U.S. patent application number 13/476685 was filed with the patent office on 2013-06-06 for hapten-carrier conjugates and uses thereof.
This patent application is currently assigned to Cytos Biotechnology AG. The applicant listed for this patent is Martin F. BACHMANN, Patrik Maurer. Invention is credited to Martin F. BACHMANN, Patrik Maurer.
Application Number | 20130142821 13/476685 |
Document ID | / |
Family ID | 30770921 |
Filed Date | 2013-06-06 |
United States Patent
Application |
20130142821 |
Kind Code |
A1 |
BACHMANN; Martin F. ; et
al. |
June 6, 2013 |
Hapten-Carrier Conjugates and Uses Thereof
Abstract
The present invention provides compositions comprising a
conjugate of a hapten with a carrier in an ordered and repetitive
array, and methods of making such compositions. The conjugates and
compositions of the invention may comprise a variety of haptens,
including hormones, toxins and drugs, especially drugs of addiction
such as nicotine. Compositions and conjugates of the invention are
useful for inducing immune responses against haptens, which can use
useful in a variety of therapeutic, prophylactic and diagnostic
regimens. In certain embodiments, immune responses generated using
the conjugates, compositions and methods of the present invention
are useful to prevent or treat addiction to drugs of abuse and the
resultant diseases associated with drug addiction.
Inventors: |
BACHMANN; Martin F.;
(Ramismuhle, CH) ; Maurer; Patrik; (Winterthur,
CH) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
BACHMANN; Martin F.
Maurer; Patrik |
Ramismuhle
Winterthur |
|
CH
CH |
|
|
Assignee: |
Cytos Biotechnology AG
Zurich-Schlieren
CH
|
Family ID: |
30770921 |
Appl. No.: |
13/476685 |
Filed: |
May 21, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
12285576 |
Oct 8, 2008 |
8187607 |
|
|
13476685 |
|
|
|
|
11125402 |
May 10, 2005 |
7452541 |
|
|
12285576 |
|
|
|
|
10622064 |
Jul 18, 2003 |
6932971 |
|
|
11125402 |
|
|
|
|
60396575 |
Jul 18, 2002 |
|
|
|
Current U.S.
Class: |
424/196.11 ;
530/403 |
Current CPC
Class: |
C07K 14/005 20130101;
A61K 2039/5258 20130101; A61P 25/34 20180101; A61K 47/6901
20170801; A61K 39/385 20130101; C07K 17/02 20130101; A61P 37/02
20180101; A61K 39/0013 20130101; A61K 2039/6075 20130101; A61K
2039/55505 20130101; A61P 25/30 20180101; C12N 2730/10122 20130101;
C12N 2795/18123 20130101 |
Class at
Publication: |
424/196.11 ;
530/403 |
International
Class: |
C07K 17/02 20060101
C07K017/02 |
Claims
1. A nicotine hapten-carrier conjugate comprising: (a) (a) a
virus-like particle of a RNA-phage carrier comprising at least one
first attachment site, and (b) (b) at least one nicotine hapten
with at least one second attachment site; wherein said second
attachment site is associated through at least one covalent bond to
said first attachment site so as to form an ordered and repetitive
hapten-carrier conjugate.
2. (canceled)
3. The conjugate of claim 1, wherein said virus-like particle is a
recombinant virus-like particle.
4.-9. (canceled)
10. The conjugate of claim 3 wherein said virus-like particle
comprises recombinant proteins, or fragments thereof, of RNA-phage
Q.beta..
11.-12. (canceled)
13. The conjugate of claim 3, wherein said virus-like particle
comprises recombinant proteins, or fragments thereof, a RNA-phage,
and wherein said recombinant proteins consist of coat proteins of
RNA phages.
14.-20. (canceled)
21. The conjugate of claim 10, wherein said recombinant proteins
comprise coat proteins having an amino acid sequence as set forth
in SEQ ID NO:3, or a mixture of coat proteins having amino acid
sequences of SEQ ID NO: 4, or mutants thereof, and of SEQ ID
NO:3.
22. The conjugate of claim 3, wherein said virus-like particle
essentially consisting of coat proteins having an amino acid
sequence of SEQ ID NO:3, or essentially consisting of a mixture of
coat proteins having amino acid sequences of SEQ ID NO: 4, or
mutants thereof; and of SEQ ID NO:3.
23.-29. (canceled)
30. The conjugate of claim 1, wherein said at least one first
attachment site is a lysine residue.
31. The conjugate of claim 1. Wherein said second attachment site
is associated to said first attachment site through at least one
non-peptide covalent bond.
32. (canceled)
33. The hapten-carrier conjugate of claim 1, wherein said conjugate
is suitable for eliciting an immune response against nicotine.
34.-37. (canceled)
38. The conjugate of claim 33, wherein the conjugate is formed from
starting materials selected from the group consisting of: (c) (a)
6-(carboxymethylureido)-(.+-.)-nicotine (CMUNic); (d) (b)
trans-3'-aminomethylnicotine succinate; (e) (c)
O-succinyl-3'-hydroxymethyl-nicotine; (f) (d)
Trans-4'-carboxycotinine; (g) (e)
N-[1-oxo-6-[(25)-2-(3-pyridyl)-1-pyrrolidinyl]hexyl]-.beta.-alani-
ne; (m) (f) 6-(.sigma.-aminocapramido)-(.+-.)-nicotine; (n) (g) 3'
aminomethylnicotine; (o) (h) 4' aminomethylnicotine; (p) (i) 5'
aminomethylnicotine; (q) (j) 5 aminonicotine; (r) (k) 6
aminonicotine; (s) (l) S-1-(b-aminoethyl)nicotinium chloride; and
(t) (m) S-1-(b-aminoethyl) cotinium chloride.
39. The conjugate of claim 33, wherein said hapten comprises the
starting material O-succinyl-3'-hydroxymethyl-nicotine.
40. The conjugate of claim 33, wherein said conjugate comprises
O-succinyl-3'-hydroxymethyl-nicotine conjugated to Q.beta. virus
like particle.
41. The conjugate of claim 33, wherein said hapten is formed from
the starting material O-succinyl-3'-hydroxymethyl-nicotine.
42. The conjugate of claim 41, wherein the second attachment site
contains, preferably is, an active group selected from the group
consisting of (u) (a) Amine; (v) (b) Amide; (w) (c) Carboxyl; (x)
(d) Sulfhydryl; (y) (e) Hydroxyl; (z) (f) Aldehyde; (aa) (g)
Diazonitim; (a) (h) Alkylhalogenid; (o) (i) Hydrazine; (aa) (j)
Vinyl; (ee) (k) Maleimid; (ff) (l) Succinimide; and (gg) (m)
Hydrazide.
43. The conjugate of claim 42, wherein said second attachment site
is formed by reaction of the O-succinyl moiety of said
O-succinyl-3'-hydroxymethyl-nicotine with the first attachment
site.
44. The conjugate of claim 41, wherein the second attachment site
contains an amide, and wherein said second attachment site is
formed by reaction of the O-succinyl moiety of said
O-succinyl-3'-hydroxymethyl-nicotine with a lysine residue being
said first attachment site.
45. (canceled)
46. The conjugate of claim 33, wherein said conjugate comprises
O-succinyl-3'-hydroxymethyl-nicotine conjugated to a virus-like
particle of a RNA-phage, preferably to a Q.beta. virus like
particle, and hereby preferably to a Q.beta. virus like particle
comprising, or preferably being composed of coat proteins of
RNA-phage Q.beta..
47.-62. (canceled)
63. A pharmaceutical composition comprising the conjugate of of
claim 33; and a pharmaceutically acceptable carrier.
64.-65. (canceled)
66. A vaccine composition comprising the conjugate of claim 1.
67.-68. (canceled)
69. A method of inducing an immune response to a drug in an animal,
said method comprising administering an immunologically effective
amount of the conjugate of claim 33 to an animal and permitting
said animal to produce an immune response to said drug.
70. The method of claim 69, wherein said conjugate is administered
to said animal by a route selected from the group consisting of:
intranasally, orally, subcutaneously, transdermally,
intramuscularly or intravenously.
71.-115. (canceled)
116. The conjugate of claim 1, wherein said virus-like particle is
a virus-like particle of RNA-phage Q.beta. coat protein.
117. The conjugate of claim 116, wherein said virus-like particle
of RNA-phage Q.beta. coat protein comprising a coat protein
consisting of the amino acid sequence as set forth in SEQ ID
NO:3.
118. The conjugate of claim 117, wherein said first attachment site
is a lysine residue and wherein said first attachment site
naturally occurs in said core particle.
Description
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation of U.S. application Ser.
No. 11/125,402, filed May 10, 2005; which is a divisional of U.S.
Pat. No. 6,932,971, issued Aug. 23, 2005; and claims benefit of the
filing date of U.S. Provisional Application No. 60/396,575, filed
Jul. 18, 2002; the disclosures of each of which are entirely
incorporated herein by reference.
BACKGROUND OF THE INVENTION
[0002] 1. Field of the Invention
[0003] The present invention is in the fields of medicine, public
health, immunology, molecular biology and virology.
[0004] 2. Related Art
[0005] Addictive drug abuse disorders carry with them a number of
specific, well recognized sequelae that have both societal and
economic consequences. These include death, disease, violence,
crime, loss of employment, reduced productivity, relationship and
familial breakdown, and the spread of HIV and other sexually
transmitted diseases. The economic cost to United States society
from drug abuse (excluding tobacco) was an estimated $98 billion in
1992, the last year for which reliable data are available ("The
economic costs of alcohol and drug abuse in the United
States-1992", National Institute on Drug Abuse). These costs
include crime ($59.1 billion), premature death ($14.6 billion),
impaired productivity/workplace accidents ($14.2 billion), welfare
($10.4 billion), health care ($5.5 billion), and motor vehicle
accidents. These costs are borne primarily by government (46%),
drug abusers and their families (44%). It is well recognized that
drug abuse remains a serious problem in society. Three years after
the 1992 study, in 1995, NIDA estimated drug abuse costs to the
society was $110 billion.
[0006] The per se use of drugs of abuse can have deleterious
effects on the user. However, it is recognized that the addictive
nature of these drugs are both central to the problems associated
with such drug use, and underlie the inability to treat both
addicted individuals and reduce the prevalence of drug addiction in
the society.
[0007] The most widely used addictive drug in the world is tobacco.
Nicotine, an alkaloid derived from tobacco leaves, is the principal
addictive component of tobacco. In 1999, 46.5 million adults in the
United States were current smokers. Cigarette smoking is the single
leading cause of preventable death in the United States. According
to the Centers for Disease Control and Prevention (CDC) 430,000
annual deaths are attributable to cigarette smoking in the United
States. Lung cancer, coronary heart disease, chronic lung disease,
and stroke are the main causes of death. Smoking is not only
dangerous to individuals, it also results in staggering societal
costs. The estimated smoking-attributable cost for medical care in
1993 was more than $50 billion and the cost of lost productivity
and forfeited earnings due to smoking-related disability was
estimated at $47 billion per year. Thus, the total economic cost
associated with nicotine addiction is greater than the combined
costs for all other types of addictive drugs.
[0008] Despite recent advances in behavioral and pharmacologic
treatments, the vast majority of cigarette smokers who try to quit
will fail (for overview see Fiore et al. (2000) Treating tobacco
use and dependence, clinical practice guideline, US Department of
Health and Human Services, Public Health Service). Nicotine
replacement therapy is one currently used medication, either in the
form of nicotine gum, inhaler, nasal spray or transdermal patches.
The efficacy of transdermal nicotine patches alone has been
questioned in a placebo-controlled, double-blinded clinical trial
(Joseph et al., N. Engl. Med. (1999), 340:1157-1158; Jorenby et
al., N. Engl. J. Med. (1999) 340:685-691). Furthermore, adverse
effects of nicotine gum such as mouth irritation, sore jaw muscles,
dyspepsia, nausea, hiccups and paresthesia and itching, erythema,
sleep disturbances, gastrointestinal problems, somnolence,
nervousness, dizziness and sweating for the nicotine patch were
observed. A treatment with the antidepressant bupropion can
increase the abstinence rates at 12 months to about 30% (Jorenby et
al., supra).
[0009] Novel approaches to the treatment and prevention of
addiction, to nicotine and to other drugs, are clearly needed.
Immunization strategies to modify the behavioral effects of drugs
have been the subject of investigation since 1974. Both active
immunization with morphine-6-hemisuccinate-BSA and passive
immunization with the resultant antibodies reduced heroin self
administration in rhesus monkeys (Bonese, et al. Nature 252:708-710
(1974); Killian, et al Pharmacol. Biochem. Behav. 9:347-352
(1978).) Immunization has also proven effective against cocaine
addiction. Active immunization reduced the effect of subsequent
cocaine administration in rats (Carrera et al Nature 379:727-730
(1995), and both active and passive immunization was demonstrated
to abolish self administration (Fox et al. Nature Med 2:1129-1132
(1996)). More recently, immunization with GNC-KLH conjugate
abolished self administration in cocaine-addicted rats (Carrera et
al Proc. Nat. Acad Sci USA 97:6202-62061992 (2000)) and both
immunization with GND-KLH conjugate or transfer of anti-cocaine
monoclonal antibodies blocked cocaine effects (Carrera et al Proc.
Nat. Acad Sci USA 98:1988-1992 (2001).
[0010] Antibodies have been raised against phencyclidine (PCP) and
show effectiveness in reducing PCP levels in the brain, reducing
behavioral effects, and show similar abilities to block the
physiologic effects of PCP analogs (Hardin et al. J Pharmacol Exp
Ther 285:1113-1122 (1998); Proksch et al. J. Pharmacol Exp Ther.
292:831-837 (2000)). Antibodies have also been successfully raised
against methamphetamine in rats (Byrnes-Blake et al. Int
Immunopharmacol 1:329-338 (2001)). U.S. Pat. No. 5,256,409
discloses a vaccine comprising a carrier protein bound to one
hapten from the desipramine/imipramine class of drugs and another
hapten from the nortriptyline/amitriptyline class of drugs.
[0011] Therefore, immune responses can be raised against drugs, the
antibodies can block drug action, and animal models have
demonstrated that vaccination is effective as a general approach to
the treatment of drug abuse and addiction. It is believed that
generating an immune response should block the actions of the drug
by preventing it from entering the central nervous system (Carrera
et al Nature 379:727-730 (1995). By reducing the rewards associated
with drug use, the addicted individual is no longer motivated to
consume the drug.
[0012] As the addictive effect of the drugs is caused by their
action in the brain, antibodies in serum should be able to reduce
drug delivery to brain. Cerny (WO 92/03163) described a vaccine and
immunoserum for use against drugs of abuse. The vaccine consisted
of a hapten bound to a carrier protein. Also disclosed therein was
the production of antibodies against drugs, and the use of these
antibodies in the detoxification of one who has taken the drug.
[0013] Nicotine, cocaine, heroin and most drugs of abuse are
haptens, which are not immunogenic. Coupling of haptens to protein
carriers typically enhances their immunogenicity.
[0014] Several different nicotine haptens, carriers and methods of
coupling have been described. Matsushita et al. (Biochem. Biophys.
Res. Comm. (1974) 57, 1006-1010) and Castro et al. (Eur. J.
Biochem. (1980) 104, 331-340) prepared nicotine haptens conjugated
to bovine serum albumin (BSA) via a linker at the 6-position of the
nicotine. Elsewhere, Castro et al. (Biochem. Biophys. Res. Commun.
(1975) 67, 583-589) disclosed two nicotine albumin conjugates:
N-succinyl-6-amino-(+/-)-nicotine-BSA and
6-(sigma-aminocapramido)-(+/-)-nicotine-BSA. Noguchi et al.
(Biochem. Biophys. Res. Comm. (1978) 83, 83-86) prepared a
nicotine-BSA conjugate with nicotine conjugated at the 1-position
of the nicotine. Langone et al. (Biochemistry (1973) 12, 5025-5030
and Meth. Enzymol. (1982) 84, 628-640) prepared the hapten
derivative O-succinyl-3'-hydroxymethyl-nicotine and conjugated it
to bovine serum albumin and keyhole limpet hemocyanin. According to
the procedures of Langone et al.(supra), Abad et al. (Anal. Chem.
(1993) 65, 3227-3231) synthesized the nicotine hapten
3'-(hydroxymethyl)-nicotine hemisuccinate and coupled it to bovine
serum albumin for immunization of mice to produce monoclonal
antibodies to nicotine. Isomura et al. (J. Org. Chem. (2001) 66,
4115-4121) provided methods to synthesize nicotine conjugates
linked to the 1'-position of nicotine, which were coupled to
keyhole limpet hemocyanin (KLH) and BSA. The conjugate to KLH was
used to immunize mice and to produce monoclonal antibodies against
nicotine. Svensson et al. (WO 99/61054) disclosed nicotine-haptens
conjugated via the pyridine ring and further disclosed a
nicotine-hapten conjugated to KLH and the induction of
nicotine-specific IgG antibodies using such conjugates. When
administered in the presence of complete Freund's adjuvant,
nicotine-specific ELISA titres of 1:3000 to 1:15500 were measured,
while in the absence of Freund's adjuvant titres of 1:500 to 1:3000
were detected. Ennifar et al. (U.S. Pat. No. 6,232,082) disclosed
nicotine haptens coupled via the pyrrolidine ring and disclosed a
nicotine-hapten conjugated to recombinant Psuedomonas aeruginosa
exotoxin A (rEPA) and the induction of nicotine-specific IgG
antibodies when the conjugates were administered in the presence of
complete Freund's adjuvant. Swain et al. (U.S. Pat. No. 5,876,727)
disclosed the coupling of a nicotine hapten to BSA and the
induction of nicotine-specific IgG antibodies in mice when the
conjugates were given in a mixture with complete Freund's
adjuvant.
[0015] The feasability of a vaccination against nicotine has been
shown in principle (Hieda et al., J. Pharm. Exp. Ther. (1997) 283,
1076-1081; Hieda et Psychopharm. (1999), 143, 150-157; Hieda et
al., Int. J. Immunopharm. (2000) 22, 809-819; Pentel et al., Pharm.
Biochem. Behav. (2000), 65, 191-198, Malin et al, Pharm. Biochem.
Behav. (2001), 68, 87-92). Covalent conjugates of nicotine with KLH
or rEPA were produced and injected into mice or rats in the
presence of complete Freund's adjuvant, and induced
nicotine-specific IgG antibodies. Vaccine efficacy was demonstrated
by several different ways. After challenge with nicotine, more
nicotine remained bound in serum and nicotine concentrations were
lower in the brain in the nicotine-KLH or nicotine-rEPA immunized
groups of rats compared to the control group immunized with carrier
alone. Immunization also reduced the psychopharmacological activity
associated with nicotine, as immunized animals were also less
susceptible to the effect of nicotine on locomoter activity,
dopamine release (Svensson et al. WO 99/61054) and relief of
nicotine withdrawal symptoms.
[0016] The above art demonstrates the efficacy of vaccine
compositions containing complete Freund's adjuvant to induce immune
responses against nicotine. Complete Freund's adjuvant is one of
the most potents adjuvants available, however because of its side
effects its use is not approved for humans. Therefore, there exists
a need for vaccine compositions able to induce strong immune
responses against nicotine without the use of complete Freund's
adjuvant. Further, while BSA has been used successfully as a
carrier in animal models it may not be appropriate for use in human
vaccine compositions because of the risk of adverse reactions such
as the risk of transmitting prion disease (variant
Creutzfeldt-Jakob disease). A further challenge to the development
of an effective vaccine against nicotine is the need for an immune
response able to rapidly decrease nicotine available for absorption
by the brain. Nicotine from cigarettes is taken up by mucosal
surfaces especially in the mouth and lungs and transported via the
blood to the brain. If nicotine-specific antibodies are to be
successful in reducing nicotine delivery to brain, they will have
to overcome the very high arterial nicotine concentration that is
presented to brain within seconds of inhalation (Hieda et al.,
1999, supra). Therefore, high concentrations of nicotine-specific
antibodies in the blood, which are mainly of the IgG subtype are
needed. In mucosal surfaces IgA antibodies are the primary subtype.
Accordingly, in addition to the antibodies in blood,
nicotine-specific antibodies of the IgA subtype in the lung would
be beneficial for neutralizing nicotine inhaled during smoking
before it begins circulating in the blood.
[0017] Cholera toxin, a known carrier protein in the art, can
induce IgA antibodies, in particular after intranasal
administration. Cholera toxin can also act as an adjuvant,
eliminating the need for complete Freund's adjuvant in a vaccine
composition. However, when cholera toxin is administered as a
mucosal adjuvant it stimulates a predominantly T.sub.H2-type immune
response with increased interleukin-4 levels and associated
increments in total and specific IgE antibody levels (Yamamoto et
al., (1997) Proc. Natl. Acad. Sci. USA 94, 5267-5272). After nasal
immunization in the presence of cholera toxin, IgE-associated
inflammatory reactions developed within the lungs of mice (Simecka
et al., (2000) Infect. Immunol. 68, 672-679, Hodge et al., (2001)
Infect. Immunol., 69, 2328-2338). Despite the promise of intranasal
immunization in the presence of cholera toxin, there is also the
potential to develop adverse immunopathological reactions
characterized by pulmonary airway inflammation (Hodge et al.,
(2001) Infect. Immunol., 69, 2328-2338).
[0018] Therefore, there exists a need for carrier systems able to
stimulate immune responses against hapten without the use of toxic
adjuvants, without the use of poorly tolerated carrier proteins
and, in certain situations, without stimulation of potentially
pathologic T.sub.H2 immune responses. Novel carrier systems meeting
these specifications can be used towards the formation of novel
conjugates and compositions suitable for the treatment of
addiction, among other conditions, for which there is currently an
urgent need.
BRIEF SUMMARY OF THE INVENTION
[0019] We have found that haptens attached to core particles
leading to highly ordered and repetitive hapten arrays are
surprisingly effective in inducing immune responses, particularly
antibodies, against haptens. Core particles, containing a first
attachment site, and haptens, containing a second attachment site,
are linked through said first and second attachment sites to form
said ordered and repetitive hapten arrays. The interaction between
first and second sites may be direct, or may involve at least one
other molecule, e.g. a linker.
[0020] In one embodiment, the first attachment site naturally
occurs in the core particle. Alternatively, the first attachment
site is added by chemical coupling or by recombinant techniques.
Preferred first attachment sites comprise amino groups, carboxyl
groups or sulfhydryl groups. Preferred amino acids comprising a
first attachment site are selected from lysine, arginine, cysteine,
aspartate, glutamate tyrosine and histidine. Particularly preferred
are lysine residues.
[0021] Suitable second attachment sites on haptens are amine,
amide, carboxyl and sulfhydryl groups. There is a wide range of
compounds that have been developed to enable crosslinking of
peptides/proteins or conjugation of protein to derivatized
molecules, by forming a covalent bond with a reactive group of a
protein molecule of the core particle.
[0022] Core particles with a first attachment site of the invention
include any particle suitable for the formation of ordered
repetitive arrays. In some embodiments such core particles include
virus-like particles (VLPs), bacteriophage, bacteriophage virus
like particles, pill, and the like. In certain embodiments these
are HbcAg bacteriophage VLP and type I pili. The invention also
provides variant forms of the core particles that remain able to
form ordered repetitive structure. Variant forms include
recombinant and natural forms, and mutant forms of core particles.
In certain embodiments, the mutant forms of the core particle
include those where the type of first attachment site, or number of
said sites, differ from the parent. Alteration of the number of
lysine residues on the core particle are particularly
preferred.
[0023] In certain embodiments, conjugates of the invention comprise
haptens suitable for inducing immune responses against a variety of
molecules, including but not limited to toxins, hormones and drugs.
More preferred are drugs, and yet more preferred are drugs of abuse
or addictive drugs. Haptens of the invention contain a second
attachment site for linkage to the first attachment site of the
core particle, either directly or via at least one linking
molecule. In one embodiment, the hapten is suitable for inducing
immune responses against cocaine, for example succinylated
norcocaine.
[0024] Preferred embodiments of the invention are nicotine-hapten
conjugates. Nicotine haptens suitable for the conjugates of the
present invention can have at least one, preferably one, side chain
bonded to any position on either the pyridine or the pyrrolidine
ring of the nicotine. Those skilled in the art know how to produce
suitable derivatives of nicotine haptens. For example, nicotine may
be chemically derivatized at the 3' position to provide an hydroxyl
residue that is suitable for reaction with reagents such as
succinic anhydride to form O-succinyl-3'-hydroxymethyl-nicotine.
This nicotine derivative may be coupled to amino acids of the core
particle, such as lysine, using the activation reagent EDC. In a
further preferred embodiment the
O-succinyl-3'-hydroxymethyl-nicotine can be activated with EDC and
the resulting activated carboxylic group is stabilized by
N-hydroxysuccinimide. In other embodiments, haptens are produced by
acylation of nornicotine with succinic anhydride in methylene
chloride in the presence of two equivalents of
diisopropylethylamine. Such a nicotine hapten is then coupled to
core particles of present invention with an activating reagent e.g.
HATU. Other methods and processes for synthesizing haptens suitable
for conjugates and compositions or the invention are provided.
[0025] The present invention provides compositions comprising a
core particle and a hapten, suitable for use in inducing immune
responses. Compositions of the invention include vaccine
compositions, with or without additional pharmaceutically
acceptable excipients or adjuvants. Methods for immunization are
provided. More preferred is intranasal immunization.
[0026] Compositions of the invention induce immune responses,
including the production of antibodies. Therefore, in another
embodiment, the invention provides methods of producing said
antibodies against such haptens. Such antibodies of the invention
are useful in treatment or prevention of diseases and for the
detection of haptens, for example in the methods of diagnosing
diseases or diseases associated with the presence of one or more
haptens in the tissues or circulation of an animal.
[0027] In a related embodiment, the invention is useful for the
prevention or treatment of diseases, disorders or conditions which
include, but are not limited to, poisoning by toxins, disregulation
of hormone levels, drug intoxication, or drug addiction and the
like. Immunization with the hapten-carrier conjugates of the
invention results in an immune response against the hapten, such
that immune molecules, particularly antibodies, bind the hapten.
Passive transfer of antibodies is also useful for the treatment and
prevention of diseases. Treatment of addiction is also useful in
the treatment of other diseases and conditions associated with
addiction.
[0028] We have found that nicotine-hapten conjugates attached to
virus-like particles induce high nicotine-specific IgG antibodies.
The present invention therefore provides a therapeutic for nicotine
addiction, which is based on an ordered and repetitive VLP-nicotine
conjugate. This therapeutic is able to induce high titers of
anti-nicotine antibodies in a vaccinated animal. High antibody
titers are induced even in the absence of adjuvants and encompass
not only IgG but also IgA subtypes. Furthermore, this therapeutic
is, surprisingly, not associated with induction of potentially
pathologic immune responses such as inflammation. Therapeutic
compositions of the invention comprise at least one nicotine hapten
molecule and a VLP, or at least one nicotine hapten and an
alternative core particle such as HbcAg or pili.
[0029] Thus, the invention embodies methods of treatment and
prevention comprising the use of the conjugates and compositions of
the invention. Such methods are useful in the therapy and
prophylaxis of diseases, disorders and conditions associated with
drugs, hormones and toxins.
[0030] In a further embodiment of the invention, a pharmaceutical
composition is provided for treating nicotine addiction, palliating
nicotine withdrawal symptoms, facilitating smoking cessation or
preventing relapse comprising a therapeutically effective
combination of the vaccine composition of the invention and an
additional agent. In one embodiment, the additional agent is
selected from the group consisting of: anti-depressant; nicotine
receptor modulator; cannabinoid receptor antagonist; opioid
receptor antagonist; monoamine oxidase inhibitor; anxiolytic or any
combination of these agents.
[0031] Other embodiments of the invention are kits suitable for
diagnosis and screening that utilize the conjugates, compositions
and methods of the present invention. Other embodiments of the
present invention will be apparent to one of ordinary skill in
light of what is known in the art, the following drawings and
description of the invention, and the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
[0032] FIGS. 1A and B depict SDS-PAGE and Westernblot analysis of
Nic-Q.beta. conjugates. The nicotine derivate Suc-Nic was coupled
to Q.beta. at different concentrations (1.times., 5.times.,
50.times., 100.times., and 500.times. molar excess). Aliquots of
the reaction solutions were loaded on a 16% SDS-PAGE gel and
stained with Coomassie Blue (A). From a gel run in parallel,
proteins were transferred onto nitrocellulose and detected with an
antiserum raised against nicotine-cholera toxin followed by a
HRPO-conjugated goat anti-mouse IgG and ECL detection (B).
Molecular weight markers are given on the left margin.
[0033] FIG. 2 depicts Nicotine-specific IgG antibodies and IgG
titer. Sera from vaccinated mice were tested for reactivity against
nicotine coupled to BSA by ELISA. Optical densities at 450 nm
obtained for each serum dilution are shown (A). Titers were
calculated from the dilution that gives half-maximal optical
density (B). Average of three mice in each group are shown.
[0034] FIGS. 3A, 3B, 3C and 3D depict Nicotine-specific IgG
subtypes. Sera from vaccinated mice were tested for reactivity
against nicotine coupled to BSA by ELISA and detected with
secondary antibodies specific for IgG subtypes IgG1 (A), IgG2a (B),
IgG2b (C) and IgG3 (D). Optical densities at 450 nm obtained for
each serum dilution are shown. Average of three mice in each group
are shown.
[0035] FIG. 4 depicts Nicotine-specific IgE antibodies. Sera from
vaccinated mice were tested for reactivity against nicotine coupled
to BSA by ELISA and detected with secondary antibodies specific for
the IgE subtype. Optical densities at 450 nm obtained for each
serum dilution are shown. Average of three mice in each group are
shown.
[0036] FIG. 5 depicts Nicotine-specific IgA antibodies. Sera from
vaccinated mice were tested for reactivity against nicotine coupled
to BSA by ELISA and detected with secondary antibodies specific for
the IgA subtype. Optical densities at 450 nm obtained for each
serum dilution are shown. Average of three mice in each group are
shown.
[0037] FIGS. 6A and B depict the efficacy of the Nicotine-VLP
vaccination. Mice were immunized with Nicotine-VLP and
concentrations of nicotine in serum and brain were measured after
injection of 3H-nicotine. Averages of four or five mice per group
are shown.
DETAILED DESCRIPTION OF THE INVENTION
[0038] It is to be understood that both the foregoing general
description and the following detailed description are exemplary
and explanatory only and are intended to provide further
explanation of the invention as claimed.
DEFINITIONS
[0039] The following definitions are summaries of concepts commonly
understood by one of ordinary skill in the relevant art and are
provided for the purposes of comprehension of the following
invention but are not meant to be a limitation of the
invention.
[0040] Adjuvant: The term "adjuvant" as used herein refers to
non-specific stimulators of the immune response or substances that
allow generation of a depot in the host which when combined with
the vaccine and pharmaceutical composition, respectively, of the
present invention may provide for an even more enhanced immune
response. A variety of adjuvants can be used. Examples include
complete and incomplete Freund's adjuvant, aluminum hydroxide and
modified muramyldipeptide. Further adjuvants are mineral gels such
as aluminum hydroxide, surface active substances such as
lysolecithin, pluronic polyols, polyanions, peptides, oil
emulsions, keyhole limpet hemocyanins, dinitrophenol, and
potentially useful human adjuvants such as BCG (bacille
Calmette-Guerin) and Corynebacterium parvum. Such adjuvants are
also well known in the art. Further adjuvants that can be
administered with the compositions of the invention include, but
are not limited to, Monophosphoryl lipid immunomodulator, AdjuVax
100a, QS-21, QS-18, CRL1005, Aluminum salts (Alum), MF-59, OM-174,
OM-197, OM-294, and Virosomal adjuvant technology. The adjuvants
can also comprise a mixture of these substances.
