U.S. patent application number 13/598051 was filed with the patent office on 2013-04-04 for fungal proteases.
This patent application is currently assigned to Codexis, Inc.. The applicant listed for this patent is Zsolt Molnar, Attila Laszlo Nemeth, Lorand Szabo. Invention is credited to Zsolt Molnar, Attila Laszlo Nemeth, Lorand Szabo.
Application Number | 20130084608 13/598051 |
Document ID | / |
Family ID | 47992918 |
Filed Date | 2013-04-04 |
United States Patent
Application |
20130084608 |
Kind Code |
A1 |
Szabo; Lorand ; et
al. |
April 4, 2013 |
FUNGAL PROTEASES
Abstract
The present invention provides fungal proteases and improved
fungal strains that are deficient in protease production.
Inventors: |
Szabo; Lorand; (Budapest,
HU) ; Molnar; Zsolt; (Miskolc, HU) ; Nemeth;
Attila Laszlo; (Budapest, HU) |
|
Applicant: |
Name |
City |
State |
Country |
Type |
Szabo; Lorand
Molnar; Zsolt
Nemeth; Attila Laszlo |
Budapest
Miskolc
Budapest |
|
HU
HU
HU |
|
|
Assignee: |
Codexis, Inc.
Redwood City
CA
|
Family ID: |
47992918 |
Appl. No.: |
13/598051 |
Filed: |
August 29, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61541327 |
Sep 30, 2011 |
|
|
|
61564107 |
Nov 28, 2011 |
|
|
|
Current U.S.
Class: |
435/99 ; 435/121;
435/128; 435/134; 435/139; 435/140; 435/145; 435/146; 435/155;
435/158; 435/159; 435/160; 435/162; 435/167; 435/183; 435/189;
435/198; 435/200; 435/205; 435/209; 435/223; 435/254.11; 435/254.2;
435/320.1; 435/484; 435/72; 536/23.2 |
Current CPC
Class: |
C12N 15/1137 20130101;
C12P 19/14 20130101; C12P 21/00 20130101; C12N 9/2482 20130101;
C12Y 304/00 20130101; C12N 9/20 20130101; C12N 15/80 20130101; C12P
21/02 20130101; C12R 1/645 20130101; Y02P 20/52 20151101; C12N 1/14
20130101; C12N 9/24 20130101; C12N 9/58 20130101; C12N 9/48
20130101; C12Y 301/01008 20130101; C12P 19/02 20130101 |
Class at
Publication: |
435/99 ; 435/223;
435/320.1; 435/254.2; 435/254.11; 435/484; 435/183; 435/209;
435/198; 435/200; 435/189; 435/72; 536/23.2; 435/205; 435/155;
435/128; 435/158; 435/134; 435/139; 435/140; 435/146; 435/145;
435/167; 435/159; 435/121; 435/162; 435/160 |
International
Class: |
C12N 1/15 20060101
C12N001/15; C12N 15/63 20060101 C12N015/63; C12N 9/20 20060101
C12N009/20; C12N 9/26 20060101 C12N009/26; C12N 9/02 20060101
C12N009/02; C12P 19/00 20060101 C12P019/00; C12N 1/19 20060101
C12N001/19; C12N 15/80 20060101 C12N015/80; C12N 9/00 20060101
C12N009/00; C12N 9/42 20060101 C12N009/42; C12N 15/57 20060101
C12N015/57; C12N 9/34 20060101 C12N009/34; C12P 19/14 20060101
C12P019/14; C12P 7/02 20060101 C12P007/02; C12P 13/04 20060101
C12P013/04; C12P 7/18 20060101 C12P007/18; C12P 7/64 20060101
C12P007/64; C12P 7/56 20060101 C12P007/56; C12P 7/54 20060101
C12P007/54; C12P 7/42 20060101 C12P007/42; C12P 7/46 20060101
C12P007/46; C12P 5/02 20060101 C12P005/02; C12P 7/20 20060101
C12P007/20; C12P 17/10 20060101 C12P017/10; C12P 7/14 20060101
C12P007/14; C12P 7/16 20060101 C12P007/16; C12N 9/58 20060101
C12N009/58 |
Claims
1. A fungal protease comprising the polypeptide sequence set forth
in SEQ ID NOS:3, 6, 9, and/or 12, or a biologically active fragment
thereof.
2. An isolated polynucleotide sequence encoding the fungal protease
set forth in claim 1.
3. The isolated polynucleotide sequence set forth in claim 2,
wherein said sequence is selected from SEQ ID NOS:1, 2, 4, 5, 7, 8,
10, and/or 11, and/or a fragment and/or fusion of said SEQ ID
NOS:1, 2, 4, 5, 7, 8, 10, and/or 11.
4. The isolated polynucleotide sequence set forth in claim 2,
wherein said polynucleotide hybridizes to the full length
complement of SEQ ID NO:1, 2, 4, 5, 7, 8, 10, and/or 11, under
stringent hybridization conditions.
5. The isolated polynucleotide of claim 4, obtainable from a
filamentous fungus.
6. The isolated polynucleotide of claim 5, wherein said filamentous
fungus is Myceliophthora.
7. The isolated polynucleotide of claim 6, wherein said filamentous
fungus is Myceliophthora thermophila.
8. A vector comprising the polynucleotide sequence of claim 2.
9. The vector of claim 8, wherein said polynucleotide sequence is
operably linked to regulatory sequences suitable for expression of
said polynucleotide sequence in a suitable host cell.
10. A host cell comprising the vector of claim 9, wherein said host
cell is prokaryotic or eukaryotic cell.
11. The host cell of claim 10, wherein said host cell is a
eukaryotic cell.
12. The host cell of claim 11, wherein said host cell is a yeast or
filamentous fungal cell.
13. The host cell of claim 11, wherein said eukaryotic cell is
Myceliophthora
14. An isolated Myceliophthora deficient in at least one protease
native to said Myceliophthora, wherein said protease comprises an
amino acid sequence having at least 70%, at least 75%, at least
80%, at least 85%, at least 90%, at least 91%, at least 92%, at
least 93%, at least 94%, at least 95%, at least 96%, at least 97%,
at least 98%, or at least 99% identity with the polypeptide
sequence set forth in SEQ ID NO:3, 6, 9, and/or 12.
15. The Myceliophthora of claim 14, wherein said Myceliophthora is
Myceliophthora thermophila.
16. The Myceliophthora of claim 14, wherein said Myceliophthora
produces at least one enzyme.
17. The Myceliophthora of claim 16, wherein said at least one
enzyme comprises at least one cellulase.
18. The Myceliophthora of claim 17, wherein said at least one
cellulase is selected from beta-glucosidases, endoglucanases,
cellobiohydrolases, cellobiose dehydrogenases, endoxylanases,
beta-xylosidases, arabinofuranosidases, alpha-glucuronidases,
acetylxylan esterases, feruloyl esterases, and/or alpha-glucuronyl
esterases.
19. The Myceliophthora of claim 17, wherein said cellulase is a
recombinant cellulase selected from EG1b, EG2, EG3, EG4, EG5, EG6,
CBH1a, CBH1b, CBH2a, CBH2b, GH61a, GH61f, GH61p, and/or BGL.
20. The Myceliophthora of claim 17, wherein said Myceliophthora
further produces at least one non-cellulase enzyme.
21. The Myceliophthora of claim 20, wherein said at least one
non-cellulase enzyme comprises at least one lipase, amylase,
glucoamylase, and/or protease.
22. A composition comprising the Myceliophthora of claim 14.
23. A composition comprising at least one of said enzymes produced
by said Myceliophthora of claim 16.
24. A method for producing the Myceliophthora of claim 14,
comprising providing a Myceliophthora having protease activity,
wherein said protease comprises at least one amino acid sequence
having at least 70%, at least 75%, at least 80%, at least 85%, at
least 90%, at least 91%, at least 92%, at least 93%, at least 94%,
at least 95%, at least 96%, at least 97%, at least 98%, or at least
99% identity with at least one polypeptide sequence set forth in
SEQ ID NO:3, 6, 9, and/or 12; and mutating said Myceliophthora
under conditions such that said protease is mutated to produce a
protease-deficient Myceliophthora.
25. The method of claim 24, wherein said Myceliophthora is
Myceliophthora thermophila.
26. A method for producing at least one enzyme, comprising
providing said Myceliophthora of claim 14, under conditions such
that said at least one enzyme is produced by said
Myceliophthora.
27. The method of claim 26, wherein said enzyme comprises at least
one cellulase is selected from beta-glucosidases (BGLs), Type 1
cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases (CBH2s),
glycoside hydrolase 61s (GH61s), and/or endoglucanases (EGs).
28. The method of claim 27, wherein said cellulase is a
Myceliophthora cellulase selected from beta-glucosidases (BGLs),
Type 1 cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases
(CBH2s), glycoside hydrolase 61s (GH61s), and/or endoglucanases
(EGs).
29. The method of claim 28, wherein said cellulase is selected from
EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a, CBH1b, CBH2a, CBH2b, GH61a,
GH61f, GH61p, and/or BGL.
30. The method of claim 27, wherein said Myceliophthora further
produces at least one non-cellulase enzyme.
31. A composition comprising at least one enzyme produced using the
method of claim 26.
32. The composition of claim 31, further comprising said
Myceliophthora.
33. The composition of claim 31, wherein said at least one enzyme
is selected from beta-glucosidases (BGLs), Type 1
cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases (CBH2s),
glycoside hydrolase 61s (GH61s), and/or endoglucanases (EGs).
34. The composition of claim 33, wherein said cellulase is selected
from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a, CBH1b, CBH2a, CBH2b,
GH61a, and/or BGL.
35. The composition of claim 31, further comprising at least one
non-cellulase enzyme.
36. The composition of claim 35, wherein said at least one
non-cellulase enzyme is a recombinant non-cellulase enzyme.
37. The composition of claim 35, wherein said at least one
non-cellulase enzyme comprises at least one lipase, amylase,
glucoamylase, protease, oxidase and/or reductase.
38. A saccharification method comprising (a) providing biomass and
protease-deficient Myceliophthora in a culture broth, (b) culturing
said protease-deficient Myceliophthora under conditions in which
said at least one enzyme is secreted by said protease-deficient
Myceliophthora into said culture broth to provide an
enzyme-containing broth, and (c) combining the enzyme-containing
broth and said biomass under conditions such that saccharification
occurs, where (b) may take place before or simultaneously with
(c).
39. The saccharification method of claim 38, wherein fermentable
sugars are produced during said saccharification.
40. A method of producing at least one fermentable sugar from at
least one cellulosic substrate, comprising contacting the
cellulosic substrate with at least one enzyme selected from
beta-glucosidase (Bgl), at least one endoglucanase (EG), at least
one type 2b cellobiohydrolase (CBH2b), at least one glycoside
hydrolase 61(GH61), and/or at least one type 1a cellobiohydrolase
(CBH1a) produced by a protease-deficient Myceliophthora, under
conditions in which the fermentable sugar is produced.
41. The method of claim 40, further comprising the step of
producing an end-product from said at least one cellulosic
substrate, the method further comprising the step of contacting the
fermentable sugars with a microorganism in a fermentation to
produce the end-product.
42. The method of claim 41, wherein the end-product is a
fermentation end product.
43. The method of claim 42, wherein the fermentation end product is
selected from alcohols, organic acids, diols, fatty acids, lactic
acid, acetic acid, 3-hydroxypropionic acid, acrylic acid, succinic
acid, citric acid, malic acid, fumaric acid, amino acids,
1,3-propanediol, ethylene, glycerol, fatty alcohols, butadiene, and
beta-lactams.
44. The method of claim 43, wherein said fermentation end product
is at least one alcohol selected from ethanol and butanol.
Description
[0001] The present application claims priority to U.S. Prov. Pat.
Appln. Ser. No. 61/541,327, filed Sep. 30, 2011, and U.S. Prov.
Pat. Appln. Ser. No. 61/564,107, filed Nov. 28, 2011, both of which
are incorporated by reference in their entireties for all
purposes.
REFERENCE TO A "SEQUENCE LISTING," A TABLE, OR A COMPUTER PROGRAM
LISTING APPENDIX SUBMITTED AS AN ASCII TEXT FILE
[0002] The Sequence Listing written in file CX35-108US1_ST25.TXT,
created on Aug. 28, 2012, 461,224 bytes, machine format IBM-PC,
MS-Windows operating system, is hereby incorporated by
reference.
FIELD OF THE INVENTION
[0003] The present invention provides fungal proteases and improved
fungal strains that are deficient in protease production.
BACKGROUND
[0004] Proteases find use in various settings where the degradation
of protein compositions is desirable. Proteases, also referred to
as "proteinases" and "proteolytic enzymes," catalyze the breakdown
of peptide bonds within proteins. Different types of proteases
hydrolyze different types of peptide bonds. Proteolytic enzymes
play important roles in fungal development and physiology. Secreted
proteases are required for survival and growth of various fungal
species, and these enzymes play roles in accessing a variety of
substrates during intracellular protein turnover, processing
translocation, sporulation, germination, and differentiation. In
addition, fungal proteases are widely used in biotechnology, mainly
in areas such as food processing, leather processing, and in
detergent compositions, as well as in bioremediation compositions
and in the production of therapeutic peptides.
SUMMARY OF THE INVENTION
[0005] The present invention provides fungal proteases and improved
fungal strains that are deficient in protease production.
