 mm i.d..times.150 mm, 5
.mu.m) at 35.degree. C. and the UV absorbance is subsequently
measured at 400 nm. The elongation index represents the ratio of
C18 (C18:0+C18:1) to C16 (C16:0+C16:1) which is quantified from
each fatty acid amount.
7.2.3 In Vivo Efficacy in KKAy Mice
[0949] Male KKAy mice given a regular diet (CE2, CLEA Japan) are
orally administered ELOVL6 inhibitor (dissolved in 0.5%
methylcellulose) twice daily (09:30, 18:30) for 28 days at 30 mg/kg
dose. At day 21, an intraperitoneal glucose tolerance test (0.5
kg/g glucose) is performed. At day 28, body composition is
determined and mice are sacrificed. Plasma parameters, hepatic
triglyceride contents, and fattyacid composition are measured as
described above.
7.2.4 Pharmacokinetic Studies in Mice
[0950] Single doses of test compound at 10 mg/kg body weight are
administered orally to C57BL/6J mice by gavage in a vehicle of 0.5%
methylcellulose aqueous suspension. Blood samples from the
abdominal vein and liver samples are obtained 2 hours after
administration. In the case of an in diet regimen, mice are dosed
with 100 mg/kg at 17:00 and fed a diet containing 0.13% test
compound overnight. Then mice are sacrificed the next morning.
Blood samples are centrifuged to separate the plasma. Liver samples
are homogenized with phosphate-buffered saline (pH 7.4). Each
sample is deproteinized with ethanol containing an internal
standard. Test compound and the internal standard are detected by
liquid chromatography mass spectrometry/mass spectrometry (Quattro
Ultima mass spectrometer, Waters, Milford, Mass.) in positive
ionization mode using an electrospray ionization probe, and their
precursor to production combinations are monitored using the
Multiple Reaction Monitoring mode.
Exemplification
[0951] The disclosed compounds can be prepared in a number of ways
well known to one skilled in the art of organic synthesis. More
specifically, disclosed compounds can be prepared using the
reactions and techniques described herein. In the description of
the synthetic methods described below, it is to be understood that
all proposed reaction conditions, including choice of solvent,
reaction atmosphere, reaction temperature, duration of the
experiment and workup procedures, can be chosen to be the
conditions standard for that reaction, unless otherwise indicated.
It is understood by one skilled in the art of organic synthesis
that the functionality present on various portions of the molecule
should be compatible with the reagents and reactions proposed.
Substituents not compatible with the reaction conditions will be
apparent to one skilled in the art, and alternate methods are
therefore indicated. The starting materials for the examples are
either commercially available or are readily prepared by standard
methods from known materials.
General Synthetic Methods
(i) Synthesis of Triazole Intermediate
##STR00061##
[0953] The triazoles (A) were either commercially available or
prepared as described in the literature (see Barluenga et al.,
Angew. Chem. Int. Ed. (2006) 45:6893-6896 and Fringuelli et al.,
Eur. J. Org. Chem. (2008) 3928-3932).
[0954] Step S-1:
[0955] To a solution of amine (B) (1.3 equiv) in dry
dichloromethane (0.5 M) under argon is added triethylamine (1.3
equiv) followed by triphosgene (0.7 equiv). The resulting
heterogeneous mixture is stirred at room temperature for 15 minutes
and then concentrated in vacuo. The residue is taken up in dry
toluene (0.5 M), treated with DMAP (1.0 equiv) and the triazole (A)
(1.0 equiv), and heated to reflux for 1 hour or until the reaction
is determined to be complete by LCMS or TLC. The reaction mixture
is cooled to room temperature, diluted with AcOEt and brine, and
the layers are separated. The organic layer is washed with brine,
10% HCl and brine, dried over MgSO.sub.4, filtered and concentrated
in vacuo. The residue is purified by flash chromatography on silica
gel (Hexanes/Ethyl acetate) or by preparative HPLC (0.1% formic
acid in acetonitrile/water) to provide the triazole intermediate
(C).
(ii) Synthesis of the Aniline Reagent ("B", HNR.sup.BR.sup.C)
##STR00062##
[0957] Step S-2:
[0958] Copper iodide (1 equiv) and cesium carbonate (2.0 equiv) are
added to a microwave vial and the vial is evacuated and filled with
argon three times. An aryl iodide (D-1) in dry dimethylformamide
(0.6 M), an alkyl amine (R.sup.CNH.sub.2) (2.0 equiv) and
2-isobutyrylcyclohexanone (0.2 equiv) are then added to the vial,
the vial is sealed and the resulting mixture is heated to
100.degree. C. under microwave irradiation for 2 hours, or until
the reaction is determined complete by LCMS or TLC. At that time,
the vial is cooled to room temperature and the reaction mixture is
diluted with ethyl acetate and filtered through a pad of Celite
with aid of ethyl acetate. The filtrate is washed with brine
(3.times.), dried over MgSO.sub.4, filtered and concentrated in
vacuo. The residue is purified by flash chromatography on silica
gel (ethyl acetate/hexanes as elutant) to provide theamine
intermediate (E).
[0959] Step S-3:
[0960] To a mixture of nitro compound (D-2) (1.0 equiv) and iron
(15.0 equiv) in 1:1 absolute ethanol/dry tetrahydrofuran solution
(0.8 mL/mmol of ester) is added water (10 uL/ml of solvent). The
mixture is then cooled to 0.degree. C. and a solution of
concentrated sulfuric acid (4.0 equiv) in water (1.2 ml/mmol of
ester) is added dropwise to the mixture. The reaction is warmed to
room temperature and stirred for 1 hour, or until the reaction is
determined complete by LCMS or TLC. The reaction is then filtered
through a pad of Celite with aid of ethyl acetate, and the filtrate
is diluted with brine, saturated aqueous sodium bicarbonate
solution and additional ethyl acetate. The organic and aqueous
layers are separated, and the organic layer is washed with
saturated sodium bicarbonate solution, brine, dried over
MgSO.sub.4, filtered and concentrated in vacuo. The residue is
purified by flash chromatography on silica gel (ethyl
acetate/hexanes as elutant) to provide (D-3).
[0961] Step S-4:
[0962] To a stirred solution of (D-3) (1.0 equiv) in acetic acid
(0.2 M) is added a carbonyl compound (10.0 equiv of a ketone or
aldehyde) and sodium borohydride (10.0 equiv) and the resulting
mixture is stirred at room temperature for 1 hour, or until the
reaction is determined complete by LCMS or TLC. The reaction is
then diluted with ethyl acetate, and washed with saturated aqueous
sodium bicarbonate solution (5.times.) and brine (2.times.), and
the organic layer is dried over MgSO.sub.4, filtered and
concentrated in vacuo. The residue is purified by flash
chromatography on silica gel (ethyl acetate/hexanes) to provide
theamine intermediate (E).