[0041] Immunologically active saponin fractions having adjuvant
activity derived from the bark of the South American tree Quillaja
Saponaria Molina are known in the art. For example QS21, also known
as QA21, is an Hplc purified fraction from the Quillaja Saponaria
Molina tree and it's method of its production is disclosed (as
QA21) in U.S. Pat. No. 5,057,540. Quillaja saponin has also been
disclosed as an adjuvant by Scott et al, Int. Archs. Allergy Appl.
Immun., 1985, 77, 409. Monosphoryl lipid A and derivatives thereof
are known in the art. A preferred derivative is 3 de-o-acylated
monophosphoryl lipid A. Further preferred adjuvants are described
in WO00/00462, the disclosure of which is herein incorporated by
reference.
[0042] However, an advantageous feature of the present invention is
the high immunogenicty of the inventive compositions. As already
outlined herein or will become apparent as this specification
proceeds, vaccines and pharmaceutical compositions devoid of
adjuvants are provided, in further alternative or preferred
embodiments, leading to vaccines and pharmaceutical compositions
for treating drug addiction, preferably nicotine addiction, being
devoid of adjuvants and, thus, having a superior safety profile
since adjuvants may cause side-effects. The term "devoid" as used
herein in the context of vaccines and pharmaceutical compositions
for treating drug addiction, preferably nicotine addiction, refers
to vaccines and pharmaceutical compositions that are used without
adjuvants.
[0043] Animal: As used herein, the term "animal" is meant to
include, for example, humans, sheep, elks, deer, mule deer, minks,
mammals, monkeys, horses, cattle, pigs, goats, dogs, cats, rats,
mice, birds, chicken, reptiles, fish, insects and arachnids.
[0044] Antibody: As used herein, the term "antibody" refers to
molecules which are capable of binding an epitope or antigenic
determinant. The term is meant to include whole antibodies and
antigen-binding fragments thereof; including single-chain
antibodies. Most preferably the antibodies are human antigen
binding antibody fragments and include, but are not limited to,
Fab, Fab' and F(ab')2, Fd, single-chain Fvs (scFv), single-chain
antibodies, disulfide-linked Fvs (sdFv) and fragments comprising
either a V.sub.L or V.sub.H domain. The antibodies can be from any
animal origin including birds and mammals. Preferably, the
antibodies are mammalian e.g. human, murine, rabbit, goat, guinea
pig, camel, horse and the like, or other suitable animals e.g.
chicken. As used herein, "human" antibodies include antibodies
having the amino acid sequence of a human immunoglobulin and
include antibodies isolated from human immunoglobulin libraries or
from animals transgenic for one or more human immunoglobulins and
that do not express endogenous immunoglobulins, as described, for
example, in U.S. Pat. No. 5,939,598, the disclosure of which is
incorporated herein by reference in its entirety.
[0045] Active immunization: As used herein, the term "active
immunization" refers to the induction of an immune response in an
individual, typically an animal, elicited by the administration of
an immunogen, vaccine, antigen or hapten-carrier conjugate. By
contrast, passive immunization refers to the conferral of immunity
in an individual by the transfer of immune molecules or cells into
said individual.
[0046] Alphavirus: As used herein, the term "alphavirus" refers to
any of the RNA viruses included within the genus Alphavirus.
Descriptions of the members of this genus are contained in Strauss
and Strauss, Microbial. Rev., 58:491-562 (1994). Examples of
alphaviruses include Aura virus, Bebaru virus, Cabassou virus,
Chikungunya virus, Easter equine encephalomyelitis virus, Fort
morgan virus, Getah virus, Kyzylagach virus, Mayoaro virus,
Middleburg virus, Mucambo virus, Ndumu virus, Pixuna virus, Tonate
virus, Triniti virus, Una virus, Western equine encephalomyelitis
virus, Whataroa virus, Sindbis virus (SIN), Semliki forest virus
(SFV), Venezuelan equine encephalomyelitis virus (VEE), and Ross
River virus.
[0047] Antigen: As used herein, the term "antigen" refers to a
molecule capable of being bound by an antibody. An antigen is
additionally capable of being recognized by the immune system
and/or being capable of inducing a humoral immune response and/or
cellular immune response leading to the activation of B- and/or
T-lymphocytes. This may, however, require that, at least in certain
cases, the antigen contains or is linked to a Th cell epitope and
is given in adjuvant. An antigen can have one or more epitopes (B-
and/or T-cell epitopes). The specific reaction referred to above is
meant to indicate that the antigen will preferably react, typically
in a highly selective manner, with its corresponding antibody or
TCR and not with the multitude of other antibodies or TCRs which
may be evoked by other antigens. Antigens as used herein may also
be mixtures of several individual antigens.
[0048] Antigenic determinant: As used herein, the term "antigenic
determinant" is meant to refer to that portion of an antigen that
is specifically recognized by either B- or T-lymphocytes.
B-lymphocytes responding to antigenic determinants produce
antibodies, whereas T-lymphocytes respond to antigenic determinants
by proliferation and establishment of effector functions critical
for the mediation of cellular and/or humoral immunity.
[0049] Association: As used herein, the term "association" as it
applies to the first and second attachment sites, refers to the
binding of the first and second attachment sites that is preferably
by way of at least one non-peptide bond. The nature of the
association may be covalent, ionic, hydrophobic, polar or any
combination thereof, preferably the nature of the association is
covalent.
[0050] Attachment Site, First: As used herein, the phrase "first
attachment site" refers to an element of the core particle to which
the second attachment site located on the antigen or antigenic
determinant may associate. The first attachment site may be a
protein, a polypeptide, an amino acid, a peptide, a sugar, a
polynucleotide, a natural or synthetic polymer, a secondary
metabolite or compound (biotin, fluorescein, retinol, digoxigenin,
metal ions, phenylmethylsulfonylfluoride), or a combination
thereof, or a chemically reactive group thereof. Multiple first
attachment sites are present on the surface of the non-natural
molecular scaffold in a repetitive configuration.
[0051] Attachment Site, Second: As used herein, the phrase "second
attachment site" refers to an element associated with the hapten to
which the first attachment site on the surface of the non-natural
molecular scaffold may associate. The second attachment site of the
hapten comprises any chemical moiety, preferably a amine, an amide,
a carboxyl, a sulfhydryl, hydroxyl, aldehyde, acylhalogenide,
hydrazine, diazonium, or hydrazide, or further chemical moieties
able to specifically react with the first attachment site.
Moreover, the second attachment site may comprise a polypeptide, a
peptide, a sugar, a polynucleotide, a natural or synthetic polymer,
a secondary metabolite or compound (biotin, fluorescein, retinol,
digoxigenin, metal ions, phenylmethylsulfonylfluoride), a
combination thereof, or a chemically reactive group thereof. At
least one second attachment site is present on the hapten. The term
"hapten" with at least one second attachment site" refers,
therefore, to a hapten construct comprising at least the hapten and
the second attachment site. However, in particular for a second
attachment site, which is not naturally occurring within the
hapten, these haptens comprise a linker which associates the hapten
with the second attachment site, or more preferably, already
comprises or contains the second attachment site.
[0052] Bound: As used herein, the term "bound" refers to binding or
attachment that may be covalent, e.g., by chemically coupling, or
non-covalent, e.g., ionic interactions, hydrophobic interactions,
hydrogen bonds, etc. Covalent bonds can be, for example, ester,
ether, phosphoester, amide, peptide, imide, carbon-sulfur bonds,
carbon-phosphorus bonds, and the like. The term "bound" is broader
than and includes terms such as "coupled," "fused" and
"attached".
[0053] Core particle: As used herein, the term "core particle"
refers to a rigid structure with an inherent repetitive
organization that provides a foundation for attachment of the first
attachment site. A core particle as used herein may be the product
of a synthetic process or the product of a biological process.
[0054] Coat protein(s): As used herein, the term "coat protein(s)"
refers to the protein(s) of a bacteriophage or a RNA-phage capable
of being incorporated within the capsid assembly of the
bacteriophage or the RNA-phage. However, when referring to the
specific gene product of the coat protein gene of RNA-phages the
term "CP" is used. For example, the specific gene product of the
coat protein gene of RNA-phage Q.beta. is referred to as "Q.beta.
CP", whereas the "coat proteins" of bacteriophage Qb comprise the
"Q.beta. CP" as well as the accessory A1 protein. The capsid of
Bacteriophage Q.beta. is composed mainly of the Q.beta. CP, with a
minor content of the A1 protein. Likewise, the VLP Q.beta. coat
protein contains mainly Q.beta. CP, with a minor content of A1
protein.
[0055] Conjugate: As used herein, the noun "conjugate" refers to
the product of conjugation between one or more of (a) a core
particle such as VLP, and one or more of (b) an organic molecule,
hapten, antigen or antigenic determinant as described elsewhere
herein, wherein the elements (a) and (b) are bound to each
other.
[0056] Composition: As used herein, the term "composition" refers
to a product of mixing or combining various elements or
ingredients.
[0057] Disease, disorder, condition: As used herein, the terms
"disease" or "disorder" refer to any adverse condition of an
individual including tumors, cancer, allergies, addiction,
autoimmunity, poisoning or impairment of optimal mental or bodily
function. "Conditions" as used herein includes diseases and
disorders but also refers to physiologic states. For example,
fertility is a physiologic state but not a disease or disorder.
Compositions of the invention suitable for preventing pregnancy by
decreasing fertility would therefore be described as a treatment of
a condition (fertility), but not a treatment of a disorder or
disease. Other conditions are understood by those of ordinary skill
in the art.
[0058] Effective Amount: As used herein, the term "effective
amount" refers to an amount necessary or sufficient to realize a
desired biologic effect. An effective amount of the composition
would be the amount that achieves this selected result, and such an
amount could be determined as a matter of routine by a person
skilled in the art. For example, an effective amount for treating
an immune system deficiency could be that amount necessary to cause
activation of the immune system, resulting in the development of an
antigen specific immune response upon exposure to antigen. The term
is also synonymous with "sufficient amount."
[0059] The effective amount for any particular application can vary
depending on such factors as the disease or condition being
treated, the particular composition being administered, the size of
the subject, and/or the severity of the disease or condition. One
of ordinary skill in the art can empirically determine the
effective amount of a particular composition of the present
invention without necessitating undue experimentation.
[0060] Epitope: As used herein, the term "epitope" refers to basic
element or smallest unit of recognition by an individual antibody
or T-cell receptor, and thus the particular domain, region or
molecular structure to which said antibody or T-cell receptor
binds. An antigen may consist of numerous epitopes while a hapten,
typically, may possess few epitopes.
[0061] Fusion: As used herein, the term "fusion" refers to the
combination of amino acid sequences of different origin in one
polypeptide chain by in-frame combination of their coding
nucleotide sequences. The term "fusion" explicitly encompasses
internal fusions, i.e., insertion of sequences of different origin
within a polypeptide chain, in addition to fusion to one of its
termini.
[0062] Hapten: As used herein, the term "hapten" refers to a
low-molecular weight organic compound that is not capable of
eliciting an immune response by itself but will elicit an immune
response once attached to a carrier molecule. Exemplary haptens
used in conjugates, compositions and methods of the invention
include drugs, hormones and toxins, but are not limited to these
specific haptens.
[0063] Heterologous sequence: As used herein, the term
"heterologous sequence" refers to a second sequence of nucleic acid
or protein that is not normally found with said nucleic acid or
protein and is, usually, artificially added to the sequence in
order to confer particular properties. In one example, heterologous
amino acids may be added to recombinant capsid proteins for the
purposes of purification of the protein, or to serve as a first
attachment site.
[0064] Isolated: As used herein, when the term "isolated" is used
in reference to a molecule, the term means that the molecule has
been removed from its native environment. For example, a
polynucleotide or a polypeptide naturally present in a living
animal is not "isolated," but the same polynucleotide or
polypeptide separated from the coexisting materials of its natural
state is "isolated." Further, recombinant DNA molecules contained
in a vector are considered isolated for the purposes of the present
invention. Isolated RNA molecules include in vivo or in vitro RNA
replication products of DNA and RNA molecules. Isolated nucleic
acid molecules further include synthetically produced molecules.
Additionally, vector molecules contained in recombinant host cells
are also isolated. Thus, not all "isolated" molecules need be
"purified."
[0065] Immune response: As used herein, the term "immune response"
refers to a humoral immune response and/or cellular immune response
leading to the activation or proliferation of B- and/or
T-lymphocytes and/or and antigen presenting cells. In some
instances, however, the immune responses may be of low intensity
and become detectable only when using at least one substance in
accordance with the invention. "Immunogenic" refers to an agent
used to stimulate the immune system of a living organism, so that
one or more functions of the immune system are increased and
directed towards the immunogenic agent. An "immunogenic
polypeptide" is a polypeptide that elicits a cellular and/or
humoral immune response, whether alone or linked to a carrier in
the presence or absence of an adjuvant. Preferably, antigen
presenting cell may be activated.
[0066] A substance which "enhances" an immune response refers to a
substance in which an immune response is observed that is greater
or intensified or deviated in any way with the addition of the
substance when compared to the same immune response measured
without the addition of the substance. For example, the lytic
activity of cytotoxic T cells can be measured, e.g. using a
.sup.51Cr release assay, in samples obtained with and without the
use of the substance during immunization. The amount of the
substance at which the CTL lytic activity is enhanced as compared
to the CTL lytic activity without the substance is said to be an
amount sufficient to enhance the immune response of the animal to
the antigen. In a preferred embodiment, the immune response in
enhanced by a factor of at least about 2, more preferably by a
factor of about 3 or more. The amount or type of cytokines secreted
may also be altered. Alternatively, the amount of antibodies
induced or their subclasses may be altered.
[0067] Immunization: As used herein, the terms "immunize" or
"immunization" or related terms refer to conferring the ability to
mount a substantial immune response (comprising antibodies and/or
cellular immunity such as effector CTL) against a target antigen or
epitope. These terms do not require that complete immunity be
created, but rather that an immune response be produced which is
substantially greater than baseline. For example, a mammal may be
considered to be immunized against a target antigen if the cellular
and/or humoral immune response to the target antigen occurs
following the application of methods of the invention.
[0068] Immunotherapeutic: As used herein, the term
"immunotherapeutic" refers to a composition for the treatment of
diseases, disorders or conditions. More specifically, the term is
used to refer to a method of treatment wherein a beneficial immune
response is generated by vaccination or by transfer of immune
molecules.
[0069] Immunologically effective amount: As used herein, the term
"immunologically effective amount" refers to an amount of a
composition sufficient to induce an immune response in an
individual when introduced into that individual. In the context of
active immunization, the term is synonymous with "immunogenically
effective amount." The amount of a composition necessary to be
immunologically effective varies according many factors including
to the composition, the presence of other components in the
composition (e.g. adjuvants), the antigen, the route of
immunization, the individual, the prior immune or physiologic state
etc.
[0070] Individual: As used herein, the term "individual" refers to
multicellular organisms and includes both plants and animals.
Preferred multicellular organisms are animals, more preferred are
vertebrates, even more preferred are mammals, and most preferred
are humans.
[0071] Low or undetectable: As used herein, the phrase "low or
undetectable," when used in reference to gene expression level,
refers to a level of expression which is either significantly lower
than that seen when the gene is maximally induced (e.g., at least
five fold lower) or is not readily detectable by the methods used
in the following examples section.
[0072] Lectin: As used herein, proteins obtained particularly from
the seeds of leguminous plants, but also from many other plant and
animal sources, that have binding sites for specific mono- or
oligosaccharides. Examples include concanavalin A and wheat-germ
agglutinin, which are widely used as analytical and preparative
agents in the study of glycoprotein.
[0073] Natural origin: As used herein, the term "natural origin"
means that the whole or parts thereof are not synthetic and exist
or are produced in nature.
[0074] Non-natural: As used herein, the term generally means not
from nature, more specifically, the term means from the hand of
man.
[0075] Non-natural origin: As used herein, the term "non-natural
origin" generally means synthetic or not from nature; more
specifically, the term means from the hand of man.
[0076] Non-natural molecular scaffold: As used herein, the phrase
"non-natural molecular scaffold" refers to any product made by the
hand of man that serves to provide a rigid and repetitive array of
first attachment sites. Ideally but not necessarily, these first
attachment sites are in a geometric order. The non-natural
molecular scaffold may be organic or non-organic and may be
synthesized chemically or through a biological process, in part or
in whole. The non-natural molecular scaffold is comprised of: (a) a
core particle, either of natural or non-natural origin; and (b) at
least one first attachment site that is connected to a core
particle by at least one covalent bond. In a particular embodiment,
the non-natural molecular scaffold may be a virus, virus-like
particle, a bacterial pilus, a virus capsid particle, a phage, a
recombinant form thereof, or synthetic particle.
[0077] Nicotine hapten: The term "nicotine hapten" as used in the
present invention refers to nicotine, either in its
enantiomerically pure (S)- or (R)-form or a mixture thereof, which
could be derivatized in such manner as to contain at least one
second attachment site which, then, is capable of associating with
the first attachment site of the carrier either directly, or via a
cross-linker. Preferably, the nicotine hapten is derivatized in
such manner as to contain only one second attachment site. This
derivatization further increases the order and repetitiveness of
the nicotine hapten-carrier conjugate and ensures a directed and
controlled coupling of the nicotine hapten to the carrier.
[0078] Ordered and repetitive antigen or antigenic determinant
array: As used herein, the term "ordered and repetitive antigen or
antigenic determinant array" generally refers to a repeating
pattern of antigen or antigenic determinant, characterized by a
uniform spacial arrangement of the antigens or antigenic
determinants with respect to the non-natural molecular scaffold. In
one embodiment of the invention, the repeating pattern may be a
geometric pattern. Typical and preferred examples of suitable
ordered and repetitive antigen or antigenic determinant arrays are
those which possess strictly repetitive paracrystalline orders of
antigens or antigenic determinants, preferably with spacings of 0.5
to 30 nanometers, more preferably with spacings of 5 to 15
nanometers.
[0079] Passive immunization: as used herein, the term "passive
immunization" refers to conferral of immunity by the
administration, by any route, of exogenously produced immune
molecules (e.g. antibodies) or cells (e.g. T-cells) into an animal.
Passive immunization differs from "active" immunization, where
immunity is obtained by introduction of an immunogen, vaccine,
antigen or hapten-carrier conjugate into an individual to elicit an
immune response.
[0080] Pili: As used herein, the term "pili" (singular being
"pilus") refers to extracellular structures of bacterial cells
composed of protein monomers (e.g., pilin monomers) which are
organized into ordered and repetitive patterns. Further, pili are
structures which are involved in processes such as the attachment
of bacterial cells to host cell surface receptors, inter-cellular
genetic exchanges, and cell-cell recognition. Examples of pili
include Type-1 pili, P-pili, F1C pili, S-pili, and 987P-pili.
Additional examples of pili are set out elsewhere herein.
[0081] Pilus-like structure: As used herein, the phrase "pilus-like
structure" refers to structures having characteristics similar to
that of pili and composed of protein monomers. One example of a
"pilus-like structure" is a structure formed by a bacterial cell
which expresses modified pilin proteins that do not form ordered
and repetitive arrays that are essentially identical to those of
natural pili.
[0082] Polypeptide: As used herein, the term "polypeptide" refers
to a molecule composed of monomers (amino acids) linearly linked by
amide bonds (also known as peptide bonds). It indicates a molecular
chain of amino acids and does not refer to a specific length of the
product. Thus, peptides, dipeptides, tripeptides, oligopeptides and
proteins are included within the definition of polypeptide. This
term is also intended to refer to post-expression modifications of
the polypeptide, for example, glycosolations, acetylations,
phosphorylations, and the like. A recombinant or derived
polypeptide is not necessarily translated from a designated nucleic
acid sequence. It may also be generated in any manner, including
chemical synthesis.
[0083] Protein: As used herein, the term protein refers to a
polypeptide generally of a size of above about 5 or more, 10 or
more 20 or more, 25 or more, 50 or more, 75 or more, 100 or more,
200 or more, 500 or more, 1000 or more, 2000 or more amino acids.
Proteins generally have a defined three dimensional structure
although they do not necessarily need to, and are often referred to
as folded, as opposed to peptides and polypeptides which often do
not possess a defined three-dimensional structure, but rather can
adopt a large number of different conformations, and are referred
to as unfolded. Peptides may, however, adopt three dimensional
structures. The defined three-dimensional structures of proteins is
especially important for the association between the core particle
and the antigen, mediated by the second attachment site, and in
particular by way of chemical cross-linking between the first and
second attachment site using a chemical cross-linker. The amino
acid linker is also intimately related to the structural properties
of proteins in some aspects of the invention.
[0084] Purified: As used herein, when the term "purified" is used
in reference to a molecule, it means that the concentration of the
molecule being purified has been increased relative to molecules
associated with it in its natural environment, or environment in
which it was produced, found or synthesized. Naturally associated
molecules include proteins, nucleic acids, lipids and sugars but
generally do not include water, buffers, and reagents added to
maintain the integrity or facilitate the purification of the
molecule being purified. For example, even if mRNA is diluted with
an aqueous solvent during oligo dT column chromatography, mRNA
molecules are purified by this chromatography if naturally
associated nucleic acids and other biological molecules do not bind
to the column and are separated from the subject mRNA molecules.
According to this definition, a substance may be 5% or more, 10% or
more, 20% or more, 30% or more, 40% or more, 50% or more, 60% or
more, 70% or more, 80% or more, 90% or more, 95% or more, 98% or
more, 99% or more, or 100% pure when considered relative to its
contaminants.
[0085] Receptor: As used herein, the term "receptor" refers to
proteins or glycoproteins or fragments thereof capable of
interacting with another molecule, called the ligand. The ligand
may belong to any class of biochemical or chemical compounds. The
receptor need not necessarily be a membrane-bound protein. Soluble
protein, like e.g., maltose binding protein or retinol binding
protein are receptors as well.
[0086] Residue: As used herein, the term "residue" is meant to mean
a specific amino acid in a polypeptide backbone or side chain.
[0087] Recombinant host cell: As used herein, the term "recombinant
host cell" refers to a host cell into which one or more nucleic
acid molecules of the invention have been introduced.
[0088] Recombinant virus: As used herein, the phrase "recombinant
virus" refers to a virus that is genetically modified by the hand
of man. The phrase covers any virus known in the art. More
specifically, the phrase refers to a an alphavirus genetically
modified by the hand of man, and most specifically, the phrase
refers to a Sinbis virus genetically modified by the hand of
man.
[0089] RNA-phage, RNA-bacteriophage: As used herein, the term
"RNA-bacteriophage," or its abbreviated form "RNA-phage" refers to
RNA viruses infecting bacteria, preferably to single-stranded
positive-sense RNA viruses infecting bacteria.
[0090] Self antigen: As used herein, the tem "self antigen" refers
to proteins encoded by the host's DNA and products generated by
proteins or RNA encoded by the host's DNA are defined as self. In
addition, proteins that result from a combination of two or several
self-molecules or that represent a fraction of a self-molecule and
proteins that have a high homology two self-molecules as defined
above (>95%, preferably >97%, more preferably >99%) may
also be considered self.
[0091] Vaccine: As used herein, the term "vaccine" refers to a
formulation which contains the composition of the present invention
and which is in a form that is capable of being administered to an
animal. Typically, the vaccine comprises a conventional saline or
buffered aqueous solution medium in which the composition of the
present invention is suspended or dissolved. In this form, the
composition of the present invention can be used conveniently to
prevent, ameliorate, or otherwise treat a condition. Upon
introduction into a host, the vaccine is able to provoke an immune
response including, but not limited to, the production of
antibodies and/or cytokines and/or the activation of cytotoxic T
cells, antigen presenting cells, helper T cells, dendritic cells
and/or other cellular responses. Optionally, the vaccine of the
present invention additionally includes an adjuvant which can be
present in either a minor or major proportion relative to the
compound of the present invention.
[0092] Vector: As used herein, the term "vector" refers to an agent
(e.g., a plasmid or virus) used to transmit genetic material to a
host cell. A vector may be composed of either DNA or RNA.
[0093] Virus-like particle: As used herein, the term "virus-like
particle" refers to a structure resembling a virus particle.
Moreover, a virus-like particle in accordance with the invention is
non replicative and noninfectious since it lacks all or part of the
viral genome, in particular the replicative and infectious
components of the viral genome. A virus-like particle in accordance
with the invention may contain nucleic acid distinct from their
genome.
[0094] Virus-like particle of a bacteriophage: As used herein, the
term "virus-like particle of a bacteriophage" refers to a
virus-like particle resembling the structure of a bacteriophage,
being non replicative and noninfectious, and lacking at least the
gene or genes encoding for the replication machinery of the
bacteriophage, and typically also lacking the gene or genes
encoding the protein or proteins responsible for viral attachment
to or entry into the host. A virus-like particle in accordance with
the invention lacks all or part of the viral genome, in particular
the replicative and infectious components of the viral genome. A
virus-like particle in accordance with the invention may contain
nucleic acid distinct from their genome. A typical and preferred
embodiment of a virus-like particle in accordance with the present
invention is a viral capsid such as the viral capsid of the
corresponding virus, bacteriophage, or RNA-phage. The terms "viral
capsid" or "capsid", as interchangeably used herein, refer to a
macromolecular assembly composed of viral protein subunits.
Typically and preferably, the viral protein subunits assemble into
a viral capsid and capsid, respectively, having a structure with an
inherent repetitive organization, wherein said structure is,
typically, spherical or tubular. For example, the capsids of
RNA-phages or HBcAg's have a spherical form of icosahedral
symmetry. The term "capsid-like structure" as used herein, refers
to a macromolecular assembly composed of viral protein subunits
ressembling the capsid morphology in the above defined sense but
deviating from the typical symmetrical assembly while maintaining a
sufficient degree of order and repetitiveness.
[0095] Virus-like particle of a bacteriophage: As used herein, the
term "virus-like particle of a bacteriophage" refers to a
virus-like particle resembling the structure of a bacteriophage,
being non replicative and noninfectious, and lacking at least the
gene or genes encoding for the replication machinery of the
bacteriophage, and typically also lacking the gene or genes
encoding the protein or proteins responsible for viral attachment
to or entry into the host. This definition should, however, also
encompass virus-like particles of bacteriophages, in which the
aforementioned gene or genes are still present but inactive, and,
therefore, also leading to non-replicative and noninfectious
virus-like particles of a bacteriophage.
[0096] VLP of RNA phage coat protein: The capsid structure formed
from the self-assembly of 180 subunits of RNA phage coat protein
and optionally containing host RNA is referred to as a "VLP of RNA
phage coat protein". A specific example is the VLP of Q.beta. coat
protein. In this particular case, the VLP of Q.beta. coat protein
may either be assembled exclusively from Q.beta. CP subunits
(generated by expression of a Q.beta. CP gene containing, for
example, a TAA stop codon precluding any expression of the longer
A1 protein through suppression, see Kozlovska, T. M., et al.,
Intervirology 39: 9-15 (1996)), or additionally contain A1 protein
subunits in the capsid assembly.
[0097] Virus particle: The term "virus particle" as used herein
refers to the morphological form of a virus. In some virus types it
comprises a genome surrounded by a protein capsid; others have
additional structures (e.g., envelopes, tails, etc.).
[0098] One, A, or An: When the terms "one," "a" or "an" are used in
this disclosure, they mean "at least one" or "one or more" unless
otherwise indicated.
[0099] As used herein when referring to any numerical value, the
term "about" means a value of .+-.10% of the stated value (e.g.,
"about 50.degree. C." encompasses a range of temperatures from
45.degree. C. to 55.degree. C., inclusive; similarly, "about 100
mM" encompasses a range of concentrations from 90 mM to 110 mM
inclusive).
Overview
[0100] In one aspect, the invention provides conjugates of one or
more haptens with a carrier in an ordered and repetitive
hapten-carrier conjugate, and methods of making such conjugates.
The invention also provides compositions comprising at least one
such conjugate of the invention and at least one other component,
suitably at least one excipient or carrier and particularly at
least one pharmaceutically acceptable excipient or carrier. Haptens
suitably used in the conjugates and compositions of the invention
include but are not limited to hormones, toxins and drugs,
especially drugs of addiction, such as nicotine. The conjugates and
compositions of the invention are useful for inducing immune
responses against haptens. Such an immune response can be utilized
to generate antibodies, useful for therapeutic, prophylactic and
diagnostic purposes. Immune response can be useful to prevent or
treat addiction to drugs of abuse and the resultant diseases
associated with drug addiction.
[0101] The conjugates of the present invention comprise highly
ordered and repetitive arrays of haptens. Conjugate arrays
according to this aspect of the invention comprise (a) a core
particle, comprising a first attachment site and (b) a hapten
comprising a second attachment site, wherein the elements (a) and
(b) are linked through the first and second attachment sites to
form said ordered and repetitive hapten arrays.
[0102] Core particles suitably used in the conjugates and
compositions of the invention may be natural or non-natural.
Natural core particles of the present invention include virus
particles, virus-like particles, and pili. The proteins of these
natural core particles may be natural or recombinant. The first
attachment sites on the core particle may occur naturally or may be
introduced via chemical or recombinant means. Haptens of the
present invention are those suitable for inducing immune responses
against a variety of molecules, including but not limited to
toxins, hormones and drugs, particularly drugs of abuse and or
addiction. The second attachment site on the hapten may naturally
occur or be introduced. The interaction between first and second
sites may be direct, or may involve at least one other molecule,
e.g. a linker. Linkers include cross-linking molecules.
[0103] The conjugates and compositions of the invention are
suprisingly effective in inducing immune responses, particularly
antibodies, against haptens. Thus, they are useful in compositions
suitable for immunization of animals for therapeutic or prophylaxis
against diseases, disorders or conditions associated with various
drugs, hormones or toxins. Antibodies produced by immunization with
the conjugates and compositions of the invention are also useful
for therapeutic and prophylactic purposes.
[0104] In other embodiments, the invention provides methods of
treatment and prevention of a disease utilizing the conjugates and
compositions of the invention. In another embodiment, the invention
provides kits suitable for diagnosis and screening.
Compositions of Ordered and Repetitive Antigen or Antigenic
Determinant Arrays and Methods to Make the Same
[0105] The present invention provides conjugates, and compositions
of conjugates, comprising an ordered and repetitive hapten array.
Furthermore, the invention conveniently enables the practitioner to
construct ordered and repetitive hapten arrays for various
purposes, and preferably the induction of an immune response
against organic molecules.
[0106] Conjugates of the invention essentially comprise, or
alternatively consist of, two elements: (1) a non-natural molecular
scaffold; and (2) a hapten with at least one second attachment site
capable of association through at least one bond to said first
attachment site.