[0006] The present invention provides proteases comprising the
polypeptide sequences set forth in SEQ ID NOS:3, 6, 9, and/or 12,
and biologically active fragments thereof. In some embodiments, the
proteases are fungal proteases. The present invention also provides
polynucleotide sequences encoding the proteases. In some
embodiments, the present invention provides polynucleotide
sequences encoding the fungal proteases provided herein. In some
embodiments, the polynucleotide sequence is selected from SEQ ID
NOS:1, 2, 4, 5, 7, 8, 10, and/or 11, and/or a fragment and/or
fusion of SEQ ID NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11. In some
additional embodiments, the present invention provides isolated
polynucleotide sequences encoding at least one protease, wherein
the polynucleotide hybridizes to the full length complement of SEQ
ID NO: 1, 2, 4, 5, 7, 8, 10, and/or 11, under stringent
hybridization conditions. In some additional embodiments, the
present invention provides isolated polynucleotides obtainable from
a filamentous fungus. In some embodiments, the filamentous fungus
is Myceliophthora thermophila.
[0007] The present invention also provides vectors comprising at
least one polynucleotide sequence encoding at least one protease,
as provided herein. In some embodiments, the polynucleotide
sequence is operably linked to regulatory sequences suitable for
expression of the polynucleotide sequence in a suitable host cell.
In some embodiments, the host cell is a prokaryotic cell, while in
some other embodiments, it is an eukaryotic cell. In some further
embodiments, the host cell is a yeast or filamentous fungal cell.
In some embodiments, the host cell is Myceliophthora thermophila.
In some embodiments, the host cells comprising at least one vector
as provided herein are prokaryotic or eukaryotic cells. In some
embodiments, the host cell is a yeast or filamentous fungal cell.
In some embodiments, the host cell is Myceliophthora
thermophila.
[0008] The present invention also provides isolated Myceliophthora
strains deficient in at least one protease native to
Myceliophthora, wherein the protease comprises an amino acid
sequence having at least about 70%, at least about 75%, at least
about 80%, at least about 85%, at least about 86%, at least about
87%, at least about 88%, at least about 89%, at least about 90%, at
least about 91%, at least about 92%, at least about 93%, at least
about 94%, at least about 95%, at least about 96%, at least about
97%, at least about 98%, at least about 99%, or at least about 100%
identity with a polypeptide sequence set forth in SEQ ID NO: 3, 6,
9, and/or 12. In some embodiments, the Myceliophthora is
Myceliophthora thermophila. In some additional embodiments, the
Myceliophthora produces at least one enzyme. In some further
embodiments, the Myceliophthora produces at least one cellulase. In
still some further embodiments, the Myceliophthora produces at
least one enzyme selected from beta-glucosidases, endoglucanases,
cellobiohydrolases, cellobiose dehydrogenases, endoxylanases,
beta-xylosidases, xylanases, arabinofuranosidases,
alpha-glucuronidases, acetylxylan esterases, feruloyl esterases,
alpha-glucuronyl esterases, lipases, amylases, glucoamylases,
and/or proteases. In some additional embodiments, the
Myceliophthora produces at least one recombinant cellulase and/or
non-cellulase, while in some other embodiments, the Myceliophthora
produces at least two recombinant cellulases and/or non-cellulase,
and in still some additional embodiments, the Myceliophthora
produces at least three recombinant cellulases and/or
non-cellulase. In some embodiments, the cellulase is a recombinant
cellulase selected from beta-glucosidases (BGLs), Type 1
cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases (CBH2s),
glycoside hydrolase 61s (GH61s), and/or endoglucanases (EGs). In
some embodiments, the cellulase is a recombinant Myceliophthora
cellulase selected from beta-glucosidases (BGLs), Type 1
cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases (CBH2s),
glycoside hydrolase 61s (GH61s), and/or endoglucanases (EGs). In
some additional embodiments, the cellulase is a recombinant
cellulase selected from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a,
CBH1b, CBH2a, CBH2b, GH61a, and/or BGL.
[0009] The present invention also provides compositions comprising
the isolated Myceliophthora provided herein. The present invention
also provides compositions comprising the isolated Myceliophthora
thermophila provided herein. In some embodiments, the present
invention provides compositions comprising at least one of the
enzymes produced by at least one isolated Myceliophthora provided
herein. In some embodiments, the present invention provides
compositions comprising at least one of the enzymes produced by at
least one isolated Myceliophthora thermophila provided herein.
[0010] The present invention also provides methods for producing
the Myceliophthora described herein, comprising providing a
Myceliophthora having protease activity, wherein the protease
comprises an amino acid sequence having at least about 70%, at
least about 75%, at least about 80%, at least about 81%, at least
about 82%, at least about 83%, at least about 84%, at least about
85%, at least about 86%, at least about 87%, at least about 88%, at
least about 89%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or at least about 100% identity with the
polypeptide sequence set forth in SEQ ID NO: 3, 6, 9, and/or 12;
and mutating the Myceliophthora under conditions such that the
protease is mutated to produce a protease-deficient Myceliophthora.
In some embodiments, the present invention provides methods for
producing the Myceliophthora thermophila described herein,
comprising providing a Myceliophthora thermophila having protease
activity, wherein the protease comprises an amino acid sequence
having at least about 70%, at least about 75%, at least about 80%,
at least about 81%, at least about 82%, at least about 83%, at
least about 84%, at least about 85%, at least about 86%, at least
about 87%, at least about 88%, at least about 89%, at least about
90%, at least about 91%, at least about 92%, at least about 93%, at
least about 94%, at least about 95%, at least about 96%, at least
about 97%, at least about 98%, at least about 99%, or at least
about 100% identity with the polypeptide sequence set forth in SEQ
ID NO: 3, 6, 9, and/or 12; and mutating the Myceliophthora
thermophila under conditions such that the protease is mutated to
produce a protease-deficient Myceliophthora thermophila.
[0011] The present invention also provides methods for producing at
least one enzyme, comprising providing Myceliophthora, under
conditions such that at least one enzyme is produced by the
Myceliophthora. In some embodiments, the at least one enzyme
comprises at least one recombinant enzyme. In some further
embodiments, the at least one enzyme comprises at least one
recombinant cellulase, at least two recombinant cellulases, at
least three recombinant cellulases, at least four recombinant
cellulases, and/or at least five recombinant cellulases. In some
embodiments, the cellulase is selected from beta-glucosidases
(BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some additional embodiments, the cellulase
is a Myceliophthora cellulase selected from beta-glucosidases
(BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some further embodiments, the cellulase is
selected from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a, CBH1b, CBH2a,
CBH2b, GH61a, and/or BGL. In still some additional embodiments, the
Myceliophthora further produces at least one additional enzyme
(e.g., a non-cellulase enzyme). In some embodiments, at least one
additional enzyme is a recombinant non-cellulase enzyme. In still
additional embodiments, at least one non-cellulase enzyme is a
Myceliophthora non-cellulase enzyme. In some embodiments, at least
one non-cellulase enzyme comprises at least one endoxylanase,
beta-xylosidase, xylanase, arabinofuranosidase,
alpha-glucuronidase, acetylxylan esterase, feruloyl esterase,
alpha-glucuronyl esterase, lipase, amylase, glucoamylase, and/or
protease.
[0012] The present invention also provides methods for producing at
least one enzyme, comprising providing Myceliophthora thermophila,
under conditions such that at least one enzyme is produced by the
M. thermophila. In some embodiments, the at least one enzyme
comprises at least one recombinant enzyme. In some further
embodiments, the at least one enzyme comprises at least one
recombinant cellulase, at least two recombinant cellulases, at
least three recombinant cellulases, at least four recombinant
cellulases, and/or at least five recombinant cellulases. In some
embodiments, the cellulase is selected from beta-glucosidases
(BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some additional embodiments, the cellulase
is a M. thermophila cellulase selected from beta-glucosidases
(BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some further embodiments, the cellulase is
selected from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a, CBH1b, CBH2a,
CBH2b, GH61a, and/or BGL. In still some additional embodiments, the
M. thermophila further produces at least one additional enzyme
(e.g., a non-cellulase enzyme). In some embodiments, at least one
non-cellulase enzyme is a recombinant non-cellulase enzyme. In
still additional embodiments, at least one non-cellulase enzyme is
a M. thermophila non-cellulase enzyme. In some embodiments, at
least one non-cellulase enzyme comprises at least one endoxylanase,
beta-xylosidase, xylanase, arabinofuranosidase,
alpha-glucuronidase, acetylxylan esterase, feruloyl esterase,
alpha-glucuronyl esterase, lipase, amylase, glucoamylase, and/or
protease.
[0013] The present invention also provides compositions comprising
at least one enzyme produced using at least one of the methods
provided herein. In some embodiments the compositions further
comprise at least one enzyme produced by Myceliophthora. In some
embodiments, at least one enzyme is a Myceliophthora enzyme
produced by a protease-deficient Myceliophthora strain. In some
further embodiments, the at least one enzyme is a recombinant
enzyme. In still some additional embodiments, the compositions
comprise at least one enzyme selected from beta-glucosidases
(BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some embodiments, the compositions
comprise at least one enzyme, wherein the enzyme is a
Myceliophthora cellulase selected from beta-glucosidases (BGLs),
Type 1 cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases
(CBH2s), glycoside hydrolase 61s (GH61s), and/or endoglucanases
(EGs). In some embodiments, the compositions comprise at least one
cellulase selected from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a,
CBH1b, CBH2a, CBH2b, GH61a, and/or BGL. In some additional
embodiments, the compositions comprise at least one non-cellulase
enzyme. In some embodiments, the cellulase-containing compositions
further comprise at least one non-cellulase enzyme. In some
embodiments, the non-cellulase enzyme is a recombinant
non-cellulase enzyme. In some embodiments, the compositions
comprise at least one non-cellulase enzyme selected from at least
one lipase, amylase, glucoamylase, and/or protease.
[0014] The present invention also provides saccharification methods
comprising (a) providing a biomass and Myceliophthora, (b)
culturing the Myceliophthora provided herein under conditions in
which at least one enzyme is secreted into a culture broth, and (c)
combining the broth and biomass under conditions such that
saccharification occurs, where (b) may take place before or
simultaneously with (c). The present invention also provides
saccharification methods comprising combining at least one
composition provided herein and biomass under conditions such that
saccharification occurs. The present invention further provides
saccharification methods comprising combining any of enzymes
produced as provided herein with biomass, under conditions such
that saccharification occurs. In some embodiments, the M.
thermophila does not produce at least one protease selected from
Protease #1, Protease #2, Protease #3, and/or Protease #4, as
provided herein. In some embodiments, the Myceliophthora does not
produce at least one polypeptide selected from SEQ ID NOS: 3, 6, 9,
and/or 12. In some embodiments, the gene encoding at least one
protease selected from the genes encoding Protease #1, Protease #2,
Protease #3, and/or Protease #4 has been deleted from the
Myceliophthora. In some embodiments, at least one polynucleotide
sequence selected from SEQ ID NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11
is deleted from the genome of the Myceliophthora.
[0015] The present invention also provides saccharification methods
comprising (a) providing a biomass and Myceliophthora thermophila,
(b) culturing the Myceliophthora thermophila provided herein under
conditions in which at least one enzyme is secreted into a culture
broth, and (c) combining the broth and biomass under conditions
such that saccharification occurs, where (b) may take place before
or simultaneously with (c). The present invention also provides
saccharification methods comprising combining at least one
composition provided herein and biomass under conditions such that
saccharification occurs. The present invention further provides
saccharification methods comprising combining any of enzymes
produced as provided herein with biomass, under conditions such
that saccharification occurs. In some embodiments, the
Myceliophthora thermophila does not produce at least one protease
selected from Protease #1, Protease #2, Protease #3, and/or
Protease #4, as provided herein. In some embodiments, the
Myceliophthora thermophila does not produce at least one
polypeptide selected from SEQ ID NOS: 3, 6, 9, and/or 12. In some
embodiments, the gene encoding at least one protease selected from
the genes encoding Protease #1, Protease #2, Protease #3, and/or
Protease #4 has been deleted from the Myceliophthora thermophila.
In some embodiments, at least one polynucleotide sequence selected
from SEQ ID NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11 is deleted from
the genome of the Myceliophthora thermophila.
[0016] The present invention also provides saccharification methods
comprising (a) providing a biomass and Myceliophthora, (b)
culturing the Myceliophthora provided herein under conditions in
which at least one enzyme is secreted into a culture broth, (c)
recovering at least one cellulase and/or non-cellulase enzyme from
the broth, (d) combining the recovered cellulase enzyme and/or at
least one non-cellulase enzyme and biomass under conditions such
that saccharification occurs. The present invention also provides
saccharification methods comprising combining at least one
composition provided herein and biomass under conditions such that
saccharification occurs. The present invention further provides
saccharification methods comprising combining any of enzymes
produced as provided herein with biomass, under conditions such
that saccharification occurs. In some embodiments, the
Myceliophthora does not produce at least one protease selected from
Protease #1, Protease #2, Protease #3, and/or Protease #4, as
provided herein. In some embodiments, the Myceliophthora does not
produce at least one protease selected from Protease #1, Protease
#2, Protease #3, and/or Protease #4, as provided herein. In some
embodiments, the Myceliophthora does not produce at least one
polypeptide selected from SEQ ID NOS:3, 6, 9, and/or 12. In some
embodiments, the gene encoding at least one protease selected from
the genes encoding Protease #1, Protease #2, Protease #3, and/or
Protease #4 has been deleted from the Myceliophthora. In some
embodiments, at least one polynucleotide sequence selected from SEQ
ID NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11 have been deleted from the
genome of the Myceliophthora.