(iv) Scope of the General Synthetic Method
[0963] The general synthetic method is not intended to be limited
to the coupling of amine intermediates such as (E) with triazole
intermediates such as (C) in the formation of compounds provided
herein. For example, other amines and triazoles have been
synthesized using the general methods described above to provide a
wide variety of intermediate compounds for coupling to afford
compounds of formula (I).
Exemplary Syntheses of Compounds
(i) Synthesis of Triazole Compounds 6 and 7
##STR00063##
[0965] Compound 2:
[0966] 4-(2,6-difluorophenyl)-1H-1,2,3-triazole-5-carbonitrile (2)
was prepared in one step from 2,6-difluorobenzaldehyde (1) and
nitroacetonitrile using a modified literature procedure (see
Fringuelli et al. Eur. J. Org. Chem. (2008) 3928-3932). A solution
of 2,6-difluorobenzaldehyde (1.0 equiv), nitroacetonitrile (1.5
equiv) and TMS-azide (3.0 equiv) in dry THF (0.4 M) under inert
atmosphere and at 0.degree. C. was treated with fluoride-bound
resin (Aldrich #387789, 1:1 w/w with respect to aldehyde). The
resulting mixture was heated to reflux for 2 h (reaction completed
according to TLC), cooled to room temperature and concentrated in
vacuo to provide (2) as an orange solid which was used directly in
the next reaction.
[0967] Compound 5:
[0968] To a solution of 3-iodobenzoic acid (1.0 equiv) in dry DMF
(0.5 M) under argon was added solid potassium carbonate (1.5 equiv)
followed by benzyl bromide (1.1 equiv). The resulting mixture was
stirred at rt for 4 h, acidified with 10% HCl, diluted with brine
and ethyl acetate, and the layers were separated. The organic layer
was washed with brine (5.times.), dried (MgSO.sub.4), filtered and
concentrated in vacuo to afford a solid, benzyl 3-iodobenzoate (4),
which was used without further purification.
[0969] Copper iodide (1.0 equiv) and cesium carbonate (2.0 equiv)
were added to a microwave vial and the vial was evacuated and
filled with argon three times. Benzyl 3-iodobenzoate (4) in dry
dimethylformamide (2 M), isopropylamine (2.0 equiv) and
2-isobutyrylcyclohexanone (0.2 equiv) were then added to the vial,
the vial was sealed and the resulting mixture is heated to
100.degree. C. under microwave irradiation for 2 hours. At that
time, the vial was cooled to room temperature and the reaction
mixture was diluted with ethyl acetate and filtered through a pad
of Celite with aid of ethyl acetate. The filtrate was washed with
brine (3 x), dried over MgSO.sub.4, filtered and concentrated in
vacuo. The residue was purified by flash chromatography on silica
gel (ethyl acetate/hexanes as elutant) to provide benzyl
3-(isopropylamino)benzoate (5).
[0970] Compound 6:
[0971] To a solution of benzyl 3-(isopropylamino)benzoate (5) in
dry dichloromethane (0.4 M) under Ar at 0.degree. C. was added
triethylamine (1.5 equiv) followed by triphosgene (1.5 equiv). The
resulting mixture was stirred at rt for 15 min and was concentrated
in vacuo. The residue was suspended in dry toluene (0.4 M), DMAP
(1.0 equiv) and
4-(2,6-difluorophenyl)-1H-1,2,3-triazole-5-carbonitrile (2) (1.0
equiv) were added and the resulting suspension was heated to reflux
for 1 h, then cooled to rt, diluted with AcOEt and washed with
water, 10% HCl and brine. The organic layer was dried (MgSO.sub.4),
filtered and concentrated in vacuo. The residue was purified by
flash chromatrography (Hexanes/AcOEt as eluant). Benzyl
3-(5-cyano-4-(2,6-difluorophenyl)-N-isopropyl-1H-1,2,3-triazole-1-carboxa-
mido)benzoate (6) was obtained as a pale yellow foam.
[0972] Compound 7:
[0973] To a solution of benzyl ester (6) (1.0 equiv) in methanol
(0.1 M) under argon was added 5% Pd/C (0.1 equiv) and the inert
atmosphere was replaced with hydrogen. The resulting mixture was
stirred at rt for 30 min, filtered through a pad of Celite with aid
of methanol and the resulting filtrate concentrated in vacuo. The
residue was purified by preparative HPLC (0.1% formic acid in
acetonitrile/water) to afford
3-(5-cyano-4-(2,6-difluorophenyl)-N-isopropyl-1H-1,2,3-triazole-1-carboxa-
mido)benzoic acid (7) as a lyophilized powder.
(ii) Synthesis of Triazole Compounds 9 and 11
##STR00064##
[0975] Compound 9:
[0976] A solution of 2-phenoxybenzaldehyde (8) (1.0 equiv),
ethyl-2-nitroacetate (2.0 equiv) and TMS-azide (3.0 equiv) in dry
THF (0.4 M) under inert atmosphere and at 0.degree. C. was treated
with fluoride-bound resin (Aldrich #387789, 1:1 w/w with respect to
aldehyde). The resulting mixture was heated to reflux for 24 hours,
cooled to room temperature and concentrated in vacuo. The residue
was purified by flash chromatography (hexane/ethyl acetate) to
provide ethyl 4-(2-phenoxyphenyl)-1H-1,2,3-triazole-5-carboxylate
(9) as a yellow foam.
[0977] Compound 11:
[0978] To a solution of decahydroquinoline (10) (1.5 equiv) in dry
dichloromethane (0.5 M) under argon was added triethylamine (1.5
equiv) followed by triphosgene (1.5 equiv). The resulting
heterogeneous mixture was stirred at room temperature for 15
minutes, concentrated in vacuo. The residue was taken up in dry
toluene (0.25 M with respect to amine), treated with
dimethylaminopyridine (DMAP) (1.0 equiv) and triazole (9) (1.0
equiv). The resulting mixture was heated to reflux for 1.5 hours,
cooled to room temperature and diluted with ethyl acetate and
brine, and the aqueous and organic layers were separated. The
organic layer was washed with brine, 10% aqueous HCl, then brine,
and dried over MgSO.sub.4, filtered and concentrated in vacuo. The
residue was purified by flash chromatography on silica gel (ethyl
acetate/hexanes) to provide ethyl
1-(decahydroquinoline-1-carbonyl)-4-(2-phenoxyphenyl)-1H-1,2,3-tria-
zole-5-carboxylate (11) as a colorless oil.
(iii) Synthesis of Triazole Compounds 13 and 14
##STR00065##
[0979] Compound 13:
[0980] A solution of ester (9) (1.0 equiv) in 2.5:1 THF/MeOH (0.5
M) was treated with a solution of lithium hydroxide (3.0 equiv) in
water (1.6 M), and the resulting mixture was stirred at 50.degree.