[0107] The non-natural molecular scaffold comprises, or
alternatively consists of (a) a core particle selected from the
group consisting of (1) a core particle of non-natural origin and
(2) a core particle of natural origin; and (b) at least one first
attachment site connected to said core particle by at least one
covalent bond. Core particles used in the conjugates, compositions
and methods of the invention include inorganic molecules, virus
particles, virus-like particles, and bacterial pili. The haptens
used in the conjugates, compositions and methods of the invention
has at least one second attachment site which is selected from the
group consisting of (a) an attachment site not naturally occurring
with said hapten; and (b) an attachment site naturally occurring
with said antigen or antigenic determinant.
[0108] The invention provides for an ordered and repetitive hapten
array through an association of the second attachment site to the
first attachment site by way of at least one bond. Thus, the hapten
and the non-natural molecular scaffold are brought together through
this association of the first and the second attachment site to
form an ordered and repetitive antigen array.
[0109] The practitioner may specifically design the hapten and the
second attachment site such that the arrangement of all the haptens
bound to the non-natural molecular scaffold or, in certain
embodiments, the core particle will be uniform. For example, one
may place a single second attachment site on the hapten, thereby
ensuring through design that all haptens that are attached to the
non-natural molecular scaffold are positioned in a uniform way.
Thus, the invention provides a convenient means of placing any
hapten onto a non-natural molecular scaffold in a defined order and
in a manner which forms a repetitive pattern.
[0110] As will be clear to those of ordinary skill in the art,
certain embodiments of the invention involve the use of recombinant
nucleic acid technologies such as cloning, polymerase chain
reaction, the purification of DNA and RNA, the expression of
recombinant proteins in prokaryotic and eukaryotic cells, etc. Such
methodologies are well known to those skilled in the art and may be
conveniently found in published laboratory methods manuals (e.g.,
Sambrook, J. et al., eds., MOLECULAR CLONING, A LABORATORY MANUAL,
2nd. edition, Cold Spring Harbor Laboratory Press, Cold Spring
Harbor, N.Y. (1989); Ausubel, F. et al., eds., CURRENT PROTOCOLS IN
MOLECULAR BIOLOGY, John H. Wiley & Sons, Inc. (1997)).
Fundamental laboratory techniques for working with tissue culture
cell lines (Celis, J., ed., CELL BIOLOGY, Academic Press, 2.sup.nd
edition, (1998)) and antibody-based technologies (Harlow, E. and
Lane, D., "Antibodies: A Laboratory Manual," Cold Spring Harbor
Laboratory, Cold Spring Harbor, N.Y. (1988); Deutscher, M. P.,
"Guide to Protein Purification," Meth. Enzymol. 128, Academic Press
San Diego (1990); Scopes, R. K., "Protein Purification Principles
and Practice," 3.sup.rd ed., Springer-Verlag, New York (1994)) are
also adequately described in the literature, all of which are
incorporated herein by reference.
[0111] Furthermore, technologies for coupling organic molecules to
amino acids and means for making derivatives of haptens containing
appropriate second attachment sites such as are necessary for the
practice of the invention are well known to those of skill in the
art. Such methodologies may be found in chemical text books and
publications, examples of which are included below and are
incorporated by reference; U.S. Pat. No. 5,876,727; WO 99/61054;
Isomura, S. et al. J. Org. Chem. 66:4115-4121 (2001); Matsushita,
H. et al. Biochem. Biophys. Res. Comm. 57:1006-1010. (1974);
Langone, J. L. and Van Vunakis, H., Methods Enzymol. 84:628-640
(1982); Wong, Chemistry of Protein Conjugation and Cross-Linking.
CRC Press, Inc., Boca Raton, Fla. (1991.)
Core Particles and Non-Natural Molecular Scaffolds
[0112] In one embodiment, the present invention provides methods
for the formation of an ordered and repetitive array of haptens. By
the invention, this occurs by the association of a core particle to
which is attached one or more haptens via first and second
attachment sites.
[0113] Thus, one element in certain conjugates and compositions of
the invention is a non-natural molecular scaffold comprising, or
alternatively consisting of, a core particle and a first attachment
site. More specifically, the non-natural molecular scaffold
comprises, or alternatively consists of, (a) a core particle of
natural or non-natural origin and (b) at least one first attachment
site connected to the core particle by at least one covalent
bond.
[0114] Core Particles.
[0115] In one embodiment of the present invention, a core particle
is a synthetic polymer, a lipid micelle or a metal. Such core
particles are known in the art, providing a basis from which to
build the non-natural molecular scaffold of the invention. By way
of example, synthetic polymer or metal core particles are disclosed
in U.S. Pat. No. 5,770,380, and U.S. Pat. No. 5,334,394, which are
incorporated by reference herein in their entireties. Suitable
metals include, but are not limited to, chromium, rubidium, iron,
zinc, selenium, nickel, gold, silver, platinum. Suitable ceramic
materials include, but are not limited to, silicon dioxide,
titanium dioxide, aluminum oxide, ruthenium oxide and tin oxide.
The core particles of this embodiment may be made from organic
materials including, but not limited to, carbon and suitable
polymers, including polystyrene, nylon and nitrocellulose. For
nanocrystalline particles, particles made from tin oxide, titanium
dioxide or carbon (diamond) are useful. Lipid micelles for use in
the present invention are prepared by any means known in the art,
for example, Baiselle and Millar (Biophys. Chem. 4:355-361 (1975))
or Corti et al. (Chem. Phys. Lipids 38:197-214 (1981)) or Lopez et
al. (FEBS Lett. 426:314-318 (1998)) or Topchieva and Karezin (J.
Colloid Interface Sci. 213:29-35 (1999)) or Morein et al., (Nature
308:457-460 (1984)), which are incorporated herein by reference in
their entireties.
[0116] In one embodiment of the invention the core particle is
produced through a biological process, which may be natural or
non-natural. For example, viruses and bacterial pili or pilus-like
structures are formed from proteins which are organized into
ordered and repetitive structures. Therefore, the present invention
comprises conjugates, compositions and methods comprising useful
core particles which include, but are not limited to a virus,
virus-like particle, a bacterial pilus, a phage, a viral capsid
particle or fragments thereof. In certain such embodiments, the
proteins may be recombinant.
[0117] In certain embodiments, the core particle of the non-natural
molecular scaffold comprises a virus, a bacterial pilus, a
structure formed from bacterial pilin, a bacteriophage, a
virus-like particle, a viral capsid particle or a recombinant form
thereof. Any virus known in the art having an ordered and
repetitive coat and/or core protein structure may be selected for
use as in the methods, conjugates and compositions of the invention
as a non-natural molecular scaffold. Examples of suitable viruses
include, but are not limited to, sindbis and other alphaviruses,
rhabdoviruses (e.g. vesicular stomatitis virus), picornaviruses
(e.g., human rhino virus, Aichi virus), togaviruses (e.g., rubella
virus), orthomyxoviruses (e.g., Thogoto virus, Balken virus, fowl
plague virus), polyomaviruses (e.g., polyomavirus BK, polyomavirus
JC, avian polyomavirus BFDV), parvoviruses, rotaviruses,
bacteriophage Q.beta., bacteriophage R17, bacteriophage M11,
bacteriophage MX1, bacteriophage NL95, bacteriophage fr,
bacteriophage GA, bacteriophage SP, bacteriophage MS2,
bacteriophage f2, bacteriophage PP7, bacteriophage AP205, Norwalk
virus, foot and mouth disease virus, a retrovirus, Hepatitis B
virus, Tobacco mosaic virus, Flock House Virus, and human
Papilomavirus (for example, see Table 1 in Bachman, M. F. and
Zinkernagel, R. M., Immunol. Today 17:553-558 (1996)). In more
specific exemplary embodiments of the present invention the core
particle may comprise, or alternatively consist of, recombinant
proteins of Rotavirus, recombinant proteins of Norwalk virus,
recombinant proteins of Alphavirus, recombinant proteins which form
bacterial pili or pilus-like structures, recombinant proteins of
Foot and Mouth Disease virus, recombinant proteins of Retrovirus,
recombinant proteins of Hepatitis B virus (e.g., a HBcAg),
recombinant proteins of Tobacco mosaic virus, recombinant proteins
of Flock House Virus, and recombinant proteins of human
Papillomavirus.
[0118] The core particle used in conjugates, compositions and
methods of the invention may further comprise, or alternatively
consist of, one or more fragments of such proteins, as well as
variants of such proteins which retain the ability to associate
with each other to form ordered and repetitive antigen or antigenic
determinant arrays. For example, as explained in WO 02/056905 core
particles may be formed from variant forms of the human HBcAg which
differ markedly from the wild-type particle in amino acid sequence
identity and similarity, and in sequence length. For example, amino
acid sequence of the HBcAg of Hepatitis B viruses which infect snow
geese and ducks differs sufficiently from that of HBcAg of viruses
infected mammals that alignment of the proteins is difficult.
However, both viruses retain the ability to form core structures
suitable for the formation of ordered repetitive hapten arrays.
Similarly, HBcAg may retain the ability to form multimeric
particles, typical of a virus, after removal of N-terminal leader
sequences, further deletions, substitutions, or additions to the
sequence. Methods which can be used to determine whether proteins
form such structures comprise gel filtration, agarose gel
electrophoresis, sucrose gradient centrifugation and electron
microscopy (e.g., Koschel, M. et al., J. Virol 73: 2153-2160
(1999)),
[0119] First Attachment Sites.
[0120] Whether natural or non-natural, the core particle used in
the conjugates, compositions and methods of the present invention
will generally possess a component comprising a first attachment
site that is attached to the natural or non-natural core particle
by at least one covalent bond. The element comprising the first
attachment site is bound to a core particle in a non-random fashion
that provides a nucleation site for creating an ordered and
repetitive antigen array. Ideally, but not necessarily, this
element is associated with the core particle in a geometric order.
The first attachment site may be a natural part of the core
particle, such as a surface exposed amino acid residue suitable for
coupling to the second attachment site. For example, lysine and
cysteine may form non-peptide bonds via reactive groups on the
amino acid. Alternatively, an element containing the first
attachment site may be introduced into the core particle via
chemical coupling or through the design of recombinant molecules.
The first attachment site may be, or be found on, any element
comprising bound to a core particle by at least one covalent
bond.
[0121] Elements comprising, or alternatively consisting of, the
first attachment site may be proteins, a polypeptide, a peptide, an
amino acid (i.e., a residue of a protein, a polypeptide or
peptide), a sugar, a polynucleotide, a natural or synthetic
polymer, a secondary metabolite or compound (biotin, fluorescein,
retinol, digoxigenin, metal ions, phenylmethylsulfonylfluoride), or
a combination thereof, or a chemically reactive group thereof. In a
more specific embodiment, the first attachment site comprising an
antigen, an antibody or antibody fragment, biotin, avidin,
strepavidin, a receptor, a receptor ligand, a ligand, a
ligand-binding protein, an interacting leucine zipper polypeptide,
an amino group, a chemical group reactive to an amino group; a
carboxyl group, chemical group reactive to a carboxyl group, a
sulthydryl group, a chemical group reactive to a sulthydryl group,
or a combination thereof.
[0122] In one embodiment, the invention utilizes genetic
engineering of a virus to create a fusion between an ordered and
repetitive viral envelope protein the element comprising the first
attachment site which comprising a heterologous protein, peptide,
antigenic determinant or a reactive amino acid residue of choice.
Other genetic manipulations known to those in the art may be
included in the construction of the non-natural molecular scaffold;
for example, it may be desirable to restrict the replication
ability of the recombinant virus through genetic mutation. The
viral protein selected for fusion to the protein containing the
first attachment site protein should have an organized and
repetitive structure. Such an organized and repetitive structure
include paracrystalline organizations with a spacing of 0.5-30,
preferably 5-15 nm, on the surface of the virus. The creation of
this type of fusion protein will result in multiple, ordered and
repetitive first attachment sites on the surface of the virus.
Thus, the ordered and repetitive organization of the first
attachment sites resulting therefrom will reflect the normal
organization of the native viral protein.
[0123] As will be understood by those of ordinary skill in the art,
the first attachment site may be or be a part of any suitable
protein, polypeptide, sugar, polynucleotide, peptide (amino acid),
natural or synthetic polymer, a secondary metabolite or combination
thereof that may serve to specifically attach the antigen or
antigenic determinant of choice to the non-natural molecular
scaffold. In one embodiment, the attachment site is a protein or
peptide that may be selected from those known in the art. For
example, the first attachment site may be a ligand, a receptor, a
lectin, avidin, streptavidin, biotin, an epitope such as an HA or
T7 tag, Myc, Max, immunoglobulin domains and any other amino acid
sequence known in the art that would be useful as a first
attachment site.
[0124] It will be further understood by those of ordinary skill in
the art that with another embodiment of the invention, the first
attachment site may be created secondarily to the creation of an
element carrying the first attachment site (i.e., protein or
polypeptide) utilized in constructing the in-frame fusion to the
capsid protein. For example, a protein may be utilized for fusion
to the envelope protein with an amino acid sequence known to be
glycosylated in a specific fashion, and the sugar moiety added as a
result may then serve at the first attachment site of the viral
scaffold by way of binding to a lectin serving as the secondary
attachment site of an antigen. Alternatively, a sequence may be
biotinylated in vivo and the biotin moiety may serve as the first
attachment site of the invention, or the sequence may be subjected
to chemical modification of distinct amino acid residues in vitro,
the modification serving as the first attachment site.
[0125] In one specific embodiment of the invention, the first
attachment site is the JUN-FOS leucine zipper protein domain that
is fused in frame to the Hepatitis B capsid (core) protein (HBcAg).
However, it will be clear to those of ordinary skill in the art
that other viral capsid proteins may be utilized in the fusion
protein construct for locating the first attachment site in the
non-natural molecular scaffold of the invention. For example, in
other embodiments of the invention, the first attachment site is
selected to be a lysine or cysteine residue that is fused in frame
to the HBcAg. However, it will be clear to all individuals in the
art that other viral capsid or virus-like particles may be utilized
in the fusion protein construct for locating the first attachment
in the non-natural molecular scaffold of the invention.
[0126] Viral Particles.
[0127] In one embodiment of the invention, the core particle is a
recombinant alphavirus, and more specifically, a recombinant
Sindbis virus. Several members of the alphavirus family, Sindbis
(Xiong, C. et al., Science 243:1188-1191 (1989); Schlesinger, S.,
Trends Biotechnol. 11:18-22 (1993)), Semliki Forest Virus (SFV)
(Liljestrom, P. & Garoff, H., Bio/Technology 9:1356-1361
(1991)) and others (Davis, N. L. et al., Virology 171:189-204
(1989)), have received considerable attention for use as
virus-based expression vectors for a variety of different proteins
(Lundstrom, K., Curr. Opin. Biotechnol. 8:578-582 (1997);
Liljestrom, P., Curr. Opin. Biotechnol. 5:495-500 (1994)) and as
candidates for vaccine development. The use of alphaviruses for the
expression of heterologous proteins and the development of vaccines
has been disclosed (see U.S. Pat. Nos. 5,766,602; 5,792,462;
5,739,026; 5,789,245; and 5,814,482) the disclosures all of which
are incorporated by reference in their entireties. The construction
of the alphaviral scaffold of the invention may be done by means
generally known in the art of recombinant DNA technology, as
described by the aforementioned articles, which are incorporated
herein by reference. A variety of different recombinant host cells
can be utilized to produce a viral-based core particle for antigen
or antigenic determinant attachment.
[0128] Packaged RNA sequences can also be used to infect host
cells. These packaged RNA sequences can be introduced to host cells
by adding them to the culture medium. For example, the preparation
of non-infective alpahviral particles is described in a number of
sources, including "Sindbis Expression System", Version C
(Invitrogen Corporation, Carlsbad Calif.; Catalog No. K750-1).
[0129] When mammalian cells are used as recombinant host cells for
the production of viral-based core particles, these cells will
generally be grown in tissue culture. Methods for growing cells in
culture are well known in the art (see, e.g., Celis, J., ed., CELL
BIOLOGY, Academic Press, 2.sup.nd edition, (1998); Sambrook, J. et
al., eds., MOLECULAR CLONING, A LABORATORY MANUAL, 2nd. edition,
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
(1989); Ausubel, F. et al., eds., CURRENT PROTOCOLS IN MOLECULAR
BIOLOGY, John H. Wiley & Sons, Inc. (1997); Freshney, R.,
CULTURE OF ANIMAL CELLS, Alan R. Liss, Inc. (1983)).
[0130] The invention thus includes viral-based core particles which
comprise, or alternatively consist of, a virus, virus-like
particle, a phage, a viral capsid particle or a recombinant form
thereof. Skilled artisans have the knowledge to produce such core
particles and attach first attachment sites thereto. The production
of Hepatitis B virus-like particles, in particular those assembled
or self-assembled from HBcAg, and measles viral capsid particles as
core particles is disclosed in Examples 17 to 22 of WO 00/32227,
which is explicitly incorporated herein by reference. In such
embodiments, the JUN leucine zipper protein domain or FOS leucine
zipper protein domain may be used as a first attachment site for
the non-natural molecular scaffold of the invention. One of skill
in the art would known methods for constructing Hepatitis B core
particles carrying an in-frame fused peptide with a reactive lysine
residue and antigens carrying a genetically fused cysteine residue,
as first and second attachment site, respectively.
[0131] In other embodiments, the core particles used in
compositions of the invention are composed of a Hepatitis B capsid
(core) protein (HBcAg), a fragment of a HBcAg, or other protein or
peptide which can form virus-like particles, which are ordered
arrays, which have been modified to either eliminate or reduce the
number of free cysteine residues. Zhou et al. (J. Virol.
66:5393-5398 (1992)) demonstrated that HBcAgs which have been
modified to remove the naturally resident cysteine residues retain
the ability to associate and form multimeric structures. Thus, core
particles suitable for use in compositions of the invention include
those comprising modified HBcAgs, or fragments thereof, in which
one or more of the naturally resident cysteine residues have been
either deleted or substituted with another amino acid residue
(e.g., a serine residue). In a preferred embodiment, the HBcAg has
the amino acid sequence as set forth in SEQ ID NO: 1, or a sequence
that is at least about 80%, at least about 85%, at least about 90%,
at least about 95%, more preferably at least about 99% or 100%
identical to the sequence of SEQ ID NO: 1. In one embodiment of the
invention, a modified HBcAg comprising the amino acid sequence
shown in SEQ ID NO:1, or subportion thereof, is used to prepare
non-natural molecular scaffolds. In particular, modified HBcAgs
suitable for use in the practice of the invention include proteins
in which one or more of the cysteine residues at positions
corresponding to positions 48, 61, 107 and 185 of a protein having
the amino acid sequence shown in SEQ ID NO:1 have been either
deleted or substituted with other amino acid residues (e.g., a
serine residue). As one skilled in the art would recognize,
cysteine residues at similar locations in HBcAg variants having
amino acids sequences which differ from that shown in SEQ ID NO:1
could also be deleted or substituted with other amino acid
residues. The modified HBcAg variants can then be used to prepare
vaccine compositions of the invention.
[0132] Under certain circumstances (e.g., when a heterobifunctional
cross-linking reagent is used to attach antigens or antigenic
determinants to the non-natural molecular scaffold), the presence
of free cysteine residues in the HBcAg is believed to lead to
covalent coupling of toxic components to core particles, as well as
the cross-linking of monomers to form undefined species.
[0133] Further, in many instances, these toxic components may not
be detectable with assays performed on compositions of the
invention. This is so because covalent coupling of toxic components
to the non-natural molecular scaffold would result in the formation
of a population of diverse species in which toxic components are
linked to different cysteine residues, or in some cases no cysteine
residues, of the HBcAgs. In other words, each free cysteine residue
of each HBcAg will not be covalently linked to toxic components.
Further, in many instances, none of the cysteine residues of
particular HBcAgs will be linked to toxic components. Thus, the
presence of these toxic components may be difficult to detect
because they would be present in a mixed population of molecules.
The administration to an individual of HBcAg species containing
toxic components, however, could lead to a potentially serious
adverse reaction.
[0134] It is well known in the art that free cysteine residues can
be involved in a number of chemical side reactions. These side
reactions include disulfide exchanges, reaction with chemical
substances or metabolites that are, for example, injected or formed
in a combination therapy with other substances, or direct oxidation
and reaction with nucleotides upon exposure to UV light. Toxic
adducts could thus be generated, especially considering the fact
that HBcAgs have a strong tendency to bind nucleic acids. Detection
of such toxic products in antigen-capsid conjugates would be
difficult using capsids prepared using HBcAgs containing free
cysteines and heterobifunctional cross-linkers, since a
distribution of products with a broad range of molecular weight
would be generated. The toxic adducts would thus be distributed
between a multiplicity of species, which individually may each be
present at low concentration, but reach toxic levels when
together.
[0135] In view of the above, one advantage to the use of HBcAgs in
vaccine compositions which have been modified to remove naturally
resident cysteine residues is that sites to which toxic species can
bind when antigens or antigenic determinants are attached to the
non-natural molecular scaffold would be reduced in number or
eliminated altogether. Further, a high concentration of
cross-linker can be used to produce highly decorated particles
without the drawback of generating a plurality of undefined
cross-linked species of HBcAg monomers (i.e., a diverse mixture of
cross-linked monomeric HbcAgs).
[0136] A number of naturally occurring HBcAg variants suitable for
use in the practice of the present invention have been identified.
Yuan et al., (J. Virol. 73:10122-10128 (1999)), for example,
describe variants in which the isoleucine residue at position
corresponding to position 97 in SEQ ID NO:1 is replaced with either
a leucine residue or a phenylalanine residue. The amino acid
sequences of a number of HBcAg variants, as well as several
Hepatitis B core antigen precursor variants, are disclosed in
GenBank reports AAF121240, AF121239, X85297, X02496, X85305,
X85303, AF151735, X85259, X85286, X85260, X85317, X85298, AF043593,
M20706, X85295, X80925, X85284, X85275, X72702, X85291, X65258,
X85302, M32138, X85293, X85315, U95551, X85256, X85316, X85296,
AB033559, X59795, X8529, X85307, X65257, X85311, X85301, X85314,
X85287, X85272, X85319, AB010289, X85285, AB010289, AF121242,
M90520, P03153, AF110999, and M95589, the disclosures of each of
which are incorporated herein by reference. These HBcAg variants
differ in amino acid sequence at a number of positions, including
amino acid residues which corresponds to the amino acid residues
located at positions 12, 13, 21, 22, 24, 29, 32, 33, 35, 38, 40,
42, 44, 45, 49, 51, 57, 58, 59, 64, 66, 67, 69, 74, 77, 80, 81, 87,
92, 93, 97, 98, 100, 103, 105, 106, 109, 113, 116, 121, 126, 130,
133, 135, 141, 147, 149, 157, 176, 178, 182 and 183 in SEQ ID
NO:1.
[0137] Further HBcAg variants suitable for use in the compositions
of the invention, and which may be further modified according to
the disclosure of this specification are described in WO 00/198333,
WO 00/177158 and WO 00/214478, herein included by reference in
their entirety.
[0138] HBcAgs suitable for use in the present invention may be
derived from any organism so long as they are able to associate to
form an ordered and repetitive antigen array. Generally processed
HBcAgs (i.e., those which lack leader sequences) will be used in
the vaccine compositions of the invention. The present invention
includes vaccine compositions, as well as methods for using these
compositions, which employ the above described variant HBcAgs for
the preparation of non-natural molecular scaffolds. Further
included within the scope of the invention are additional HBcAg
variants which are capable of associating to form dimeric or
multimeric structures. Thus, the invention further includes vaccine
compositions comprising HBcAg polypeptides comprising, or
alternatively consisting of, amino acid sequences which are at
least about 80%, about 85%, about 90%, about 95%, about 97%, or
about 99% identical to any of the amino acid sequences shown in the
above sequences, including SEQ ID No: 1, and forms of these
proteins which have been processed, where appropriate, to remove
the N-terminal leader sequence.
[0139] Whether the amino acid sequence of a polypeptide has an
amino acid sequence that is at least about 80%, about 85%, about
90%, about 95%, about 97%, or about 99% identical to one of the
amino acid sequences shown above, or a subportion thereof, can be
determined conventionally using known computer programs such the
Bestfit program. When using Bestfit or any other sequence alignment
program to determine whether a particular sequence is, for
instance, about 95% identical to a reference amino acid sequence
according to the present invention, the parameters are set such
that the percentage of identity is calculated over the full length
of the reference amino acid sequence and that gaps in homology of
up to 5% of the total number of amino acid residues in the
reference sequence are allowed. In such a manner, comparisons may
be made between the amino acid sequence of HBcAg of SEQ ID NO:1 and
other HBcAg. When comparing proteins that are relatively similar,
reference to an amino acid residue of a HBcAg variant located at a
position which corresponds to a particular position in SEQ ID NO:1,
refers to the amino acid residue which is present at that position
in the amino acid sequence shown in SEQ ID NO:1. The homology
between these HBcAg variants is for the most part high enough among
Hepatitis B viruses that infect mammals so that one skilled in the
art would have little difficulty reviewing both the amino acid
sequence shown in SEQ ID NO:1 and that of a particular HBcAg
variant and identifying "corresponding" amino acid residues. For
example, comparisons between the SEQ ID NO:1 and the amino acid
sequence of the an HBcAg derived from a virus which infect
woodchucks, it is readily apparent that a three amino acid residue
insert is present in that sequence between amino acid residues 155
and 156 of SEQ ID NO:1.
[0140] However, where alignment is difficult, one skilled in the
art would recognize the importance of particular amino acids or
motifs in a sequence. For example, the amino acid sequence of HBcAg
from human viruses differs from duck viruses such that alignment is
difficult, yet one skilled in the art would recognize conserved
cysteine residues could be either substituted with another amino
acid residue or deleted prior to their inclusion in vaccine
compositions of the invention.
[0141] In one embodiment, the cysteine residues at positions 48 and
107 of a protein having the amino acid sequence shown in SEQ ID
NO:1 are deleted or substituted with another amino acid residue but
the cysteine at position 61 is left in place. Further, the modified
polypeptide is then used to prepare vaccine compositions of the
invention.
[0142] The preparation of preferred Hepatitis B virus-like
particles, which can be used for the present invention, is
disclosed, for example, in WO 00/32227, and hereby in particular in
Examples 17 to 19 and 21 to 24, as well as in WO 01/85208, and
hereby in particular in Examples 17 to 19, 21 to 24, 31 and 41, and
in WO 02/056905. For the latter application, it is in particular
referred to Example 23, 24, 31 and 51. All three documents are
explicitly incorporated herein by reference.
[0143] As set out below in Example 31 of WO 02/056905, the cysteine
residues at positions 48 and 107, which are accessible to solvent,
may be removed, for example, by site-directed mutagenesis. Further,
the inventors have found that the Cys-48-Ser, Cys-107-Ser HBcAg
double mutant constructed as described in WO 02/056905, (which is
incorporated herein by reference in its entirety) can be expressed
in E. coli.
[0144] As discussed above, the elimination of free cysteine
residues reduces the number of sites where toxic components can
bind to the HBcAg, and also eliminates sites where cross-linking of
lysine and cysteine residues of the same or of neighboring HBcAg
molecules can occur. The cysteine at position 61, which is involved
in dimer formation and forms a disulfide bridge with the cysteine
at position 61 of another HBcAg, will normally be left intact for
stabilization of HBcAg dimers and multimers of the invention.
Cross-linking experiments performed with (1) HBcAgs containing free
cysteine residues and (2) HBcAgs whose free cysteine residues have
been made unreactive with iodacetamide, indicate that free cysteine
residues of the HBcAg are responsible for cross-linking between
HBcAgs through reactions between heterobifunctional cross-linker
derivatized lysine side chains, and free cysteine residues. It was
also found that that cross-linking of HBcAg subunits leads to the
formation of high molecular weight species of undefined size which
can not be resolved by SDS-polyacrylamide gel electrophoresis.
[0145] When an antigen or antigenic determinant is linked to the
non-natural molecular scaffold through a lysine residue, it may be
advantageous to either substitute or delete one or both of the
naturally resident lysine residues located at positions
corresponding to positions 7 and 96 in SEQ ID NO:1, as well as
other lysine residues present in HBcAg variants. The elimination of
these lysine residues results in the removal of binding sites for
antigens or antigenic determinants which could disrupt the ordered
array and should improve the quality and uniformity of the final
vaccine composition.
[0146] In many instances, when both of the naturally resident
lysine residues at positions corresponding to positions 7 and 96 in
SEQ ID NO:1 are eliminated, another lysine will be introduced into
the HBcAg as an attachment site for an antigen or antigenic
determinant. Methods for inserting such a lysine residue are set
out, for example, in Example 23 of WO 02/056905, which is
incorporated hereby by reference in its entirety. It will often be
advantageous to introduce a lysine residue into the HBcAg when, for
example, both of the naturally resident lysine residues at
positions corresponding to positions 7 and 96 in SEQ ID NO:1 are
altered and one seeks to attach the antigen or antigenic
determinant to the non-natural molecular scaffold using a
heterobifunctional cross-linking agent.
[0147] The C-terminus of the HBcAg has been shown to direct nuclear
localization of this protein (Eckhardt et al., J. Virol. 65:575-582
(1991).) Further, this region of the protein is also believed to
confer upon the HBcAg the ability to bind nucleic acids.
[0148] In some embodiments, vaccine compositions of the invention
will contain HBcAgs which have nucleic acid binding activity (e.g.,
which contain a naturally resident HBcAg nucleic acid binding
domain). HBcAgs containing one or more nucleic acid binding domains
are useful for preparing vaccine compositions which exhibit
enhanced T-cell stimulatory activity. Thus, the vaccine
compositions of the invention include compositions which contain
HBcAgs having nucleic acid binding activity. Further included are
vaccine compositions, as well as the use of such compositions in
vaccination protocols, where HBcAgs are bound to nucleic acids.
These HBcAgs may bind to the nucleic acids prior to administration
to an individual or may bind the nucleic acids after
administration.
[0149] Further HBcAgs suitable for use in the practice of the
present invention include N- and C-terminal truncation mutants, and
muteins whose amino acid sequences comprises or alternatively
consists of, amino acid sequences which are at least about 80%,
about 85%, about 90%, about 95%, about 97%, or about 99% identical
to the above described truncation mutants.
[0150] As discussed above, in certain embodiments of the invention,
a lysine residue is introduced as a first attachment site into a
polypeptide which forms the non-natural molecular scaffold. In
preferred embodiments, vaccine compositions of the invention are
prepared using a HBcAg comprising, or alternatively consisting of,
amino acids 1-144 or amino acids 1-149 or amino acids 1-185 of SEQ
ID NO:1 which is modified so that the amino acids corresponding to
positions 79 and 80 are replaced with a peptide having the amino
acid sequence of Gly-Gly-Lys-Gly-Gly (SEQ ID NO: 11) and the
cysteine residues at positions 48 and 107 are either deleted or
substituted with another amino acid residue, while the cysteine at
position 61 is left in place.
[0151] The invention further includes vaccine compositions
comprising fragments of a HBcAg comprising, or alternatively
consisting of, an amino acid sequence other than that shown in SEQ
ID NO:1 from which a cysteine residue not present at corresponding
location in SEQ ID NO:1 has been deleted.