[0017] The present invention also provides saccharification methods
comprising (a) providing a biomass and Myceliophthora thermophila,
(b) culturing the Myceliophthora thermophila provided herein under
conditions in which at least one enzyme is secreted into a culture
broth, (c) recovering at least one cellulase and/or non-cellulase
enzyme from the broth, (d) combining the recovered cellulase enzyme
and/or at least one non-cellulase enzyme and biomass under
conditions such that saccharification occurs. The present invention
also provides saccharification methods comprising combining at
least one composition provided herein and biomass under conditions
such that saccharification occurs. The present invention further
provides saccharification methods comprising combining any of
enzymes produced as provided herein with biomass, under conditions
such that saccharification occurs. In some embodiments, the
Myceliophthora thermophila does not produce at least one protease
selected from Protease #1, Protease #2, Protease #3, and/or
Protease #4, as provided herein. In some embodiments, the
Myceliophthora thermophila does not produce at least one
polypeptide selected from SEQ ID NOS: 3, 6, 9, and/or 12. In some
embodiments, the gene encoding at least one protease selected from
the genes encoding Protease #1, Protease #2, Protease #3, and/or
Protease #4 has been deleted from the Myceliophthora thermophila.
In some embodiments, at least one sequence selected from SEQ ID
NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11 has been deleted from the
genome of the Myceliophthora thermophila.
[0018] The present invention also provides isolated fungal
proteases comprising amino acid sequences that are at least about
75%, at least about 80%, at least about 85%, at least about 86%, at
least about 87%, at least about 88%, at least about 89%, at least
about 90%, at least about 91%, at least about 92%, at least about
93%, at least about 94%, at least about 95%, at least about 96%, at
least about 97%, at least about 98%, or at least about 99%
identical to any of SEQ ID NOS:3, 6, 9, and/or 12 or a biologically
active fragment of any of SEQ ID NOS:3, 6, 9, and/or 12, wherein
the amino acid sequence of the protease is numbered with reference
to SEQ ID NO:3. In some embodiments, the fungal proteases comprise
the polypeptide sequence(s) set forth in SEQ ID NOS:3, 6, 9, and/or
12, or a biologically active fragment thereof.
[0019] The present invention also provides isolated polynucleotide
sequences encoding the fungal proteases provided herein. In some
embodiments, the isolated polynucleotide sequences comprise at
least one sequence selected from SEQ ID NOS:1, 2, 4, 5, 7, 8, 10,
and/or 11, and/or a fragment and/or fusion of SEQ ID NOS:1, 2, 4,
5, 7, 8, 10, and/or 11. In some additional embodiments, the
polynucleotides hybridize to the full length complement of SEQ ID
NO:1, 2, 4, 5, 7, 8, 10, and/or 11, under stringent hybridization
conditions. In some additional embodiments, the isolated
polynucleotides are obtainable from a filamentous fungus. In some
further embodiments, the filamentous fungus is Myceliophthora. In
still some additional embodiments, the filamentous fungus is
Myceliophthora thermophila.
[0020] The present invention also provides vectors comprising at
least one polynucleotide sequence encoding at least one protease
provided herein. In some embodiments, the isolated polynucleotide
sequences comprise at least one sequence selected from SEQ ID
NOS:1, 2, 4, 5, 7, 8, 10, and/or 11, and/or a fragment and/or
fusion of SEQ ID NOS:1, 2, 4, 5, 7, 8, 10, and/or 11. In some
additional embodiments, the polynucleotides hybridize to the full
length complement of SEQ ID NO:1, 2, 4, 5, 7, 8, 10, and/or 11,
under stringent hybridization conditions. In some additional
embodiments, the isolated polynucleotides are obtainable from a
filamentous fungus. In some further embodiments, the filamentous
fungus is Myceliophthora. In still some additional embodiments, the
filamentous fungus is Myceliophthora thermophila. In some
embodiments, the polynucleotide sequence(s) comprising the vector
is operably linked to regulatory sequences suitable for expression
of the polynucleotide sequence in a suitable host cell. In some
embodiments, the host cell is a prokaryotic or eukaryotic cell. In
some further embodiments, the host cell is a eukaryotic cell. In
some additional embodiments, the host cell is a yeast or
filamentous fungal cell. In some embodiments, the host cell is
Myceliophthora. In some further embodiments, the host cell is
Myceliophthora thermophila.
[0021] The present invention further provides host cells comprising
at least one vector as provided herein. In some embodiments the
host cell is prokaryotic or eukaryotic cell. In some embodiments,
the host cell is a prokaryotic or eukaryotic cell. In some further
embodiments, the host cell is a eukaryotic cell. In some additional
embodiments, the host cell is a yeast or filamentous fungal cell.
In some embodiments, the host cell is Myceliophthora. In some
further embodiments, the host cell is Myceliophthora thermophila.
In some embodiments, the isolated polynucleotide sequences of the
vectors comprise at least one sequence selected from SEQ ID NOS:1,
2, 4, 5, 7, 8, 10, and/or 11, and/or a fragment and/or fusion of
SEQ ID NOS:1, 2, 4, 5, 7, 8, 10, and/or 11. In some additional
embodiments, the polynucleotides hybridize to the full length
complement of SEQ ID NO:1, 2, 4, 5, 7, 8, 10, and/or 11, under
stringent hybridization conditions. In some additional embodiments,
the isolated polynucleotides are obtainable from a filamentous
fungus. In some further embodiments, the filamentous fungus is
Myceliophthora. In still some additional embodiments, the
filamentous fungus is Myceliophthora thermophila.
[0022] The present invention also provides isolated Myceliophthora
deficient in at least one protease native to Myceliophthora,
wherein the protease comprises an amino acid sequence having at
least about 70%, at least about 75%, at least about 80%, at least
about 85%, at least about 90%, at least about 91%, at least about
92%, at least about 93%, at least about 94%, at least about 95%, at
least about 96%, at least about 97%, at least about 98%, at least
about 99%, or about 100% identity with the polypeptide sequence set
forth in SEQ ID NO:3, 6, 9, and/or 12. In some embodiments, the
protease comprises an amino acid sequence having at least 70%, at
least 75%, at least 80%, at least 85%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% identity
with the polypeptide sequence set forth in SEQ ID NO:3, 6, 9,
and/or 12. In some embodiments the Myceliophthora is Myceliophthora
thermophila. In some additional embodiments, the Myceliophthora
produces at least one enzyme. In some embodiments, the
Myceliophthora provided herein produces at least one cellulase. In
some further embodiments, the Myceliophthora produces at least one
cellulase is selected from beta-glucosidases, endoglucanases,
cellobiohydrolases, cellobiose dehydrogenases, xylanases,
beta-xylosidases, arabinofuranosidases, alpha-glucuronidases,
acetylxylan esterases, feruloyl esterases, alpha-glucuronyl
esterases, laccases, and/or peroxidases. In some embodiments, the
Myceliophthora produces at least one recombinant cellulase, while
in some alternative embodiments the Myceliophthora produces at
least two recombinant cellulases, and in some further embodiments,
the Myceliophthora produces at least three, four, five, or more
recombinant cellulases. In some embodiments, the recombinant
cellulase comprises a recombinant cellulase selected from
beta-glucosidases (BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some additional embodiments, the cellulase
comprises a recombinant Myceliophthora cellulase selected from
beta-glucosidases (BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some further embodiments, the cellulase is
a recombinant cellulase selected from EG1b, EG2, EG3, EG4, EG5,
EG6, CBH1a, CBH1b, CBH2a, CBH2b, GH61a, and/or BGL. In some
additional embodiments, the Myceliophthora further produces at
least one non-cellulase enzyme. In some embodiments, the
Myceliophthora produces at least one non-cellulase enzyme
comprising at least one lipase, amylase, glucoamylase, protease,
oxidase, and/or reductase. In some additional embodiments, the
Myceliophthora produces two, three, four, or more non-cellulase
enzymes.
[0023] The present invention also provides compositions comprising
the Myceliophthora provided herein. The present invention also
provides compositions comprising at least one enzyme produced by
the Myceliophthora provided herein. In some embodiments, the
Myceliophthora is Myceliophthora thermophila. The present invention
also provides compositions comprising Myceliophthora thermophila.
In some embodiments the compositions comprise at least one
additional enzyme produced by at least one Myceliophthora provided
herein. In some further embodiments, the compositions further
comprise at least one additional enzyme produced by any suitable
organism, including but not limited to any suitable eukaryotic
and/or prokaryotic organisms. In some further embodiments, the
compositions further comprise at least one additional suitable
organism, including but not limited to eukaryotic and prokaryotic
organisms. In some embodiments, the additional organism is selected
from yeast, filamentous fungi, and bacteria.
[0024] The present invention further provides methods for producing
the Myceliophthora provided herein, comprising providing a
Myceliophthora having protease activity, wherein the protease
comprises at least one amino acid sequence having at least 70%, at
least 75%, at least 80%, at least 85%, at least 90%, at least 91%,
at least 92%, at least 93%, at least 94%, at least 95%, at least
96%, at least 97%, at least 98%, at least 99%, or 100% identity
with at least one polypeptide sequence set forth in SEQ ID NO:3, 6,
9, and/or 12; and mutating the Myceliophthora under conditions such
that a protease-deficient Myceliophthora is produced. The present
invention further provides methods for producing the Myceliophthora
provided herein, comprising providing a Myceliophthora having
protease activity, wherein the protease comprises at least one
amino acid sequence having at least about 70%, at least about 75%,
at least about 80%, at least about 85%, at least about 90%, at
least about 91%, at least about 92%, at least about 93%, at least
about 94%, at least about 95%, at least about 96%, at least about
97%, at least about 98%, or at least about 99% identity with at
least one polypeptide sequence set forth in SEQ ID NO:3, 6, 9,
and/or 12; and mutating the Myceliophthora under conditions such
that a protease-deficient Myceliophthora is produced. It is not
intended that the protease-deficient Myceliophthora be produced
using any particular methods, as it is intended that any suitable
method for production of protease-deficient fungal organisms will
find use in the present invention. In some embodiments, the
Myceliophthora is Myceliophthora thermophila.
[0025] The present invention also provides methods for producing at
least one enzyme, comprising providing the Myceliophthora provided
herein, under conditions such that at least one enzyme is produced
by the Myceliophthora. In some embodiments, at least one enzyme
produced by the isolated Myceliophthora comprises at least one
recombinant enzyme. In some embodiments, at least one enzyme
comprises at least one recombinant cellulase, while in some
alternative embodiments the methods provide at least two
recombinant cellulases, and some further embodiments, the methods
provide at least three, four, or five or more recombinant
cellulases. In some embodiments, the cellulase is selected from
beta-glucosidases (BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). IN some further embodiments, the cellulase is
a Myceliophthora cellulase selected from beta-glucosidases (BGLs),
Type 1 cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases
(CBH2s), glycoside hydrolase 61s (GH61s), and/or endoglucanases
(EGs). In some additional embodiments, the cellulase is selected
from EG1b, EG2, EG3, EG4, EG5, EG6, CBH1a, CBH1b, CBH2a, CBH2b,
GH61a, and/or BGL. In some embodiments, the Myceliophthora further
produces at least one non-cellulase enzyme. In some additional
embodiments, the non-cellulase enzyme(s) is/are recombinant
non-cellulase enzyme(s). In some further embodiments, the
non-cellulase enzyme(s) comprise at least one lipase, amylase,
glucoamylase, protease, oxidase, and/or reductase. In some
additional embodiments, the Myceliophthora produces two, three,
four, or more non-cellulase enzymes. In some embodiments, the
Myceliophthora is Myceliophthora thermophila.
[0026] The present invention also provides compositions comprising
at least one enzyme produced using at least one method provided
herein. In some embodiments, the composition further comprises
Myceliophthora. In some additional embodiments, the compositions
comprise at least one Myceliophthora enzyme. In some further
embodiments, at least one enzyme is a recombinant enzyme. In some
additional embodiments, at least one enzyme is selected from
beta-glucosidases (BGLs), Type 1 cellobiohydrolases (CBH1s), Type 2
cellobiohydrolases (CBH2s), glycoside hydrolase 61s (GH61s), and/or
endoglucanases (EGs). In some embodiments, the compositions
comprise at least one enzyme comprising at least one Myceliophthora
cellulase selected from beta-glucosidases (BGLs), Type 1
cellobiohydrolases (CBH1s), Type 2 cellobiohydrolases (CBH2s),
glycoside hydrolase 61s (GH61s), and/or endoglucanases (EGs). In
some embodiments, the cellulase is selected from EG1b, EG2, EG3,
EG4, EG5, EG6, CBH1a, CBH1b, CBH2a, CBH2b, GH61a, and/or BGL. In
some additional embodiments, the Myceliophthora is Myceliophthora
thermophila. In some further embodiments, the compositions further
comprise at least one non-cellulase enzyme. In some embodiments, at
least one non-cellulase enzyme is a recombinant non-cellulase
enzyme. In some further embodiments, the non-cellulase enzyme(s)
comprise at least one lipase, amylase, glucoamylase, protease,
oxidase, and/or reductase. In some additional embodiments, the
Myceliophthora produces two, three, four, or more non-cellulase
enzymes. In some embodiments, the Myceliophthora is Myceliophthora
thermophila.
[0027] The present invention also provides saccharification methods
comprising (a) providing biomass and protease-deficient
Myceliophthora as provided herein in a culture broth, (b) culturing
the protease-deficient Myceliophthora under conditions in which at
least one enzyme is secreted by the Myceliophthora into the culture
broth to provide an enzyme-containing broth, and (c) combining the
enzyme-containing broth and the biomass under conditions such that
saccharification occurs, where (b) may take place before or
simultaneously with (c). In some embodiments, the saccharification
methods comprise combining at least one composition as provided
herein and biomass under conditions such that saccharification
occurs. In some further embodiments, fermentable sugars are
produced during saccharification.
[0028] The present invention also provides methods for producing a
fermentable sugar from at least one cellulosic substrate,
comprising contacting the cellulosic substrate with at least one
enzyme selected from beta-glucosidase (Bgl), at least one
endoglucanase (EG), at least one type 2b cellobiohydrolase (CBH2b),
at least one glycoside hydrolase 61(GH61), and/or at least one
CBH1a produced by at least one protease-deficient Myceliophthora
provided herein, under conditions in which the fermentable sugar is
produced.