C. overnight, cooled to room temperature, acidified with 1M HCl,
diluted with brine and extracted with AcOEt (3.times.). The
combined organic extracts were washed with brine, dried
(MgSO.sub.4), filtered and concentrated under reduced pressure. The
pale yellow foam obtained was dissolved in dry DMF (0.4 M) and
treated with (-)-isopinocampheyl amine (12) (1.0 equiv), followed
by triethylamine (1.0 equiv) and HBTU (1.0 equiv). The resulting
solution was stirred at rt for 1 h, diluted with brine and AcOEt.
The layers were separated and the aqueous one was washed with brine
(2.times.), 1M HCl and brine (2.times.), dried (MgSO.sub.4),
filtered and concentrated under reduced pressure to provide
4-(2-phenoxyphenyl)-N-((1R,2R,3R,5R)-2,6,6-trimethylbicyclo[3.1.1]
heptan-3-yl)-1H-1,2,3-triazole-5-c arboxamide (13) as a pale yellow
foam and was used without further purification.
[0981] Compound 14:
[0982] To a solution of decahydroquinoline (10) (1.5 equiv) in dry
dichloromethane (0.5 M) under argon was added triethylamine (1.5
equiv) followed by triphosgene (1.5 equiv). The resulting
heterogeneous mixture was stirred at room temperature for 15
minutes, concentrated in vacuum and the residue was taken up in 1:1
dry toluene/THF (0.25 M with respect to amine), and treated with
dimethylaminopyridine (DMAP) (1.0 equiv) and triazole (13) (1.0
equiv). The resulting mixture was heated to reflux for 1.5 hours,
cooled to room temperature and diluted with ethyl acetate and
brine, and the aqueous and organic layers were separated. The
organic layer was washed with brine, 10% aqueous HCl, then brine,
and dried over MgSO.sub.4, filtered and concentrated in vacuo. The
residue is purified by flash chromatography on silica gel (ethyl
acetate/hexanes) to provide
1-(decahydroquinoline-1-carbonyl)-4-(2-phenoxyphenyl)-N-((1R,2R,3R,5R)-2,-
6,6-trimethylbicyclo[3.1.1]heptan-3-yl)-1H-1,2,3-triazole-5-carboxamide
(14) which was further purified by preparative HPLC (1% formic
acid) to afford a lyophilized powder.
(iv) Synthesis of Triazole Compounds 20 and 21
##STR00066##
[0984] Compound 17:
[0985] A solution of tosyl azide (16) (1.0 equiv) in CHCl.sub.3
(0.5M) cooled to 0.degree. C. was treated with 2-chlorophenyl
acetylene (15) (1.2 equiv), 2,6-lutidine (1.2 equiv) and CuI (0.1
equiv). The resulting mixture was stirred at 0.degree. C. for 24 h,
quenched with 10% HCl, the layers separated and the aqueous one
washed with brine, dried (MgSO.sub.4), filtered and concentrated in
vacuo. The residue was purified by flash chromatography
(Hexane/AcOEt 5:1, 3:1 and 1:1) to provide
4-(2-chlorophenyl)-1-tosyl-1H-1,2,3-triazole (17) as a pale yellow
crystalline solid.
[0986] Compound 18:
[0987] A solution of (17) (1 equiv) in dry MeOH (0.1 M) was added
to magnesium powder (10 equiv) under argon at 0.degree. C. and the
resulting suspension was stirred at 0.degree. C. for 1 hour,
diluted with DCM (3 volumes) and quenched very slowly with 10% HCl
(15 ml). The layers were separated and the organic one was washed
with 5% aqueous sodium bicarbonate solution and brine, dried
(MgSO.sub.4), filtered and concentrated in vacuo. An oil was
obtained which was purified by flash chromatrography (Hex/AcOEt 5:1
and 1:1) to render 4-(2-chlorophenyl)-1H-1,2,3-triazole (18) as a
white crystalline solid (42% yield).
[0988] Compound 20:
[0989] To a solution of N-ethyl 2-fluoroaniline (19) (1.5 equiv) in
dry DCM (0.5 M) under argon at 0.degree. C. was added Et.sub.3N
(1.5 equiv) followed by triphosgene (1.5 equiv). The resulting
mixture was stirred at room temperature for 30 minutes,
concentrated in vacuo, and the residue was taken up in dry toluene
(0.25M with respect to amine), treated with DMAP (1 equiv) and
triazole (18) (1 equiv). The resulting suspension was heated to
reflux for 30 min, cooled to rt, diluted with AcOEt and washed with
water, 10% HCl, brine, saturated aqueous sodium bicarbonate
solution and brine. The organic layer was dried (MgSO.sub.4),
filtered and concentrated in vacuo. The residue was partially
purified by prep HPLC (40 mM ammonium bicarbonate). A 2:1 mixture
of regioisomers 20/21 was obtained, which was separated by
preparative TLC (Hexane/AcOEt 4:1). Two fractions were obtained:
5-(2-chlorophenyl)-N-ethyl-N-(2-fluorophenyl)-1H-1,2,3-triazole-1-carboxa-
mide (21) (dr=9:1) and
4-(2-chlorophenyl)-N-ethyl-N-(2-fluorophenyl)-1H-1,2,3-triazole-1-c
arbox amide (20).
(v) Synthesis of Triazole Compound 24
##STR00067##
[0991] Compound 24:
[0992] To a solution of N-ethylaniline (22) (1.5 equiv) in dry DCM
(0.5 M) under argon at 0.degree. C. was added Et.sub.3N (1.5 equiv)
followed by triphosgene (1.5 equiv) and the resulting mixture was
stirred at rt for 1 hour, and concentrated in vacuo. The residue
was taken up in dry toluene (0.25M with respect to amine), treated
with DMAP (1 equiv) and azabenzotriazole (23) (1 equiv). The
resulting suspension was heated to reflux for 70 min, cooled to rt,
diluted with EtOAc and washed with 1N HCl and water. The organic
layer was dried with sodium sulfate, filtered, and concentrated in
vacuo. The residue was purified by silica gel column chromatography
(100% hexane to 3:1 hexanes:ethyl acetate) to afford (24) as a
white solid.
(vi) Synthesis of Triazole Compounds 27 and 28
##STR00068##
[0994] Compound 27:
[0995] To a solution of 4-carbonylbenzyloxy-N-ethylaniline (25)
(1.5 equiv) in dry DCM (0.5 M) under argon at 0.degree. C. was
added Et.sub.3N (1.5 equiv) followed by triphosgene (1.0 equiv) and
the resulting mixture was stirred at rt for 30 minutes,
concentrated in vacuo and the residue taken up in dry toluene
(0.25M with respect to amine), treated with DMAP (1 equiv) and
benzotriazole (26) (1 equiv). The resulting suspension was heated
to reflux for 90 min, cooled to rt, diluted with AcOEt and washed
with 1N HCl and brine. The organic layer was dried with sodium
sulfate, filtered, and concentrated in vacuo. The residue was
purified by silica gel column chromatography (hexane to 3:1
hexanes:ethyl acetate) to afford (27) as a gummy syrup.