[0152] Vaccine compositions of the invention may comprise mixtures
of different HBcAgs. Thus, these vaccine compositions may be
composed of HBcAgs which differ in amino acid sequence. For
example, vaccine compositions could be prepared comprising a
"wild-type" HBcAg and a modified HBcAg in which one or more amino
acid residues have been altered (e.g., deleted, inserted or
substituted). The invention further includes vaccine compositions
where the non-natural molecular scaffold is prepared using a HBcAg
fused to another protein. As discussed above, one example of such a
fusion protein is a HBcAg/FOS fusion. Other examples of HBcAg
fusion proteins suitable for use in vaccine compositions of the
invention include fusion proteins where an amino acid sequence has
been added which aids in the formation and/or stabilization of
HBcAg dimers and multimers. This additional amino acid sequence may
be fused to the or C-terminus of the HBcAg. One example, of such a
fusion protein is a fusion of a HBcAg with the GCN4 helix region of
Saccharomyces cerevisiae, which forms homodimers via non-covalent
interactions which can be used to prepare and stabilize HBcAg
dimers and multimers.
[0153] In one embodiment, the invention provides vaccine
compositions prepared using HBcAg fusions proteins comprising a
HBcAg, or fragment thereof, with a GCN4 polypeptide
(PAALKRARNEAARRSRARKLQ-RMKQLEDKVEELLSKNYHLENEVARLKK (SEQ ID NO:
12)) fused to the C-terminus. This GCN4 polypeptide may also be
fused to the N-terminus of the HbcAg.
[0154] HBcAg/src homology 3 (SH3) domain fusion proteins could also
be used to prepare vaccine compositions of the invention. SH3
domains are relatively small domains found in a number of proteins
which confer the ability to interact with specific proline-rich
sequences in protein binding partners (see McPherson, Cell Signal
11:229-238 (1999). HBcAg/SH3 fusion proteins could be used in
several ways. First, the SH3 domain could form a first attachment
site which interacts with a second attachment site of the antigen
or antigenic determinant. Similarly, a proline rich amino acid
sequence could be added to the HBcAg and used as a first attachment
site for an SH3 domain second attachment site of an antigen or
antigenic determinant. Second, the SH3 domain could associate with
proline rich regions introduced into HBcAgs. Thus, SH3 domains and
proline rich SH3 interaction sites could be inserted into either
the same or different HBcAgs and used to form and stabilized dimers
and multimers of the invention.
[0155] As evidenced by the aforementioned example, one of skill in
the art would know how to form a molecular scaffold comprising core
particles and a first attachment site from HBcAg and HBcAg-derived
muteins. By application of art-known techniques and routine
experimentation, it would be understood by one of ordinary skill
how other viruses could be similarly used to construct a molecular
scaffold.
[0156] As presented elsewhere herein, viral capsids may be used for
(1) the presentation or haptens and (2) the preparation of vaccine
compositions of the invention. Particularly, useful in the practice
of the invention are viral capsid proteins, also referred to herein
as "coat proteins," which upon expression form capsids or
capsid-like structures. Thus, these capsid proteins can form core
particles and non-natural molecular scaffolds. Generally, these
capsids or capsid-like structures form ordered and repetitive
arrays which can be used for the presentation of haptens
determinants and the preparation of vaccine compositions of the
invention.
[0157] One or more (e.g., one, two, three, four, five, etc.)
haptens may be attached by any number of means to one or more
(e.g., one, two, three, four, five, etc.) proteins which form viral
capsids or capsid-like structures (e.g., bacteriophage coat
proteins), as well as other proteins. For example, haptens may be
attached to core particles using first and second attachment sites.
Further, one or more (e.g., one, two, three, four, five, etc.)
heterobifunctional crosslinkers can be used to attach haptens
determinants to one or more proteins which form viral capsids or
capsid-like structures.
[0158] Viral capsid proteins, or fragments thereof may be used, for
example, to prepare core particles and vaccine compositions of the
invention. Bacteriophage Q.beta. coat proteins, for example, can be
expressed recombinantly in E. coli. Further, upon such expression
these proteins spontaneously form capsids, which are virus-like
particles. Additionally, these capsids form ordered and repetitive
antigen arrays which can be used for hapten presentation and the
preparation of vaccine compositions. As described below in Example
1, bacteriophage Q.beta. coat proteins can be used to prepare
vaccine compositions which elicit immunological responses to
haptens.
[0159] In a preferred embodiment, the virus-like particle
comprises, consists essentially of, or alternatively consists of
recombinant proteins, or fragments thereof, of a RNA-phage.
Preferably, the RNA-phage is selected from the group consisting of
a) bacteriophage Q.beta.; b) bacteriophage R17; c) bacteriophage
fr; d) bacteriophage GA; e) bacteriophage SP; f) bacteriophage MS2;
g) bacteriophage M11; h) bacteriophage MX1; i) bacteriophage NL95;
k) bacteriophage f2; l) bacteriophage PP7, and m) bacteriophage
AP205.
[0160] In another preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively consists
essentially of, or alternatively consists of recombinant proteins,
or fragments thereof, of the RNA-bacteriophage Q.beta. or of the
RNA-bacteriophage fr or of the RNA-bacteriophage AP205.
[0161] In a further preferred embodiment of the present invention,
the recombinant proteins comprise, or alternatively consist
essentially of, or alternatively consist of coat proteins of RNA
phages.
[0162] Specific examples of bacteriophage coat proteins which can
be used to prepare compositions of the invention include the coat
proteins of RNA bacteriophages such as bacteriophage Q.beta. (SEQ
ID NO:3, PER. Database, Accession No. VCBPQ.beta. referring to
Q.beta. CP; and SEQ ID NO: 4, Accession No. AAA16663 referring to
Q.beta. A1 protein), bacteriophage R17 (SEQ ID NO: 24; PIR
Accession No. VCBPR7), bacteriophage fr (SEQ ID NO: 25; PIR
Accession No. VCBPFR), bacteriophage GA (SEQ ID NO: 26; GenBank
Accession No. NP-040754), bacteriophage SP (SEQ ID NO: 27; GenBank
Accession No. CAA30374 referring to SP CP and SEQ ID NO: 28,
Accession No. NP 695026 referring to SP A1 protein), bacteriophage
MS2 (SEQ ID NO: 29; PIR Accession No. VCBPM2), bacteriophage M11
(SEQ ID NO: 30; GenBank Accession No. AAC06250), bacteriophage MX1
(SEQ ID NO: 31; GenBank Accession No. AAC 14699), bacteriophage
NL95 (SEQ ID NO: 32; GenBank Accession No. AAC14704), bacteriophage
f2 (SEQ ID NO: 33; GenBank Accession No. P03611), bacteriophage PP7
(SEQ ID NO: 13), bacteriophage AP205 (SEQ ID NO:14). As one skilled
in the art would recognize, any protein which forms capsids or
capsid-like structures can be used for the preparation of vaccine
compositions of the invention. Furthermore, the A1 protein of
bacteriophage Q.beta. (Genbank accession No. AAA16663 (SEQ ID NO:
4)) or C-terminal truncated forms missing as much as about 100,
about 150 or about 180 amino acids from its C-terminus may be
incorporated in a capsid assembly of Q.beta. coat proteins. The A1
protein may also be fused an element containing a first attachment
site, for attachment of haptens containing a second attachment
site. Generally, the percentage of A1 protein relative to Q.beta.
CP in the capsid assembly will be limited, in order to insure
capsid formation.
[0163] Q.beta. coat protein has also been found to self-assemble
into capsids when expressed in E. coli (Kozlovska T M. et al., GENE
137: 133-137 (1993)). The obtained capsids or virus-like particles
showed an icosahedral phage-like capsid structure with a diameter
of 25 nm and T=3 quasi symmetry. Further, the crystal structure of
phage Q.beta. has been solved. The capsid contains 180 copies of
the coat protein, which are linked in covalent pentamers and
hexamers by disulfide bridges (Golmohammadi, R. et al., Structure
4: 543-5554 (1996)). Other RNA phage coat proteins have also been
shown to self-assemble upon expression in a bacterial host
(Kastelein, R A. et al., Gene 23: 245-254 (1983), Kozlovskaya, T M.
et al., Dokl. Akad. Nauk SSSR 287: 452-455 (1986), Adhin, M R. et
al., Virology 170: 238-242 (1989), Ni, CZ., et al., Protein Sci. 5:
2485-2493 (1996), Priano, C. et al., J. Mol. Biol. 249: 283-297
(1995)). The Q.beta. phage capsid contains, in addition to the coat
protein, the so called read-through protein A1 and the maturation
protein A2. A1 is generated by suppression at the UGA stop codon
and has a length of 329 aa. The capsid of phage Q.beta. recombinant
coat protein used in the invention is devoid of the A2 lysis
protein, and contains RNA from the host. The coat protein of RNA
phages is an RNA binding protein, and interacts with the stem loop
of the ribosomal binding site of the replicase gene acting as a
translational repressor during the life cycle of the virus. The
sequence and structural elements of the interaction are known
(Witherell, G W. & Uhlenbeck, O C. Biochemistry 28: 71-76
(1989); Lim F. et al., J. Biol. Chem. 271: 31839-31845 (1996)). The
stem loop and RNA in general are known to be involved in the virus
assembly (Golmohammadi, R. et al., Structure 4: 543-0.5554
(1996).)
[0164] Upon expression in E. coli, the N-terminal methionine of
Q.beta. coat protein is usually removed, as we observed by
N-terminal Edman sequencing as described in Stoll, E. et al. J.
Biol. Chem. 252:990-993 (1977). VLP composed from Q.beta. coat
proteins where the N-terminal methionine has not been removed, or
VLPs comprising a mixture of Q.beta. coat proteins where the
N-terminal methionine is either cleaved or present are also within
the scope of the present invention.
[0165] Further preferred virus-like particles of RNA-phages, in
particular of Q.beta., in accordance of this invention are
disclosed in WO 02/056905, the disclosure of which is herewith
incorporated by reference in its entirety.
[0166] Further RNA phage coat proteins have also been shown to
self-assemble upon expression in a bacterial host (Kastelein, R A.
et al., Gene 23: 245-254 (1983), Kozlovskaya, T M. et al., Dokl.
Akad. Nauk SSSR 287: 452-455 (1986), Adhin, M R. et al., Virology
170: 238-242 (1989), Ni, CZ., et al., Protein Sci. 5: 2485-2493
(1996), Priano, C. et al., J. Mol. Biol. 249: 283-297 (1995)). The
Q.beta. phage capsid contains, in addition to the coat protein, the
so called read-through protein A1 and the maturation protein A2. A1
is generated by suppression at the UGA stop codon and has a length
of 329 aa. The capsid of phage Q.beta. recombinant coat protein
used in the invention is devoid of the A2 lysis protein, and
contains RNA from the host. The coat protein of RNA phages is an
RNA binding protein, and interacts with the stem loop of the
ribosomal binding site of the replicase gene acting as a
translational repressor during the life cycle of the virus. The
sequence and structural elements of the interaction are known
(Witherell, G W. & Uhlenbeck, O C. Biochemistry 28: 71-76
(1989); Lim F. et al., J. Biol. Chem. 271: 31839-31845 (1996)). The
stem loop and RNA in general are known to be involved in the virus
assembly (Golmohammadi, R. et al., Structure 4: 543-5554
(1996)).
[0167] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively consists
essentially of or alternatively consists of recombinant proteins,
or fragments thereof of a RNA-phage, wherein the recombinant
proteins comprise, consist essentially of or alternatively consist
of mutant coat proteins of RNA phages. In another preferred
embodiment, the mutant coat proteins have been modified by removal
of at least one lysine residue, more preferably of at least two
lysine residues, by way of substitution, or by addition of at least
one lysine residue by way of substitution. Alternatively, the
mutant coat proteins have been modified by deletion of at least one
lysine residue, more preferably of at least two lysine residues, or
by addition of at least one lysine residue, more preferably of at
least two lysine residues, by way of insertion.
[0168] In another preferred embodiment, the virus-like particle
comprises, consists essentially of, or alternatively consists of
recombinant proteins, or fragments thereof, of the
RNA-bacteriophage Q.beta., wherein the recombinant proteins
comprise, consist essentially of, or alternatively consist of coat
proteins having an amino acid sequence of SEQ ID NO:3, or a mixture
of coat proteins having amino acid sequences of SEQ ID NO:3 and of
SEQ ID NO: 4 or mutants of SEQ ID NO: 4 and wherein the N-terminal
methionine is preferably cleaved.
[0169] In a further preferred embodiment of the present invention,
the virus-like particle comprises, consists essentially of or
alternatively consists of recombinant proteins of Q.beta., or
fragments thereof, wherein the recombinant proteins comprise,
consist essentially of or alternatively consist of mutant Q.beta.
coat proteins. In another preferred embodiment, these mutant coat
proteins have been modified by removal of at least one lysine
residue by way of substitution, or by addition of at least one
lysine residue by way of substitution. Alternatively, these mutant
coat proteins have been modified by deletion of at least one lysine
residue, or by addition of at least one lysine residue by way of
insertion.
[0170] Four lysine residues are exposed on the surface of the
capsid of Q.beta. coat protein. Q.beta. mutants, for which exposed
lysine residues are replaced by arginines can also be used for the
present invention. The following Q.beta. coat protein mutants and
mutant Q.beta. VLP's can, thus, be used in the practice of the
invention: "Q.beta.-240" (Lys13-Arg; SEQ ID NO:6), "Q.beta.-243"
(Asn 10-Lys; SEQ ID NO:7), "Q.beta.-250" (Lys 2-Arg, Lys13-Arg; SEQ
ID NO:8), "Q.beta.-251" (SEQ ID NO:9) and "Q.beta.-259" (Lys 2-Arg,
Lys16-Arg; SEQ ID NO:10). Thus, in further preferred embodiment of
the present invention, the virus-like particle comprises, consists
essentially of or alternatively consists of recombinant proteins of
mutant Q.beta. coat proteins, which comprise proteins having an
amino acid sequence selected from the group of a) the amino acid
sequence of SEQ ID NO:6; b) the amino acid sequence of SEQ ID NO:7;
c) the amino acid sequence of SEQ ID NO:8; d) the amino acid
sequence of SEQ ID NO:9; and e) the amino acid sequence of SEQ ID
NO:10. The construction, expression and purification of the above
indicated Q.beta. coat proteins, mutant Q.beta. coat protein VLP's
and capsids, respectively, are described in WO 02/056905. In
particular is hereby referred to Example 18 of above mentioned
application.
[0171] In a further preferred embodiment of the present invention,
the virus-like particle comprises, consists essentially of or
alternatively consists of recombinant proteins of Q.beta., or
fragments thereof, wherein the recombinant proteins comprise,
consist essentially of or alternatively consist of a mixture of
either one of the foregoing Q.beta. mutants and the corresponding
A1 protein.
[0172] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively essentially
consists of, or alternatively consists of recombinant proteins, or
fragments thereof, of RNA-phage AP205.
[0173] The AP205 genome consists of a maturation protein, a coat
protein, a replicase and two open reading frames not present in
related phages; a lysis gene and an open reading frame playing a
role in the translation of the maturation gene (Klovins, J., et
al., J. Gen. Virol. 83: 1523-33 (2002)). AP205 coat protein can be
expressed from plasmid pAP283-58 (SEQ ID NO: 15), which is a
derivative of pQb10 (Kozlovska, T. M. et al., Gene 137:133-37
(1993)), and which contains an AP205 ribosomal binding site.
Alternatively, AP205 coat protein may be cloned into pQb 185,
downstream of the ribosomal binding site present in the vector.
Both approaches lead to expression of the protein and formation of
capsids as described in Example 10. Vectors pQb10 and pQb185 are
vectors derived from pGEM vector, and expression of the cloned
genes in these vectors is controlled by the trp promoter
(Kozlovska, T. M. et al., Gene 137:133-37 (1993)). Plasmid
pAP283-58 (SEQ ID NO:15) comprises a putative AP205 ribosomal
binding site in the following sequence, which is downstream of the
XbaI site, and immediately upstream of the ATG start codon of the
AP205 coat protein: tctagaATTTTCTGCGCACCCATCCCGGGTGGCGCCCAAAGTGAGG
AAAATCACatg (SEQ ID NO: 16). The vector pQb185 comprises a Shine
Delagarno sequence downstream from the XbaI site and upstream of
the start codon (tctagaTTAACCCAACGCGTAGGAG TCAGGCCatg (SEQ ID NO:
17), Shine Delagarno sequence underlined).
[0174] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively essentially
consists of, or alternatively consists of recombinant coat
proteins, or fragments thereof, of the RNA-phage AP205.
[0175] This preferred embodiment of the present invention, thus,
comprises AP205 coat proteins that form capsids. Such proteins are
recombinantly expressed, or prepared from natural sources. AP205
coat proteins produced in bacteria spontaneously form capsids, as
evidenced by Electron Microscopy (EM) and immunodiffusion. The
structural properties of the capsid formed by the AP205 coat
protein (SEQ ID NO: 14) and those formed by the coat protein of the
AP205 RNA phage are nearly indistinguishable when seen in EM. AP205
VLPs are highly immunogenic, and can be linked with antigens and/or
antigenic determinants to generate vaccine constructs displaying
the antigens and/or antigenic determinants oriented in a repetitive
manner. High titers are elicited against the so displayed antigens
showing that bound antigens and/or antigenic determinants are
accessible for interacting with antibody molecules and are
immunogenic.
[0176] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively essentially
consists of, or alternatively consists of recombinant mutant coat
proteins, or fragments thereof, of the RNA-phage AP205.
[0177] Assembly-competent mutant forms of AP205 VLPs, including
AP205 coat protein with the substitution of proline at amino acid 5
to threonine (SEQ ID NO: 18), may also be used in the practice of
the invention and leads to a further preferred embodiment of the
invention. These VLPs, AP205 VLPs derived from natural sources, or
AP205 viral particles, may be bound to antigens to produce ordered
repetitive arrays of the antigens in accordance with the present
invention.
[0178] AP205 P5-T mutant coat protein can be expressed from plasmid
pAP281-32 (SEQ ID No. 19), which is derived directly from pQb185,
and which contains the mutant AP205 coat protein gene instead of
the Q.beta. coat protein gene. Vectors for expression of the AP205
coat protein are transfected into E. coli for expression of the
AP205 coat protein.
[0179] Methods for expression of the coat protein and the mutant
coat protein, respectively, leading to self-assembly into VLPs are
described in Examples 9 and 10. Suitable E. coli strains include,
but are not limited to, E. coli K802, JM 109, RR1. Suitable vectors
and strains and combinations thereof can be identified by testing
expression of the coat protein and mutant coat protein,
respectively, by SDS-PAGE and capsid formation and assembly by
optionally first purifying the capsids by gel filtration and
subsequently testing them in an immunodiffusion assay (Ouchterlony
test) or Electron Microscopy (Kozlovska, T. M. et al., Gene
137:133-37 (1993)).
[0180] AP205 coat proteins expressed from the vectors pAP283-58 and
pAP281-32 may be devoid of the initial Methionine amino-acid, due
to processing in the cytoplasm of E. coli. Cleaved, uncleaved forms
of AP205 VLP, or mixtures thereof are further preferred embodiments
of the invention.
[0181] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively essentially
consists of, or alternatively consists of a mixture of recombinant
coat proteins, or fragments thereof, of the RNA-phage AP205 and of
recombinant mutant coat proteins, or fragments thereof, of the
RNA-phage AP205.
[0182] In a further preferred embodiment of the present invention,
the virus-like particle comprises, or alternatively essentially
consists of, or alternatively consists of fragments of recombinant
coat proteins or recombinant mutant coat proteins of the RNA-phage
AP205.
[0183] Recombinant AP205 coat protein fragments capable of
assembling into a VLP and a capsid, respectively are also useful in
the practice of the invention. These fragments may be generated by
deletion, either internally or at the termini of the coat protein
and mutant coat protein, respectively. Insertions in the coat
protein and mutant coat protein sequence or fusions of antigen
sequences to the coat protein and mutant coat protein sequence, and
compatible with assembly into a VLP, are further embodiments of the
invention and lead to chimeric AP205 coat proteins, and particles,
respectively. The outcome of insertions, deletions and fusions to
the coat protein sequence and whether it is compatible with
assembly into a VLP can be determined by electron microscopy.
[0184] The particles formed by the AP205 coat protein, coat protein
fragments and chimeric coat proteins described above, can be
isolated in pure form by a combination of fractionation steps by
precipitation and of purification steps by gel filtration using
e.g. Sepharose CL-4B, Sepharose CL-2B, Sepharose CL-6B columns and
combinations thereof. Other methods of isolating virus-like
particles are known in the art, and may be used to isolate the
virus-like particles (VLPs) of bacteriophage AP205. For example,
the use of ultracentrifugation to isolate VLPs of the yeast
retrotransposon Ty is described in U.S. Pat. No. 4,918,166, which
is incorporated by reference herein in its entirety.
[0185] According to the present invention, one or more haptens may
be attached to one subunit of the capsid of RNA phages coat
proteins. The ability to couple several haptens per subunit of the
capsid of the coat protein of RNA phages and in particular of
Q.beta. capsid allows for the generation of a dense hapten array.
Other viral capsids may be used for covalent attachment of haptens
by way of chemical cross-linking, such for example a HBcAg modified
with a lysine residue in its major immunodominant region (MIR; WO
00/32227). The distance between the spikes (corresponding to the
MIR) of HBcAg is 50 Angstroms (Wynne, S A. et al., Mol. Cell. 3:
771-780 (1999)), and therefore an hapten array with distances
shorter than 50 A cannot be generated
[0186] Capsids of Q.beta. coat protein display a defined number of
lysine residues on their surface, with a defined topology with
three lysine residues pointing towards the interior of the capsid
and interacting with the RNA, and four other lysine residues
exposed to the exterior of the capsid. These defined properties
favor the attachment of haptens to the exterior of the particle,
and not to the interior where the lysine residues interact with
RNA. Capsids of other RNA phage coat proteins also have a defined
number of lysine residues on their surface and a defined topology
of these lysine residues. Another advantage of the capsids derived
from RNA phages is their high expression yield in bacteria, that
allows the production of large quantities of material at affordable
cost.
[0187] Another feature of the capsid of Q.beta. coat protein is its
stability. Q.beta. subunits are bound via disulfide bridges to each
other, covalently linking the subunits. Q.beta. capsid protein also
shows unusual resistance to organic solvents and denaturing agents.
Surprisingly, we have observed that DMSO and acetonitrile
concentrations as high as about 30%, and Guanidinium concentrations
as high as about 1 M could be used without affecting the stability
or the ability to form hapten arrays of the capsid. Thus, theses
organic solvents may be used to couple hydrophobic molecules, such
as hormones, drugs and toxins. The high stability of the capsid of
Q.beta. coat protein is an important feature pertaining to its use
for immunization and vaccination of mammals and humans in
particular. The resistance of the capsid to organic solvent allows
the coupling of haptens not soluble in aqueous buffers.
[0188] Insertion of a cysteine residue into the N-terminal
.beta.-hairpin of the coat protein of the RNA phage MS-2 has been
described in the U.S. Pat. No. 5,698,424, the reference of which is
incorporated herein in its entirety. We note however, that the
presence of an exposed free cysteine residue in the capsid may lead
to oligomerization of capsids by way of disulfide bridge formation.
Other attachments contemplated in the above U.S. patent involve the
formation of disulfide bridges between the antigen and the Q.beta.
particle. Such attachments are labile to sulfhydryl-moiety
containing molecules.
[0189] The reaction between an initial disulfide bridge formed with
a cysteine-residue on Q.beta., and the antigen containing a free
sulfhydryl residue releases sulfhydryl containing species other
than the hapten. These newly formes sulfhydryl containing species
can react again with other disulfide bridges present on the
particle, thus establishing an equilibrium. Upon reaction with the
disulfide bridge formed on the particle, the hapten may either form
a disulfide bridge with the cysteine-residue from the particle, or
with the cysteine-residue of the leaving group molecule which was
forming the initial disulfide bridge on the particle. Moreover, the
other method of attachment described, using a hetero-bifunctional
cross-linker reacting with a cysteine on the Q.beta. particle on
one side, and with a lysine residue on the antigen on the other
side, may lead to a random orientation of the antigens on the
particle.
[0190] We further note that, in contrast to the capsid of the
Q.beta. and Fr coat proteins, recombinant MS-2 described in U.S.
Pat. No. 5,698,424 is essentially free of nucleic acids, while RNA
is packaged inside the two capsids mentioned above.
[0191] We describe new and inventive compositions allowing the
formation of robust hapten arrays with variable hapten density. We
show that very high epitope density can be achieved by attaching
haptens to VLPs. Further, the density and spacing of haptens can be
modified by alterations in the number and type of residues with
suitable first attachment sites. For example WO 02/056905 discloses
a Q.beta. mutant coat protein with additional lysine residues,
suitable for obtaining higher density arrays than observed with
wild type Q.beta. coat protein. Further, the aforesaid application
also discloses compositions suitable for simultaneous display of
several hapten with appropriate spacing, and compositions wherein
the addition of accessory molecules, enhancing solubility or
modifying the capsid in a suitable and desired way. Other Q.beta.
coat protein mutants, forming capsids, which are virus-like
particles, are disclosed in WO 02/056905 and are suitable for
generating compositions of the invention. In particular, in
occurrences where solubility of the hapten, and of the
Q.beta.-hapten antigen array imposes a limit on the number of
hapten residues that can be attached on the Q.beta. virus-like
particle, mutants where lysine residues have been substituted for
arginines, which do not have the same reactivity as lysine
residues, can be used. When preparing these compositions, a high
concentration of hapten, or hapten modified to comprise a second
attachment site, can be used to achieve complete reaction at the
lysine residues on the mutant Q.beta. virus-like particles, without
generating potentially insoluble particles with a higher number of
attached haptens, as would be the case when using the wt Q.beta.
virus-like particle.
[0192] The crystal structure of several RNA bacteriophages has been
determined (Golmohammadi, R. et al., Structure 4:543-554 (1996)).
Using such information, one skilled in the art could readily
identify surface exposed residues and modify bacteriophage coat
proteins such that one or more reactive amino acid residues can be
inserted. Thus, one skilled in the art could readily generate and
identify modified forms of bacteriophage coat proteins which can be
used in the practice of the invention. Thus, variants of proteins
which form capsids or capsid-like structures (e.g., coat proteins
of bacteriophage Q.beta., bacteriophage R17, bacteriophage fr,
bacteriophage GA, bacteriophage SP, and bacteriophage MS2) can also
be used to prepare vaccine compositions of the invention.
[0193] Although the sequence of the variants proteins discussed
above will differ from their wild-type counterparts, these variant
proteins will generally retain the ability to form capsids or
capsid-like structures. Thus, the invention further includes
vaccine compositions which contain variants of proteins which form
capsids or capsid-like structures, as well as methods for preparing
such vaccine compositions, individual protein subunits used to
prepare such vaccine compositions. Thus, included within the scope
of the invention are variant forms of wild-type proteins which form
ordered and repetitive hapten arrays (e.g., variants of proteins
which form capsids or capsid-like structures) and retain the
ability to associate and form capsids or capsid-like structures.
Normally, C- an N-terminal trunction variants retain the ability to
form virus like particles. As a result, variant forms including
deletion, addition, or substitution, chimeric forms, and naturally
occurring variants are suitable components of the invention.
[0194] Bacterial Pili and Pilin Proteins.
[0195] In another embodiment, the core particle of the invention
comprises, preferably consists of, a bacterial pilus or pilus-like
particle. The pilus particle comprises proteins, mutant proteins or
fragments of pilin proteins produced by organisms including
Escherichia coli; Haemophilus influenzae; Neisseria meningitidis;
Neisseria gonorrhoeae; Caulobacter crescentus; Pseudomonas
stutzeri; Pseudomonas aeruginosa; Salmonella spp; and Vibrio
cholera. In a preferred embodiment, the pilin proteins or fragments
thereof are selected from the group consisting of: a) Type 1 pilin
proteins; and b) P-pilin proteins. In another embodiment, the pilin
proteins are recombinant proteins, or the pilus or pilus-like
particle comprises a mixture of recombinant and non-recombinant
proteins. In yet an other embodiment, the pilus or pilus-like
particle comprises type I pilin proteins or fragments thereof. In a
further embodiment, the pilin proteins are mutant proteins,
preferably proteins which have been modified by removal of at least
one lysine residue by way of substitution, by addition of at least
one lysine residue by way of substitution, by deletion of at least
one lysine residue, or by addition of at least one lysine residue
by way of insertion. In a preferred embodiment, the type I pilin
proteins have an amino acid sequence as set forth in SEQ ID No: 2.
In yet a further aspect, the invention provides a composition
comprising the conjugate of the invention wherein the core particle
comprises, preferably consists of, a bacterial pilus or pilus-like
particle, and a pharmaceutically acceptable carrier.
[0196] In other embodiments, a bacterial pilin, a subportion of a
bacterial pilin, or a fusion protein which contains either a
bacterial pilin or subportion thereof is used to prepare vaccine
compositions of the invention. Examples of pilin proteins include
pilins produced by Escherichia coli, Haemophilus influenzae,
Neisseria meningitidis, Neisseria gonorrhoeae, Caulobacter
crescentus, Pseudomonas stutzeri, and Pseudomonas aeruginosa. The
amino acid sequences of pilin proteins suitable for use with the
present invention include those set out in GenBank reports
AJ000636, M132364, AF229646, AF051814, AF051815, and X00981, the
entire disclosures of which are incorporated herein by
reference.
[0197] Bacterial pilin proteins are generally processed to remove
N-terminal leader sequences prior to export of the proteins into
the bacterial periplasm. Further, as one skilled in the art would
recognize, bacterial pilin proteins used to prepare vaccine
compositions of the invention will generally not have the naturally
present leader sequence.
[0198] One specific example of a pilin protein suitable for use in
the present invention is the P-pilin of E. coli (GenBank report
AF237482). An example of a Type-1 E. coli pilin suitable for use
with the invention is a pilin having the amino acid sequence set
out in GenBank report P04128 (SEQ ID NO:2), which is encoded by
nucleic acid having the nucleotide sequence set out in GenBank
report M27603. The entire disclosures of these GenBank reports are
incorporated herein by reference. Again, the mature form of the
above referenced protein would generally be used to prepare vaccine
compositions of the invention.
[0199] Bacterial pilins or pilin subportions suitable for use in
the practice of the present invention will generally be able to
associate to form non-natural molecular scaffolds. Methods for
preparing pili and pilus-like structures in vitro are known in the
art. Bullitt et al., Proc. Natl. Acad. Sci. USA 93:12890-12895
(1996), for example, describe the in vitro reconstitution of E.
coli P-pili subunits. Further, Eshdat et al (J. Bacteriol.
148:308-314 (1981)) describe methods suitable for dissociating
Type-1 pili of E. coli and the reconstitution of pili. In brief,
these methods are as follows: pili are dissociated by incubation at
37.degree. C. in saturated guanidine hydrochloride. Pilin proteins
are then purified by chromatography, after which pilin dimers are
formed by dialysis against 5 mM tris(hydroxymethyl)aminomethane
hydrochloride (pH 8.0). Eshdat et al. also found that pilin dimers
reassemble to form pili upon dialysis against the 5 mM
tris(hydroxymethyl)aminomethane (pH 8.0) containing 5 mM
MgCl.sub.2.