[0029] The present invention also provides methods of producing at
least one end-product from at least one cellulosic substrate, the
method comprising: (a) contacting the cellulosic substrate with at
least one enzyme selected from beta-glucosidase (Bgl), at least one
endoglucanase (EG), at least one type 2b cellobiohydrolase (CBH2b),
at least one glycoside hydrolase 61(GH61), and/or at least one
CBH1a produced by the protease-deficient Myceliophthora provided
herein, under conditions in which fermentable sugars are produced;
and (b) contacting the fermentable sugars with a microorganism in a
fermentation to produce the end-product. In some embodiments, the
cellulosic substrate is pretreated prior to step (a). In some
embodiments, at least one end product comprises at least one
fermentation end product. In some embodiments, the methods further
comprise recovering at least one end product. In some additional
embodiments, the fermentation end product is selected from
alcohols, organic acids, diols, fatty acids, lactic acid, acetic
acid, 3-hydroxypropionic acid, acrylic acid, succinic acid, citric
acid, malic acid, fumaric acid, amino acids, 1,3-propanediol,
ethylene, glycerol, fatty alcohols, butadiene, and beta-lactams. In
some embodiments, the fermentation end product is at least one
alcohol selected from ethanol and butanol. In some further
embodiments, the alcohol is ethanol. In some additional
embodiments, the microorganism is a yeast. In some embodiments, the
yeast is Saccharomyces.
[0030] The present invention also provides use of at least one
protease-deficient Myceliophthora provided herein and/or at least
one composition as provided herein, to produce at least one
fermentation end product. In some embodiments, the present
invention also provides use of at least one protease-deficient
Myceliophthora provided herein and/or at least one composition
provided herein to produce at least one fermentation end product
selected from alcohols, fatty acids, lactic acid, acetic acid,
3-hydroxypropionic acid, acrylic acid, citric acid, malic acid,
fumaric acid, succinic acid, amino acids, 1,3-propanediol,
ethylene, glycerol, butadiene, fatty alcohols, and beta-lactams. In
some embodiments, the fermentation end product is an alcohol
selected from ethanol and butanol. In some further embodiments, the
alcohol is ethanol.
BRIEF DESCRIPTION OF THE FIGURES
[0031] FIG. 1 provides a map of the construct C1V16-1809.g1.
[0032] FIG. 2 provides a map of the construct pUC19-690.g5.
DESCRIPTION OF THE INVENTION
[0033] The present invention provides fungal proteases and improved
fungal strains that are deficient in protease production.
[0034] In some embodiments, the improved fungal strains find use in
hydrolyzing cellulosic material to glucose. In some embodiments,
the improved fungal strains find use in hydrolyzing lignocellulose
material. As indicated herein, the present invention provides
improved fungal strains for the conversion of cellulose to
fermentable sugars (e.g., glucose). In particular, the improved
fungal strains provided herein are genetically modified to reduce
the amount of endogenous protease activity secreted by the cells.
The present invention also provides purified enzymes produced by
the improved fungal strains provided herein.
[0035] Fungi are particularly suitable for large scale production
of useful proteins, particularly proteins that are secreted from
cells. Proteolytic enzymes play roles in these production
processes, as they are generally required for proper processing of
proteins and the metabolic health of the host organism. However,
proteolytic degradation can sometimes result in decreased yields of
secreted proteins. In addition, separation of intact from cleaved
proteins, particularly on a large scale, is challenging and
time-consuming. Thus, in some situations it is desirable to
attenuate protease production and/or activity. Means to achieve
this attenuation include, but are not limited to deleting (i.e.,
knocking out) the genes encoding proteases that are problematic in
protein production.
[0036] The present invention provides novel proteases obtained from
Myceliophthora thermophila, as well as M. thermophila strains that
are deficient in the production of at least one protease.
DEFINITIONS
[0037] Unless otherwise indicated, the practice of the present
invention involves conventional techniques commonly used in
molecular biology, protein engineering, microbiology, and
fermentation science, which are within the skill of the art. Such
techniques are well-known and described in numerous texts and
reference works well known to those of skill in the art. All
patents, patent applications, articles and publications mentioned
herein, both supra and infra, are hereby expressly incorporated
herein by reference.
[0038] Unless defined otherwise herein, all technical and
scientific terms used herein have the same meaning as commonly
understood by one of ordinary skill in the art to which this
invention pertains. Many technical dictionaries are known to those
of skill in the art. Although any suitable methods and materials
similar or equivalent to those described herein find use in the
practice of the present invention, some methods and materials are
described herein. It is to be understood that this invention is not
limited to the particular methodology, protocols, and reagents
described, as these may vary, depending upon the context they are
used by those of skill in the art. Accordingly, the terms defined
immediately below are more fully described by reference to the
application as a whole.
[0039] Also, as used herein, the singular "a", "an," and "the"
include the plural references, unless the context clearly indicates
otherwise. Numeric ranges are inclusive of the numbers defining the
range. Thus, every numerical range disclosed herein is intended to
encompass every narrower numerical range that falls within such
broader numerical range, as if such narrower numerical ranges were
all expressly written herein. It is also intended that every
maximum (or minimum) numerical limitation disclosed herein includes
every lower (or higher) numerical limitation, as if such lower (or
higher) numerical limitations were expressly written herein.
Furthermore, the headings provided herein are not limitations of
the various aspects or embodiments of the invention which can be
had by reference to the application as a whole. Accordingly, the
terms defined immediately below are more fully defined by reference
to the application as a whole. Nonetheless, in order to facilitate
understanding of the invention, a number of terms are defined
below. Unless otherwise indicated, nucleic acids are written left
to right in 5' to 3' orientation; amino acid sequences are written
left to right in amino to carboxy orientation, respectively.
[0040] As used herein, the term "comprising" and its cognates are
used in their inclusive sense (i.e., equivalent to the term
"including" and its corresponding cognates)
[0041] As used herein, "protease" includes enzymes that hydrolyze
peptide bonds (peptidases), as well as enzymes that hydrolyze bonds
between peptides and other moieties, such as sugars
(glycopeptidases). Many proteases are characterized under EC 3.4,
and are suitable for use in the present invention. Some specific
types of proteases include but are not limited to, cysteine
proteases including pepsin, papain and serine proteases including
chymotrypsins, carboxypeptidases and metalloendopeptidases.
[0042] As used herein, the term "protease-deficient" refers to
microbial strains, in particular fungal strains (e.g., M.
thermophila) that produce reduced levels or no endogenous or
heterologous proteases. In some embodiments, the strains do not
produce at least one protease selected from Protease #1, Protease
#2, Protease #3, and/or Protease #4, as provided herein. In some
embodiments, the M. thermophila does not produce at least one
polypeptide selected from SEQ ID NOS:3, 6, 9, and/or 12. In some
embodiments, the gene encoding at least one protease selected from
the genes encoding Protease #1, Protease #2, Protease #3, and/or
Protease #4 has been deleted from the M. thermophila. In some
embodiments, at least one polynucleotide sequence selected from SEQ
ID NOS:1, 2, 4, 5, 7, 8, 10, and/or 11 have been deleted from the
genome of the M. thermophila. In some additional embodiments, at
least one polynucleotide sequence selected from SEQ ID NOS: 1, 2,
4, 5, 7, 8, 10, and/or 11 have been mutated, such that the M.
thermophila produces a reduced level of at least one protease
(e.g., Protease #1, Protease #2, Protease #3, and/or Protease #4),
as compared to a M. thermophila in which SEQ ID NOS: 1, 2, 4, 5, 7,
8, 10, and/or 11 have not been mutated. In some embodiments, at
least one polynucleotide sequence or a portion thereof selected
from SEQ ID NOS: 1, 2, 4, 5, 7, 8, 10, and/or 11 are expressed by
M. thermophila, but reduced levels or no detectable levels of at
least one protease (e.g., Protease #1, Protease #2, Protease #3,
and/or Protease #4) are produced. It is also intended that the term
be used to indicate that a strain is deficient in the production of
a specific protease but not other protease(s). Thus, in some
embodiments, the strain is deficient in the production of at least
one protease selected from Protease #1, Protease #2, Protease #3,
and/or Protease #4, but is not deficient in production of at least
one additional protease, including but not limited to endogenous
and/or heterologous protease(s).
[0043] As used herein, "substrate" refers to a substance or
compound that is converted or designated for conversion into
another compound (e.g., a product) by the action of an enzyme. The
term includes not only a single compound but also combinations of
compounds, such as solutions, mixtures and other materials which
contain at least one substrate.
[0044] As used herein, "conversion" refers to the enzymatic
transformation of a substrate to the corresponding product.
"Percent conversion" refers to the percent of the substrate that is
converted to the product within a period of time under specified
conditions.
[0045] The terms "polynucleotide" and "nucleic acid", used
interchangeably herein, refer to a polymeric form of nucleotides of
any length, either ribonucleotides or deoxyribonucleotides. These
terms include, but are not limited to, single-, double- or
triple-stranded DNA, genomic DNA, cDNA, RNA, DNA-RNA hybrid,
polymers comprising purine and pyrimidine bases, and/or other
natural, chemically, biochemically modified, non-natural or
derivatized nucleotide bases. The following are non-limiting
examples of polynucleotides: genes, gene fragments, chromosomal
fragments, ESTs, exons, introns, mRNA, tRNA, rRNA, ribozymes, cDNA,
recombinant polynucleotides, branched polynucleotides, plasmids,
vectors, isolated DNA of any sequence, isolated RNA of any
sequence, nucleic acid probes, and primers. In some embodiments,
polynucleotides comprise modified nucleotides, such as methylated
nucleotides and nucleotide analogs, uracyl, other sugars and
linking groups such as fluororibose and thioate, and/or nucleotide
branches. In some alternative embodiments, the sequence of
nucleotides is interrupted by non-nucleotide components.
[0046] As used herein, the terms "DNA construct" and "transforming
DNA" are used interchangeably to refer to DNA that is used to
introduce sequences into a host cell or organism. The DNA may be
generated in vitro by PCR or any other suitable technique(s) known
to those in the art. In some embodiments, the DNA construct
comprises a sequence of interest (e.g., as an "incoming sequence").
In some embodiments, the sequence is operably linked to additional
elements such as control elements (e.g., promoters, etc.). In some
embodiments, the DNA construct further comprises at least one
selectable marker. In some further embodiments, the DNA construct
comprises an incoming sequence flanked by homology boxes. In some
further embodiments, the transforming DNA comprises other
non-homologous sequences, added to the ends (e.g., stuffer
sequences or flanks). In some embodiments, the ends of the incoming
sequence are closed such that the transforming DNA forms a closed
circle. The transforming sequences may be wild-type, mutant or
modified. In some embodiments, the DNA construct comprises
sequences homologous to the host cell chromosome. In some other
embodiments, the DNA construct comprises non-homologous sequences.
Once the DNA construct is assembled in vitro, it may be used to: 1)
insert heterologous sequences into a desired target sequence of a
host cell; 2) mutagenize a region of the host cell chromosome
(i.e., replace an endogenous sequence with a heterologous
sequence); 3) delete target genes; and/or 4) introduce a
replicating plasmid into the host. In some embodiments, the
incoming sequence comprises at least one selectable marker. This
sequence can code for one or more proteins of interest. It can have
other biological functions. In many cases the incoming sequence
comprises at least one selectable marker, such as a gene that
confers antimicrobial resistance.
[0047] As used herein, the terms "expression cassette" and
"expression vector" refer to nucleic acid constructs generated
recombinantly or synthetically, with a series of specified nucleic
acid elements that permit transcription of a particular nucleic
acid in a target cell. The recombinant expression cassette can be
incorporated into a plasmid, chromosome, mitochondrial DNA, plastid
DNA, virus, or nucleic acid fragment. Typically, the recombinant
expression cassette/vector includes, among other sequences, a
nucleic acid sequence to be transcribed and a promoter. In some
embodiments, expression vectors have the ability to incorporate and
express heterologous DNA fragments in a host cell. Many prokaryotic
and eukaryotic expression vectors are commercially available.
Selection of appropriate expression vectors is within the knowledge
of those of skill in the art. The term "expression cassette" is
used interchangeably herein with "DNA construct," and their
grammatical equivalents. Selection of appropriate expression
vectors is within the knowledge of those of skill in the art.
[0048] As used herein, the term "vector" refers to a polynucleotide
construct designed to introduce nucleic acids into one or more cell
types. Vectors include cloning vectors, expression vectors, shuttle
vectors, plasmids, cassettes and the like. In some embodiments, the
polynucleotide construct comprises a DNA sequence encoding the
enzyme (e.g., precursor or mature enzyme) that is operably linked
to a suitable prosequence capable of effecting the expression of
the DNA in a suitable host.
[0049] As used herein, "a secretion signal peptide" can be a
propeptide, a prepeptide or both. For example, the term
"propeptide" refers to a protein precursor that is cleaved to yield
a mature protein. The term "prepeptide" refers to a polypeptide
synthesized with an N-terminal signal peptide that targets it for
secretion. Accordingly, a "pre-pro-peptide" is a polypeptide that
contains a signal peptide that targets the polypeptide for
secretion and which is cleaved off to yield a mature polypeptide.
Signal peptides are found at the N-terminus of the protein and are
typically composed of between about 3 to about 136 basic and
hydrophobic amino acids.
[0050] As used herein, the term "plasmid" refers to a circular
double-stranded (ds) DNA construct used as a cloning vector, and
which forms an extrachromosomal self-replicating genetic element in
some eukaryotes or prokaryotes, or integrates into the host
chromosome.