[0996] Compound 28:
[0997] To a stirred solution of (24) (1.0 equiv) in methanol (0.1
M) under argon was added 5% Pd/C (0.1 equiv) and the inert
atmosphere was replaced with hydrogen. The resulting mixture was
stirred at rt for 3 hours, filtered through a pad of Celite and the
resulting filtrate concentrated in vacuo. The residue was purified
by silica gel column chromatography (100% dichloromethane to 9:1
dichloromethane:methanol) to provide (28) as a clear oil.
Biological Assays
Preparation of Human FASN Protein
[0998] Human FASN protein (SEQ ID NO 1) was purified from SKBR3
cells using procedures modified from those in Jayakumar et al.,
PNAS (1995) 92:8695-8699. SKBR3 cells were obtained from ATCC and
grown in DMEM high glucose medium supplemented with 10% FBS, 1
.mu.g/mL bovine pancreas insulin, 100 U/mL penicillin and 100
.mu.g/mL streptomycin. The confluent cells were trypsinized and
washed three times with PBS buffer before frozen in liquid N.sub.2
and stored at -80.degree. C. Frozen cells were thawed on ice and
re-suspended in lysis buffer (25 mM Tris-HCl, pH 7.0, 15 mM NaCl, 1
mM EDTA, and 1 mM DTT) with protease inhibitors. The cells were
lysed by sonication, and the cell debris was removed by
centrifugation at 20,000 rpm for 30 min. To the supernatant,
neutralized saturated ammonium sulfate solution was added to a
final concentration of 35%. The solution was left on ice for 1 hr,
and the precipitated proteins were harvested by centrifugation at
20,000 rpm for 30 min. The proteins were re-dissolved in lysis
buffer without NaCl and loaded on a mono Q column. Bound proteins
were eluted with a linear gradient of NaCl in lysis buffer. Each
fraction was analyzed by SDS-PAGE and FASN NADPH consumption assay.
The fractions containing FASN were pooled and concentrated to 2-3
mg/mL. Glycerol was added to 20%, and the protein was frozen in
liquid N.sub.2 and stored at -80.degree. C.
FASN NADPH Consumption Assay
[0999] All chemicals were purchased from Sigma (St. Louis, Mo.).
The procedures of NADPH consumption assay were similar to those
described in Cox et al., PNAS (1983) 80:4233-4237. On a 96-well
polypropylene microplate, dilution series (typical concentrations
60 nM-1.0 mM) of inhibitor compounds were prepared in DMSO, of
which 4.0 .mu.L each was transferred to a black polystyrene assay
microplate and mixed with 36 .mu.L FASN assay buffer (50 mM
potassium phosphate, pH 7.0, 1.0 mM EDTA, 0.01% NP-40) plus 5.0 mM
fresh DTT. FASN protein (40 .mu.L 150 nM FASN) was added per well,
and the microplate was incubated at 37.degree. C. for 30 min.
Enzyme activity measurement was initiated by addition of 20 .mu.L
5.times. substrate mixture to final concentrations of 60 nM FASN,
2.4 nM-40 .mu.M compound, 0.2 mM NADPH, 50 .mu.M butyryl-CoA, 0.5
mM malonyl-CoA in 100 .mu.L assay buffer plus 5.0 mM DTT and 4.0%
DMSO. NADPH consumption was monitored kinetically by fluorescence
(.lamda..sub.EX=340 nm, .lamda..sub.Em=460 nm) on an EnVision 2100
multilabel plate reader (Perkin Elmer, Waltham, Mass.). FASN enzyme
activity (slope) in the presence of 4% DMSO was used as maximum
control, whereas background (minimum control) was measured by
omission of malonyl-CoA in the substrate mixture. Inhibition curves
were fitted by a logistic function to yield IC.sub.50 values:
% Inhibition = [ 1 - ( Slope - Min ) ( Max - Min ) ] .times. 100 %
% Inhibition = 100 1 + ( IC 50 / [ I ] total ) Hill coefficient
##EQU00001##
[1000] Compounds of provided herein were found to inhibit FASN
activity using this assay.
[1001] Activities provided from the FASN NADPH consumption Assay
are designated in Table 1, wherein "A" refers to compounds having
an IC.sub.50 of less than 200 .mu.M; "B" refers to compounds having
an IC.sub.50 of 200 .mu.M to 500 .mu.M, inclusive; "C" refers to
compounds having an IC.sub.50 of greater than 500 .mu.M to 1000
.mu.M, inclusive; and "D" refers to compounds having an IC.sub.50
of greater than 1000 .mu.M, as measured by the assay.
FASN Scintillation Proximity Flashplate Assay
[1002] Acetyl-coenzyme A, malonyl-coenzyme A, NADPH, bovine gamma
globulin, and orlistat were purchased from Sigma (St. Louis, Mo.).
Tris(2-carboxyethyl) phosphine hydrochloride (TCEP) was purchased
from Pierce Biotechnologies (Rockford, Ill.).
[.sup.3H]-acetyl-coenzyme A was purchased from Moravek Biochemicals
(Brea, Calif.). FlashPlate.RTM. PLUS phospholipid 96-well
scintillant coated microplates were purchased from Perkin Elmer
Life and Analytical Sciences (Shelton, Conn.). The method of the
FASN scintillation proximity FlashPlate assay is similar to that
described in Weiss and Glickman Assay Drug Dev Technol 2003, 1,
161-6. In a 96-well polypropylene microplate, dilution series
(typical concentrations 60 nM-1.0 mM) of inhibitor compounds were
prepared in DMSO followed by a 20-fold dilution into FASN assay
buffer (50 mM potassium phosphate, pH 7.0, 1.0 mM EDTA, 0.01%
NP-40), of which 5.0 .mu.L each was transferred to a
FlashPlate.RTM. PLUS 96-well plate and mixed with 35 .mu.L FASN
assay buffer plus 0.5 mg/mL bovine gamma globulin and 1 mM TCEP.
FASN protein (10 .mu.L 10 nM) was added per well, and the
microplate was incubated at 37.degree. C. for 30 min. 10 .mu.L 20
mM NADPH was added, and the reaction was initiated by addition of
40 .mu.L substrate mixture to final concentrations of 1 nM FASN,
100 .mu.M acetyl-coenzyme A, 6 .mu.Ci [.sup.3H]-acetyl-coenzyme A,
300 .mu.M malonyl-coenzyme A, 2 mM NADPH, 0.5 mg/mL bovine gamma
globulin, and 1 mM TCEP in a volume of 100 .mu.L per well. Assay
plates were incubated for 2 hr at 37.degree. C. and the reaction
was stopped with 2 .mu.L 2.5 mM stock solution of ORLISTAT in DMSO
to .about.50 .mu.M. The plates were read in a Wallac 1450 Microbeta
Plus liquid scintillation counter (Perkin Elmer, Waltham, Mass.),
and counts per minute (CPM) were collected over 2 min. Each
inhibitor well CPM was compared to the maximum FASN enzyme activity
(Max) CPM and the background (Min) CPM, as measured by omission of
FASN enzyme in the background well. % Inhibition values were
calculated, and curves were fitted by a four-parameter logistic
function to yield IC.sub.50 values:
% Inhibition = [ 1 - ( Inhibitor - Min ) ( Max - Min ) ] .times.