[0200] Further, using, for example, conventional genetic
engineering and protein modification methods, pilin proteins may be
modified to contain a first attachment site to which a hapten is
linked through a second attachment site. Alternatively, haptens can
be directly linked through a second attachment site to amino acid
residues which are naturally resident in these proteins. These
modified pilin proteins may then be used in immunizing compositions
of the invention.
[0201] Bacterial pilin proteins used to prepare compositions of the
invention may be modified in a manner similar to that described
herein for HBcAg. For example, cysteine and lysine residues may be
either deleted or substituted with other amino acid residues and
first attachment sites may be added to these proteins. Further,
pilin proteins may either be expressed in modified form or may be
chemically modified after expression. Similarly, intact pili may be
harvested from bacteria and then modified chemically.
[0202] In another embodiment, pili or pilus-like structures are
harvested from bacteria (e.g., E. coli) and used to form vaccine
compositions of the invention. One example of pili suitable for
preparing vaccine compositions is the Type-1 pilus of E. coli,
which is formed from pilin monomers having the amino acid sequence
set out in SEQ ID NO:2.
[0203] A number of methods for harvesting bacterial pili are known
in the art. Bullitt and Makowski (Biophys. J. 74:623-632 (1998)),
for example, describe a pilus purification method for harvesting
P-pili from E. coli. According to this method, pili are sheared
from hyperpiliated E. coli containing a P-pilus plasmid and
purified by cycles of solubilization and MgCl.sub.2 (1.0 M)
precipitation. WO 02/056905 discloses harvesting and purification
of Type I pili from bacteria that naturally produce pili, or into
which a vector has been introduced encoding the fim operon
responsible for pilus production.
[0204] Once harvested, pili or pilus-like structures may be
modified in a variety of ways. For example, a first attachment site
can be added to the pili to which haptens may be attached through a
second attachment site. In other words, bacterial pili or
pilus-like structures can be harvested and modified to form
non-natural molecular scaffolds.
[0205] Pili or pilus-like structures may also be modified by the
attachment of haptens in the absence of a non-natural first
attachment site. For example, antigens or antigenic determinants
could be linked to naturally occurring cysteine resides or lysine
residues. In such instances, the high order and repetitiveness of a
naturally occurring amino acid residue would guide the coupling of
the antigens or antigenic determinants to the pili or pilus-like
structures. For example, the pili or pilus-like structures could be
linked to the second attachment sites of the haptens using a
heterobifunctional cross-linking agent.
[0206] When structures which are naturally synthesized by organisms
(e.g., pili) are used to prepare vaccine compositions of the
invention, it will often be advantageous to genetically engineer
these organisms so that they produce structures having desirable
characteristics. For example, when Type-1 pili of E. coli are used,
the E. coli from which these pili are harvested may be modified so
as to produce structures with specific characteristics. Examples of
possible modifications of pilin proteins include the insertion of
one or more lysine residues, the deletion or substitution of one or
more of the naturally resident lysine residues, and the deletion or
substitution of one or more naturally resident cysteine residues
(e.g., the cysteine residues at positions 44 and 84 in SEQ ID
NO:2).
[0207] Further, additional modifications can be made to pilin genes
which result in the expression products containing a first
attachment site other than a lysine residue (e.g., a FOS or JUN
domain). Of course, suitable first attachment sites will generally
be limited to those which do not prevent pilin proteins from
forming pili or pilus-like structures suitable for use in vaccine
compositions of the invention. The ability of recombinant pilin
proteins to form pili may be determined by a number of methods
including electron microscopy.
[0208] Pilin genes which naturally reside in bacterial cells can be
modified in vivo (e.g., by homologous recombination) or pilin genes
with particular characteristics can be inserted into these cells.
For examples, pilin genes could be introduced into bacterial cells
as a component of either a replicable cloning vector or a vector
which inserts into the bacterial chromosome, The inserted pilin
genes may also be linked to expression regulatory control sequences
(e.g., a lac operator).
[0209] In most instances, the pili or pilus-like structures used in
vaccine compositions of the invention will be composed of single
type of a pilin subunit. However, the compositions of the invention
also include vaccines comprising pili or pilus-like structures
formed from heterogenous pilin subunits. Pili or pilus-like
structures composed of identical subunits will generally be used
because they are expected to form structures which present highly
ordered and repetitive antigen arrays.
[0210] Second Attachment Site.
[0211] The preparation of molecular scaffolds with ordered and
repetitive arrays is provided by the present including compositions
of capsids of RNA phage coat proteins with a high epitope density.
The nature of the hapten, and nature and location of the second
attachment site on the hapten are important factors that may
influence the means available to construct conjugates of the
invention, and the effectiveness of those conjugates in inducing an
immune response, as is understood by those of ordinary skill in the
art.
[0212] A prerequisite for designing a second attachment site is the
choice of the position at which it should be fused, inserted or
generally engineered and attached. A skilled artisan would know how
to find guidance in selecting the position of the second attachment
site, and many factors may be considered relevant to this decision.
The chemical and/or crystal structure of the hapten may provide
information on the availability of domains or moieties on the
molecule suitable for coupling. A reactive moiety or domain's
accessibility to solvent may be a limiting factor in the kinetics
of chemical coupling to a first attachment site. Groups suitable
for coupling must be available, such as sulfhydryl residues. In
general, in the case where immunization with a hapten is aimed at
inhibiting the interaction of said hapten, which may also be a
self-antigen, with its natural ligands, such as a receptor, the
second attachment site will be added such that it allows generation
of antibodies against the site of interaction with the natural
ligands. Thus, the location of the second attachment site will
selected such, that steric hindrance from the second attachment
site or any linker or amino acid linker containing it, is avoided.
In further embodiments, an antibody response directed at a site
distinct from the interaction site of the hapten, which can also be
a self-antigen with its natural ligand is desired. In such
embodiments, the second attachment site may be selected such that
it prevents generation of antibodies against the interaction site
of said hapten with its natural ligands. Other factors of
consideration include the nature of the hapten, its biochemical
properties, such as pI, charge distribution, further modification.
In general, flexible linkers are favored.
[0213] Other criteria in selecting the position of the second
attachment site include the oligomerization state of the hapten,
the site of oligomerization, the presence of a cofactor, the
chemical reactivity of the hapten, and the availability of
experimental evidence disclosing sites in the hapten structure and
sequence where modification of the hapten is compatible with the
function of the hapten, or with the generation of antibodies
recognizing said hapten and preferably, blocking hapten
function.
[0214] One method of attachment of haptens comprising a polypeptide
linker to VLPs, and in particular to capsids of RNA phage coat
proteins is the linking of a lysine residue on the surface of the
capsid of RNA phage coat proteins with a sulfhydryl group residue
on the polypeptide linker, such as is found in cysteine residues.
Similarly, free sulfhydryl groups on haptens may also be effective
attachment sites. Where an oxidized sulfhydryl groups must be in a
reduced state in order to function as a second attachment site,
reduction of may be achieved with e.g. DTT, TCEP or
.beta.-mercaptoethanol.
[0215] In one preferred embodiment of the invention, the hapten is
synthesized in such a manner that it comprises a second attachment
site which can react with the lysine residue on the surface of the
capsid of RNA phage coat proteins.
[0216] According to the present invention, the epitope density on
the capsid of RNA phage coat proteins can be modulated by the
choice of cross-linker and other reaction conditions. For example,
the cross-linkers Sulfo-GMBS and SMPH allow reaching high epitope
density. Derivatization is positively influenced by high
concentration of reactants, and manipulation of the reaction
conditions can be used to control the number of antigens coupled to
RNA phages capsid proteins, and in particular to Q.beta. capsid
protein. In addition, the number of first attachment sites on the
core particle is another factor affecting the density of the hapten
array. In one embodiment of the present invention, we provide a
Q.beta. mutant coat protein with additional lysine residues,
suitable for obtaining higher density arrays.
[0217] Cross Linking.
[0218] Methods for linking the hapten to the core particle are well
within the working knowledge of the practitioner of ordinary skill
in the art, and numerous references exist to aid such a
practitioner (e.g., Sambrook, J. et al., eds., MOLECLAR CLONING, A
LABORATORY MANUAL, 2nd. edition, Cold Spring Harbor Laboratory
Press, Cold Spring Harbor, N.Y. (1989); Ansubel, F. et al., eds.,
CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John H. Wiley & Sons,
Inc. (1997); Cells, J., ed., CELL BIOLGY, Academic Press, 2.sup.nd
edition, (1998); Harlow, E. and Lane, B., "Antibodies: A Laboratory
Manual," Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y.
(1988), all of which are incorporated herein by reference in their
entireties.
[0219] Differing methods of achieving an association between the
core particle and hapten are described herein and are further
described in WO 02/056905. Methods include the JUN and FOS leucine
zipper protein domains are utilized for the first and second
attachment sites of the invention, respectively.
[0220] Preferred embodiments of the invention comprise the coupling
of the non-natural molecular scaffold to the hapten by chemical
cross-linking. There is a wide range of compounds which have been
developed to facilitate cross-linking of proteins/peptides or
conjugation of proteins to derivatized molecules, e.g., haptens.
These include, but are not limited, to carboxylic acid derived
active esters (activated compounds), mixed anhydrides, acyl
halides, acyl azides, alkyl halides, N-maleimides, imino esters,
isocyanates and isothiocyanates, which are known to those skilled
in the art. These are capable of forming a covalent bond with a
reactive group of a protein molecule. Depending upon the activating
group, the reactive group is the amino group of a lysine residue on
a protein molecule or a thiol group in a carrier protein or a
modified carrier protein molecule which, when reacted, result in
amide, amine, thioether, amidine urea or thiourea bond formation.
One skilled in the art may identify further suitable activating
groups, for example, in general reference texts such as Chemistry
of Protein Conjugation and Cross-Linking (Wong (1991) CRC Press,
Inc., Boca Raton, Fla.). Most reagents react preferentially with
lysine side chain groups.
[0221] In some embodiments, the antigen is attached to the core
particle by way of chemical cross-linking, using a
heterobifunctional cross-linker. Several hetero-bifunctional
cross-linkers are known in the art. In one embodiment, the
hetero-bifunctional cross-linker contains a functional group which
can react with the side-chain amino group of lysine residues of the
core particle, and a functional group which can react with a
cysteine residue or sulfhydryl group present on the hapten, made
available for reaction by reduction, or engineered or attached on
the hapten and optionally also made available for reaction by
reduction. The first step of the procedure, called the
derivatization, is the reaction of the core particle with the
cross-linker. The product of this reaction is an activated core
particle, also called activated carrier. In the second step,
unreacted cross-linker is removed using usual methods such as gel
filtration or dialysis. In the third step, the antigen is reacted
with the activated core particle, and this step is called the
coupling step. Unreacted antigen may be optionally removed in a
fourth step.
[0222] In an alternative embodiment, the hapten is derivatized with
an active moiety suitable for cross linking to the first attachment
site, generating an activated hapten. Such derivatization may occur
on an isolated hapten or via a chemical synthesis. The activated
hapten is then reacted with the core particle such that coupling
occurs.
[0223] Several hetero-bifunctional cross-linkers are known in the
art. These include the cross-linkers SMPH (Pierce), Sulfo-MBS,
Sulfo-EMCS, Sulfo-GMBS, Sulfo-SIAB, Sulfo-SMPB, Sulfo-SMCC, SVSB,
SIA and other cross-linkers available, for example from the Pierce
Chemical Company (Rockford, Ill., USA), and having one functional
group reactive towards amino groups and one functional group
reactive towards SH residues. The above mentioned cross-linkers all
lead to formation of a thioether linkage. Another class of
cross-linkers suitable in the practice of the invention is
characterized by the introduction of a disulfide linkage between
the hapten and the core particle upon coupling. Cross-linkers
belonging to this class include for example SPDP and Sulfo-LC-SPDP
(Pierce). The extent of derivatization of the core particle with
cross-linker can be influenced by varying experimental conditions
such as the concentration of each of the reaction partners, the
excess of one reagent over the other, the pH, the temperature and
the ionic strength, as is well known from reaction theory in the
field of organic chemistry. The degree of coupling, i.e. the amount
of hapten per carrier can be adjusted by varying the experimental
conditions described above to match the requirements of the
vaccine. Solubility of the hapten may impose a limitation on the
amount of antigen that can be coupled on each subunit, and in those
cases where the obtained vaccine is insoluble, reducing the amount
of antigens per subunit is beneficial.
[0224] In one specific embodiment the chemical agent is the
heterobifunctional cross-linking agent .epsilon.-maleimidocaproic
acid N-hydroxysuccinimide ester (Tanimori et al., J. Pharm. Dyn.
4:812 (1981); Fujiwara et al., J. Immunol. Meth. 45:195 (1981)),
which contains (1) a succinimide group reactive with amino groups
and (2) a maleimide group reactive with SH groups. A heterologous
protein or polypeptide of the first attachment site may be
engineered to contain one or more lysine residues that will serve
as a reactive moiety for the succinimide portion of the
heterobifunctional cross-linking agent. Once chemically coupled to
the lysine residues of the heterologous protein, the maleimide
group of the heterobifunctional cross-linking agent will be
available to react with the SH group of a cysteine residue on the
antigen or antigenic determinant. Antigen or antigenic determinant
preparation in this instance may require the engineering of a
sulfhydryl residue as the second attachment site so that it may be
reacted to the free maleimide function on the cross-linking agent
bound to the non-natural molecular scaffold first attachment sites.
Thus, in such an instance, the heterobifunctional cross-linking
agent binds to a first attachment site of the non-natural molecular
scaffold and connects the scaffold to a second binding site of the
antigen or antigenic determinant.
[0225] Other methods of coupling the hapten to the core particle
include methods wherein the hapten is cross-linked to the core
particle using carbodiimide compounds. These include the
carbodiimide EDC (1-(3-dimethylaminopropyl)-3-ethylcarbodiimide
hydrochloride), which can optionally also be used with
N-hydroxy-succinimide NHS in the reaction. In one method, EDC is
mixed with a hapten containing a free carboxylic acid, then added
to the protein carrier. In other methods, the hapten is attached to
the core particle using a homo-bifunctional cross-linker such as
glutaraldehyde, DSG, BM[PEO].sub.4, BS.sup.3, (Pierce Chemical
Company, Rockford, Ill., USA) or other known homo-bifunctional
cross-linkers with functional groups reactive towards amine groups
or carboxyl groups of the core particle.
[0226] Additional cross-linking methods and cross-linkers, suitable
for attaching a hapten to a core particle and a virus-like
particle, respectively, as well as guidance on performing the
coupling reactions and on the use of chemical cross-linkers and
chemical cross-linking procedures can be found in Hermanson, G. T.
in Bioconjugate Techniques, Academic Press Inc., San Diego, Calif.,
USA.
[0227] Further methods of binding the core particle to a hapten
include methods where the core particle is biotinylated, and the
hapten linked to streptavidin, or methods wherein both the hapten
and the core particle are biotinylated. In this case, the hapten
may be first bound to streptavidin or avidin by adjusting the ratio
of antigen to streptavidin such that free binding sites are still
available for binding of the core particle, which is added in the
next step. Alternatively, all components may be mixed in a "one
pot" reaction. Other ligand-receptor pairs, where a soluble form of
the receptor and of the ligand is available, and are capable of
being cross-linked to the core particle or the hapten, may be used
as binding agents for binding the hapten to the core particle.
[0228] Haptens.
[0229] In one aspect, the invention provides ordered, repetitive
hapten arrays suitable for immunization against haptens. Preferred
haptens are hormones, drugs and toxic compounds. More preferred are
drugs, especially addictive drugs. Immune responses against said
drugs, hormones and toxic compounds may be used to protect an
individual at risk of exposure to said compounds, as therapy in an
individual so exposed, or so as to prevent or treat addictions.
[0230] Representative hormones include, but are not limited to,
progesterone, testosterone, estrogen, melanin stimulating hormone,
cortisone, follicle stimulating hormone, adrenalin, and
noradrenalin. Immune responses against said hormones may be used in
therapies against melanoma; cancers of the reproductive organs,
such as breast, ovarian, uterine, testicular, and cervical cancers;
and in conditions where alteration of hormone levels is desired
such as for contraception.
[0231] Representative toxic compounds include, but are not limited
to, the natural products of toxic plants, animals, and
microorganisms; these include but are not limited to aflatoxin,
ciguautera toxin, and tetrodotoxin. Representative toxic compounds
produced artificially, or as a result of metabolism include
antibiotics (e.g vancomycin and the like), anticancer compounds (eg
vinblastine and the like) and chemical warfare agents (eg.
botulinus toxin, sarin, tabun, soman, VX and the like). An aspect
of the invention includes the production of antibodies against
toxic metabolites of commonly used pharmaceutical agents, such that
an individual may continue to receive the beneficial effects of a
pharmaceutical agents without side effects associated with toxic
metabolites.
[0232] The selection of antigens or antigenic determinants for
compositions and methods of treatment for drug addiction, in
particular recreational drug addiction, would be known to those
skilled in the medical arts treating such disorders. Representative
examples of such antigens or antigenic determinants include, for
example, opioids and morphine derivatives such as codeine,
fentanyl, heroin, morphium and opium; relaxants such as diazepam;
stimulants such as amphetamine, cocaine, MDMA
(methylenedioxymethamphetamine), methamphetamine, methylphenidate
and nicotine; hallucinogens such as PCP, LSD, mescaline and
psilocybin; cannabinoids such as hashish and marijuana; as well as
the desipramine/imipramine class of drugs and the
nortriptyline/amitriptyline class of drugs. Therapy for nicotine
addiction may also target nicotine metabolites including
nornicotine and cotinine, both of which have longer half lives than
nicotine, have pharmacologic and neuropharmacologic affects similar
to nicotine and may be addictive.
[0233] In the above embodiments, it is not necessary that the
immunizing hapten comprising the entire molecule of hormone, drug,
or toxin. Suitable immune responses against the drug, hormone or
toxin of interest may be generated by the use of fragments of the
drug, hormone or toxin, or related chemical structures.
[0234] The invention embodies different sites of linkage and means
of linkage of the hapten to the carrier, and have been illustrated
both earlier in the invention, and by reference to the examples.
Preferred sites and means of linkage may be determined on the basis
of prior experience, theory and by routine experimentation.
[0235] Nicotine and Nicotine Metabolites.
[0236] Immune responses suitable for nicotine may be generated by
haptens coupled to the core particle either via the pyridine or
pyrrolidine ring. In one embodiment,
6-(carboxymethylureido)-(.+-.)-nicotine (CMUNic) conjugate is
synthesized from 6-amino-(.+-.)-nicotine, which is reacted with
ethyl isocyanoacetate to form
6-(carboxyethylureido)-(.+-.)-nicotine, and hydrolysis by lithium
hydroxide to form CMUNic as described (Hieda et al Int J Pharmacol
22:809-819 (2000)), the reference to which is incorporated herein
in its entirety. The hapten is conjugated to the core particle via
the terminal carboxyl group, which may be activated using e.g.
1-ethyl-3-(3-dimethylaminopropyl) carbodiimide HCl. In another
embodiment, 6-amino-(.+-.)-nicotine is coupled to carrier proteins
as described by WO 99/61054, incorporated herein by reference in
its entirety.
[0237] In another embodiment of the present invention,
trans-3'-aminomethylnicotine conjugate is prepared by
trans-3'-hydroxymethylnicotine alcohol via the tosylate as
described by Cushman and Castignoli (J Org Chem 37:1268-1271
(1972)) the reference to which is incorporated herein in its
entirety. The hapten is conjugated to the core particle through a
succinic acid linker using 1-ethyl-3-(3-dimethylaminopropyl)
carbodiimide HCl (EDAC) to activate the linker's carboxylic acid
group.
[0238] In a related embodiment, 3'-linkages to nicotine haptens are
performed by first generating trans-3'-hydroxymethylnicotine which
is reacted with succinic anhydride to yield the succinylated
hydroxymethylnicotine (O-succinyl-3'-hydroxymethyl-nicotine). This
product is then mixed with EDAC and the core particle for
carbodiimide-activated coupling, as described by Langone and Van
Vunakis (Methods Enzymol. 84:628-640 (1982)) the reference to which
is incorporated herein in its entirety. In another embodiment,
trans-4'-carboxycotinine is similarly activated with EDAC for
coupling to a protein carrier.
[0239] In one embodiment, a nicotine hapten is coupled via the
1-position Nitrogen by conversion to the aminoethylpyridinium
derivative, S-1-(b-aminoethyl)nicotinium chloride dihydrochloride,
which is then coupled to a core particle in the presence of
1-cyclohexyl-3-(2-morpholinoethyl)-carbodiimide
metho-p-toluenesulfonate as described Noguchi et al. (Biochem
Biophys Res Comm. 83:83-86 (1978)) the reference to which is
incorporated herein in its entirety. In a related embodiment,
Cotinine is conjugated to core particles using the same general
approach, via formation of S-1-(b-aminoethyl) cotinium chloride
hydrochloride.
[0240] In one embodiment, a nicotine hapten is coupled via the
1'-position as described by Isomura et al. (J. Org Chem
66:4115-4121 (2001), the reference to which is incorporated herein
in its entirety, via formation of
N-[1-oxo-6-[(2S)-2-(3-pyridyl)-1-pyrrolidinyl]hexyl]-.beta.-alanine.
This activated hapten is then coupled to a protein carrier. In
three other embodiments, conjugates are formed between the first
attachment site on a protein core particle and the cotinine hapten
4-oxo-4-[[6-[(5S)-2-oxo-5-(3-pyridinyl)-1-pyrrolidinyl]]hexyl]amino]-buta-
noic acid, or the nornicotine haptens
(2S)-2-(3-pyridinyl)-1-pyrrolidinebutanoic acid phenylmethyl ester
or (2R)-2-(3-pyridinyl)-1-pyrrolidinebutanoic acid phenylmethyl
ester.
[0241] In one embodiment, cotinine 4'-carboxylic acid is covalently
bound to carriers at lysine as described by Bjerke et al. (J.
Immunol. Methods, 96, 239-246 (1987)) the reference to which is
incorporated herein in its entirety.
[0242] Nicotine haptens may be conjugated to carrier protein via a
linker at the 6-position of nicotine. Along these lines, the
following haptens are used in embodiments of the present invention
N-succinyl-6-amino-(.+-.)-nicotine;
6-(.sigma.-aminocapramido)-(.+-.)-nicotine and
6-(.sigma.-aminocapramido)-(.+-.)-nicotine, as described (Castro et
al. Eur. J. Biochem., 104, 331-340 (1980); Castro et al. in
Biochem. Biophys. Res. Commun. 67, 583-589 (1975); Castro et al.
Res. Commun Chem. Path. Pharm. 51, 393-404 (1986)), which is
incorporated by reference herein in its entirety.
[0243] In other embodiments of the invention, nicotine haptens are
conjugated via the 3',4', or 5' position via succinylation of
aminomethylnicotine, activation with EDC and subsequent mixture
with the carrier, as described by U.S. Pat. No. 6,232,082, the
reference to which is incorporated herein in its entirety. In other
embodiments, aminomethyl nicotine is conjugated via polyglutamic
acid-ADH to the core particle. In other embodiments, conjugates are
formed from acetyl nicotine and aldehydro nicotine derivatized at
the 3',4', or 5' positions.
[0244] In other embodiments, hapten carrier conjugates comprise 5-
and 6-linkages of nicotine, including
5-(1-methyl-2-pyrrolidinyl)-2- or 3-pyridinyl-conjugates and
5-(N-methyl-2-pyrrolidinyl)-2- or 3-pyridinyl-conjugates. The
construction of the haptens for these conjugates is described in WO
99/61054, the reference to which is incorporated herein in its
entirety. In other embodiments, 5- and 6-amino nicotine are
utilized as starting materials that are further derivatized at the
amino group to add, typically, carbon chains that terminate in a
suitably reactive group including amines and carboxylic acids.
These haptens are then suitable for conjugation to core particles
of the present invention. In other embodiments, 5- or
6-bromonicotine is used as a suitable starting material for
reaction with alkynes leading to the addition of unsaturated carbon
groups with a chain which terminate with moeities suitable for
coupling, including amines and carboxylic acids, that allow
conjugation to the core particle.
[0245] Other embodiments of the present invention comprise
conjugates comprising nicotine haptens conjugated at the 1, 2, 4,
5, 6, or 1' positions of the nicotine, as described by Swain et al.
(WO 98/14216), herein incorporated by reference in its
entirety.
[0246] Other embodiments of the present invention comprise
conjugates comprising nicotine haptens as described by Janda et al.
(WO 02/058635).
[0247] Further embodiments comprise conformationally constrained
nicotine haptens as described in Meijler et al. (J. Am. Chem. Soc,
2003, 125, 7164-7165).
[0248] Cocaine and Related Drugs.
[0249] The present invention provides conjugates, compositions and
methods comprising cocaine conjugated to a core particle. In one
group of embodiments, the diazonium salts of benzoyl cocaine and
benzoyl ecognine are coupled to carrier proteins. In other
embodiments the para-imino ester derivatives of cocaine and
norcocaine are conjugated to core particles. Haptens suitable for
these embodiments are described in U.S. Pat. Nos. 3,88,866,
4,123,431 and 4,197,237 the references to which are incorporated
herein in their entireties. Conjugates of cocaine using the
para-position of the phenyl ring of various cocaine derivatives
show increased stability to hydrolysis by the introduction of an
amide bond.
[0250] Other embodiments of the present invention comprise cocaine
haptens described by U.S. Pat. No. 5,876,727, the reference to
which is incorporated herein in its entirety.
[0251] In one embodiment, precursors of the conjugates of the
instant invention are synthesized by acylating ecgonine methyl
ester with bromoacetyl bromide in DMF in the presence of two
equivalents of diisopropylethylamine. The product is then coupled
to the thiol group of a thiolated carrier protein to obtain a
conjugate.
[0252] In another embodiment, precursors of the conjugates of the
instant invention are synthesized by succinylating ecgonine methyl
ester with succinic anhydride in DMF in the presence of one
equivalent of triethylamine. The product is then coupled to the
amino group of a lysine residue of a carrier protein to obtain a
conjugate. In one embodiment, precursors of the conjugates of the
instant invention are synthesized by reacting norcocaine with
succinic anhydride in methylene chloride in the presence of two
equivalents of triethylamine. In other embodiments precursors of
the conjugates of the instant invention are synthesized by reacting
a solution of norcocaine monoactivated succinic acid and
triethylamine to form succinylated norcocaine. In either case, the
resulting succinyl norocaine consists of a mixture of at least two
isomers, namely the exo and endo forms of the succinyl group. In
these embodiments succinyl norocaine is then be coupled to the
.epsilon.-amino group of a lysine residue of a carrier protein
using EDC to obtain a conjugate. In an alternative embodiment, the
coupling reaction is carried out using a pre-activated succinylated
norcocaine derivative. That is, the intermediate can be isolated
and characterized. The pre-activated succinylated norcocaine
derivative is synthesized by reacting 4-hydroxy-3-nitrobenzene
sulfonic acid sodium salt with succinylated norcocaine in the
presence of dicyclohexylcarbodiimide (DCC) and DMF. The product is
conjugated to the amino group of a lysine residue of a carrier
protein to obtain a conjugate.
[0253] In one alternative embodiment, compounds of the present
invention are synthesized by reacting succinylated norcocaine with
N-hydroxysuccimide in the presence of ethyl chloroformate,
N-methylmorpholine (NMM) and DMF. The product is then coupled to
the amino group of a lysine residue of a carrier protein to obtain
a conjugate.
[0254] In one embodiment, compounds of the instant invention are
synthesized by reacting thionyl chloride with succinylated
norcocaine. The product is then conjugated to a carrier protein to
obtain a conjugate. In another embodiment, compounds of the instant
invention are synthesized by reacting succinylated norcocaine with
HATU in DMF and diisopropylethylamine as outlined by Carpino
((1993) J. Am. Chem. Soc. 115:4397-4398) the reference to which is
incorporated herein in its entirety. The product is added to an
aqueous solution containing the carrier protein to obtain a
conjugate.
[0255] In another embodiment, compounds of the invention are
synthesized by reacting succinylated norcocaine with PyBroP in DMF
and diisopropylethylamine. The product is added to an aqueous
solution containing the carrier protein to obtain a conjugate. In a
related embodiment the carrier protein is succinylated with
succinic anhydride in borate buffer. The product is then coupled to
norcocaine in the presence of EDC to obtain a conjugate.
[0256] In another embodiment, reduction of the free acid of
coacaine in benzoyl ecgonine to its corresponding primary alcohol,
is achieved using borane-dimethylsulfide complex. The alcohol is
reacted with succinic anhydride in DMF, the product of which is
then conjugated to the free amino acid group of a carrier protein
in the presence of EDC to obtain a conjugate.
[0257] In another embodiment, compounds of the instant invention
are synthesized by conjugating benzoyl ecgonine to the amino group
of a lysine residue of a carrier protein in the presence of EDC to
obtain a conjugate.
[0258] In one embodiment, the precursor of the conjugates is
synthesized by acylating racemic nornicotine with succinic
anhydride in methylene chloride in the presence of two equivalents
of diisopropylethylamine. The product of this reaction is then
coupled to the lysine residue of a carrier protein using HATU to
obtain the conjugate. In another embodiment, selectively alkylating
the pyridine nitrogen in (S)-(-)-nicotine in anhydrous methanol,
with ethyl 3-bromobutyrate, 5-bromovaleric acid, 6-bromohexanoic
acid or 8-bromooctanoic acid yield products suitable for
conjugation to a carrier protein using HATU.
Compositions, Vaccines, and the Administration Thereof, and Methods
of Treatment
[0259] As discussed herein, the invention provides compositions
which may be used for preventing and/or treating diseases or
conditions. The invention further provides vaccination methods for
preventing and/or treating diseases or conditions in individuals.
In a preferred embodiment, compositions stimulate an immune
response leading to the production of immune molecules, including
antibodies, that bind to organic molecules. The invention further
provides vaccination methods for preventing and/or treating
diseases or conditions in individuals.
[0260] The nature or type of immune response is not a limiting
factor of this disclosure. The desired outcome of a therapeutic or
prophylactic immune response may vary according to the disease,
according to principles well known in the art. For example, a
vaccine against an inhaled drug (eg nicotine, cocaine) may be
designed to induce high titres of serum IgG and also of secreted
sIgA antibodies in the respiratory epithelium, thus binding
nicotine both in the respiratory tract and within the bloodstream.
By comparison, titres of sIgA antibodies are presumably less
relevant when targeting an injected drug of abuse (eg heroin).
However, a vaccination methodology against an injected drug of
abuse that results in high serum titres as well as sIgA will
nonetheless be effective, so long as serum titres are
sufficient.
[0261] The invention comprises vaccines sufficient to cure or
prevent a disease or condition or addiction. The invention further
comprises vaccines that reduce the number, severity or duration of
symptoms; and vaccine compositions effective in reducing the number
of individuals in a population with symptoms. The invention
comprises compositions with effects upon the immune system that may
aid in the treatment of a disease, as one facet in an overall
therapeutic intervention against a disease. Given the notably
complex nature of addiction, the invention comprises compositions
that aid in therapy against drug addiction but are accompanied by
psychiatric, behavioural, social and legal interventions.
[0262] Furthermore, it may be desired to stimulate different types
of immune response depending on the disease, and according to
principles known in the art. It is well known, for example, that
some immune responses are more appropriate for a particular antigen
than other immune responses. Some immune responses are, indeed,
inappropriate and can cause pathology, such as pathologic
inflammation.