[0051] As used herein in the context of introducing a nucleic acid
sequence into a cell, the term "introduced" refers to any method
suitable for transferring the nucleic acid sequence into the cell.
Such methods for introduction include but are not limited to
protoplast fusion, transfection, transformation, conjugation,
transduction, and electroporation.
[0052] As used herein, the terms "transformed" and "stably
transformed" refers to a cell that has a non-native (i.e.,
heterologous) polynucleotide sequence integrated into its genome or
as an episomal plasmid that is maintained for at least two
generations.
[0053] As used herein, the terms "control sequences" and
"regulatory sequences" refer to nucleic acid sequences necessary
and/or useful for expression of a polynucleotide encoding a
polypeptide. In some embodiments, control sequences are native
(i.e., from the same gene) or foreign (i.e., from a different gene)
to the polynucleotide encoding the polypeptide. Control sequences
include, but are not limited to leaders, polyadenylation sequences,
propeptide sequences, promoters, signal peptide sequences, and
transcription terminators. In some embodiments, at a minimum,
control sequences include a promoter, and transcriptional and
translational stop signals. In some embodiments, control sequences
are provided with linkers for the purpose of introducing specific
restriction sites facilitating ligation of the control sequences
with the coding region of the polynucleotide encoding the
polypeptide.
[0054] As used herein, "operably linked" refers to a configuration
in which a control sequence is appropriately placed (i.e., in a
functional relationship) at a position relative to a polynucleotide
of interest such that the control sequence directs or regulates the
expression of the polynucleotide and/or polypeptide of interest.
Thus, a nucleic acid is "operably linked" to another nucleic acid
sequence when it is placed into a functional relationship with
another nucleic acid sequence. For example, DNA encoding a
secretory leader (i.e., a signal peptide), is operably linked to
DNA for a polypeptide if it is expressed as a preprotein that
participates in the secretion of the polypeptide; a promoter or
enhancer is operably linked to a coding sequence if it affects the
transcription of the sequence; or a ribosome binding site is
operably linked to a coding sequence if it is positioned so as to
facilitate translation. Generally, "operably linked" means that the
DNA sequences being linked are contiguous, and, in the case of a
secretory leader, contiguous and in reading phase. However,
enhancers do not have to be contiguous. Linking is accomplished by
ligation at convenient restriction sites. If such sites do not
exist, the synthetic oligonucleotide adaptors or linkers are used
in accordance with conventional practice.
[0055] As used herein the term "gene" refers to a polynucleotide
(e.g., a DNA segment), that encodes a polypeptide and includes
regions preceding and following the coding regions as well as
intervening sequences (introns) between individual coding segments
(exons).
[0056] Nucleic acids "hybridize" when they associate, typically in
solution. There are numerous texts and other reference materials
that provide details regarding hybridization methods for nucleic
acids (See e.g., Tijssen, Laboratory Techniques in Biochemistry and
Molecular Biology-Hybridization with Nucleic Acid Probes," Part 1,
Chapter 2, Elsevier, New York, [1993], incorporated herein by
reference). For polynucleotides of at least 100 nucleotides in
length, low to very high stringency conditions are defined as
follows: prehybridization and hybridization at 42.degree. C. in
5.times.SSPE, 0.3% SDS, 200 .mu.g/ml sheared and denatured salmon
sperm DNA, and either 25% formamide for low stringencies, 35%
formamide for medium and medium-high stringencies, or 50% formamide
for high and very high stringencies, following standard Southern
blotting procedures. For polynucleotides of at least 200
nucleotides in length, the carrier material is finally washed three
times each for 15 minutes using 2.times.SSC, 0.2% SDS at least at
50.degree. C. ("low" stringency), at least at 55.degree. C.
("medium" or "moderate" stringency), at least at 60.degree. C.
("medium-high" stringency), at least at 65.degree. C. ("high"
stringency), and at least at 70.degree. C. ("very high"
stringency). In some embodiments, the stringency conditions include
those that: (1) employ low ionic strength and high temperature for
washing, for example 0.015 M sodium chloride/0.0015 M sodium
citrate/0.1% sodium dodecyl sulfate at 50.degree. C.; (2) employ a
denaturing agent during hybridization, such as formamide, for
example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1%
Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at
pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at
42.degree. C.; or (3) employ 50% formamide, 5.times.SSC (0.75 M
NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8),
0.1% sodium pyrophosphate, 5.times.Denhardt's solution, sonicated
salmon sperm DNA (50 .mu.g/mL), 0.1% SDS, and 10% dextran sulfate
at 42.degree. C., with washes at 42.degree. C. in 0.2.times.SSC
(sodium chloride/sodium citrate) and 50% formamide at 55.degree.
C., followed by a high-stringency wash consisting of 0.1.times.SSC
containing EDTA at 55.degree. C. In other embodiments, the
stringency conditions include overnight incubation at 37.degree. C.
in a solution comprising: 20% formamide, 5.times.SSC (150 mM NaCl,
15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6),
5.times.Denhardt's solution, 10% dextran sulfate, and 20 mg/mL
denatured sheared salmon sperm DNA, followed by washing the filters
in 1.times.SSC at about 37-50.degree. C. The skilled artisan will
recognize how to adjust the temperature, ionic strength, etc. as
necessary to accommodate factors to accomplish the desired
stringency.
[0057] As used herein, an "endogenous" or "homologous" gene refers
to a gene that is found in a parental strain of a cell (e.g., a
fungal or bacterial cell). In some embodiments, endogenous genes
are present in wild-type strains. As used herein in making
comparisons between nucleic acid sequences, "homologous genes" (or
"homologue" genes) refers to genes from different, but usually
related species, that correspond to each other and are identical or
very similar to each other. The term encompasses genes that are
separated by speciation (i.e., the development of new species)
(e.g., orthologous genes), as well as genes that have been
separated by genetic duplication (e.g., paralogous genes).
[0058] As used herein, "heterologous" polynucleotides are any
polynucleotides that are introduced into a host cell through the
use of laboratory techniques/manipulation, and include
polynucleotides that are removed from a host cell, subjected to
laboratory manipulation, and then reintroduced into a host
cell.
[0059] As used herein, when used with reference to a nucleic acid
or polypeptide, the term "heterologous" refers to a sequence that
is not normally expressed and secreted by an organism (e.g., a
"wild-type" organism). In some embodiments, the term encompasses a
sequence that comprises two or more subsequences which are not
found in the same relationship to each other as normally found in
nature, or is recombinantly engineered so that its level of
expression, or physical relationship to other nucleic acids or
other molecules in a cell, or structure, is not normally found in
nature. For instance, a heterologous nucleic acid is typically
recombinantly produced, having two or more sequences from unrelated
genes arranged in a manner not found in nature (e.g., a nucleic
acid open reading frame (ORF) of the invention operatively linked
to a promoter sequence inserted into an expression cassette, such
as a vector).
[0060] As used herein, a "heterologous enzyme" is used in reference
to an enzyme that is encoded by a heterologous gene. However, it is
also contemplated herein that a heterologous gene can encode an
endogenous or homologous enzyme. As used herein, the term
"heterologous gene" refers to a gene that occurs in a form not
found in a parental strain of the fungal cell. Thus, in some
embodiments, a heterologous gene is a gene that is derived from a
species that is different from the species of the fungal cell
expressing the gene and recognized anamorphs, teleomorphs or
taxonomic equivalents of the fungal cell expressing the gene. In
some embodiments, a heterologous gene is a modified version of a
gene that is endogenous to the host fungal cell (e.g., an
endogenous gene subjected to manipulation and then introduced or
transformed into the host cell). For example, in some embodiments,
a heterologous gene has an endogenous coding sequence, but has
modifications in the promoter sequence. Similarly, in other
embodiments, a heterologous gene encodes the same amino acid
sequence as an endogenous gene, but has modifications in codon
usage and/or to noncoding regions (e.g., introns), and/or
combinations thereof. For example, in some embodiments, a
heterologous gene contains modifications to the coding sequence to
encode a non-wild-type polypeptide. As another example, in some
embodiments, a heterologous gene has the same promoter sequence, 5'
and 3' untranslated regions and coding regions as a parental
strain, but is located in another region of the same chromosome, or
on an entirely different chromosome as compared to a parental
strain of the host cell. In some embodiments, the heterologous gene
is a gene that has been modified to overexpress a gene product of
interest.
[0061] As used herein, "recombinant" includes reference to a cell
or vector, that has been modified by the introduction of a
heterologous nucleic acid sequence or that the cell is derived from
a cell so modified. Thus, for example, recombinant cells express
genes that are not found in identical form within the native (i.e.,
non-recombinant) form of the cell or express native genes that are
otherwise abnormally expressed, under-expressed or not expressed at
all as a result of deliberate human intervention. "Recombinant,"
"engineered," and "non-naturally occurring," when used with
reference to a cell, nucleic acid, or polypeptide, refers to a
material, or a material corresponding to the natural or native form
of the material, that has been modified in a manner that would not
otherwise exist in nature, or is identical thereto but produced or
derived from synthetic materials and/or by manipulation using
recombinant techniques. Non-limiting examples include, among
others, recombinant cells expressing genes that are not found
within the native (i.e., non-recombinant) form of the cell or
express native genes that are otherwise expressed at a different
level. "Recombination," "recombining," and "generating a
recombined" nucleic acid also encompass the assembly of two or more
nucleic acid fragments wherein the assembly gives rise to a
chimeric gene.
[0062] As used herein, a "genetically modified" or "genetically
engineered" cell is a cell whose genetic material has been altered
using genetic engineering techniques. A genetically modified cell
also refers to a derivative of or the progeny of a cell whose
genetic material has been altered using genetic engineering
techniques. An example of a genetic modification as a result of
genetic engineering techniques includes a modification to the
genomic DNA. Another example of a genetic modification as a result
of genetic engineering techniques includes introduction of a stable
heterologous nucleic acid into the cell. For example, in some
embodiments, the genetically modified fungal cell of the present
invention secretes a reduced amount of at least one protease or the
secreted enzyme has a reduced ability to oxidize cellobiose.
[0063] As used herein, the term "overexpression" refers to any
state in which a gene is caused to be expressed at an elevated rate
or level as compared to the endogenous expression rate or level for
that gene. In some embodiments, "overexpression" includes an
elevated translation rate or level of the gene compared to the
endogenous translation rate or level for that gene. In some
embodiments, overexpression includes an elevated transcription rate
or level of the gene compared to the endogenous transcription rate
or level for that gene. For example, in some embodiments, a
heterologous gene is introduced into a fungal cell to express a
gene encoding a heterologous enzyme such as a beta-glucosidase from
another organism. In some other embodiments, a heterologous gene is
introduced into a fungal cell to overexpress a gene encoding a
homologous enzyme such as a beta-glucosidase.
[0064] In some embodiments, mutant DNA sequences are generated
using site saturation mutagenesis in at least one codon. In some
other embodiments, site saturation mutagenesis is performed for two
or more codons. In some further embodiments, mutant DNA sequences
have more than about 50%, more than about 55%, more than about 60%,
more than about 65%, more than about 70%, more than about 75%, more
than about 80%, more than about 81%, more than about 82%, more than
about 83%, more than about 84%, more than about 85%, more than
about 86%, more than about 87%, more than about 88%, more than
about 89%, more than about 90%, more than about 91%, more than
about 92%, more than about 93%, more than about 94%, more than
about 95%, more than about 96%, more than about 97%, more than
about 98%, or more than about 99% homology with the wild-type
sequence. In some alternative embodiments, mutant DNA is generated
in vivo using any suitable known mutagenic procedures including,
but not limited to the use of radiation, nitrosoguanidine, etc. The
desired DNA sequence is then isolated and used in the methods
provided herein.
[0065] As used herein, the terms "amplification" and "gene
amplification" refer to a method by which specific DNA sequences
are disproportionately replicated such that the amplified gene
becomes present in a higher copy number than was initially present
in the genome. In some embodiments, selection of cells by growth in
the presence of a drug (e.g., an inhibitor of an inhibitable
enzyme) results in the amplification of either the endogenous gene
encoding the gene product required for growth in the presence of
the drug or by amplification of exogenous (i.e., input) sequences
encoding this gene product, or both. "Amplification" is a special
case of nucleic acid replication involving template specificity. It
is to be contrasted with non-specific template replication (i.e.,
replication that is template-dependent but not dependent on a
specific template). Template specificity is here distinguished from
fidelity of replication (i.e., synthesis of the proper
polynucleotide sequence) and nucleotide (ribo- or deoxyribo-)
specificity. Template specificity is frequently described in terms
of "target" specificity. Target sequences are "targets" in the
sense that they are sought to be sorted out from other nucleic
acid. Amplification techniques have been designed primarily for
this sorting out.
[0066] As used herein, the term "primer" refers to an
oligonucleotide, whether occurring naturally as in a purified
restriction digest or produced synthetically, that is capable of
acting as a synthesis initiation point when placed under conditions
in which synthesis of a primer extension product which is
complementary to a nucleic acid strand is induced (i.e., in the
presence of nucleotides and an inducing agent such as DNA
polymerase and at a suitable temperature and pH). The primer is
preferably single stranded for maximum efficiency in amplification,
but may alternatively be double stranded. If double stranded, the
primer is first treated to separate its strands before being used
to prepare extension products. In some embodiments, the primer is
an oligodeoxyribonucleotide. The primer must be sufficiently long
to prime the synthesis of extension products in the presence of the
inducing agent. As known in the art, the exact lengths of the
primers will depend on many factors, including temperature, source
of primer and the use of the method.