100 % ##EQU00002##
[1003] Compounds of provided herein were found to inhibit FASN
activity using this assay.
[1004] Activities provided from the FASN Scintillation Proximity
Flashplate Assay are provided in Table 1, wherein "A*" refers to
compounds having an IC.sub.50 of less than 200 .mu.M; "B*" refers
to compounds having an IC.sub.50 of 200 .mu.M to 500 .mu.M,
inclusive; "C*" refers to compounds having an IC.sub.50 of greater
than 500 .mu.M to 1000 .mu.M, inclusive; and "D*" refers to
compounds having an IC.sub.50 of greater than 1000 .mu.M, as
measured by the assay.
Inhibition of Human FASN
Scintillation Proximity Flashplate Assay and NADPH Consumption
Assay
[1005] Compounds prepared following the above described methods are
provided in Tables 1-4 below. Compounds were assayed as inhibitors
of human FASN using the above-described FASN Scintillation
Proximity Flashplate Assay (*) (IC.sub.50; .mu.M) or FASN NADPH
Consumption Assay (IC.sub.50; .mu.M). The corresponding activity of
the isolated compound is also provided along with the measured mass
(ES.sup.+).
TABLE-US-00006 TABLE 1 ACTIV- [M + STRUCTURE ITY H].sup.+
##STR00069## B 372.2 ##STR00070## B 404.1 ##STR00071## A 430
##STR00072## A 440.2 ##STR00073## C 480.2 ##STR00074## B 483.2
##STR00075## A 483.2 ##STR00076## C 515.3 ##STR00077## B 515.3
##STR00078## B 324.2 ##STR00079## A 354.1 ##STR00080## A 370.1
##STR00081## A 386.1 ##STR00082## A 388.1 ##STR00083## B 400
##STR00084## A 410 ##STR00085## A* 412.1 ##STR00086## A* 422.1
##STR00087## D 521.2 ##STR00088## D 579.3 ##STR00089## D 399.2
##STR00090## C 475.2 ##STR00091## D 582.3 ##STR00092## D 582.3
##STR00093## C 457.2 ##STR00094## D 285.2 ##STR00095## D 286.2
##STR00096## C 268.1 ##STR00097## C 285.1 ##STR00098## D 311.1
##STR00099## D 299.2 ##STR00100## D 327.1 ##STR00101## D 345.1
##STR00102## D 299.2 ##STR00103## C 327.1 ##STR00104## D 345.1
TABLE-US-00007 TABLE 2 NAME ABBREVIATION STRUCTURE methyl Me
--CH.sub.3 ethyl Et --CH.sub.2CH.sub.3 N-propyl nPr
--CH.sub.2CH.sub.2CH.sub.3 Iso-propyl iPr --CH(CH.sub.3).sub.2
N-butyl nBu --CH.sub.2CH.sub.2CH.sub.2CH.sub.3 tert-butyl tBu
--C(CH.sub.3).sub.3 sec-butyl --CH(CH.sub.2)(CH.sub.2CH.sub.3)
iso-butyl iBu --CH.sub.2CH(CH.sub.3).sub.2 N-pentyl nPent
--CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.3 3-pentanyl or
pentan-3-yl --CH(CH.sub.2CH.sub.3).sub.2 amyl
--CH.sub.2CH(CH.sub.3)CH.sub.2CH.sub.3 neopentyl
--CH.sub.2C(CH.sub.3).sub.3 3-methyl-2-butanyl
--CH(CH.sub.3)CH(CH.sub.3).sub.2 tertiary amyl
--C(CH.sub.3).sub.2CH.sub.2CH.sub.3 N-hexyl nHex
--CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.2CH.sub.3 phenyl Ph
--C.sub.6H.sub.5 acetyl Ac --C(.dbd.O)CH.sub.3
tert-butyloxycarbonyl Boc --C(.dbd.O)OC(CH.sub.3).sub.3
EQUIVALENTS
References
[1006] All publications and patents mentioned herein are hereby
incorporated by reference in their entirety as if each individual
publication or patent was specifically and individually
incorporated by reference. In case of conflict, the present
application, including any definitions herein, will control.
Equivalents
[1007] While specific embodiments of the present disclosure have
been discussed, the above specification is illustrative and not
restrictive. Many variations of this disclosure will become
apparent to those skilled in the art upon review of this
specification. The full scope of the disclosure should be
determined by reference to the claims, along with their full scope
of equivalents, and the specification, along with such
variations.
[1008] Unless otherwise indicated, all numbers expressing
quantities of ingredients, reaction conditions, and so forth used
in the specification and claims are to be understood as being
modified in all instances by the term "about." Accordingly, unless
indicated to the contrary, the numerical parameters set forth in
this specification and attached claims are approximations that can
vary depending upon the desired properties sought to be obtained by
the present disclosure.