[0263] The nature of the immune response can be affected by the
nature of the antigen, route of introduction into the body, dose,
dosage regimen, repetitive nature of the antigen, host background,
and signalling factors of the immune system. Such knowledge is well
known in the art. As such, an immune response may be tailored by
the application of both art known theory and routine
experimentation.
[0264] Furthermore, the invention embodies the use of differing
core particles during the course of vaccination against a drug or
drugs. Individuals who develop strong immune responses against core
particles such as e.g. pili, may be immunized with compositions
comprising the same hapten but differing in core particle.
[0265] While not wishing to be bound by theory or any particular
mechanistic explanation for operation of the present invention, the
conjugates of the present invention provide particular novel and
surprising advantages as components of pharmaceutical compositions
to generate an immune response, and particularly as vaccines. Other
carriers known in the art including BSA, keyhole limpet hemocyanin,
tetanus toxoid, bacterial outermembrane proteins, cholera toxin,
and Pseudomonas aeruginosa Exotoxin A may be inappropriate for use
in an individual, and in particular a human. The aforementioned
carriers may induce allergic reactions, or stimulate pathologic
immune responses (for example, cholera toxin, KLH, BSA). The
aforementioned carriers may require the presence of adjuvants such
as complete Freunds adjuvant, now considered inappropriate for use
in humans. A number of the carriers may be components of current
vaccines (for example, tetanus toxiod, cholera toxin, Exotoxin A).
As such, an individual may possess a high level of pre-existing
immunity to these carriers, such that immunization with an
antigen-carrier conjugate will induce a relatively greater immune
response to the carrier than to the novel antigen. For these
reasons, individually or as a whole, the conjugates and
compositions of the present invention represent a useful
improvement over the above-described carrier proteins. The present
invention demonstrates the use of Nicotine-Q.beta. VLP conjugate
composition to stimulate an immune response against nicotine
without the use of complete Freund's adjuvant and without evidence
of pathologic immune responses.
[0266] in the use of the embodiments of the invention, haptens
conjugated to core particles can be taken up by antigen presenting
cells and thereby stimulate T-cell help to induce immune response.
T helper cell responses can be divided into type 1 (T.sub.H1) and
type 2 (T.sub.H2) T helper cell responses (Romagnani, Immunol.
Today 18:263-266 (1997)). T.sub.H1 cells secrete interferon-gamma
and other cytokines which trigger B cells to produce IgG1-3
antibodies. In contrast, a critical cytokine produced by T.sub.H2
cells is IL-4, which derived B cells to produce IgG4 and IgE. In
many experimental systems, the development of T.sub.H1 and T.sub.H2
responses is mutually exclusive since T.sub.H1 cells suppress the
induction of T.sub.H2 cells and vice versa. Thus, antigens that
trigger a strong T.sub.H1 response simultaneously suppress the
development of T.sub.H2 responses and hence the production of IgE
antibodies. Interestingly, virtually all viruses induce a T.sub.H1
response in the host and fail to trigger the production of IgE
antibodies (Coutelier et al., J. Exp. Med. 165:64-69 (1987)).
Antibodies of the IgE isotype are important components in allergic
reactions. Mast cells bind IgE antibodies on their surface and
release histamines and other mediators of allergic response upon
binding of specific antigen to the IgE molecules bound on the mast
cell surface. The isotype pattern typical of T.sub.H1 responses is
not restricted to live viruses but has also been observed for
inactivated or recombinant viral particles (Lo-Man et al., Eur. J.
Immunol. 28:1401-1407 (1998)). Thus, by using the processes of the
invention (e.g., AlphaVaccine Technology), viral particles can be
decorated with various hapten and used for immunization. Due to the
resulting "viral structure" of the hapten, a T.sub.H1 response will
be elicited, "protective" IgG1-3 antibodies will be produced, and
the production of IgE antibodies which cause allergic reactions
will be prevented. Thus, the invention embodies compositions
capable of inducing preferred immune responses, notably T.sub.H1
type responses. Further, the invention embodies the use of
compositions of the invention to counter allergic reactions induced
by alternative vaccines against haptens of interest.
[0267] A further advantageous feature of the present invention is
that haptens may be presented on the in regular, repetitive arrays
that are able to induce efficient immune responses both with and
without T-cell help. This feature of the invention is particularly
advantageous.
[0268] Unlike isolated proteins, viruses induce prompt and
efficient immune responses in the absence of any adjuvants both
with and without T-cell help (Bachmann & Zinkemagel, Ann. Rev.
Immunol: 15:235-270 (1997)). Although viruses often consist of few
proteins, they are able to trigger much stronger immune responses
than their isolated components. For B-cell responses, it is known
that one crucial factor for the immunogenicity of viruses is the
repetitiveness and order of surface epitopes. Many viruses exhibit
a quasi-crystalline surface that displays a regular array of
epitopes which efficiently crosslinks epitope-specific
immunoglobulins on B cells (Bachmann & Zinkemagel, Immunol.
Today 17:553-558 (1996)). This crosslinking of surface
immunoglobulins on B cells is a strong activation signal that
directly induces cell-cycle progression and the production of IgM
antibodies. Further, such triggered B cells are able to activate T
helper cells, which in turn induce a switch from IgM to IgG
antibody production in B cells and the generation of long-lived B
cell memory--the goal of any vaccination (Bachmann &
Zinkemagel, Ann. Rev. Immunol. 15:235-270 (1997)). The present
invention provides one way to improve the efficiency of vaccination
by increasing the degree of repetitiveness of the hapten to be used
for immunization, through binding of the hapten to the core
particles. As previously noted, the invention provides for
compositions comprising core particle modified to alter the number
and or arrangement of the first attachment sites.
[0269] As will be understood by one of ordinary skill in the art,
when conjugates of the present invention are administered to an
individual, they may be in a composition which contains salts,
buffers, adjuvants and other substances, excipients or carriers
which are desirable for improving the efficacy of the composition.
Examples of materials suitable, or acceptable, for use in preparing
pharmaceutical compositions are provided in numerous sources
including REMINGTON'S PHARMACEUTICAL SCIENCES (Osol, A, ed., Mack
Publishing Co., (1990)).
[0270] Compositions of the invention are said to be
"pharmacologically acceptable" if their administration can be
tolerated by a recipient individual. Further, the compositions of
the invention will be administered in a "therapeutically effective
amount" (i.e., an amount that produces a desired physiological
effect).
[0271] The compositions of the present invention may be
administered by various methods known in the art, but will normally
be administered by injection, infusion, inhalation, oral
administration, or other suitable physical methods. The
compositions may alternatively be administered intramuscularly,
intravenously, transmucosally, transdermally or subcutaneously.
Components of compositions for administration include sterile
aqueous (e.g., physiological saline) or non-aqueous solutions and
suspensions. Examples of non-aqueous solvents are propylene glycol,
polyethylene glycol, vegetable oils such as olive oil, and
injectable organic esters such as ethyl oleate. Carriers or
occlusive dressings can be used to increase skin permeability and
enhance antigen absorption.
[0272] In one specific embodiment, a human with nicotine addiction
is immunized with 5 to 500 .mu.g, preferably 25 to 200 .mu.g, more
preferably 50 to 100 .mu.g, most preferably 100 .mu.g of
Nic-Q.beta. conjugate, with boosts at 3 weeks and again at 6 weeks,
more preferably with boosts at 4 weeks and again at 8 weeks. Routes
of immunizations can comprise intramuscular, subcutaneous,
intradermal, transdermal, or intravenous injections. Two weeks
after immunization, the immune response is monitored with kits as
described elsewhere herein. The resulting immune response is
specific for nicotine and comprises high serum IgG, and is
sufficient to inhibit nicotine uptake into the brain. The resulting
immune response is long lasting and thus the individual does not
experience pleasurable effects from nicotine, and ceases nicotine
use. Those skilled in the art will know from the measured immune
response whether additional immunizations will be needed to
maintain nicotine specific IgG levels. In an alternative embodiment
of the present invention the nicotine-hapten carrier conjugates of
the invention are administered by intranasal vaccination. This type
of administration leads to high antibody titers encompassing IgA as
indicated in the examples.
[0273] In a further embodiment of the invention, a pharmaceutical
composition is provided for treating nicotine addiction, palliating
nicotine withdrawal symptoms, facilitating smoking cessation or
preventing relapse comprising a therapeutically effective
combination of the vaccine composition of the invention and an
additional agent. In one embodiment, the additional agent is
selected from the group consisting of: anti-depressant; nicotine
receptor modulator; cannabinoid receptor antagonist; opioid
receptor antagonist; monoamine oxidase inhibitor; anxiolytic or any
combination of these agents. Preferably, the additional agent is an
anti-depressant selected from the group consisting of bupropion,
doxepin, desipramine, clomipramine, imipramine, nortriptyline,
amitriptyline, protriptyline, trimipramine, fluoxetine,
fluvoxamine, paroxetine, sertraline, phenelzine, tranylcypromine,
amoxapine, maprotiline, trazodone, venlafaxine, mirtazapine, their
pharmaceutically active salts and their optical isomers. In a very
preferred embodiment, the anti-depressant is either bupropion or a
pharmaceutically acceptable salt thereof, or nortriptyline or a
pharmaceutically acceptable salt thereof.
[0274] In another embodiment, the additional agent is a nicotine
receptor modulator selected from the group consisting of
mecamylamine, SSR591813, amantadine, pempidine,
dihydro-beta-erythroidine, hexamethonium, erysodine,
chlorisondamine, trimethaphan camsylate, tubocurarine chloride,
d-tubocurarine, varenicline, their pharmaceutically acceptable
salts and their optical isomers. In a very preferred embodiment,
the nicotine receptor modulator is mecamylamine or a
pharmaceutically acceptable salt thereof. In another preferred
embodiment, the nicotine receptor modulator is varenicline or a
pharmaceutically acceptable salt thereof.
[0275] In one embodiment, the present invention comprises a method
of treating tobacco addiction or nicotine addiction, palliating
nicotine withdrawal symptoms, preventing relapse or facilitating
smoking cessation comprising the step of administering to a patient
the vaccine composition of the invention and an additional agent.
In a preferred embodiment, the vaccine composition is administered
intranasally, orally, subcutaneously, transdermally,
intramuscularly or intravenously, and wherein said additional agent
is administered orally or via a transdermal patch. In a more
preferred embodiment, the vaccine composition of the invention
comprises O-succinyl-3'-hydroxymethyl-nicotine conjugated to
Q.beta. virus like particle.
[0276] Anti-depressants, nicotine receptor agonists and
antagonists, cannabinoid and opioid receptor antagonists, monoamine
oxidase inhibitors and anxiolytics are able to relieve certain
symptoms during smoking cessation such as withdrawal, craving,
depression, irritability, anergia, amotivation, appetite changes,
nausea and hypersomnia. They mainly act directly on receptors in
the brain. Furthermore, weight increase upon smoking cessation is a
major concern for a number of people. Vaccination inhibits the
uptake of the nicotine into the brain and thus inhibits its
rewarding effects. It does not inhibit withdrawal symptoms but
inhibits the reinforcement of nicotine addiction upon a slip.
Therefore, a combination of vaccination and the use of
anti-depressants, nicotine receptor antagonists, cannabinoid
receptor antagonists, monoamine oxidase inhibitors and anxiolytics
and further drugs inhibiting weight gain is beneficial for aid in
smoking cessation and relapse prevention.
[0277] Anti-depressants are used to treat symptoms of nicotine
withdrawal and aid smoking cessation. One such anti-depressant is
bupropion and a sustained-release formulation of bupropion HCl
under the tradename Zyban is marketed as an aid for smoking
cessation. The mechanism of action of bupropion is presumed to
involve inhibition of neural re-uptake of dopamine and/or
norepinephrine. As dopamine has been associated with the rewarding,
effects of addictive substances, such as nicotine, inhibition of
the norepinephrine uptake was contemplated to induce a decrease of
withdrawal symptoms. Methods to produce bupropion and
pharmaceutically acceptable salts thereof are disclosed in U.S.
Pat. Nos. 3,819,706 and 3,885,046. Methods to produce optically
pure (+)-bupropion and pure (-)-bupropion have been disclosed
(Castaldi G, et al., J. Org. Chem., 1987, 52:3018, Musso et al.,
1993, Chirality 5: 495-500).
[0278] A preferred embodiment of the invention envisages the
combined treatment of subjects for aid in smoking cessation or
relapse prevention by vaccination using nicotine-VLP conjugates,
preferentially nicotine-Qb conjugates, and administering bupropion,
preferably bupropion hydrochloride. The amount of bupropion to be
administered is formulated so as to provide a initial dose of about
150 mg per day for 6 days which is then followed by a dose of 300
mg per day.
[0279] Nortriptyline is used to treat depressions and has also been
shown to be active in aiding smoking cessation (da Costa et al.,
2002, Chest, 122, 403-408). Methods to produce nortryptyline are
known to those skilled in the art. A preferred embodiment of the
invention envisages the combined treatment of subjects for aid in
smoking cessation or relapse prevention by vaccination using
nicotine-VLP conjugates, preferentially nicotine-Qb conjugates, and
administering nortriptyline. Nortriptyline is administered in a
dose of 10-150 mg, most preferably 75 mg per day.
[0280] Additional anti-depressants contemplated for combination
with vaccination include: doxepin, fluoxetine, desipramine,
clomipramine, imipramine, amitriptyline, trimipramine, fluvoxamine,
proxetine, sertraline, phenelzine, tranylcypromine, amoxapine,
maprotiline, trazodone, venlafaxine, mirtrazapine, their
pharmaceutically active salts or their optical isomers.
[0281] Nicotine receptor agonists and antagonists attenuate the
reward received by tobacco usage by blocking the receptors.
[0282] Varenicline tartrate is a further selective nicotinic
receptor modulator. Varenicline tartrate
(7,8,9,10-tetrahydro-6,10-methano-6H-pyrazino[2,3-h][3]benzazepine
(2R,3R)-2,3-dihydroxybutanedionate) reduces severity of nicotine
withdrawal symptoms. Its synthesis has been described in WO
01/62736. A preferred embodiment of the invention envisages the
combined treatment of subjects for aid in smoking cessation or
relapse prevention by vaccination using nicotine-VLP conjugates,
preferentially nicotine-Qb conjugates, and administering
varenicline, preferably varenicline tartrate. The dose of
varenicline tartrate administered is 1 mg twice daily.
[0283] (5aS,8S,10aR)-5a,6,9,10-tetrahydro,
7H,11H-8,10a-methanopyrido[2',3':5,6]pyrano-[2,3-d]azepine
(SSR591813) is a compound that binds with high affinity alpha4beta2
nicotinic acetylcholine receptor (nAChR) subtypes. The synthesis of
derivatives is described in U.S. Pat. No. 6,538,003. A preferred
embodiment of the invention envisages the combined treatment of
subjects for aid in smoking cessation or relapse prevention by
vaccination using nicotine-VLP conjugates, preferentially
nicotine-Qb conjugates, and administering SSR591813. The dose of
SSR591813 is formulated to provide a dose between 1 mg and 500 mg
daily.
[0284] In a preferred embodiment of the invention the nicotine
receptor antagonist mecamylamine hydrochloride or an
pharmaceutically acceptable salt thereof is given to subjects for
aid in smoking cessation or relapse prevention in combination with
vaccination using nicotine-VLP conjugates, preferentially
nicotine-Qb conjugates. Mecamylamine hydrochloride has been shown
to block many of the physiological, behavioral and reinforcing
effects of nicotine. Mecamylamine hydrochloride is formulated to
provide a dose of about 1 mg to about 25 mg per day.
[0285] Further specific nicotine antagonists include amantadine,
pempidine, dihydro-beta-erthyroidine, hexamethonium, erysodine,
chlorisondamine, trimethaphan camsylate, tubocurarine chloride,
d-tubocurarine, their pharmaceutically acceptable salts or their
optical isomers.
[0286] Central cannabinoid receptor antagonists are also used to
help quitting smoking. Such a cannabinoid antagonist is
N-piperidino-5-(4-chloro-phenyl)-1-(2,4-dichlorophenyl)-4-methylpyrazole--
3-carboxamide, referred to below as rimonabant. Its synthesis and
pharmaceutical compositions containing the same are disclosed in
patent applications EP-576'357, EP-656'354, WO 96/02248 and WO
03/040105. The efficacy of rimonabant has been described by Cohen
et al. (Behav Pharmacol. 2002, 13, 451-63).
[0287] A preferred embodiment of the invention envisages the
combined treatment of subjects for aid in smoking cessation or
relapse prevention by vaccination using nicotine-VLP conjugates,
preferentially nicotine-Qb conjugates, and administering
rimonabant. The amount of rimonabant to be administered is
formulated so as to provide a dose of 5 to 40 mg per day,
preferably 20 mg/day.
[0288] In a further embodiment opoid antagonists such as naltrexone
can be used in combination with vaccination against nicotine. The
use of naltrexone and related compounds in smoking cessation are
described in U.S. Pat. No. 6,004,970. Typical doses vary between
12.5 mg and 150 mg.
[0289] Anxiolytics have also been administered to treat nicotine
withdrawal. Anxiolytics counter the mild anxiety symptoms that
occur during smoking cessation treatment, or the treatment of
alcoholism and other substance abuse. The anxiolytic isovaleramide
has been recommended for the use in smoking cessation (Baladrin et
al., WO 94/28888). Further anxiolytics comprise buspirone,
hydroxyzine and meprobamate. Buspirone is administered in a dosage
range of about 5 mg to 60 mg per day.
[0290] Monoamine oxidase inhibitors have been described for
treatment of drug withdrawal symptoms (WO 92/21333 and WO
01/12176). Reversible selective inhibitors of monoamine oxidase A,
reversible selective inhibitors of monoamine oxidase B or
reversible mixed inhibitors of monoamine oxidase A and B can have
activity in reducing withdrawal symptoms. Among reversible
monoamine oxidase A inhibitors befloxatone, moclobemide,
brofaromine, phenoxathine, esuprone, befol, RS 8359 (Sankyo), T794
(Tanabe), KP 9 (Krenitsky USA), E 2011(Eisei), toloxatone,
pirlindole, amiflavine, sercloremine and bazinaprine may be cited.
These compounds are known and their preparations are described in
the art. Among reversible selective inhibitors of monoamine oxidase
B, lazabemide, milacemide, caroxazone, rFO, deprenyl, AGN-1135,
MDL72145 and 3-508 may be cited. The use of befloxatone or
3-[4-(4,4,4-trifluoro-3R-hydroxybutoxy)phenyl]5(R)-methoxymethyl-2-oxazol-
idinone for treatment of obesity has been described in WO 01/12176.
The use of the deprenyl isomer selegeline has been described in
WO92/21333.
[0291] A further compound useful in smoking cessation is clonidine
(Gourlay et al., Cochrane Library 2003, 2. A preferred embodiment
of the invention envisages the combined treatment of subjects for
aid in smoking cessation or relapse prevention by vaccination using
nicotine-VLP conjugates, preferentially nicotine-Qb conjugates, and
administering clonidine, preferably clonidine hydrochloride.
[0292] A further compound useful in smoking cessation is
sibutramine. Sibutramine has received FDA approval to help people
lose weight and it inhibits serotonin and norepinephrine reuptake.
Preferably, sibutramine is given in the hydrochloride monohydrate
form. Dose administered is 1 to 20 mg daily, preferably 10 or 15 mg
daily. A preferred embodiment of the invention envisages the
combined treatment of subjects for aid in smoking cessation or
relapse prevention by vaccination using nicotine-VLP conjugates,
preferentially nicotine-Qb conjugates, and administering
sibutramine, preferably sibutramine hydrochloride.
[0293] All drug mentioned above may be given orally as a tablet or
gel capsule or as a transdermal patches. Formulations of tablets,
gel capsules and transdermal patches are described in the art.
[0294] Smoking cessation has also been treated with a combination
of antidepressants and anxiolytics (Glazer, U.S. Pat. No. 4,788,189
or a combination of nicotine receptor antagonists and an
antidepressant or anti-anxiety drug (Cary, WO 99/17803).
[0295] Further embodiments of the invention include immune
molecules produced by immunization with compositions of the
invention. Immune molecules include antibodies and T-cell
receptors. Such immune molecules may be useful in a vaccinated
individual for binding to target haptens. Immune molecules may also
be useful when transferred to another individual not immunized
against compositions of the invention, thereby to "passively"
transfer immunity. In one embodiment, the immune molecule is an
antibody. A monoclonal antibody suitable for binding a toxin,
hormone or drug may be transferred into an individual to achieve
therapy or prophylaxis. Antibodies against nicotine and other
addictive drugs may provide temporary alleviation of addictive
behaviour. In other embodiments, antibodies may be administered to
an individual at risk of poisoning, or who has been acutely exposed
to a toxic agent.
[0296] In another embodiment, antibodies are transferred to an
individual with immune deficiencies such as observed with
cyclosporin or other immunosuppressive drugs, or with acquired
immunodeficiency disorders e.g. HIV infection. HIV infection
frequently co-occurs with addiction to drugs of abuse, particularly
injectable drugs, and addiction may be an underlying cause leading
to behaviors that increase the risk of individual acquiring HIV
infection (e.g. sharing needles, prostitution). Thus, treatment of
addictive behaviour is beneficial to preventing the transmission of
HIV into uninfected individuals of the population.
[0297] In embodiments utilizing passive immunization, a pool of
human donors is immunized with conjugates of the invention using
optimal immunization regimens, as determined empirically. At
various times, donors are bled by venipuncture and the titers of
anti-cocaine antibody are assayed by ELISA. Hyperimmune plasma from
multiple donors is pooled and the IgG fraction is isolated by cold
alcohol fractionation. The antibody preparation is buffered,
stabilized, preserved and standardized as needed for hyperimmune
antibody preparations for human use. The level of anti-hapten
antibody is standardized by ELISA or other antibody-based
assay.
[0298] An appropriate dose of purified antibody is administered to
patients intramuscularly, subcutaneously or intravenously. In one
embodiment, the antibodies are administered with conjugate vaccine,
at a different anatomical site in order to elicit active immunity.
The appropriate dose is determined by assaying serum levels of
recipients in a trail patient population by ELISA or other
antibody-based assay at 24 hours or other appropriate time point
after injection of the hyperimmune antibody preparation and/or
assaying the effectiveness of different doses in inhibiting the
effects of the hapten.
[0299] The passively transferred immune globulin inhibits the
hormone, toxin or drug effects in the patients. The use of human
donors, polyclonal antibody, and the large number of donors in the
donor pool limits the chance of immune response by the patients to
the transferred antibody.
[0300] Other embodiments of the invention include processes for the
production of the compositions of the invention and methods of
medical treatment using said compositions. Diverse approaches for
the treatment of addiction are suitable as co-therapies in
preventing relapse, including psychiatric, social and legal
remedies. Pharmacologic agents useful in co-treatment of addiction
include desipramine, buprenorphine, naloxone, haloperidol,
chlorproazine, bromocriptine, ibogaine, mazindol, antidepressants
and others that will be apparent to the ordinarily skilled
artisan.
Kits
[0301] The invention also embodies the use of antibodies produced
by immunization with compositions of the invention in kits for the
detection of haptens in immunoassays (eg ELISA). In a related
embodiment, repetitive ordered hapten arrays can be useful for the
detection of antibodies against haptens in binding assays.
[0302] In some specific embodiments, the compositions of the
present invention may be assembled into kits for use in detection
in assays or industrial settings, in diagnosis or detection of
diseases, conditions or disorders. Such kits according to the
present invention may comprise at least one container containing
one or more of the above-described conjugates or compositions,
including hapten-core particle conjugates and immune molecules
directed against such conjugates. Alternative kits of the invention
may comprise one or more antibodies of the invention produced by
the methods of the invention or by immunization methods familiar to
the ordinarily skilled artisan using the conjugates and
compositions of the present invention. The kits of the invention
may optionally further comprise at least one additional container
which may contain, for example, one or more antigens, one or more
haptens, one or more core particles, one or more
conjugates/compositions of the invention, one or more
pharmaceutically acceptable carriers or excipients, one or more
buffers, one or more proteins, one or more nucleic acid molecules,
and the like
[0303] The present invention provides kits that can be used in the
above methods. In one embodiment, a kit comprises an antibody,
produced by a method of the invention, preferably a purified
antibody, in one or more containers. In a specific embodiment, the
kits of the present invention contain a substantially isolated
hapten which is specifically immunoreactive with an antibody
included in the kit. Preferably, the kits of the present invention
further comprise a control antibody which does not react with the
hapten of interest. In another specific embodiment, the kits of the
present invention contain a means for detecting the binding of an
antibody to a hapten of interest (e.g., the antibody may be
conjugated to a detectable substrate such as a fluorescent
compound, an enzymatic substrate, a radioactive compound or a
luminescent compound, or a second antibody which recognizes the
first antibody may be conjugated to a detectable substrate).
[0304] In another specific embodiment of the present invention, the
kit is a diagnostic kit for use in screening serum containing
antibodies specific against Nicotine. Such a kit includes
antibodies of IgA, IgE, IgG and IgG subclasses directed against
nicotine and obtained by the immunization of a human with
nicotine-Q.beta. VLP conjugates of the present invention. Such a
kit includes a control antibody that does not react with nicotine,
and substantially isolated nicotine, cotinine and nornicotine
haptens, and purified core particle free of hapten. Further, such a
kit includes means for detecting the binding of said antibody to
nicotine hapten (e.g., the antibody may be conjugated to a
fluorescent compound such as fluorescein or rhodamine which can be
detected by flow cytometry, or HRP for use in an ELISA). In one
specific embodiments, the kit may include a nicotine attached to a
solid support. The invention embodies the use of such a kit, where
the titre of different immunoglobulin classes and subclasses are
determined in an ELISA. The anti nicotine IgA, IgE and IgG
antibodies provided in the kit serve as controls to assess the
relative titre of antibodies in the patient serum. After binding of
the antibody of the serum and the kit with nicotine hapten, and
removing unbound serum components by washing, the antibodies are
reacted with antibodies specific for immunoglobulin subtypes that
are conjugated to reporter molecules. After a further washing step,
to remove unbound labeled antibody, and the amount of reporter
associated with the solid phase is determined in the presence of a
suitable fluorometric, luminescent or colorimetric substrate
(Sigma, St. Louis, Mo.).
[0305] Thus, by the use of the above kits, the invention provides a
method for monitoring the progress of immunization against
nicotine. An immunized person will be monitored during the course
of immunization for IgG and IgA antibodies against nicotine, and
for the lack IgE antibodies against nicotine that would indicate
the development of an allergic reaction If the immune response is
primarily against the core particle rather than the hapten, an
alternative nicotine conjugate will be utilized, with a different
core partile and, in one embodiment, a different hapten.
[0306] In one embodiment a kit includes a solid support to which an
Nicotine-core particle conjugate is attached. In this embodiment,
binding of antibody in the serum of an individual to the antigen
presented on the core particle can be detected by binding of a
reporter-labeled antibody.
[0307] The solid surface reagent in the above assay is prepared by
known techniques for attaching protein material to solid support
material, such as polymeric beads, dip sticks, 96-well plate or
filter material. These attachment methods generally include
non-specific adsorption of the protein to the support or covalent
attachment of the protein, typically through a free amine group, to
a chemically reactive group on the solid support, such as an
activated carboxyl, hydroxyl, or aldehyde group. Alternatively,
streptavidin coated plates can be used in conjunction with
biotinylated antigen(s).
[0308] Thus, the invention provides an assay systems or kits for
carrying out a diagnostic method. The kit generally includes bound
recombinant antigen and a reporter-labeled antibody for detecting
bound anti-antigen antibody. Other suitable kits of the present
invention are understood to those of ordinary skill in the art.
[0309] It will be understood by one of ordinary skill in the
relevant arts that other suitable modifications and adaptations to
the methods and applications described herein are readily apparent
and may be made without departing from the scope of the invention
or any embodiment thereof. Having now described the present
invention in detail, the same will be more clearly understood by
reference to the following examples, which are included herewith
for purposes of illustration only and are not intended to be
limiting of the invention.
EXAMPLES
Example 1
Coupling Procedure for Nicotine-Q.beta. Conjugate
[0310] A nicotine derivate suitable for coupling to VLPs was
synthesized according Langone et al. (1982, supra).
Trans-4'-carboxycotinine is available from commercial sources. The
methylester of trans-4'-carboxycotinine is produced by reacting
trans-4'-carboxycotinine with methanolic sulfuric acid. The
solution is neutralized with sodium bicarbonate, extracted with
chloroform, concentrated on a rotary evaporator and recrystallized
from ether-acetone. Reduction of the methyl ester with lithium
aluminium hydride in ether then produces
trans-3'-hydroxymethylnicotine. The
O'-succinyl-hydroxymethylnicotine is then produced by the addition
of succinic anhydride in benzene. The solution is concentrated on a
rotary evaporator. Activation of the carboxyl group is subsequently
achieved by addition of EDC
(1-Ethyl-3-(3-dimethylaminopropyl)-carbodiimide) and
N-hydroxysuccinimide (NHS) resulting in the N-hydroxysuccinimide
ester of O'-succinyl-hydroxymethylnicotine (in the following
abbreviated as "Suc-Nic").
[0311] Q.beta. CP VLPs (SEQ ID NO: 3) were dialysed against
Hepes-buffered saline HBS (50 mM Hepes, 150 mM NaCl, pH 8.0). The
nicotine derivative Suc-Nic was dissolved in HBS at a concentration
of 121 mM. It was added to a Q.beta. CP VLP solution (0.14 mM) at
1.times., 5.times., 50.times., 100.times. and 500.times. molar
excess and incubated at room temperature for 2 h on a shaker. The
reaction solution was then dialysed against HBS, pH 8.0 (cut off
10000 Da), flash-frozen in liquid nitrogen and stored at
-80.degree. C. The nicotine derivative suc-nic reacts with lysines
on the surface of Q.beta. under formation of an amid bond. The
resulting covalent conjugate is termed herein "Nic-Q.beta.".
[0312] SDS-PAGE analysis showed with increasing molar excess of
Suc-Nic a shift of the Q.beta. monomer band to higher molecular
weights (FIG. 1A). The presence of nicotine in the coupling product
was confirmed by a westernblot using an anti-nicotine antiserum.
While uncoupled Q.beta. control and Q.beta. coupled to nicotine at
a 1.times. and 5.times. excess did not show an anti-nicotine
reactive band, the bands at 50.times., 100.times. and 500.times.
clearly demonstrated covalent coupling of nicotine to Q.beta. (FIG.
1B). This was confirmed by an ELISA with nicotine-BSA coated on the
wells and detection with an anti-nicotine antiserum. A higher
absorbance was reached when Q.beta. coupled with 500 fold excess
nicotine was used compared to a vaccine produced with an 50 fold
excess.
Example 2
Immunization of Mice with Nic-Q.beta. and Measurement of
Anti-Nicotine
Antibody Titers
[0313] A. Immunization of Mice
[0314] 10 week-old female Balb/c mice were vaccinated twice with 30
.mu.g of the nicotine-Q.beta. (Nic-Q.beta.) resulting from the
coupling using 500.times. excess of Suc-Nic. The vaccine was
diluted in sterile PBS and given intranasally or injected
subcutaneously with or without the addition of Alum (Imject,
Pierce). 14 days after the first immunization the mice were boosted
(Table I). On day 29 the nicotine-specific antibody titers in serum
were determined by ELISA.