[0067] As used herein, the term "probe" refers to an
oligonucleotide (i.e., a sequence of nucleotides), whether
occurring naturally as in a purified restriction digest or produced
synthetically, recombinantly or by PCR amplification, that is
capable of hybridizing to another oligonucleotide of interest. A
probe may be single-stranded or double-stranded. Probes are useful
in the detection, identification and isolation of particular gene
sequences. It is contemplated that any probe used in the present
invention will be labeled with any "reporter molecule," so that is
detectable in any detection system, including, but not limited to
enzyme (e.g., ELISA, as well as enzyme-based histochemical assays),
fluorescent, radioactive, and luminescent systems. It is not
intended that the present invention be limited to any particular
detection system or label.
[0068] As used herein, the term "target," when used in reference to
the polymerase chain reaction, refers to the region of nucleic acid
bounded by the primers used for polymerase chain reaction. Thus,
the "target" is sought to be sorted out from other nucleic acid
sequences. A "segment" is defined as a region of nucleic acid
within the target sequence.
[0069] As used herein, the term "polymerase chain reaction" (PCR)
refers to the methods of U.S. Pat. Nos. 4,683,195, 4,683,202, and
4,965,188, hereby incorporated by reference, which include methods
for increasing the concentration of a segment of a target sequence
in a mixture of genomic DNA without cloning or purification. This
method for amplifying the target sequence is well known in the
art.
[0070] As used herein, the term "amplification reagents" refers to
those reagents (deoxyribonucleotide triphosphates, buffer, etc.),
needed for amplification except for primers, nucleic acid template
and the amplification enzyme. Typically, amplification reagents
along with other reaction components are placed and contained in a
reaction vessel (test tube, microwell, etc.).
[0071] As used herein, the terms "restriction endonucleases" and
"restriction enzymes" refer to bacterial enzymes, each of which cut
double-stranded DNA at or near a specific nucleotide sequence.
[0072] A "restriction site" refers to a nucleotide sequence
recognized and cleaved by a given restriction endonuclease and is
frequently the site for insertion of DNA fragments. In some
embodiments of the invention, restriction sites are engineered into
the selective marker and into 5' and 3' ends of the DNA
construct.
[0073] As used herein, "homologous recombination" means the
exchange of DNA fragments between two DNA molecules or paired
chromosomes at the site of identical or nearly identical nucleotide
sequences. In some embodiments, chromosomal integration is
homologous recombination.
[0074] As used herein "amino acid" refers to peptide or protein
sequences or portions thereof. The terms "protein," "peptide," and
"polypeptide" are used interchangeably in reference to a polymer of
amino acid residues). The term "amino acid" refers to naturally
occurring and synthetic amino acids, as well as amino acid analogs.
Naturally occurring amino acids are those encoded by the genetic
code, as well as those amino acids that are later modified (e.g.,
hydroxyproline, .gamma.-carboxyglutamate, and O-phosphoserine).
"The term amino acid analogs" refers to compounds that have the
same basic chemical structure as a naturally occurring amino acid
(i.e., an .alpha.-carbon that is bound to a hydrogen, a carboxyl
group, an amino group, and an R group, such as homoserine,
norleucine, methionine sulfoxide, or methionine methyl sulfonium).
Such analogs have modified R groups (e.g., norleucine) or modified
peptide backbones, but retain the same basic chemical structure as
a naturally occurring amino acid. Amino acids may be referred to
herein by either their commonly known three letter symbols or by
the one-letter symbols recommended by the IUPAC-RJB Biochemical
Nomenclature Commission. Nucleotides, likewise, may be referred to
by their commonly accepted single-letter codes. It is also
understood that a polypeptide may be encoded by more than one
nucleotide sequence, due to the degeneracy of the genetic code.
[0075] A used herein, an amino acid or nucleotide base "position"
is denoted by a number that sequentially identifies each amino acid
(or nucleotide base) in the reference sequence based on its
position relative to the N-terminus (or 5'-end). Due to deletions,
insertions, truncations, fusions, and the like that must be taken
into account when determining an optimal alignment, the amino acid
residue number in a test sequence determined by simply counting
from the N-terminus will not necessarily be the same as the number
of its corresponding position in the reference sequence. For
example, in a case where a variant has a deletion relative to an
aligned reference sequence, there will be no amino acid in the
variant that corresponds to a position in the reference sequence at
the site of deletion. Where there is an insertion in an aligned
reference sequence, that insertion will not correspond to a
numbered amino acid position in the reference sequence. In the case
of truncations or fusions there can be stretches of amino acids in
either the reference or aligned sequence that do not correspond to
any amino acid in the corresponding sequence.
[0076] As used herein, the terms "numbered with reference to" or
"corresponding to," when used in the context of the numbering of a
given amino acid or polynucleotide sequence, refers to the
numbering of the residues of a specified reference sequence when
the given amino acid or polynucleotide sequence is compared to the
reference sequence.
[0077] As used herein, "conservative substitution," as used with
respect to amino acids, refers to the substitution of an amino acid
with a chemically similar amino acid. Amino acid substitutions that
do not generally alter specific activity are well known in the art
and are described in numerous textbooks. The most commonly
occurring exchanges are Ala/Ser, Val/Ile, Asp/Glu, Thr/Ser,
Ala/Gly, Ala/Thr, Ser/Asn, Ala/Val, Ser/Gly, Tyr/Phe, Ala/Pro,
Lys/Arg, Asp/Asn, Leu/Ile, Leu/Val, Ala/Glu, and Asp/Gly, as well
as these in reverse. As used herein, a conservative substitute for
a residue is another residue in the same group as shown below.
TABLE-US-00001 basic amino acids arginine (R), lysine (K),
histidine (H) acidic amino acids glutamic acid (E), aspartic acid
(D) polar amino acids glutamine (Q), asparagine (N) hydrophobic
amino acids leucine (L), isoleucine (I), valine (V) aromatic amino
acids phenylalanine (F), tryptophan (W), tyrosine (Y) small amino
acids glycine (G), alanine (A), serine (S), threonine (T), proline
(P), cysteine (C), methionine (M)
[0078] The following nomenclature may be used to describe
substitutions in a reference sequence relative to a reference
sequence or a variant polypeptide or nucleic acid sequence:
"R-#-V," where "#" refers to the position in the reference
sequence, "R" refers to the amino acid (or base) at that position
in the reference sequence, and "V" refers to the amino acid (or
base) at that position in the variant sequence.
[0079] The term "amino acid substitution set" or "substitution set"
refers to a group of amino acid substitutions. A substitution set
can have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more
amino acid substitutions.
[0080] As used herein, "deletion" when used in reference to a
polypeptide, refers to modification of the polypeptide by removal
of one or more amino acids from a reference polypeptide. Deletions
can comprise removal of 1 or more amino acids, 2 or more amino
acids, 3 or more amino acids, 4 or more amino acids, 5 or more
amino acids, 6 or more amino acids, 7 or more amino acids, 8 or
more amino acids, 9 or more amino acids, 10 or more amino acids, 15
or more amino acids, or 20 or more amino acids, up to 10% of the
total number of amino acids, or up to 20% of the total number of
amino acids making up the polypeptide while retaining enzymatic
activity and/or retaining the improved properties of an engineered
at least one protease enzyme. Deletions may be present in the
internal portions and/or terminal portions of the polypeptide. In
some embodiments, the deletion comprises a continuous segment,
while in other embodiments, it is discontinuous.
[0081] As used herein, a "gene deletion" or "deletion mutation" is
a mutation in which at least part of a sequence of the DNA making
up the gene is missing. Thus, a "deletion" in reference to nucleic
acids is a loss or replacement of genetic material resulting in a
complete or partial disruption of the sequence of the DNA making up
the gene. Any number of nucleotides can be deleted, from a single
base to an entire piece of a chromosome. Thus, in some embodiments,
the term "deletion" refers to the removal of a gene necessary for
encoding a specific protein (e.g., a protease). In this case, the
strain having this deletion can be referred to as a "deletion
strain." In some embodiments, the Myceliophthora (e.g., M.
thermophila) is a deletion strain comprising deletion of at least
one gene encoding at least one protease selected from Protease #1,
Protease #2, Protease #3, and/or Protease #4. In some additional
embodiments, the Myceliophthora (e.g., M. thermophila) is a strain
described in U.S. Pat. No. 8,236,551 and/or WO 2012/061382 (both of
which are incorporated herein by reference), comprising deletion
and/or inactivation of at least one cdh gene, and further
comprising deletion of at least one polynucleotide sequence
selected from SEQ ID NOS:1, 3, 4, and/or 6. In some embodiments,
the Myceliophthora (e.g., M. thermophila) is a deletion strain
comprising deletion of at least one polynucleotide sequence
selected from SEQ ID NOS:1, 3, 4, and/or 6. In some additional
embodiments, the Myceliophthora (e.g., M. thermophila) is a strain
described in U.S. Pat. No. 8,236,551 and/or WO 2012/061382 (both of
which are incorporated herein by reference), comprising deletion
and/or inactivation of at least one cdh gene, and further
comprising deletion of at least one polynucleotide sequence
selected from SEQ ID NOS:1, 3, 4, and/or 6.
[0082] As used herein, "gene inactivation" refers to any alteration
results in greatly reduced or the absence of gene expression. The
term encompasses any embodiment in which at least one gene is
inactivated by any means, including but not limited to deletion,
alterations, promoter alterations, antisense RNA, dsRNA, etc. In
some embodiments, the Myceliophthora (e.g., M. thermophila)
comprises a strain comprising inactivation of at least one gene
encoding at least one protease selected from Protease #1, Protease
#2, Protease #3, and/or Protease #4. In some embodiments, the
Myceliophthora (e.g., M. thermophila) is a strain comprising
inactivation of at least one polynucleotide sequence selected from
SEQ ID NOS:1, 3, 4, and/or 6. In some embodiments, the
Myceliophthora (e.g., M. thermophila) comprises a strain described
in U.S. Pat. No. 8,236,551 and/or WO 2012/061382, comprising
deletion and/or inactivation of at least one cdh gene, and further
comprising inactivation of at least one gene encoding at least one
protease selected from Protease #1, Protease #2, Protease #3,
and/or Protease #4. In some additional embodiments, the
Myceliophthora (e.g., M. thermophila) is a strain described in U.S.
Pat. No. 8,236,551 and/or WO 2012/061382 (both of which are
incorporated herein by reference), comprising deletion and/or
inactivation of at least one cdh gene, and further comprising
inactivation of at least one polynucleotide sequence selected from
SEQ ID NOS:1, 3, 4, and/or 6.
[0083] As used herein, "fragment" refers to a polypeptide that has
an amino-terminal and/or carboxy-terminal and/or internal deletion,
as compared to a reference polypeptide, but where the remaining
amino acid sequence is identical to the corresponding positions in
the reference sequence. Fragments can typically have about 60%,
about 65%, about 70%, about 75%, about 80%, about 85%, about 86%,
about 87%, about 88%, about 89%, about 90%, about 91%, about 92%,
about 93%, about 94%, about 95%, about 96%, about 97%, about 98%,
or about 99% of the full-length of at least one protease
polypeptide, for example the polypeptide of SEQ ID NOS:2, 4 and/or
6. In some instances, the sequences of the non-naturally occurring
and wild-type at least one protease polypeptide disclosed herein
include an initiating methionine (M) residue (i.e., M at position
1). However, the skilled artisan will recognize that this
initiating methionine residue can be removed during the course of
biological processing of the enzyme, such as in a host cell or in
vitro translation system, to generate a mature enzyme lacking the
initiating methionine residue, but otherwise retaining the enzyme's
properties. Thus, for each of the protease polypeptides disclosed
herein having an amino acid sequence comprising an initiating
methionine, the present disclosure also encompasses the polypeptide
with the initiating methionine residue deleted (i.e., a fragment of
the at least one protease polypeptide lacking a methionine at
position 1).
[0084] As used herein, the term "biologically active fragment,"
refers to a polypeptide that has an amino-terminal and/or
carboxy-terminal deletion(s) and/or internal deletion(s), but where
the remaining amino acid sequence is identical to the corresponding
positions in the sequence to which it is being compared (e.g., a
full-length protease of the present invention) and that retains
substantially all of the activity of the full-length polypeptide.
In some embodiments, the biologically active fragment is a
biologically active protease fragment. A biologically active
fragment can comprise about 60%, about 65%, about 70%, about 75%,
about 80%, about 85%, at about 90%, about 91%, about 92%, about
93%, about 94%, about 95%, about 96%, about 97%, about 98%, or
about 99% of a full-length protease polypeptide
[0085] As used herein, "protein of interest" and "polypeptide of
interest" refer to a protein/polypeptide that is desired and/or
being assessed. In some embodiments, the protein of interest is
expressed intracellularly, while in other embodiments, it is a
secreted polypeptide. In some embodiments, these protein of
interest is an enzyme, including but not limited to the enzymes
described herein (e.g., a protease). In some embodiments, the
protein of interest is a secreted polypeptide which is fused to a
signal peptide (i.e., an amino-terminal extension on a protein to
be secreted). Nearly all secreted proteins use an amino-terminal
protein extension which plays a crucial role in the targeting to
and translocation of precursor proteins across the membrane. This
extension is proteolytically removed by a signal peptidase during
or immediately following membrane transfer.
[0086] A polynucleotide is said to "encode" an RNA or a polypeptide
if, in its native state or when manipulated by methods known to
those of skill in the art, it can be transcribed and/or translated
to produce the RNA, the polypeptide or a fragment thereof. The
anti-sense strand of such a nucleic acid is also said to encode the
sequences. As is known in the art, DNA can be transcribed by an RNA
polymerase to produce RNA, but RNA can be reverse transcribed by
reverse transcriptase to produce a DNA. Thus, a DNA molecule can
effectively encode an RNA molecule and vice versa.