Sequence CWU 1
1
112511PRTHomo sapiens 1Met Glu Glu Val Val Ile Ala Gly Met Ser Gly
Lys Leu Pro Glu Ser1 5 10 15 Glu Asn Leu Gln Glu Phe Trp Asp Asn
Leu Ile Gly Gly Val Asp Met 20 25 30 Val Thr Asp Asp Asp Arg Arg
Trp Lys Ala Gly Leu Tyr Gly Leu Pro 35 40 45 Arg Arg Ser Gly Lys
Leu Lys Asp Leu Ser Arg Phe Asp Ala Ser Phe 50 55 60 Phe Gly Val
His Pro Lys Gln Ala His Thr Met Asp Pro Gln Leu Arg65 70 75 80 Leu
Leu Leu Glu Val Thr Tyr Glu Ala Ile Val Asp Gly Gly Ile Asn 85 90
95 Pro Asp Ser Leu Arg Gly Thr His Thr Gly Val Trp Val Gly Val Ser
100 105 110 Gly Ser Glu Thr Ser Glu Ala Leu Ser Arg Asp Pro Glu Thr
Leu Val 115 120 125 Gly Tyr Ser Met Val Gly Cys Gln Arg Ala Met Met
Ala Asn Arg Leu 130 135 140 Ser Phe Phe Phe Asp Phe Arg Gly Pro Ser
Ile Ala Leu Asp Thr Ala145 150 155 160 Cys Ser Ser Ser Leu Met Ala
Leu Gln Asn Ala Tyr Gln Ala Ile His 165 170 175 Ser Gly Gln Cys Pro
Ala Ala Ile Val Gly Gly Ile Asn Val Leu Leu 180 185 190 Lys Pro Asn
Thr Ser Val Gln Phe Leu Arg Leu Gly Met Leu Ser Pro 195 200 205 Glu
Gly Thr Cys Lys Ala Phe Asp Thr Ala Gly Asn Gly Tyr Cys Arg 210 215
220 Ser Glu Gly Val Val Ala Val Leu Leu Thr Lys Lys Ser Leu Ala
Arg225 230 235 240 Arg Val Tyr Ala Thr Ile Leu Asn Ala Gly Thr Asn
Thr Asp Gly Phe 245 250 255 Lys Glu Gln Gly Val Thr Phe Pro Ser Gly
Asp Ile Gln Glu Gln Leu 260 265 270 Ile Arg Ser Leu Tyr Gln Ser Ala
Gly Val Ala Pro Glu Ser Phe Glu 275 280 285 Tyr Ile Glu Ala His Gly
Thr Gly Thr Lys Val Gly Asp Pro Gln Glu 290 295 300 Leu Asn Gly Ile
Thr Arg Ala Leu Cys Ala Thr Arg Gln Glu Pro Leu305 310 315 320 Leu
Ile Gly Ser Thr Lys Ser Asn Met Gly His Pro Glu Pro Ala Ser 325 330
335 Gly Leu Ala Ala Leu Ala Lys Val Leu Leu Ser Leu Glu His Gly Leu
340 345 350 Trp Ala Pro Asn Leu His Phe His Ser Pro Asn Pro Glu Ile
Pro Ala 355 360 365 Leu Leu Asp Gly Arg Leu Gln Val Val Asp Gln Pro
Leu Pro Val Arg 370 375 380 Gly Gly Asn Val Gly Ile Asn Ser Phe Gly
Phe Gly Gly Ser Asn Val385 390 395 400 His Ile Ile Leu Arg Pro Asn
Thr Gln Pro Pro Pro Ala Pro Ala Pro 405 410 415 His Ala Thr Leu Pro
Arg Leu Leu Arg Ala Ser Gly Arg Thr Pro Glu 420 425 430 Ala Val Gln
Lys Leu Leu Glu Gln Gly Leu Arg His Ser Gln Asp Leu 435 440 445 Ala
Phe Leu Ser Met Leu Asn Asp Ile Ala Ala Val Pro Ala Thr Ala 450 455
460 Met Pro Phe Arg Gly Tyr Ala Val Leu Gly Gly Glu Arg Gly Gly
Pro465 470 475 480 Glu Val Gln Gln Val Pro Ala Gly Glu Arg Pro Leu
Trp Phe Ile Cys 485 490 495 Ser Gly Met Gly Thr Gln Trp Arg Gly Met
Gly Leu Ser Leu Met Arg 500 505 510 Leu Asp Arg Phe Arg Asp Ser Ile
Leu Arg Ser Asp Glu Ala Val Lys 515 520 525 Pro Phe Gly Leu Lys Val
Ser Gln Leu Leu Leu Ser Thr Asp Glu Ser 530 535 540 Thr Phe Asp Asp
Ile Val His Ser Phe Val Ser Leu Thr Ala Ile Gln545 550 555 560 Ile
Gly Leu Ile Asp Leu Leu Ser Cys Met Gly Leu Arg Pro Asp Gly 565 570
575 Ile Val Gly His Ser Leu Gly Glu Val Ala Cys Gly Tyr Ala Asp Gly
580 585 590 Cys Leu Ser Gln Glu Glu Ala Val Leu Ala Ala Tyr Trp Arg
Gly Gln 595 600 605 Cys Ile Lys Glu Ala His Leu Pro Pro Gly Ala Met
Ala Ala Val Gly 610 615 620 Leu Ser Trp Glu Glu Cys Lys Gln Arg Cys
Pro Pro Gly Val Val Pro625 630 635 640 Ala Cys His Asn Ser Lys Asp
Thr Val Thr Ile Ser Gly Pro Gln Ala 645 650 655 Pro Val Phe Glu Phe
Val Glu Gln Leu Arg Lys Glu Gly Val Phe Ala 660 665 670 Lys Glu Val
Arg Thr Gly Gly Met Ala Phe His Ser Tyr Phe Met Glu 675 680 685 Ala
Ile Ala Pro Pro Leu Leu Gln Glu Leu Lys Lys Val Ile Arg Glu 690 695
700 Pro Lys Pro Arg Ser Ala Arg Trp Leu Ser Thr Ser Ile Pro Glu
Ala705 710 715 720 Gln Trp His Ser Ser Leu Ala Arg Thr Ser Ser Ala
Glu Tyr Asn Val 725 730 735 Asn Asn Leu Val Ser Pro Val Leu Phe Gln
Glu Ala Leu Trp His Val 740 745 750 Pro Glu His Ala Val Val Leu Glu
Ile Ala Pro His Ala Leu Leu Gln 755 760 765 Ala Val Leu Lys Arg Gly
Leu Lys Pro Ser Cys Thr Ile Ile Pro Leu 770 775 780 Met Lys Lys Asp
His Arg Asp Asn Leu Glu Phe Phe Leu Ala Gly Ile785 790 795 800 Gly
Arg Leu His Leu Ser Gly Ile Asp Ala Asn Pro Asn Ala Leu Phe 805 810
815 Pro Pro Val Glu Phe Pro Ala Pro Arg Gly Thr Pro Leu Ile Ser Pro
820 825 830 Leu Ile Lys Trp Asp His Ser Leu Ala Trp Asp Val Pro Ala
Ala Glu 835 840 845 Asp Phe Pro Asn Gly Ser Gly Ser Pro Ser Ala Ala