TABLE-US-00001 TABLE I Immunization scheme of mice: B. ELISA. Day 0
Day 14 Amount Amount Day 29 No. of animals vaccine (.mu.g) (.mu.g)
Bled 3 Nic-Q.beta. s.c. 30 30 Bled 3 Nic-Q.beta. s.c. & Alum 30
30 Bled 3 Nic-Q.beta. intranasal 30 30 Bled
[0315] Sera were analyzed in a nicotine-specific ELISA: Microtiter
plates (Maxisorp, Nunc) were coated overnight with 5 .mu.g/ml
nicotine coupled to BSA (NAB03) in coating buffer (pH 9.6). After
washing and blocking with 2% BSA in PBS, sera were added at
different dilutions, in 2% BSA/1% FCS/PBS. After 2 hours incubation
at room temperature the plates were washed (0.05% Tween 20/PBS) and
HRPO-labeled antibodies specific for mouse antibody subclasses were
added. After 1 hour incubation the plates were washed and the color
substrate OPD in citric acid buffer was added. After 5 minutes the
color reaction was stopped with 5% H.sub.2SO.sub.4.
[0316] Optical densities at 450 nm were read in an ELISA Reader
(Benchmark, Becton Dickinson). For the detection of IgE, sera were
pre-incubated in Eppendorf tubes with Protein G beads (Pierce) for
30 min on a shaker before adding to the ELISA plate.
[0317] The Nic-Q.beta. vaccine induced nicotine-specific IgG
antibodies (FIG. 3A). The ELISA titers were calculated for the
total IgG response (FIG. 3B, Table II). The ELISA titer was defined
as the dilution of the serum which gives a half-maximal optical
density signal (OD 50%)) in the ELISA. For the subcutaneous route
with Alum, the average IgG titers obtained with Nic-Q.beta. were
13228. For the intranasal route, nicotine-Q.beta. titers were
38052.
[0318] IgG subtypes and IgE were also measured by ELISA and titers
determined (FIG. 3, FIG. 4, Table II). No significant IgE response
above background (preimmune serum) could be detected for any of the
conditions tested. The ratio of IgG2a to IgG1 antibody titers is
indicative for a Th1 mediated immune response. A ratio of 2.1 was
measured for the mice immunized subcutanously with Nic-Q.beta. in
the absence of Alum, and was even enhanced to 2.6 when applied
intranasally. As expected Alum drove the immune response towards a
more Th2 type response and resulted in a ratio of 0.4. Notably, the
Nic-Q.beta. vaccines also induced high IgG2b and IgG3 titers. A
significant amount of anti-nicotine IgA antibodies could be found
in serum (FIG. 5) which are indicative for the presence of IgA in
mucosal surfaces.
[0319] The high nicotine titres upon intranasal immunization are
especially noteworthy.
TABLE-US-00002 TABLE II Nicotine-specific antibody titers in
vaccinated mice Titers were calculated as the dilution of serum
that gives half-maximal optical density in the ELISA. Average
titers of 3 mice each are given. IgG IgG1 IgG2a Vaccine titer titer
titer IgG2b titer IgG3 titer Nic-Q.beta. s.c. 13228 672 1386 515
2030 Nic-Q.beta. alum s.c. 93762 9642 10016 14977 19701 Nic-Q.beta.
intranasal 38052 2845 7493 3617 6107
Example 3
Evaluation of Nicotine Distribution in Plasma and Brain in Rats
[0320] Groups of rats are immunized with the nicotine-VLP vaccine,
boosted at day 21. One group receives a second boost at day 35.
Seven to 10 days after the last boost rats are anestethized and
catheters are placed in the femoral artery and vein for sampling
and the jugular vein of the other leg for nicotine administration.
Nicotine 0.03 mg/kg containing 3 microCi 3H-(-)-nicotine is infused
in 1 ml/kg 0.9% saline via the jugular vein over 10 s. The
radiolabel added to permit estimation of nicotine concentrations
from very small volumes of blood. This the possible because
metabolism of nicotine to cotinine over the first 90 s after
nicotine administration in rats negligible. Blood (0.3 ml) was
removed from both the femoral artery and vein catheters every 15 s
up to 90 s, centrifuged immediately and serum separated for assay.
Rats are killed at 3 min by decapitation, the brain is removed
quickly, rinsed with water and stored at -20.degree. C. until
assayed. For measurement of 3H-nicotine concentration in serum, 100
ul serum is mixed with liquid scintillation fluid. Brain samples
were digested in 5 vol NaOH prior to extraction and analysed after
addition of scintillation fluid.
[0321] Nicotine-specific antibodies induced by the vaccination are
capable of binding 3H-nicotine in serum and inhibit or lower its
diffusion into the brain. Accordingly, a decreased concentration of
brain nicotine and an increased concentration of plasma nicotine
are measured.
Example 4
Chemical Coupling of Nicotine Hapten to HbcAg-Lys
[0322] O-succinyl-hydroxymethylnicotine is prepared as described in
Example 1, and incubated with EDC and NHS to yield the activated
N-hydroxysuccinamide ester (Suc-Nic). Purified HbcAg-Lys VLP is
prepared as described in copending U.S. patent application Ser. No.
10/050,902. Suc-Nic solution in HBS is added at 1.times., 5.times.,
50.times., 100.times. and 500.times. molar excess to a 95% pure
solution of HBcAg-Lys particles (2 mg/ml) and incubated for 2 h. at
room temperature. After completion of the reaction, the mixture is
dialyzed overnight against HBS, pH 8.0, flash frozen in liquid
nitrogen and stored at -80.degree. C. Reaction is monitored by
SDS-PAGE analysis and western blot with antinicotine antiserum.
Nicotine decorated particles are injected into rodents to induce
immune responses against nicotine.
Example 5
Chemical Coupling of Nicotine Hapten to Type-1 Pili of Escherichia
coli
[0323] Type I pili are prepared from E. coli strain W3110
transformed with the vector pFIMAICDFGK, and purified by
ultracentrifugation, as described in commonly owned, co-pending
U.S. patent application Ser. No. 10/050,902, filed Jan. 18, 2002,
the disclosure of which is incorporated herein by reference in its
entirety. Activated hapten Suc-Nic in HBS are added at 1.times.,
5.times., 50.times., 100.times. and 500.times. molar excess to a
95% pure solution of type I pili particles (2 mg/ml) and incubated
for 2 h. at room temperature. After completion of the reaction, the
mixture is dialyzed against HBS, pH 8.0, flash frozen in liquid
nitrogen and stored at -80.degree. C. Reaction is monitored by
SDS-PAGE analysis and western blot with antinicotine antiserum.
Nicotine decorated particles are injected into rodents to induce
immune responses against nicotine.
Example 6
Synthesis of Multi-hapten Vaccine Suitable for Treatment of
Nicotine Addiction
[0324] A vaccine against nicotine addiction designed to target
multiple epitopes of nicotine and also the pharmaceutically active
metabolites cotinine and nornicotine is prepared. Individual 120 mM
solutions in HBS of 6-(carboxymethylureido)-(.+-.)-nicotine
(CMUNic), trans-3'-aminomethylnicotine succinate,
O-succinyl-3'-hydroxymethyl-nicotine, Trans-4'-carboxycotinine,
N-[1-oxo-6-[(25)-2-(3-pyridyl)-1-pyrrolidinyl]hexyl]-.beta.-alanine,
4-oxo-4-[[6-[(5S)-2-oxo-5-(3-pyridinyl)-1-pyrrolidinyl]]hexyl]amino]-buta-
noic acid, (2S)-2-(3-pyridinyl)-1-pyrrolidinebutanoic acid
phenylmethyl ester, (2R)-2-(3-pyridinyl)-1-pyrrolidinebutanoic acid
phenylmethyl ester, Cotinine 4'-carboxylic acid,
N-succinyl-6-amino-(.+-.)-nicotine;
6-(.sigma.-aminocapramido)-(.+-.)-nicotine- and
6-(.sigma.-aminocapramido)-(.+-.)-nicotine-conjugates; succinylated
3',4', and 5' aminomethylnicotine, 5 and 6 aminonicotine and 3',4',
and 5' acetyl derivatives of acetyl nicotine. The solutions are
mixed with EDC and NHS to form activated forms which are added, in
separate reactions, at 10-100 molar excess to Q.beta. VLP as
described elsewhere.
[0325] Individual solutions of S-1-(b-aminoethyl)nicotinium
chloride dihydrochloride and S-1-(b-aminoethyl) cotinium chloride
hydrochloride solutions are coupled to Q.beta. VIP with
1-cyclohexyl-3-(2-morpholinoethyl)-carbodiimide
metho-p-toluenesulfonate.
[0326] From this selection of conjugates, eight of the nicotine
hapten Q.beta. VLP conjugates, a cotinine VLP conjugate and a
nornicotine conjugate Q.beta. VLP are then admixed to form a
vaccine composition, which is used to vaccinate individuals. After
2 doses, individuals are then boosted 3 times with parallel haptens
coupled to HBc-Lys VLP conjugates.
Example 7
Synthesis of Cocaine VLP-Hapten Conjugate
[0327] A solution of norcocaine hydrochloride (1 g, 3.07 mmol),
triethylamine (0.86 ml, 6.14 mmol) in methylene chloride (20 ml) is
treated with succinic anhydride (614 mg, 6.14 mmol) and the mixture
heated at 45.degree. C. overnight, as described in U.S. Pat. No.
5,876,727. The solvents are removed under reduced pressure and the
residue purified using silica gel flash chromatography (2:1
chloroform:methanol as the eluent). This gives succinylated
norcocaine (1.0 g, 84%) as a thick syrup
(3.beta.-(Benzoyloxy)-8-succinoyl-8-azabicyclo[3.2.1]octane-2.beta.-carbo-
xylic acid methyl ester). To a solution of the acid (14 mg, 0.036
mmol) in distilled water (1 ml) at 0.degree. C., EDC (10.4 mg,
0.055 mmol) was added. After 5 minutes a solution of Q.beta. VLP in
PBS (1 ml) is added dropwise and the mixture is allowed to warm to
ambient temperature overnight. The conjugate is purified by
dialysis against PBS and the degree of conjugation analyzed by mass
spectral analysis. The resultant conjugate is used to immunize
individuals.
[0328] Having now fully described the present invention in some
detail by way of illustration and example for purposes of clarity
of understanding, it will be obvious to one of ordinary skill in
the art that the same can be performed by modifying or changing the
invention within a wide and equivalent range of conditions,
formulations and other parameters without affecting the scope of
the invention or any specific embodiment thereof, and that such
modifications or changes are intended to be encompassed within the
scope of the appended claims.
[0329] All publications, patents and patent applications mentioned
in this specification are indicative of the level of skill of those
skilled in the art to which this invention pertains, and are herein
incorporated by reference to the same extent as if each individual
publication, patent or patent application was specifically and
individually indicated to be incorporated by reference.
Example 8
Evaluation of Nicotine Distribution in Plasma and Brain of Mice
[0330] Groups of 4 to 5 mice were immunized with 60 ug of the
nicotine-VLP vaccine produced as described in EXAMPLE 1 and were
boosted at day 35 and day 63 with the same amount of vaccine.
Fourteen days after the last boost mice were injected i.v. at the
base of the tail with a solution containing 750 ng (-)-nicotine
hydrogen tartrate with 5 microCi 3H-(-)-nicotine. The amount of
nicotine corresponds to 0.03 mg/kg which is equivalent to the
nicotine uptake of 2 cigarettes by a smoker. The radiolabel was
added to permit estimation of nicotine concentrations from very
small volumes of blood. After five minutes mice were sacrificed by
CO.sub.2. Blood was removed by punctuation of the heart and serum
was prepared. Brains was immediately dissected, cleaned from
adhering blood and their weights measured. For measurement of
3H-nicotine concentration in serum, 50 ul serum is mixed with
liquid scintillation fluid. Brain samples were completely dissolved
in 2 ml Tissue Solubilizer (Serva) and analysed after addition of
scintillation fluid. From the radioactivities nicotine
concentrations in serum and brain were calculated (FIG. 7).
[0331] Nicotine-specific antibodies induced by the vaccination were
capable of binding 3H-nicotine in serum and inhibit or lower its
diffusion into the brain. Accordingly, a decreased concentration of
brain nicotine and an increased concentration of plasma nicotine
were measured. The Nicotine-VLP vaccine was able to inhibit the
nicotine uptake in brain by 56% in the absence of Alum and by 68%
in the presence of Alum (FIG. 7).
[0332] Further immunization schedules, such as immunization at day
0 and boosting at day 14 also yielded in antibodies levels that
were able to significantly reduce nicotine uptake into brain. In
general, high anti-nicotine antibody titers correlated with a
higher efficacy of the vaccination.
Example 9
Cloning of the AP205 Coat Protein Gene
[0333] The cDNA of AP205 coat protein (CP) (SEQ ID NO: 90) was
assembled from two cDNA fragments generated from phage AP205 RNA by
using a reverse transcription-PCR technique and cloning in the
commercial plasmid pCR 4-TOPO for sequencing. Reverse transcription
techniques are well known to those of ordinary skill in the
relevant art. The first fragment, contained in plasmid p205-246,
contained 269 nucleotides upstream of the CP sequence and 74
nucleotides coding for the first 24 N-terminal amino acids of the
CP. The second fragment, contained in plasmid p205-262, contained
364 nucleotides coding for amino acids 12-131 of CP and an
additional 162 nucleotides downstream of the CP sequence. Both
p205-246 and p205-262 were a generous gift from J. Klovins.
[0334] The plasmid 283.-58 was designed by two-step PCR, in order
to fuse both CP fragments from plasmids p205-246 and p205-262 in
one full-length CP sequence.
[0335] An upstream primer p1.44 containing the NcoI site for
cloning into plasmid pQb185, or p1.45 containing the XbaI site for
cloning into plasmid pQb10, and a downstream primer p1.46
containing the HindIII restriction site were used (recognition
sequence of the restriction enzyme underlined):
TABLE-US-00003 p1.44 (SEQ ID NO: 5) 5'-NNCC ATG GCA AAT AAG CCA ATG
CAA CCG-3' p1.45 (SEQ ID NO: 20)
5'-NNTCTAGAATTTTCTGCGCACCCATCCCGG-3' p1.46 (SEQ ID NO: 21)
5'-NNAAGC TTA AGC AGT AGT ATC AGA CGA TAC G- 3'
[0336] Two additional primers, p1.47, annealing at the 5' end of
the fragment contained in p205-262, and p1.48, annealing at the 3'
end of the fragment contained in plasmid p205-246 were used to
amplify the fragments in the first PCR. Primers p1.47 and p1.48 are
complementary to each other.
TABLE-US-00004 p1.47: (SEQ ID NO: 22)
5'-GAGTGATCCAACTCGTTTATCAACTACATTT- TCAGCAAGTCTG-3' p1.48: (SEQ ID
NO: 23) 5'-CAGACTTGCTGAAAATGTAGTTGATAAACGA- GTTGGATCACTC-3'
[0337] In the first two PCR reactions, two fragments were
generated. The first fragment was generated with primers p1.45 and
p1.48 and template p205-246. The second fragment was generated with
primers p1.47 and p1.46, and template p205-262. Both fragments were
used as templates for the second PCR reaction, a splice-overlap
extension, with the primer combination p1.45 and p1.46 or p1.44 and
p1.46. The product of the two second-step PCR reactions were
digested with XbaI or NcoI respectively, and HindIII, and cloned
with the same restriction sites into pQb10 or pQb185 respectively,
two pGEM-derived expression vectors under the control of E. coli
tryptophan operon promoter.
[0338] Two plasmids were obtained, pAP283-58 (SEQ ID NO: 15),
containing the gene coding for wt AP205 CP (SEQ ID NO: 14) in
pQb10, and pAP281-32 (SEQ ID NO: 19) with mutation Pro5.fwdarw.Thr
(SEQ ID NO: 18), in pQb185. The coat protein sequences were
verified by DNA sequencing. PAP283-58 contains 49 nucleotides
upstream of the ATG codon of the CP, downstream of the XbaI site,
and contains the putative original ribosomal binding site of the
coat protein mRNA.
Example 10
Expression and Purification of Recombinant AP205 VLP
[0339] A. Expression of Recombinant AP205 VLP
[0340] E. coli 1M109 was transformed with plasmid pAP283-58. 5 ml
of LB liquid medium with 20 .mu.g/ml ampicillin were inoculated
with a single colony, and incubated at 37.degree. C. for 16-24 h
without shaking.
[0341] The prepared inoculum was diluted 1:100 in 100-300 ml of LB
medium, containing 20 .mu.g/ml ampicillin and incubated at
37.degree. C. overnight without shaking. The resulting second
inoculum was diluted 1:50 in 2TY medium, containing 0.2% glucose
and phosphate for buffering, and incubated at 37.degree. C.
overnight on a shaker. Cells were harvested by centrifugation and
frozen at -80.degree. C.
[0342] B. Purification of Recombinant AP205 VLF
[0343] Solutions and Buffers:
[0344] 1. Lysis buffer [0345] 50 mM Tris-HCl pH 8.0 with 5 mM EDTA,
0.1% triton.times.100 and PMSF at 5 micrograms per ml.
[0346] 2. SAS [0347] Saturated ammonium sulphate in water
[0348] 3. Buffer NET. [0349] 20 mM Tris-HCl, pH 7.8 with 5 mM EDTA
and 150 mM NaCl.
[0350] 4. PEG [0351] 40% (w/v) polyethylenglycol 6000 in NET
Lysis:
[0352] Frozen cells were resuspended in lysis buffer at 2 ml/g
cells. The mixture was sonicated with 22 kH five times for 15
seconds, with intervals of 1 min to cool the solution on ice. The
lysate was then centrifuged for 20 minutes at 12 000 rpm, using a
F34-6-38 rotor (Ependorf). The centrifugation steps described below
were all performed using the same rotor, except otherwise stated.
The supernatant was stored at 4.degree. C., while cell debris were
washed twice with lysis buffer. After centrifugation, the
supernatants of the lysate and wash fractions were pooled.
[0353] Ammonium-sulphate precipitation can be further used to
purify AP205 VLP. In a first step, a concentration of
ammonium-sulphate at which AP205 VLP does not precipitate is
chosen. The resulting pellet is discarded. In the next step, an
ammonium sulphate concentration at which AP205 VLP quantitatively
precipitates is selected, and AP205 VLP is isolated from the pellet
of this precipitation step by centrifugation (14 000 rpm, for 20
min). The obtained pellet is solubilised in NET buffer.
Chromatography:
[0354] The capsid protein from the pooled supernatants was loaded
on a Sepharose 4B column (2.8.times.70 cm), and eluted with NET
buffer, at 4 ml/hour/fraction. Fractions 28-40 were collected, and
precipitated with ammonium sulphate at 60% saturation. The
fractions were analyzed by SDS-PAGE and Western Blot with an
antiserum specific for AP205 prior to precipitation. The pellet
isolated by centrifugation was resolubilized in NET buffer, and
loaded on a Sepharose 2B column (2.3.times.65 cm), eluted at 3
ml/h/fraction. Fractions were analysed by SDS-PAGE, and fractions
44-50 were collected, pooled and precipitated with ammonium
sulphate at 60% saturation. The pellet isolated by centrifugation
was resolubilized in NET buffer, and purified on a Sepharose 6B
column (2.5.times.47 cm), eluted at 3 ml/hour/fraction. The
fractions were analysed by SDS-PAGE. Fractions 23-27 were
collected, the salt concentration adjusted to 0.5 M, and
precipitated with PEG 6000, added from a 40% stock in water and to
a final concentration of 13.3%. The pellet isolated by
centrifugation was resolubilized in NET buffer, and loaded on the
same Sepharose 2B column as above, eluted in the same manner.
Fractions 43-53 were collected, and precipitated with ammonium
sulphate at a saturation of 60%. The pellet isolated by
centrifugation was resolubilized in water, and the obtained protein
solution was extensively dialyzed against water. About 10 mg of
purified protein per gram of cells could be isolated. Examination
of the virus-like particles in Electron microscopy showed that they
were identical to the phage particles.
Sequence CWU 1
1
331185PRTHepatitis B virus 1Met Asp Ile Asp Pro Tyr Lys Glu Phe Gly
Ala Thr Val Glu Leu Leu1 5 10 15Ser Phe Leu Pro Ser Asp Phe Phe Pro
Ser Val Arg Asp Leu Leu Asp 20 25 30Thr Ala Ser Ala Leu Tyr Arg Glu
Ala Leu Glu Ser Pro Glu His Cys 35 40 45Ser Pro His His Thr Ala Leu
Arg Gln Ala Ile Leu Cys Trp Gly Glu 50 55 60Leu Met Thr Leu Ala Thr
Trp Val Gly Asn Asn Leu Glu Asp Pro Ala65 70 75 80Ser Arg Asp Leu
Val Val Asn Tyr Val Asn Thr Asn Met Gly Leu Lys 85 90 95Ile Arg Gln
Leu Leu Trp Phe His Ile Ser Cys Leu Thr Phe Gly Arg 100 105 110Glu
Thr Val Leu Glu Tyr Leu Val Ser Phe Gly Val Trp Ile Arg Thr 115 120
125Pro Pro Ala Tyr Arg Pro Pro Asn Ala Pro Ile Leu Ser Thr Leu Pro
130 135 140Glu Thr Thr Val Val Arg Arg Arg Asp Arg Gly Arg Ser Pro
Arg Arg145 150 155 160Arg Thr Pro Ser Pro Arg Arg Arg Arg Ser Gln
Ser Pro Arg Arg Arg 165 170 175Arg Ser Gln Ser Arg Glu Ser Gln Cys
180 1852182PRTEscherichia coli 2Met Lys Ile Lys Thr Leu Ala Ile Val
Val Leu Ser Ala Leu Ser Leu1 5 10 15Ser Ser Thr Thr Ala Leu Ala Ala
Ala Thr Thr Val Asn Gly Gly Thr 20 25 30Val His Phe Lys Gly Glu Val
Val Asn Ala Ala Cys Ala Val Asp Ala 35 40 45Gly Ser Val Asp Gln Thr
Val Gln Leu Gly Gln Val Arg Thr Ala Ser 50 55 60Leu Ala Gln Glu Gly
Ala Thr Ser Ser Ala Val Gly Phe Asn Ile Gln65 70 75 80Leu Asn Asp
Cys Asp Thr Asn Val Ala Ser Lys Ala Ala Val Ala Phe 85 90 95Leu Gly
Thr Ala Ile Asp Ala Gly His Thr Asn Val Leu Ala Leu Gln 100 105
110Ser Ser Ala Ala Gly Ser Ala Thr Asn Val Gly Val Gln Ile Leu Asp
115 120 125Arg Thr Gly Ala Ala Leu Thr Leu Asp Gly Ala Thr Phe Ser
Ser Glu 130 135 140Thr Thr Leu Asn Asn Gly Thr Asn Thr Ile Pro Phe
Gln Ala Arg Tyr145 150 155 160Phe Ala Thr Gly Ala Ala Thr Pro Gly
Ala Ala Asn Ala Asp Ala Thr 165 170 175Phe Lys Val Gln Tyr Gln
1803132PRTBacteriophage Qbeta 3Ala Lys Leu Glu Thr Val Thr Leu Gly
Asn Ile Gly Lys Asp Gly Lys1 5 10 15Gln Thr Leu Val Leu Asn Pro Arg
Gly Val Asn Pro Thr Asn Gly Val 20 25 30Ala Ser Leu Ser Gln Ala Gly
Ala Val Pro Ala Leu Glu Lys Arg Val 35 40 45Thr Val Ser Val Ser Gln
Pro Ser Arg Asn Arg Lys Asn Tyr Lys Val 50 55 60Gln Val Lys Ile Gln
Asn Pro Thr Ala Cys Thr Ala Asn Gly Ser Cys65 70 75 80Asp Pro Ser
Val Thr Arg Gln Ala Tyr Ala Asp Val Thr Phe Ser Phe 85 90 95Thr Gln
Tyr Ser Thr Asp Glu Glu Arg Ala Phe Val Arg Thr Glu Leu 100 105
110Ala Ala Leu Leu Ala Ser Pro Leu Leu Ile Asp Ala Ile Asp Gln Leu
115 120 125Asn Pro Ala Tyr 1304329PRTBacteriophage Qbeta 4Met Ala
Lys Leu Glu Thr Val Thr Leu Gly Asn Ile Gly Lys Asp Gly1 5 10 15Lys
Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly 20 25
30Val Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys Arg
35 40 45Val Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr
Lys 50 55 60Val Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala Asn
Gly Ser65 70 75 80Cys Asp Pro Ser Val Thr Arg Gln Ala Tyr Ala Asp
Val Thr Phe Ser 85 90 95Phe Thr Gln Tyr Ser Thr Asp Glu Glu Arg Ala
Phe Val Arg Thr Glu 100 105 110Leu Ala Ala Leu Leu Ala Ser Pro Leu
Leu Ile Asp Ala Ile Asp Gln 115 120 125Leu Asn Pro Ala Tyr Trp Thr
Leu Leu Ile Ala Gly Gly Gly Ser Gly 130 135 140Ser Lys Pro Asp Pro
Val Ile Pro Asp Pro Pro Ile Asp Pro Pro Pro145 150 155 160Gly Thr
Gly Lys Tyr Thr Cys Pro Phe Ala Ile Trp Ser Leu Glu Glu 165 170
175Val Tyr Glu Pro Pro Thr Lys Asn Arg Pro Trp Pro Ile Tyr Asn Ala
180 185 190Val Glu Leu Gln Pro Arg Glu Phe Asp Val Ala Leu Lys Asp
Leu Leu 195 200 205Gly Asn Thr Lys Trp Arg Asp Trp Asp Ser Arg Leu
Ser Tyr Thr Thr 210 215 220Phe Arg Gly Cys Arg Gly Asn Gly Tyr Ile
Asp Leu Asp Ala Thr Tyr225 230 235 240Leu Ala Thr Asp Gln Ala Met
Arg Asp Gln Lys Tyr Asp Ile Arg Glu 245 250 255Gly Lys Lys Pro Gly
Ala Phe Gly Asn Ile Glu Arg Phe Ile Tyr Leu 260 265 270Lys Ser Ile
Asn Ala Tyr Cys Ser Leu Ser Asp Ile Ala Ala Tyr His 275 280 285Ala
Asp Gly Val Ile Val Gly Phe Trp Arg Asp Pro Ser Ser Gly Gly 290 295
300Ala Ile Pro Phe Asp Phe Thr Lys Phe Asp Lys Thr Lys Cys Pro
Ile305 310 315 320Gln Ala Val Ile Val Val Pro Arg Ala
325528DNAArtificial Sequencep1.44 primer 5nnccatggca aataagccaa