[0087] As used herein, "host strain" and "host cell" refers to a
suitable host for an expression vector comprising DNA. The "host
cells" used in the present invention generally are prokaryotic or
eukaryotic hosts which preferably have been manipulated by methods
known to those skilled in the art. In some embodiments, host cells
are transformed with vectors constructed using recombinant DNA
techniques. Such transformed host cells are capable of either
replicating vectors encoding protein variant(s) and/or expressing
the desired protein variant(s). In the case of vectors which encode
the pre- or prepro-form of the protein variant, such variants, when
expressed, are typically secreted from the host cell into the host
cell medium.
[0088] As used herein, "naturally-occurring enzyme" refers to an
enzyme having the unmodified amino acid sequence identical to that
found in nature (i.e., "wild-type"). Naturally occurring enzymes
include native enzymes (i.e., those enzymes naturally expressed or
found in the particular microorganism).
[0089] The terms "wild-type sequence" and "naturally-occurring
sequence" are used interchangeably herein, to refer to a
polypeptide or polynucleotide sequence that is native or naturally
occurring in a host cell. In some embodiments, the wild-type
sequence refers to a sequence of interest that is the starting
point of a protein engineering project. The wild-type sequence may
encode either a homologous or heterologous protein.
[0090] As used herein, the terms "isolated" and "purified" refer to
a material that is removed from its original environment (e.g., the
natural environment, if it is naturally occurring). For example,
the material is said to be "purified" when it is present in a
particular composition in a higher or lower concentration than
exists in a naturally-occurring or wild-type organism or in
combination with components not normally present upon expression
from a naturally-occurring or wild-type organism. For example, a
naturally-occurring polynucleotide or polypeptide present in a
living animal is not isolated, but the same polynucleotide or
polypeptide, separated from some or all of the coexisting materials
in the natural system, is isolated. In some embodiments, such
polynucleotides are part of a vector, and/or such polynucleotides
or polypeptides are part of a composition, and still considered to
be isolated, in that such vector or composition is not part of its
natural environment. In some embodiments, a nucleic acid or protein
is said to be purified, for example, if it gives rise to
essentially one band in an electrophoretic gel or blot. In some
embodiments, the terms "isolated" and "purified" are used to refer
to a molecule (e.g., an isolated nucleic acid, polypeptide, etc.)
or other component that is removed from at least one other
component with which it is naturally associated. In some
embodiments, the term "isolated" refers to a nucleic acid,
polypeptide, or other component that is partially or completely
separated from components with which it is normally associated in
nature. Thus, the term encompasses a substance in a form or
environment that does not occur in nature. Non-limiting examples of
isolated substances include, but are not limited to: any
non-naturally occurring substance; any substance including, but not
limited to, any enzyme, variant, polynucleotide, protein, peptide
or cofactor, that is at least partially removed from one or more or
all of the naturally occurring constituents with which it is
associated in nature; any substance modified by the hand of man
relative to that substance found in nature; and/or any substance
modified by increasing the amount of the substance relative to
other components with which it is naturally associated (e.g.,
multiple copies of a gene encoding the substance; and/or use of a
stronger promoter than the promoter naturally associated with the
gene encoding the substance). In some embodiments, a polypeptide of
interest is used in industrial applications in the form of a
fermentation broth product (i.e., the polypeptide is a component of
a fermentation broth) used as a product in industrial applications
such as ethanol production. In some embodiments, in addition to the
polypeptide of interest (e.g., an EG1b polypeptide), the
fermentation broth product further comprises ingredients used in
the fermentation process (e.g., cells, including the host cells
containing the gene encoding the polypeptide of interest and/or the
polypeptide of interest), cell debris, biomass, fermentation media,
and/or fermentation products. In some embodiments, the fermentation
broth is optionally subjected to one or more purification steps
(e.g., filtration) to remove or reduce at least one components of a
fermentation process. Accordingly, in some embodiments, an isolated
substance is present in such a fermentation broth product.
[0091] The terms "purification" and "isolation" when used in
reference to an enzyme (e.g., at least one protease), mean that the
enzyme is altered from its natural state by virtue of separating
the enzyme from some or all of the naturally occurring constituents
with which it is associated in nature. This may be accomplished by
any suitable art-recognized separation technique, including but not
limited to ion exchange chromatography, affinity chromatography,
hydrophobic separation, dialysis, protease treatment, ammonium
sulphate precipitation or other protein salt precipitation,
centrifugation, size exclusion chromatography, filtration,
microfiltration, gel electrophoresis, separation on a gradient or
any other suitable methods, to remove whole cells, cell debris,
impurities, extraneous proteins, or enzymes undesired in the final
composition. It is further possible to then add constituents to an
enzyme-containing composition which provide additional benefits,
for example, activating agents, anti-inhibition agents, desirable
ions, compounds to control pH, other enzymes, etc.
[0092] The term "isolated," when used in reference to a DNA
sequence, refers to a DNA sequence that has been removed from its
natural genetic milieu and is thus free of other extraneous or
unwanted coding sequences, and is in a form suitable for use within
genetically engineered protein production systems. Such isolated
molecules are those that are separated from their natural
environment and include cDNA and genomic clones. Isolated DNA
molecules of the present invention are free of other genes with
which they are ordinarily associated, but may include naturally
occurring 5' and 3' untranslated regions (e.g., promoters and
terminators). The identification of associated regions will be
evident to one of ordinary skill in the art (See e.g., Dynan and
Tijan, Nature 316:774-78 [1985]). The term "an isolated DNA
sequence" is alternatively referred to as "a cloned DNA
sequence."
[0093] The term "isolated," when used in reference to a protein,
refers to a protein that is found in a condition other than its
native environment. In some embodiments, the isolated protein is
substantially free of other proteins, particularly other homologous
proteins. An isolated protein is more than about 10% pure,
preferably more than about 20% pure, and even more preferably more
than about 30% pure, as determined by SDS-PAGE. Further aspects of
the invention encompass the protein in a highly purified form
(i.e., more than about 40% pure, more than about 50% pure, more
than about 55% pure, more than about 60% pure, more than about 65%
pure, more than about 70% pure, more than about 75% pure, more than
about 80% pure, more than about 85% pure, more than about 90% pure,
more than about 95% pure, more than about 96% pure, more than about
97% pure, more than about 98% pure, or even more than about 99%
pure), as determined by SDS-PAGE.
[0094] As used herein, the phrase "substantially pure polypeptide"
refers to a composition in which the polypeptide species is the
predominant species present (i.e., on a molar or weight basis, it
is more abundant than any other individual macromolecular species
in the composition), and is generally a substantially purified
composition when the object species comprises at least about 50
percent of the macromolecular species present by mole or % weight.
Generally, a substantially pure enzyme composition will comprise
about 60% or more, about 65% or more, about 70% or more, about 75%
or more, about 80% or more, about 85% or more, about 90% or more,
about 95% or more, about 96% or more, about 97% or more, about 98%,
or about 99% or more, or more of all macromolecular species by mole
or percent weight present in the composition. Solvent species,
small molecules (<500 Daltons), and elemental ion species are
not considered macromolecular species.
[0095] As used herein, the term "starting gene" refers to a gene of
interest that encodes a protein of interest that is to be improved,
deleted, mutated, and/or otherwise changed using the present
invention.
[0096] The term "property" and grammatical equivalents thereof in
the context of a nucleic acid, as used herein, refer to any
characteristic or attribute of a nucleic acid that can be selected
or detected. These properties include, but are not limited to, a
property affecting binding to a polypeptide, a property conferred
on a cell comprising a particular nucleic acid, a property
affecting gene transcription (e.g., promoter strength, promoter
recognition, promoter regulation, and/or enhancer function), a
property affecting RNA processing (e.g., RNA splicing, RNA
stability, RNA conformation, and/or post-transcriptional
modification), a property affecting translation (e.g., level,
regulation, binding of mRNA to ribosomal proteins, and/or
post-translational modification). For example, a binding site for a
transcription factor, polymerase, regulatory factor, etc., of a
nucleic acid may be altered to produce desired characteristics or
to identify undesirable characteristics.
[0097] The term "property" and grammatical equivalents thereof in
the context of a polypeptide (including proteins), as used herein,
refer to any characteristic or attribute of a polypeptide that can
be selected or detected. These properties include, but are not
limited to oxidative stability, substrate specificity, catalytic
activity, thermal stability, alkaline stability, pH activity
profile, resistance to proteolytic degradation, k.sub.m, h.sub.cat,
k.sub.cat/k.sub.m ratio, protein folding, inducing an immune
response, not inducing an immune response, ability to bind to a
ligand, ability to bind to a receptor, ability to be secreted,
ability to be displayed on the surface of a cell, ability to
oligomerize, ability to signal, ability to stimulate cell
proliferation, ability to inhibit cell proliferation, ability to
induce apoptosis, ability to be modified by phosphorylation or
glycosylation, and/or ability to treat disease, etc. Indeed, it is
not intended that the present invention be limited to any
particular property.
[0098] As used herein, the term "screening" has its usual meaning
in the art and is, in general a multi-step process. In the first
step, a mutant nucleic acid or variant polypeptide is provided. In
the second step, a property of the mutant nucleic acid or variant
polypeptide is determined. In the third step, the determined
property is compared to a property of the corresponding precursor
nucleic acid, to the property of the corresponding naturally
occurring polypeptide or to the property of the starting material
(e.g., the initial sequence) for the generation of the mutant
nucleic acid. It will be apparent to the skilled artisan that the
screening procedure for obtaining a nucleic acid or protein with an
altered property depends upon the property of the starting
material, and the modification of which the generation of the
mutant nucleic acid is intended to facilitate. The skilled artisan
will therefore appreciate that the invention is not limited to any
specific property to be screened for and that the following
description of properties lists illustrative examples only. Methods
for screening for any particular property are generally described
in the art. For example, one can measure binding, pH optima,
specificity, etc., before and after mutation, wherein a change
indicates an alteration. In some embodiments, the screens are
performed in a high-throughput manner, including multiple samples
being screened simultaneously, including, but not limited to assays
utilizing chips, phage display, multiple substrates and/or
indicators, and/or any other suitable method known in the art. As
used in some embodiments, screens encompass selection steps in
which variants of interest are enriched from a population of
variants. It is intended that the term encompass any suitable means
for selection. Indeed, it is not intended that the present
invention be limited to any particular method of screening.
[0099] As used herein, the term "targeted randomization" refers to
a process that produces a plurality of sequences where one or
several positions have been randomized. In some embodiments,
randomization is complete (i.e., all four nucleotides, A, T, G, and
C can occur at a randomized position). In some alternative
embodiments, randomization of a nucleotide is limited to a subset
of the four nucleotides. Targeted randomization can be applied to
one or several codons of a sequence, coding for one or several
proteins of interest. When expressed, the resulting libraries
produce protein populations in which one or more amino acid
positions can contain a mixture of all 20 amino acids or a subset
of amino acids, as determined by the randomization scheme of the
randomized codon. In some embodiments, the individual members of a
population resulting from targeted randomization differ in the
number of amino acids, due to targeted or random insertion or
deletion of codons. In some further embodiments, synthetic amino
acids are included in the protein populations produced. In some
additional embodiments, the majority of members of a population
resulting from targeted randomization show greater sequence
homology to the consensus sequence than the starting gene. In some
embodiments, the sequence encodes one or more proteins of interest.
In some alternative embodiments, the proteins have differing
biological functions.
[0100] The terms "modified nucleic acid sequence" and "modified
genes" are used interchangeably herein to refer to a nucleic acid
sequence that includes a deletion, insertion, substitution or any
other change and/or interruption of the naturally occurring nucleic
acid sequence. In some embodiments, the expression product of the
modified sequence is a truncated protein (e.g., if the modification
is a deletion or interruption in the sequence). In some
embodiments, the truncated protein retains biological activity. In
some alternative embodiments, the expression product of the
modified sequence is an elongated protein (e.g., modifications
comprising an insertion into the nucleic acid sequence). In some
further embodiments, an insertion leads to a truncated protein
(e.g., when the insertion results in the formation of a stop
codon). Thus, an insertion may result in either a truncated protein
or an elongated protein as an expression product.
[0101] As used herein, the terms "mutant nucleic acid sequence,"
"mutant nucleotide sequence," and "mutant gene" are used
interchangeably in reference to a nucleotide sequence that has an
alteration in at least one codon occurring in a host cell's
wild-type nucleotide sequence. The expression product of the mutant
sequence is a protein with an altered amino acid sequence relative
to the wild-type. In some embodiments, the expression product has
an altered functional capacity (e.g., enhanced enzymatic
activity).
[0102] As used herein, the term "degenerate codon" refers to a
codon used to represent a set of different codons (also referred to
as an "ambiguous codon"). For example, the degenerate codon "NNT"
represents a set of 16 codons having the base triplet sequence (A,
C, T, or G)/(A, C, T, or G)/T.
[0103] As used herein, "coding sequence" refers to that portion of
a polynucleotide that encodes an amino acid sequence of a protein
(e.g., a gene).
[0104] As used herein, the term "antibodies" refers to
immunoglobulins. Antibodies include but are not limited to
immunoglobulins obtained directly from any species from which it is
desirable to obtain antibodies. In addition, the present invention
encompasses modified antibodies. The term also refers to antibody
fragments that retain the ability to bind to the epitope that the
intact antibody binds and includes polyclonal antibodies,
monoclonal antibodies, chimeric antibodies, anti-idiotype (anti-ID)
antibodies. Antibody fragments include, but are not limited to the
complementarity-determining regions (CDRs), single-chain fragment
variable regions (scFv), heavy chain variable region (VH), and
light chain variable region (VL) fragments.