Ile Tyr Asn Ile 850 855 860 Asp Thr Ser Ser Glu Ser Pro Asp His Tyr
Leu Val Asp His Thr Leu865 870 875 880 Asp Gly Arg Val Leu Phe Pro
Ala Thr Gly Tyr Leu Ser Ile Val Trp 885 890 895 Lys Thr Leu Ala Arg
Ala Leu Gly Leu Gly Val Glu Gln Leu Pro Val 900 905 910 Val Phe Glu
Asp Val Val Leu His Gln Ala Thr Ile Leu Pro Lys Thr 915 920 925 Gly
Thr Val Ser Leu Glu Val Arg Leu Leu Glu Ala Ser Arg Ala Phe 930 935
940 Glu Val Ser Glu Asn Gly Asn Leu Val Val Ser Gly Lys Val Tyr
Gln945 950 955 960 Trp Asp Asp Pro Asp Pro Arg Leu Phe Asp His Pro
Glu Ser Pro Thr 965 970 975 Pro Asn Pro Thr Glu Pro Leu Phe Leu Ala
Gln Ala Glu Val Tyr Lys 980 985 990 Glu Leu Arg Leu Arg Gly Tyr Asp
Tyr Gly Pro His Phe Gln Gly Ile 995 1000 1005 Leu Glu Ala Ser Leu
Glu Gly Asp Ser Gly Arg Leu Leu Trp Lys Asp 1010 1015 1020 Asn Trp
Val Ser Phe Met Asp Thr Met Leu Gln Met Ser Ile Leu Gly1025 1030
1035 1040Ser Ala Lys His Gly Leu Tyr Leu Pro Thr Arg Val Thr Ala
Ile His 1045 1050 1055 Ile Asp Pro Ala Thr His Arg Gln Lys Leu Tyr
Thr Leu Gln Asp Lys 1060 1065 1070 Ala Gln Val Ala Asp Val Val Val
Ser Arg Trp Leu Arg Val Thr Val 1075 1080 1085 Ala Gly Gly Val His
Ile Ser Gly Leu His Thr Glu Ser Ala Pro Arg 1090 1095 1100 Arg Gln
Gln Glu Gln Gln Val Pro Ile Leu Glu Lys Phe Cys Phe Thr1105 1110
1115 1120Pro His Thr Glu Glu Gly Cys Leu Ser Glu Arg Ala Ala Leu
Gln Glu 1125 1130 1135 Glu Leu Gln Leu Cys Lys Gly Leu Val Gln Ala
Leu Gln Thr Lys Val 1140 1145 1150 Thr Gln Gln Gly Leu Lys Met Val
Val Pro Gly Leu Asp Gly Ala Gln 1155 1160 1165 Ile Pro Arg Asp Pro
Ser Gln Gln Glu Leu Pro Arg Leu Leu Ser Ala 1170 1175 1180 Ala Cys
Arg Leu Gln Leu Asn Gly Asn Leu Gln Leu Glu Leu Ala Gln1185 1190
1195 1200Val Leu Ala Gln Glu Arg Pro Lys Leu Pro Glu Asp Pro Leu
Leu Ser 1205 1210 1215 Gly Leu Leu Asp Ser Pro Ala Leu Lys Ala Cys
Leu Asp Thr Ala Val 1220 1225 1230 Glu Asn Met Pro Ser Leu Lys Met
Lys Val Val Glu Val Leu Ala Gly 1235 1240 1245 His Gly His Leu Tyr
Ser Arg Ile Pro Gly Leu Leu Ser Pro His Pro 1250 1255 1260 Leu Leu
Gln Leu Ser Tyr Thr Ala Thr Asp Arg His Pro Gln Ala Leu1265 1270
1275 1280Glu Ala Ala Gln Ala Glu Leu Gln Gln His Asp Val Ala Gln
Gly Gln 1285 1290 1295 Trp Asp Pro Ala Asp Pro Ala Pro Ser Ala Leu
Gly Ser Ala Asp Leu 1300 1305 1310 Leu Val Cys Asn Cys Ala Val Ala
Ala Leu Gly Asp Pro Ala Ser Ala 1315 1320 1325 Leu Ser Asn Met Val
Ala Ala Leu Arg Glu Gly Gly Phe Leu Leu Leu 1330 1335 1340 His Thr
Leu Leu Arg Gly His Pro Leu Gly Asp Ile Val Ala Phe Leu1345 1350
1355 1360Thr Ser Thr Glu Pro Gln Tyr Gly Gln Gly Ile Leu Ser Gln
Asp Ala 1365 1370 1375 Trp Glu Ser Leu Phe Ser Arg Val Ser Leu Arg
Leu Val Gly Leu Lys 1380 1385 1390 Lys Ser Phe Tyr Gly Ser Thr Leu
Phe Leu Cys Arg Arg Pro Thr Pro 1395 1400 1405 Gln Asp Ser Pro Ile
Phe Leu Pro Val Asp Asp Thr Ser Phe Arg Trp 1410 1415 1420 Val Glu
Ser Leu Lys Gly Ile Leu Ala Asp Glu Asp Ser Ser Arg Pro1425 1430
1435 1440Val Trp Leu Lys Ala Ile Asn Cys Ala Thr Ser Gly Val Val
Gly Leu 1445 1450 1455 Val Asn Cys Leu Arg Arg Glu Pro Gly Gly Asn
Arg Leu Arg Cys Val 1460 1465 1470 Leu Leu Ser Asn Leu Ser Ser Thr
Ser His Val Pro Glu Val Asp Pro 1475 1480 1485 Gly Ser Ala Glu Leu
Gln Lys Val Leu Gln Gly Asp Leu Val Met Asn 1490 1495 1500 Val Tyr
Arg Asp Gly Ala Trp Gly Ala Phe Arg His Phe Leu Leu Glu1505 1510
1515 1520Glu Asp Lys Pro Glu Glu Pro Thr Ala His Ala Phe Val Ser
Thr Leu 1525 1530 1535 Thr Arg Gly Asp Leu Ser Ser Ile Arg Trp Val
Cys Ser Ser Leu Arg 1540 1545 1550 His Ala Gln Pro Thr Cys Pro Gly
Ala Gln Leu Cys Thr Val Tyr Tyr 1555 1560 1565 Ala Ser Leu Asn Phe
Arg Asp Ile Met Leu Ala Thr Gly Lys Leu Ser 1570 1575 1580 Pro Asp
Ala Ile Pro Gly Lys Trp Thr Ser Gln Asp Ser Leu Leu Gly1585 1590
1595 1600Met Glu Phe Ser Gly Arg Asp Ala Ser Gly Lys Arg Val Met
Gly Leu 1605 1610 1615 Val Pro Ala Lys Gly Leu Ala Thr Ser Val Leu
Leu Ser Pro Asp Phe 1620 1625 1630 Leu Trp Asp Val Pro Ser Asn Trp
Thr Leu Glu Glu Ala Ala Ser Val 1635 1640 1645 Pro Val Val Tyr Ser
Thr Ala Tyr Tyr Ala Leu Val Val Arg Gly Arg 1650 1655 1660 Val Arg
Pro Gly Glu Thr Leu Leu Ile His Ser Gly Ser Gly Gly Val1665 1670
1675 1680Gly Gln Ala Ala Ile Ala Ile Ala Leu Ser Leu Gly Cys Arg