tgcaaccg 286132PRTArtificial SequenceBacteriophage Qbeta 240 mutant
6Ala Lys Leu Glu Thr Val Thr Leu Gly Asn Ile Gly Arg Asp Gly Lys1 5
10 15Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly
Val 20 25 30Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys
Arg Val 35 40 45Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn
Tyr Lys Val 50 55 60Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala
Asn Gly Ser Cys65 70 75 80Asp Pro Ser Val Thr Arg Gln Lys Tyr Ala
Asp Val Thr Phe Ser Phe 85 90 95Thr Gln Tyr Ser Thr Asp Glu Glu Arg
Ala Phe Val Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Ala Ser Pro
Leu Leu Ile Asp Ala Ile Asp Gln Leu 115 120 125Asn Pro Ala Tyr
1307132PRTArtificial SequenceBacteriophage Q-beta 243 mutant 7Ala
Lys Leu Glu Thr Val Thr Leu Gly Lys Ile Gly Lys Asp Gly Lys1 5 10
15Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly Val
20 25 30Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys Arg
Val 35 40 45Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr
Lys Val 50 55 60Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala Asn
Gly Ser Cys65 70 75 80Asp Pro Ser Val Thr Arg Gln Lys Tyr Ala Asp
Val Thr Phe Ser Phe 85 90 95Thr Gln Tyr Ser Thr Asp Glu Glu Arg Ala
Phe Val Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Ala Ser Pro Leu
Leu Ile Asp Ala Ile Asp Gln Leu 115 120 125Asn Pro Ala Tyr
1308132PRTArtificial SequenceBacteriophage Q-beta 250 mutant 8Ala
Arg Leu Glu Thr Val Thr Leu Gly Asn Ile Gly Arg Asp Gly Lys1 5 10
15Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly Val
20 25 30Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys Arg
Val 35 40 45Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr
Lys Val 50 55 60Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala Asn
Gly Ser Cys65 70 75 80Asp Pro Ser Val Thr Arg Gln Lys Tyr Ala Asp
Val Thr Phe Ser Phe 85 90 95Thr Gln Tyr Ser Thr Asp Glu Glu Arg Ala
Phe Val Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Ala Ser Pro Leu
Leu Ile Asp Ala Ile Asp Gln Leu 115 120 125Asn Pro Ala Tyr
1309132PRTArtificial SequenceBacteriophage Q-beta 251 mutant 9Ala
Lys Leu Glu Thr Val Thr Leu Gly Asn Ile Gly Lys Asp Gly Arg1 5 10
15Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly Val
20 25 30Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys Arg
Val 35 40 45Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr
Lys Val 50 55 60Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala Asn
Gly Ser Cys65 70 75 80Asp Pro Ser Val Thr Arg Gln Lys Tyr Ala Asp
Val Thr Phe Ser Phe 85 90 95Thr Gln Tyr Ser Thr Asp Glu Glu Arg Ala
Phe Val Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Ala Ser Pro Leu
Leu Ile Asp Ala Ile Asp Gln Leu 115 120 125Asn Pro Ala Tyr
13010132PRTArtificial SequenceBacteriophage Q-beta 259 mutant 10Ala
Arg Leu Glu Thr Val Thr Leu Gly Asn Ile Gly Lys Asp Gly Arg1 5 10
15Gln Thr Leu Val Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly Val
20 25 30Ala Ser Leu Ser Gln Ala Gly Ala Val Pro Ala Leu Glu Lys Arg
Val 35 40 45Thr Val Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr
Lys Val 50 55 60Gln Val Lys Ile Gln Asn Pro Thr Ala Cys Thr Ala Asn
Gly Ser Cys65 70 75 80Asp Pro Ser Val Thr Arg Gln Lys Tyr Ala Asp
Val Thr Phe Ser Phe 85 90 95Thr Gln Tyr Ser Thr Asp Glu Glu Arg Ala
Phe Val Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Ala Ser Pro Leu
Leu Ile Asp Ala Ile Asp Gln Leu 115 120 125Asn Pro Ala Tyr
130115PRTArtificial Sequencelinker 11Gly Gly Lys Gly Gly1
51249PRTArtificial SequenceGCN4 12Pro Ala Ala Leu Lys Arg Ala Arg
Asn Glu Ala Ala Arg Arg Ser Arg1 5 10 15Ala Arg Lys Leu Gln Arg Met
Lys Gln Leu Glu Asp Lys Val Glu Glu 20 25 30Leu Leu Ser Lys Asn Tyr
His Leu Glu Asn Glu Val Ala Arg Leu Lys 35 40
45Lys13128PRTBacteriophage PP7 13Met Ser Lys Thr Ile Val Leu Ser
Val Gly Glu Ala Thr Arg Thr Leu1 5 10 15Thr Glu Ile Gln Ser Thr Ala
Asp Arg Gln Ile Phe Glu Glu Lys Val 20 25 30Gly Pro Leu Val Gly Arg
Leu Arg Leu Thr Ala Ser Leu Arg Gln Asn 35 40 45Gly Ala Lys Thr Ala
Tyr Arg Val Asn Leu Lys Leu Asp Gln Ala Asp 50 55 60Val Val Asp Cys
Ser Thr Ser Val Cys Gly Glu Leu Pro Lys Val Arg65 70 75 80Tyr Thr
Gln Val Trp Ser His Asp Val Thr Ile Val Ala Asn Ser Thr 85 90 95Glu
Ala Ser Arg Lys Ser Leu Tyr Asp Leu Thr Lys Ser Leu Val Ala 100 105
110Thr Ser Gln Val Glu Asp Leu Val Val Asn Leu Val Pro Leu Gly Arg
115 120 12514131PRTBacteriophage AP205 14Met Ala Asn Lys Pro Met
Gln Pro Ile Thr Ser Thr Ala Asn Lys Ile1 5 10 15Val Trp Ser Asp Pro
Thr Arg Leu Ser Thr Thr Phe Ser Ala Ser Leu 20 25 30Leu Arg Gln Arg
Val Lys Val Gly Ile Ala Glu Leu Asn Asn Val Ser 35 40 45Gly Gln Tyr
Val Ser Val Tyr Lys Arg Pro Ala Pro Lys Pro Glu Gly 50 55 60Cys Ala
Asp Ala Cys Val Ile Met Pro Asn Glu Asn Gln Ser Ile Arg65 70 75
80Thr Val Ile Ser Gly Ser Ala Glu Asn Leu Ala Thr Leu Lys Ala Glu
85 90 95Trp Glu Thr His Lys Arg Asn Val Asp Thr Leu Phe Ala Ser Gly
Asn 100 105 110Ala Gly Leu Gly Phe Leu Asp Pro Thr Ala Ala Ile Val
Ser Ser Asp 115 120 125Thr Thr Ala 130153635DNAArtificial
SequencePlasmid, pAP283-58, encoding RNA phage AP205 coat protein
15cgagctcgcc cctggcttat cgaaattaat acgactcact atagggagac cggaattcga
60gctcgcccgg ggatcctcta gaattttctg cgcacccatc ccgggtggcg cccaaagtga
120ggaaaatcac atggcaaata agccaatgca accgatcaca tctacagcaa
ataaaattgt 180gtggtcggat ccaactcgtt tatcaactac attttcagca
agtctgttac gccaacgtgt 240taaagttggt atagccgaac tgaataatgt
ttcaggtcaa tatgtatctg tttataagcg 300tcctgcacct aaaccggaag
gttgtgcaga tgcctgtgtc attatgccga atgaaaacca 360atccattcgc
acagtgattt cagggtcagc cgaaaacttg gctaccttaa aagcagaatg
420ggaaactcac aaacgtaacg ttgacacact cttcgcgagc ggcaacgccg
gtttgggttt 480ccttgaccct actgcggcta tcgtatcgtc tgatactact
gcttaagctt gtattctata 540gtgtcaccta aatcgtatgt gtatgataca
taaggttatg tattaattgt agccgcgttc 600taacgacaat atgtacaagc
ctaattgtgt agcatctggc ttactgaagc agaccctatc 660atctctctcg
taaactgccg tcagagtcgg tttggttgga cgaaccttct gagtttctgg
720taacgccgtt ccgcaccccg gaaatggtca ccgaaccaat cagcagggtc
atcgctagcc 780agatcctcta cgccggacgc atcgtggccg gcatcaccgg
cgccacaggt gcggttgctg 840gcgcctatat cgccgacatc accgatgggg
aagatcgggc tcgccacttc gggctcatga 900gcgcttgttt cggcgtgggt
atggtggcag gccccgtggc cgggggactg ttgggcgcca 960tctccttgca
tgcaccattc cttgcggcgg cggtgctcaa cggcctcaac ctactactgg
1020gctgcttcct aatgcaggag tcgcataagg gagagcgtcg atatggtgca
ctctcagtac 1080aatctgctct gatgccgcat agttaagcca actccgctat
cgctacgtga ctgggtcatg 1140gctgcgcccc gacacccgcc aacacccgct
gacgcgccct gacgggcttg tctgctcccg 1200gcatccgctt acagacaagc
tgtgaccgtc tccgggagct gcatgtgtca gaggttttca 1260ccgtcatcac
cgaaacgcgc gaggcagctt gaagacgaaa gggcctcgtg atacgcctat
1320ttttataggt taatgtcatg ataataatgg tttcttagac gtcaggtggc
acttttcggg 1380gaaatgtgcg cggaacccct atttgtttat ttttctaaat
acattcaaat atgtatccgc 1440tcatgagaca ataaccctga taaatgcttc
aataatattg aaaaaggaag agtatgagta 1500ttcaacattt ccgtgtcgcc
cttattccct tttttgcggc attttgcctt cctgtttttg 1560ctcacccaga
aacgctggtg aaagtaaaag atgctgaaga tcagttgggt gcacgagtgg
1620gttacatcga actggatctc aacagcggta agatccttga gagttttcgc
cccgaagaac 1680gttttccaat gatgagcact tttaaagttc tgctatgtgg
cgcggtatta tcccgtattg 1740acgccgggca agagcaactc ggtcgccgca
tacactattc tcagaatgac ttggttgagt 1800actcaccagt cacagaaaag
catcttacgg atggcatgac agtaagagaa ttatgcagtg 1860ctgccataac
catgagtgat aacactgcgg ccaacttact tctgacaacg atcggaggac
1920cgaaggagct aaccgctttt ttgcacaaca tgggggatca tgtaactcgc
cttgatcgtt 1980gggaaccgga gctgaatgaa gccataccaa acgacgagcg
tgacaccacg atgcctgtag 2040caatggcaac aacgttgcgc aaactattaa
ctggcgaact acttactcta gcttcccggc 2100aacaattaat agactggatg
gaggcggata aagttgcagg accacttctg cgctcggccc 2160ttccggctgg
ctggtttatt gctgataaat ctggagccgg tgagcgtggg tctcgcggta
2220tcattgcagc actggggcca gatggtaagc cctcccgtat cgtagttatc
tacacgacgg 2280ggagtcaggc aactatggat gaacgaaata gacagatcgc
tgagataggt gcctcactga 2340ttaagcattg gtaactgtca gaccaagttt
actcatatat actttagatt gatttaaaac 2400ttcattttta atttaaaagg
atctaggtga agatcctttt tgataatctc atgaccaaaa 2460tcccttaacg
tgagttttcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat
2520cttcttgaga tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa
aaaccaccgc 2580taccagcggt ggtttgtttg ccggatcaag agctaccaac
tctttttccg aaggtaactg 2640gcttcagcag agcgcagata ccaaatactg
tccttctagt gtagccgtag ttaggccacc 2700acttcaagaa ctctgtagca
ccgcctacat acctcgctct gctaatcctg ttaccagtgg 2760ctgctgccag
tggcgataag tcgtgtctta ccgggttgga ctcaagacga tagttaccgg
2820ataaggcgca gcggtcgggc tgaacggggg gttcgtgcac acagcccagc
ttggagcgaa 2880cgacctacac cgaactgaga tacctacagc gcgagcattg
agaaagcgcc acgcttcccg 2940aagggagaaa ggcggacagg tatccggtaa
gcggcagggt cggaacagga gagcgcacga 3000gggagcttcc agggggaaac
gcctggtatc tttatagtcc tgtcgggttt cgccacctct 3060gacttgagcg
tcgatttttg tgatgctcgt caggggggcg gagcctatgg aaaaacgcca
3120gcaacgcggc ctttttacgg ttcctggcct tttgctggcc ttttgctcac
atgttctttc 3180ctgcgttatc ccctgattct gtggataacc gtattaccgc
ctttgagtga gctgataccg 3240ctcgccgcag ccgaacgacc gagcgcagcg
agtcagtgag cgaggaagcg gaagagcgcc 3300caatacgcaa accgcctctc
cccgcgcgtt ggccgattca ttaatgcagc tgtggtgtca 3360tggtcggtga
tcgccagggt gccgacgcgc atctcgactg catggtgcac caatgcttct
3420ggcgtcaggc agccatcgga agctgtggta tggccgtgca ggtcgtaaat
cactgcataa 3480ttcgtgtcgc tcaaggcgca ctcccgttct ggataatgtt
ttttgcgccg acatcataac 3540ggttctggca aatattctga aatgagctgt
tgacaattaa tcatcgaact agttaactag 3600tacgcaagtt
cacgtaaaaa gggtatcgcg gaatt 36351657DNAArtificial Sequenceputative
AP205 ribosomal binding site of plasmid pAP283-58 16tctagaattt
tctgcgcacc catcccgggt ggcgcccaaa gtgaggaaaa tcacatg
571735DNAArtificial SequenceShine Delagarno sequence of vector
pQb185 17tctagattaa cccaacgcgt aggagtcagg ccatg
3518131PRTArtificial SequenceBacteriophage AP205 mutant 18Met Ala
Asn Lys Thr Met Gln Pro Ile Thr Ser Thr Ala Asn Lys Ile1 5 10 15Val
Trp Ser Asp Pro Thr Arg Leu Ser Thr Thr Phe Ser Ala Ser Leu 20 25
30Leu Arg Gln Arg Val Lys Val Gly Ile Ala Glu Leu Asn Asn Val Ser
35 40 45Gly Gln Tyr Val Ser Val Tyr Lys Arg Pro Ala Pro Lys Pro Glu
Gly 50 55 60Cys Ala Asp Ala Cys Val Ile Met Pro Asn Glu Asn Gln Ser
Ile Arg65 70 75 80Thr Val Ile Ser Gly Ser Ala Glu Asn Leu Ala Thr
Leu Lys Ala Glu 85 90 95Trp Glu Thr His Lys Arg Asn Val Asp Thr Leu
Phe Ala Ser Gly Asn 100 105 110Ala Gly Leu Gly Phe Leu Asp Pro Thr
Ala Ala Ile Val Ser Ser Asp 115 120 125Thr Thr Ala
130193613DNAArtificial SequencePlasmid, pAP281-32, encoding RNA
phage AP205 coat protein 19cgagctcgcc cctggcttat cgaaattaat
acgactcact atagggagac cggaattcga 60gctcgcccgg ggatcctcta gattaaccca
acgcgtagga gtcaggccat ggcaaataag 120acaatgcaac cgatcacatc
tacagcaaat aaaattgtgt ggtcggatcc aactcgttta 180tcaactacat
tttcagcaag tctgttacgc caacgtgtta aagttggtat agccgaactg
240aataatgttt caggtcaata tgtatctgtt tataagcgtc ctgcacctaa
accggaaggt 300tgtgcagatg cctgtgtcat tatgccgaat gaaaaccaat
ccattcgcac agtgatttca 360gggtcagccg aaaacttggc taccttaaaa
gcagaatggg aaactcacaa acgtaacgtt 420gacacactct tcgcgagcgg
caacgccggt ttgggtttcc ttgaccctac tgcggctatc 480gtatcgtctg
atactactgc ttaagcttgt attctatagt gtcacctaaa tcgtatgtgt
540atgatacata aggttatgta ttaattgtag ccgcgttcta acgacaatat
gtacaagcct 600aattgtgtag catctggctt actgaagcag accctatcat
ctctctcgta aactgccgtc 660agagtcggtt tggttggacg aaccttctga
gtttctggta acgccgttcc gcaccccgga 720aatggtcacc gaaccaatca
gcagggtcat cgctagccag atcctctacg ccggacgcat 780cgtggccggc
atcaccggcg ccacaggtgc ggttgctggc gcctatatcg ccgacatcac
840cgatggggaa gatcgggctc gccacttcgg gctcatgagc gcttgtttcg
gcgtgggtat 900ggtggcaggc cccgtggccg ggggactgtt gggcgccatc
tccttgcatg caccattcct 960tgcggcggcg gtgctcaacg gcctcaacct
actactgggc tgcttcctaa tgcaggagtc 1020gcataaggga gagcgtcgat
atggtgcact ctcagtacaa tctgctctga tgccgcatag 1080ttaagccaac
tccgctatcg ctacgtgact gggtcatggc tgcgccccga cacccgccaa
1140cacccgctga cgcgccctga cgggcttgtc tgctcccggc atccgcttac
agacaagctg 1200tgaccgtctc cgggagctgc atgtgtcaga ggttttcacc
gtcatcaccg aaacgcgcga 1260ggcagcttga agacgaaagg gcctcgtgat
acgcctattt ttataggtta atgtcatgat 1320aataatggtt tcttagacgt
caggtggcac ttttcgggga aatgtgcgcg gaacccctat 1380ttgtttattt
ttctaaatac attcaaatat gtatccgctc atgagacaat aaccctgata
1440aatgcttcaa taatattgaa aaaggaagag tatgagtatt caacatttcc
gtgtcgccct 1500tattcccttt tttgcggcat tttgccttcc tgtttttgct
cacccagaaa cgctggtgaa 1560agtaaaagat gctgaagatc agttgggtgc
acgagtgggt tacatcgaac tggatctcaa 1620cagcggtaag atccttgaga
gttttcgccc cgaagaacgt tttccaatga tgagcacttt 1680taaagttctg
ctatgtggcg cggtattatc ccgtattgac gccgggcaag agcaactcgg
1740tcgccgcata cactattctc agaatgactt ggttgagtac tcaccagtca
cagaaaagca 1800tcttacggat ggcatgacag taagagaatt atgcagtgct
gccataacca tgagtgataa 1860cactgcggcc aacttacttc tgacaacgat
cggaggaccg aaggagctaa ccgctttttt 1920gcacaacatg ggggatcatg
taactcgcct tgatcgttgg gaaccggagc tgaatgaagc 1980cataccaaac
gacgagcgtg acaccacgat gcctgtagca atggcaacaa cgttgcgcaa
2040actattaact ggcgaactac ttactctagc ttcccggcaa caattaatag
actggatgga 2100ggcggataaa gttgcaggac cacttctgcg ctcggccctt
ccggctggct ggtttattgc 2160tgataaatct ggagccggtg agcgtgggtc
tcgcggtatc attgcagcac tggggccaga 2220tggtaagccc tcccgtatcg
tagttatcta cacgacgggg agtcaggcaa ctatggatga 2280acgaaataga
cagatcgctg agataggtgc ctcactgatt aagcattggt aactgtcaga
2340ccaagtttac tcatatatac tttagattga tttaaaactt catttttaat
ttaaaaggat 2400ctaggtgaag atcctttttg ataatctcat gaccaaaatc
ccttaacgtg agttttcgtt 2460ccactgagcg tcagaccccg tagaaaagat
caaaggatct tcttgagatc ctttttttct 2520gcgcgtaatc tgctgcttgc
aaacaaaaaa accaccgcta ccagcggtgg tttgtttgcc 2580ggatcaagag
ctaccaactc tttttccgaa ggtaactggc ttcagcagag cgcagatacc
2640aaatactgtc cttctagtgt agccgtagtt aggccaccac ttcaagaact
ctgtagcacc 2700gcctacatac ctcgctctgc taatcctgtt accagtggct
gctgccagtg gcgataagtc 2760gtgtcttacc gggttggact caagacgata
gttaccggat aaggcgcagc ggtcgggctg 2820aacggggggt tcgtgcacac
agcccagctt ggagcgaacg acctacaccg aactgagata 2880cctacagcgc
gagcattgag aaagcgccac gcttcccgaa gggagaaagg cggacaggta
2940tccggtaagc ggcagggtcg gaacaggaga gcgcacgagg gagcttccag
ggggaaacgc 3000ctggtatctt tatagtcctg tcgggtttcg ccacctctga
cttgagcgtc gatttttgtg 3060atgctcgtca ggggggcgga gcctatggaa
aaacgccagc aacgcggcct ttttacggtt 3120cctggccttt tgctggcctt
ttgctcacat gttctttcct gcgttatccc ctgattctgt 3180ggataaccgt
attaccgcct ttgagtgagc tgataccgct cgccgcagcc gaacgaccga
3240gcgcagcgag tcagtgagcg aggaagcgga agagcgccca atacgcaaac
cgcctctccc 3300cgcgcgttgg ccgattcatt aatgcagctg tggtgtcatg
gtcggtgatc gccagggtgc 3360cgacgcgcat ctcgactgca tggtgcacca
atgcttctgg cgtcaggcag ccatcggaag 3420ctgtggtatg gccgtgcagg
tcgtaaatca ctgcataatt cgtgtcgctc aaggcgcact 3480cccgttctgg
ataatgtttt ttgcgccgac atcataacgg ttctggcaaa tattctgaaa
3540tgagctgttg acaattaatc atcgaactag ttaactagta cgcaagttca
cgtaaaaagg 3600gtatcgcgga att 36132030DNAArtificial Sequencep1.45
primer 20nntctagaat tttctgcgca cccatcccgg 302131DNAArtificial
Sequencep1.46 primer 21nnaagcttaa gcagtagtat cagacgatac g
312243DNAArtificial Sequencep1.47 primer 22gagtgatcca actcgtttat
caactacatt ttcagcaagt ctg 432343DNAArtificial Sequencep1.48 primer
23cagacttgct gaaaatgtag ttgataaacg agttggatca ctc
4324129PRTBacteriophage R17 24Ala Ser Asn Phe Thr Gln Phe Val Leu
Val Asn Asp Gly Gly Thr Gly1 5 10 15Asn Val Thr Val Ala Pro Ser Asn
Phe Ala Asn Gly Val Ala Glu Trp 20 25 30Ile Ser Ser Asn Ser Arg Ser
Gln Ala Tyr Lys Val Thr Cys Ser Val 35 40 45Arg Gln Ser Ser Ala Gln
Asn Arg Lys Tyr Thr Ile Lys Val Glu Val 50 55 60Pro Lys Val Ala Thr
Gln Thr Val Gly Gly Val Glu Leu Pro Val Ala65 70 75 80Ala Trp Arg
Ser Tyr Leu Asn Met Glu Leu Thr Ile Pro Ile Phe Ala 85 90 95Thr Asn
Ser Asp Cys Glu Leu Ile Val Lys Ala Met Gln Gly Leu Leu 100 105
110Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala Asn Ser Gly Ile
115 120 125Tyr 25130PRTBacteriophage fr 25Met Ala Ser Asn Phe Glu
Glu Phe Val Leu Val Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Lys Val
Ala Pro Ser Asn Phe Ala Asn Gly Val Ala Glu 20 25 30Trp Ile Ser Ser
Asn Ser Arg Ser Gln Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln
Ser Ser Ala Asn Asn Arg Lys Tyr Thr Val Lys Val Glu 50 55 60Val Pro
Lys Val Ala Thr Gln Val Gln Gly Gly Val Glu Leu Pro Val65 70 75
80Ala Ala Trp Arg Ser Tyr Met Asn Met Glu Leu Thr Ile Pro Val Phe
85 90 95Ala Thr Asn Asp Asp Cys Ala Leu Ile Val Lys Ala Leu Gln Gly
Thr 100 105 110Phe Lys Thr Gly Asn Pro Ile Ala Thr Ala Ile Ala Ala
Asn Ser Gly 115 120 125Ile Tyr 13026130PRTBacteriophage GA 26Met
Ala Thr Leu Arg Ser Phe Val Leu Val Asp Asn Gly Gly Thr Gly1 5 10
15Asn Val Thr Val Val Pro Val Ser Asn Ala Asn Gly Val Ala Glu Trp
20 25 30Leu Ser Asn Asn Ser Arg Ser Gln Ala Tyr Arg Val Thr Ala Ser
Tyr 35 40 45Arg Ala Ser Gly Ala Asp Lys Arg Lys Tyr Ala Ile Lys Leu
Glu Val 50 55 60Pro Lys Ile Val Thr Gln Val Val Asn Gly Val Glu Leu
Pro Gly Ser65 70 75 80Ala Trp Lys Ala Tyr Ala Ser Ile Asp Leu Thr
Ile Pro Ile Phe Ala 85 90 95Ala Thr Asp Asp Val Thr Val Ile Ser Lys
Ser Leu Ala Gly Leu Phe 100 105 110Lys Val Gly Asn Pro Ile Ala Glu
Ala Ile Ser Ser Gln Ser Gly Phe 115 120 125Tyr Ala
13027132PRTBacteriophage SP 27Met Ala Lys Leu Asn Gln Val Thr Leu
Ser Lys Ile Gly Lys Asn Gly1 5 10 15Asp Gln Thr Leu Thr Leu Thr Pro
Arg Gly Val Asn Pro Thr Asn Gly 20 25 30Val Ala Ser Leu Ser Glu Ala
Gly Ala Val Pro Ala Leu Glu Lys Arg 35 40 45Val Thr Val Ser Val Ala
Gln Pro Ser Arg Asn Arg Lys Asn Phe Lys 50 55 60Val Gln Ile Lys Leu
Gln Asn Pro Thr Ala Cys Thr Arg Asp Ala Cys65 70 75 80Asp Pro Ser
Val Thr Arg Ser Ala Phe Ala Asp Val Thr Leu Ser Phe 85 90 95Thr Ser
Tyr Ser Thr Asp Glu Glu Arg Ala Leu Ile Arg Thr Glu Leu 100 105
110Ala Ala Leu Leu Ala Asp Pro Leu Ile Val Asp Ala Ile Asp Asn Leu
115 120 125Asn Pro Ala Tyr 13028329PRTBacteriophage SP 28Ala Lys
Leu Asn Gln Val Thr Leu Ser Lys Ile Gly Lys Asn Gly Asp1 5 10 15Gln
Thr Leu Thr Leu Thr Pro Arg Gly Val Asn Pro Thr Asn Gly Val 20 25
30Ala Ser Leu Ser Glu Ala Gly Ala Val Pro Ala Leu Glu Lys Arg Val
35 40 45Thr Val Ser Val Ala Gln Pro Ser Arg Asn Arg Lys Asn Phe Lys
Val 50 55 60Gln Ile Lys Leu Gln Asn Pro Thr Ala Cys Thr Arg Asp Ala
Cys Asp65 70 75 80Pro Ser Val Thr Arg Ser Ala Phe Ala Asp Val Thr
Leu Ser Phe Thr 85 90 95Ser Tyr Ser Thr Asp Glu Glu Arg Ala Leu Ile
Arg Thr Glu Leu Ala 100 105 110Ala Leu Leu Ala Asp Pro Leu Ile Val
Asp Ala Ile Asp Asn Leu Asn 115 120 125Pro Ala Tyr Trp Ala Ala Leu
Leu Val Ala Ser Ser Gly Gly Gly Asp 130 135 140Asn Pro Ser Asp Pro
Asp Val Pro Val Val Pro Asp Val Lys Pro Pro145 150 155 160Asp Gly
Thr Gly Arg Tyr Lys Cys Pro Phe Ala Cys Tyr Arg Leu Gly 165 170
175Ser Ile Tyr Glu Val Gly Lys Glu Gly Ser Pro Asp Ile Tyr Glu Arg
180 185 190Gly Asp Glu Val Ser Val Thr Phe Asp Tyr Ala Leu Glu Asp
Phe Leu 195 200 205Gly Asn Thr Asn Trp Arg Asn Trp Asp Gln Arg Leu
Ser Asp Tyr Asp 210 215 220Ile Ala Asn Arg Arg Arg Cys Arg Gly Asn
Gly Tyr Ile Asp Leu Asp225 230 235 240Ala Thr Ala Met Gln Ser Asp
Asp Phe Val Leu Ser Gly Arg Tyr Gly 245 250 255Val Arg Lys Val Lys
Phe Pro Gly Ala Phe Gly Ser Ile Lys Tyr Leu 260 265 270Leu Asn Ile
Gln Gly Asp Ala Trp Leu Asp Leu Ser Glu Val Thr Ala 275 280 285Tyr
Arg Ser Tyr Gly Met Val Ile Gly Phe Trp Thr Asp Ser Lys Ser 290 295
300Pro Gln Leu Pro Thr Asp Phe Thr Gln Phe Asn Ser Ala Asn Cys
Pro305 310 315 320Val Gln Thr Val Ile Ile Ile Pro Ser
32529130PRTBacteriophage MS2 29Met Ala Ser Asn Phe Thr Gln Phe Val
Leu Val Asp Asn Gly Gly Thr1 5 10 15Gly Asp Val Thr Val Ala Pro Ser
Asn Phe Ala Asn Gly Val Ala Glu 20 25 30Trp Ile Ser Ser Asn Ser Arg
Ser Gln Ala Tyr Lys Val Thr Cys Ser 35 40 45Val Arg Gln Ser Ser Ala
Gln Asn Arg Lys Tyr Thr Ile Lys Val Glu 50 55 60Val Pro Lys Val Ala
Thr Gln Thr Val Gly Gly Val Glu Leu Pro Val65 70 75 80Ala Ala Trp
Arg Ser Tyr Leu Asn Met Glu Leu Thr Ile Pro Ile Phe 85 90 95Ala Thr
Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met Gln Gly Leu 100 105
110Leu Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala Asn Ser Gly
115 120 125Ile Tyr 13030133PRTBacteriophage M11 30Met Ala Lys Leu
Gln Ala Ile Thr Leu Ser Gly Ile Gly Lys Lys Gly1 5 10 15Asp Val Thr
Leu Asp Leu Asn Pro Arg Gly Val Asn Pro Thr Asn Gly 20 25 30Val Ala
Ala Leu Ser Glu Ala Gly Ala Val Pro Ala Leu Glu Lys Arg 35 40 45Val
Thr Ile Ser Val Ser Gln Pro Ser Arg Asn Arg Lys Asn Tyr Lys 50 55
60Val Gln Val Lys Ile Gln Asn Pro Thr Ser Cys Thr Ala Ser Gly Thr65
70 75 80Cys Asp Pro Ser Val Thr Arg Ser Ala Tyr Ser Asp Val Thr Phe
Ser 85 90 95Phe Thr Gln Tyr Ser Thr Val Glu Glu Arg Ala Leu Val Arg
Thr Glu 100 105 110Leu Gln Ala Leu Leu Ala Asp Pro Met Leu Val Asn
Ala Ile Asp Asn 115 120 125Leu Asn Pro Ala Tyr
13031133PRTBacteriophage MX1 31Met Ala Lys Leu Gln Ala Ile Thr Leu
Ser Gly Ile Gly Lys Asn Gly1 5 10 15Asp Val Thr Leu Asn Leu Asn Pro
Arg Gly Val Asn Pro Thr Asn Gly 20 25 30Val Ala Ala Leu Ser Glu Ala
Gly Ala Val Pro Ala Leu Glu Lys Arg 35 40 45Val Thr Ile Ser Val Ser
Gln Pro Ser Arg Asn Arg Lys Asn Tyr Lys 50 55 60Val Gln Val Lys Ile
Gln Asn Pro Thr Ser Cys Thr Ala Ser Gly Thr65 70 75 80Cys Asp Pro
Ser Val Thr Arg Ser Ala Tyr Ala Asp Val Thr Phe Ser 85 90 95Phe Thr
Gln Tyr Ser Thr Asp Glu Glu Arg Ala Leu Val Arg Thr Glu 100 105
110Leu Lys Ala Leu Leu Ala Asp Pro Met Leu Ile Asp Ala Ile Asp Asn
115 120 125Leu Asn Pro Ala Tyr 13032330PRTBacteriophage NL95 32Met
Ala Lys Leu Asn Lys Val Thr Leu Thr Gly Ile Gly Lys Ala Gly1 5 10
15Asn Gln Thr Leu Thr Leu Thr Pro Arg Gly Val Asn Pro Thr Asn Gly
20 25 30Val Ala Ser Leu Ser Glu Ala Gly Ala Val Pro Ala Leu Glu Lys
Arg 35 40 45Val Thr Val Ser Val Ala Gln Pro Ser Arg Asn Arg Lys Asn
Tyr Lys 50 55 60Val Gln Ile Lys Leu Gln Asn Pro Thr Ala Cys Thr Lys
Asp Ala Cys65 70 75 80Asp Pro Ser Val Thr Arg Ser Gly Ser Arg Asp
Val Thr Leu Ser Phe 85 90 95Thr Ser Tyr Ser Thr Glu Arg Glu Arg Ala
Leu Ile Arg Thr Glu Leu 100 105 110Ala Ala Leu Leu Lys Asp Asp Leu
Ile Val Asp Ala Ile Asp Asn Leu 115 120 125Asn Pro Ala Tyr Trp Ala
Ala Leu Leu Ala Ala Ser Pro Gly Gly Gly 130 135 140Asn Asn Pro Tyr
Pro Gly Val Pro Asp Ser Pro Asn Val Lys Pro Pro145 150 155 160Gly
Gly Thr Gly Thr Tyr Arg Cys Pro Phe Ala Cys Tyr Arg Arg Gly 165 170
175Glu Leu Ile Thr Glu Ala Lys Asp Gly Ala Cys Ala Leu Tyr Ala Cys
180 185 190Gly Ser Glu Ala Leu Val Glu Phe Glu Tyr Ala Leu Glu Asp
Phe Leu 195 200 205Gly Asn Glu Phe Trp Arg Asn Trp Asp Gly Arg Leu
Ser Lys Tyr Asp 210 215 220Ile Glu Thr His Arg Arg Cys Arg Gly Asn
Gly Tyr Val Asp Leu Asp225 230 235 240Ala Ser Val Met Gln Ser Asp
Glu Tyr Val Leu Ser Gly Ala Tyr Asp 245 250 255Val Val Lys Met Gln
Pro Pro Gly Thr Phe Asp Ser Pro Arg Tyr Tyr 260 265 270Leu His Leu
Met Asp Gly Ile Tyr Val Asp Leu Ala Glu Val Thr Ala 275 280 285Tyr
Arg Ser Tyr Gly Met Val Ile Gly Phe Trp Thr Asp Ser Lys Ser 290 295
300Pro Gln Leu Pro Thr Asp Phe Thr Arg Phe Asn Arg His Asn Cys
Pro305 310 315 320Val Gln Thr Val Ile Val Ile Pro Ser Leu 325
33033129PRTBacteriophage f2 33Ala Ser Asn Phe Thr Gln Phe Val
Leu Val Asn Asp Gly Gly Thr Gly1 5 10 15Asn Val Thr Val Ala Pro Ser
Asn Phe Ala Asn Gly Val Ala Glu Trp 20 25 30Ile Ser Ser Asn Ser Arg
Ser Gln Ala Tyr Lys Val Thr Cys Ser Val 35 40 45Arg Gln Ser Ser Ala
Gln Asn Arg Lys Tyr Thr Ile Lys Val Glu Val 50 55 60Pro Lys Val Ala
Thr Gln Thr Val Gly Gly Val Glu Leu Pro Val Ala65 70 75 80Ala Trp
Arg Ser Tyr Leu Asn Leu Glu Leu Thr Ile Pro Ile Phe Ala 85 90 95Thr
Asn Ser Asp Cys Glu Leu Ile Val Lys Ala Met Gln Gly Leu Leu 100 105
110Lys Asp Gly Asn Pro Ile Pro Ser Ala Ile Ala Ala Asn Ser Gly Ile
115 120 125Tyr
* * * * *