Val Phe 1685 1690 1695 Thr Thr Val Gly Ser Ala Glu Lys Arg Ala Tyr
Leu Gln Ala Arg Phe 1700 1705 1710 Pro Gln Leu Asp Ser Thr Ser Phe
Ala Asn Ser Arg Asp Thr Ser Phe 1715 1720 1725 Glu Gln His Val Leu
Trp His Thr Gly Gly Lys Gly Val Asp Leu Val 1730 1735 1740 Leu Asn
Ser Leu Ala Glu Glu Lys Leu Gln Ala Ser Val Arg Cys Leu1745 1750
1755 1760Ala Thr His Gly Arg Phe Leu Glu Ile Gly Lys Phe Asp Leu
Ser Gln 1765 1770 1775 Asn His Pro Leu Gly Met Ala Ile Phe Leu Lys
Asn Val Thr Phe His 1780 1785 1790 Gly Val Leu Leu Asp Ala Phe Phe
Asn Glu Ser Ser Ala Asp Trp Arg 1795 1800 1805 Glu Val Trp Ala Leu
Val Gln Ala Gly Ile Arg Asp Gly Val Val Arg 1810 1815 1820 Pro Leu
Lys Cys Thr Val Phe His Gly Ala Gln Val Glu Asp Ala Phe1825 1830
1835 1840Arg Tyr Met Ala Gln Gly Lys His Ile Gly Lys Val Val Val
Gln Val 1845 1850 1855 Leu Ala Glu Glu Pro Glu Ala Val Leu Lys Gly
Ala Lys Pro Lys Leu 1860 1865 1870 Met Ser Ala Ile Ser Lys Thr Phe
Cys Pro Ala His Lys Ser Tyr Ile 1875 1880 1885 Ile Ala Gly Gly Leu
Gly Gly Phe Gly Leu Glu Leu Ala Gln Trp Leu 1890 1895 1900 Ile Gln
Arg Gly Val Gln Lys Leu Val Leu Thr Ser Arg Ser Gly Ile1905 1910
1915 1920Arg Thr Gly Tyr Gln Ala Lys Gln Val Arg Arg Trp Arg Arg
Gln Gly 1925 1930 1935 Val Gln Val Gln Val Ser Thr Ser Asn Ile Ser
Ser Leu Glu Gly Ala 1940 1945 1950 Arg Gly Leu Ile Ala Glu Ala Ala
Gln Leu Gly Pro Val Gly Gly Val 1955 1960 1965 Phe Asn Leu Ala Val
Val Leu Arg Asp Gly Leu Leu Glu Asn Gln Thr 1970 1975 1980 Pro Glu
Phe Phe Gln Asp Val Cys Lys Pro Lys Tyr Ser Gly Thr Leu1985 1990
1995 2000Asn Leu Asp Arg Val Thr Arg Glu Ala Cys Pro Glu Leu Asp
Tyr Phe 2005 2010 2015 Val Val Phe Ser Ser Val Ser Cys Gly Arg Gly
Asn Ala Gly Gln Ser 2020 2025 2030 Asn Tyr Gly Phe Ala Asn Ser Ala
Met Glu Arg Ile Cys Glu Lys Arg 2035 2040 2045 Arg His Glu Gly Leu
Pro Gly Leu Ala Val Gln Trp Gly Ala Ile Gly 2050 2055 2060 Asp Val
Gly Ile Leu Val Glu Thr Met Ser Thr Asn Asp Thr Ile Val2065 2070
2075 2080Ser Gly Thr Leu Pro Gln Arg Met Ala Ser Cys Leu Glu Val
Leu Asp 2085 2090 2095 Leu Phe Leu Asn Gln Pro His Met Val Leu Ser
Ser Phe Val Leu Ala 2100 2105 2110 Glu Lys Ala Ala Ala Tyr Arg Asp
Arg Asp Ser Gln Arg Asp Leu Val 2115 2120 2125 Glu Ala Val Ala His
Ile Leu Gly Ile Arg Asp Leu Ala Ala Val Asn 2130 2135 2140 Leu Asp
Ser Ser Leu Ala Asp Leu Gly Leu Asp Ser Leu Met Ser Val2145 2150
2155 2160Glu Val Arg Gln Thr Leu Glu Arg Glu Leu Asn Leu Val Leu
Ser Val 2165 2170 2175 Arg Glu Val Arg Gln Leu Thr Leu Arg Lys Leu
Gln Glu Leu Ser Ser 2180 2185 2190 Lys Ala Asp Glu Ala Ser Glu Leu
Ala Cys Pro Thr Pro Lys Glu Asp 2195 2200 2205 Gly Leu Ala Gln Gln
Gln Thr Gln Leu Asn Leu Arg Ser Leu Leu Val 2210 2215 2220 Asn Pro
Glu Gly Pro Thr Leu Met Arg Leu Asn Ser Val Gln Ser Ser2225 2230
2235 2240Glu Arg Pro Leu Phe Leu Val His Pro Ile Glu Gly Ser Thr
Thr Val 2245 2250 2255 Phe His Ser Leu Ala Ser Arg Leu Ser Ile Pro
Thr Tyr Gly Leu Gln 2260 2265 2270 Cys Thr Arg Ala Ala Pro Leu Asp
Ser Ile His Ser Leu Ala Ala Tyr 2275 2280 2285 Tyr Ile Asp Cys Ile
Arg Gln Val Gln Pro Glu Gly Pro Tyr Arg Val 2290 2295 2300 Ala Gly
Tyr Ser Tyr Gly Ala Cys Val Ala Phe Glu Met Cys Ser Gln2305
2310 2315 2320Leu Gln Ala Gln Gln Ser Pro Ala Pro Thr His Asn Ser
Leu Phe Leu 2325 2330 2335 Phe Asp Gly Ser Pro Thr Tyr Val Leu Ala
Tyr Thr Gln Ser Tyr Arg 2340 2345 2350 Ala Lys Leu Thr Pro Gly Cys
Glu Ala Glu Ala Glu Thr Glu Ala Ile 2355 2360 2365 Cys Phe Phe Val
Gln Gln Phe Thr Asp Met Glu His Asn Arg Val Leu 2370 2375 2380 Glu
Ala Leu Leu Pro Leu Lys Gly Leu Glu Glu Arg Val Ala Ala Ala2385
2390 2395 2400Val Asp Leu Ile Ile Lys Ser His Gln Gly Leu Asp Arg
Gln Glu Leu 2405 2410 2415 Ser Phe Ala Ala Arg Ser Phe Tyr Tyr Lys
Leu Arg Ala Ala Glu Gln 2420 2425 2430 Tyr Thr Pro Lys Ala Lys Tyr
His Gly Asn Val Met Leu Leu Arg Ala 2435 2440 2445 Lys Thr Gly Gly
Ala Tyr Gly Glu Asp Leu Gly Ala Asp Tyr Asn Leu 2450 2455 2460 Ser
Gln Val Cys Asp Gly Lys Val Ser Val His Val Ile Glu Gly Asp2465
2470 2475 2480His Arg Thr Leu Leu Glu Gly Ser Gly Leu Glu Ser Ile
Ile Ser Ile 2485 2490 2495 Ile His Ser Ser Leu Ala Glu Pro Arg Val
Ser Val Arg Glu Gly 2500 2505 2510
* * * * *
References