[0105] As used herein, the term "oxidation stable" refers to
enzymes of the present invention that retain a specified amount of
enzymatic activity over a given period of time under conditions
prevailing during the use of the invention, for example while
exposed to or contacted with oxidizing agents. In some embodiments,
the enzymes retain at least about 50%, about 60%, about 70%, about
75%, about 80%, about 85%, about 90%, about 92%, about 95%, about
96%, about 97%, about 98%, or about 99% enzymatic activity after
contact with an oxidizing agent over a given time period, for
example, at least about 1 minute, about 3 minutes, about 5 minutes,
about 8 minutes, about 12 minutes, about 16 minutes, about 20
minutes, etc.
[0106] As used herein, the terms "thermally stable" and
"thermostable" refer to enzymes of the present invention that
retain a specified amount of enzymatic activity after exposure to
identified temperatures over a given period of time under
conditions prevailing during the use of the enzyme, for example,
when exposed to altered temperatures. "Altered temperatures"
include increased or decreased temperatures. In some embodiments,
the enzymes retain at least about 50%, about 60%, about 70%, about
75%, about 80%, about 85%, about 90%, about 92%, about 95%, about
96%, about 97%, about 98%, or about 99% enzymatic activity after
exposure to altered temperatures over a given time period, for
example, at least about 60 minutes, about 120 minutes, about 180
minutes, about 240 minutes, about 300 minutes, etc.
[0107] As used herein, the term "thermophilic fungus" refers to any
fungus which exhibits optimum growth at a temperature of at least
about 35.degree. C., and generally below about 100.degree. C., such
as for example between about 35.degree. C. to about 80.degree. C.,
between about 35.degree. C. to about 75.degree. C., between about
40.degree. C. to about 65.degree. C., or between about 40.degree.
C. to about 60.degree. C. Typically, the optimum growth is
exhibited at a temperature of at least about 35.degree. to about
60.degree. C.
[0108] As used herein, "solvent stable" refers to a polypeptide
that maintains similar activity (more than for example, about 60%
to about 80%) after exposure to varying concentrations (e.g., about
5 to about 99%) of a non-aqueous solvent (e.g., isopropyl alcohol,
tetrahydrofuran, 2-methyltetrahydrofuran, acetone, toluene,
butylacetate, methyl tert-butylether, etc.) for a period of time
(e.g., about 0.5 to about 24 hrs) compared to a reference
polypeptide.
[0109] As used herein, "pH stable" refers to a polypeptide that
maintains similar activity (more than for example, about 60% to
about 80%) after exposure to low or high pH (e.g., about 4.5 to
about 6, or about 8 to about 12) for a period of time (e.g., 0.5-24
hrs) compared to a reference polypeptide.
[0110] As used herein, the term "enhanced stability" in the context
of an oxidation, chelator, thermal and/or pH stable enzyme refers
to a higher retained enzymatic activity over time as compared to
other enzymes and/or wild-type enzymes.
[0111] As used herein, the term "diminished stability" in the
context of an oxidation, chelator, thermal and/or pH stable enzyme
refers to a lower retained enzymatic activity over time as compared
to other enzymes and/or wild-type enzymes.
[0112] As used herein, "secreted activity" refers to enzymatic
activity of at least one protease enzymes produced by a fungal cell
that is present in an extracellular environment. An extracellular
environment can be, for example, an extracellular milieu such as a
culture medium. The secreted activity is influenced by the total
amount of at least one protease secreted, and also is influenced by
the catalytic efficiency of the secreted at least one protease.
[0113] As used herein, a "protease that is secreted by a cell" is a
protease produced by the cell in a manner such that the protease is
exported across the cell membrane and then subsequently released
into the extracellular milieu, such as into culture media.
[0114] As used herein, the term "culturing" refers to growing a
population of microbial cells under suitable conditions in a liquid
or solid medium.
[0115] The terms "biomass," and "biomass substrate," encompass any
suitable materials for use in saccharification reactions. The terms
encompass, but are not limited to materials that comprise cellulose
(i.e., "cellulosic biomass," "cellulosic feedstock," and
"cellulosic substrate"). Biomass can be derived from plants,
animals, or microorganisms, and may include, but is not limited to
agricultural, industrial, and forestry residues, industrial and
municipal wastes, and terrestrial and aquatic crops grown for
energy purposes. Examples of biomass substrates include, but are
not limited to, wood, wood pulp, paper pulp, corn fiber, corn
grain, corn cobs, crop residues such as corn husks, corn stover,
grasses, wheat, wheat straw, barley, barley straw, hay, rice, rice
straw, switchgrass, waste paper, paper and pulp processing waste,
woody or herbaceous plants, fruit or vegetable pulp, distillers
grain, grasses, rice hulls, cotton, hemp, flax, sisal, sugar cane
bagasse, sorghum, soy, switchgrass, components obtained from
milling of grains, trees, branches, roots, leaves, wood chips,
sawdust, shrubs and bushes, vegetables, fruits, and flowers and any
suitable mixtures thereof. In some embodiments, the biomass
comprises, but is not limited to cultivated crops (e.g., grasses,
including C4 grasses, such as switch grass, cord grass, rye grass,
miscanthus, reed canary grass, or any combination thereof), sugar
processing residues, for example, but not limited to, bagasse
(e.g., sugar cane bagasse, beet pulp [e.g., sugar beet], or a
combination thereof), agricultural residues (e.g., soybean stover,
corn stover, corn fiber, rice straw, sugar cane straw, rice, rice
hulls, barley straw, corn cobs, wheat straw, canola straw, oat
straw, oat hulls, corn fiber, hemp, flax, sisal, cotton, or any
combination thereof), fruit pulp, vegetable pulp, distillers'
grains, forestry biomass (e.g., wood, wood pulp, paper pulp,
recycled wood pulp fiber, sawdust, hardwood, such as aspen wood,
softwood, or a combination thereof). Furthermore, in some
embodiments, the biomass comprises cellulosic waste material and/or
forestry waste materials, including but not limited to, paper and
pulp processing waste, municipal paper waste, newsprint, cardboard
and the like. In some embodiments, biomass comprises one species of
fiber, while in some alternative embodiments, the biomass comprises
a mixture of fibers that originate from different biomasses. In
some embodiments, the biomass may also comprise transgenic plants
that express ligninase and/or cellulase enzymes (See e.g., US
2008/0104724 A1).
[0116] A biomass substrate is said to be "pretreated" when it has
been processed by some physical and/or chemical means to facilitate
saccharification. As described further herein, in some embodiments,
the biomass substrate is "pretreated," or treated using methods
known in the art, such as chemical pretreatment (e.g., ammonia
pretreatment, dilute acid pretreatment, dilute alkali pretreatment,
or solvent exposure), physical pretreatment (e.g., steam explosion
or irradiation), mechanical pretreatment (e.g., grinding or
milling) and biological pretreatment (e.g., application of
lignin-solubilizing microorganisms) and combinations thereof, to
increase the susceptibility of cellulose to hydrolysis. Thus, the
term "biomass" encompasses any living or dead biological material
that contains a polysaccharide substrate, including but not limited
to cellulose, starch, other forms of long-chain carbohydrate
polymers, and mixtures of such sources. It may or may not be
assembled entirely or primarily from glucose or xylose, and may
optionally also contain various other pentose or hexose monomers.
Xylose is an aldopentose containing five carbon atoms and an
aldehyde group. It is the precursor to hemicellulose, and is often
a main constituent of biomass. In some embodiments, the substrate
is slurried prior to pretreatment. In some embodiments, the
consistency of the slurry is between about 2% and about 30% and
more typically between about 4% and about 15%. In some embodiments,
the slurry is subjected to a water and/or acid soaking operation
prior to pretreatment. In some embodiments, the slurry is dewatered
using any suitable method to reduce steam and chemical usage prior
to pretreatment. Examples of dewatering devices include, but are
not limited to pressurized screw presses (See e.g., WO 2010/022511,
incorporated herein by reference) pressurized filters and
extruders.
[0117] In some embodiments, the pretreatment is carried out to
hydrolyze hemicellulose, and/or a portion thereof present in the
cellulosic substrate to monomeric pentose and hexose sugars (e.g.,
xylose, arabinose, mannose, galactose, and/or any combination
thereof). In some embodiments, the pretreatment is carried out so
that nearly complete hydrolysis of the hemicellulose and a small
amount of conversion of cellulose to glucose occurs. In some
embodiments, an acid concentration in the aqueous slurry from about
0.02% (w/w) to about 2% (w/w), or any amount therebetween, is
typically used for the treatment of the cellulosic substrate. Any
suitable acid finds use in these methods, including but not limited
to, hydrochloric acid, nitric acid, and/or sulfuric acid. In some
embodiments, the acid used during pretreatment is sulfuric acid.
Steam explosion is one method of performing acid pretreatment of
biomass substrates (See e.g., U.S. Pat. No. 4,461,648). Another
method of pretreating the slurry involves continuous pretreatment
(i.e., the cellulosic biomass is pumped though a reactor
continuously). This methods are well-known to those skilled in the
art (See e.g., U.S. Pat. No. 7,754,457).
[0118] In some embodiments, alkali is used in the pretreatment. In
contrast to acid pretreatment, pretreatment with alkali may not
hydrolyze the hemicellulose component of the biomass. Rather, the
alkali reacts with acidic groups present on the hemicellulose to
open up the surface of the substrate. In some embodiments, the
addition of alkali alters the crystal structure of the cellulose so
that it is more amenable to hydrolysis. Examples of alkali that
find use in the pretreatment include, but are not limited to
ammonia, ammonium hydroxide, potassium hydroxide, and sodium
hydroxide. One method of alkali pretreatment is Ammonia Freeze
Explosion, Ammonia Fiber Explosion or Ammonia Fiber Expansion
("AFEX" process; See e.g., U.S. Pat. Nos. 5,171,592; 5,037,663;
4,600,590; 6,106,888; 4,356,196; 5,939,544; 6,176,176; 5,037,663
and 5,171,592). During this process, the cellulosic substrate is
contacted with ammonia or ammonium hydroxide in a pressure vessel
for a sufficient time to enable the ammonia or ammonium hydroxide
to alter the crystal structure of the cellulose fibers. The
pressure is then rapidly reduced, which allows the ammonia to flash
or boil and explode the cellulose fiber structure. In some
embodiments, the flashed ammonia is then recovered using methods
known in the art. In some alternative methods, dilute ammonia
pretreatment is utilized. The dilute ammonia pretreatment method
utilizes more dilute solutions of ammonia or ammonium hydroxide
than AFEX (See e.g., WO2009/045651 and US 2007/0031953). This
pretreatment process may or may not produce any
monosaccharides.
[0119] An additional pretreatment process for use in the present
invention includes chemical treatment of the cellulosic substrate
with organic solvents, in methods such as those utilizing organic
liquids in pretreatment systems (See e.g., U.S. Pat. No. 4,556,430;
incorporated herein by reference). These methods have the advantage
that the low boiling point liquids easily can be recovered and
reused. Other pretreatments, such as the Organosolv.TM. process,
also use organic liquids (See e.g., U.S. Pat. No. 7,465,791, which
is also incorporated herein by reference). Subjecting the substrate
to pressurized water may also be a suitable pretreatment method
(See e.g., Weil et al. (1997) Appl. Biochem. Biotechnol., 68(1-2):
21-40 [1997], which is incorporated herein by reference). In some
embodiments, the pretreated cellulosic biomass is processed after
pretreatment by any of several steps, such as dilution with water,
washing with water, buffering, filtration, or centrifugation, or
any combination of these processes, prior to enzymatic hydrolysis,
as is familiar to those skilled in the art. The pretreatment
produces a pretreated feedstock composition (e.g., a "pretreated
feedstock slurry") that contains a soluble component including the
sugars resulting from hydrolysis of the hemicellulose, optionally
acetic acid and other inhibitors, and solids including unhydrolyzed
feedstock and lignin. In some embodiments, the soluble components
of the pretreated feedstock composition are separated from the
solids to produce a soluble fraction. In some embodiments, the
soluble fraction, including the sugars released during pretreatment
and other soluble components (e.g., inhibitors), is then sent to
fermentation. However, in some embodiments in which the
hemicellulose is not effectively hydrolyzed during the pretreatment
one or more additional steps are included (e.g., a further
hydrolysis step(s) and/or enzymatic treatment step(s) and/or
further alkali and/or acid treatment) to produce fermentable
sugars. In some embodiments, the separation is carried out by
washing the pretreated feedstock composition with an aqueous
solution to produce a wash stream and a solids stream comprising
the unhydrolyzed, pretreated feedstock. Alternatively, the soluble
component is separated from the solids by subjecting the pretreated
feedstock composition to a solids-liquid separation, using any
suitable method (e.g., centrifugation, microfiltration, plate and
frame filtration, cross-flow filtration, pressure filtration,
vacuum filtration, etc.). Optionally, in some embodiments, a
washing step is incorporated into the solids-liquids separation. In
some embodiments, the separated solids containing cellulose, then
undergo enzymatic hydrolysis with cellulase enzymes in order to
convert the cellulose to glucose. In some embodiments, the
pretreated feedstock composition is fed into the fermentation
process without separation of the solids contained therein. In some
embodiments, the unhydrolyzed solids are subjected to enzymatic
hydrolysis with cellulase enzymes to convert the cellulose to
glucose after the fermentation process. In some embodiments, the
pretreated cellulosic feedstock is subjected to enzymatic
hydrolysis with cellulase enzymes.
[0120] Lignocellulose (also "lignocellulosic biomass") comprises a
matrix of cellulose, hemicellulose and lignin Economic production
of biofuels from lignocellulosic biomass typically involves
conversion of the cellulose and hemicellulose components to
fermentable sugars, typically monosaccharides such as glucose (from
the cellulose) and xylose and arabinose (from the hemicelluloses).
Nearly complete conversion can be achieved by a chemical
pretreatment of the lignocellulose followed by enzymatic hydrolysis
with cellulase enzymes. The chemical pretreatment step renders the
cellulose more susceptible to enzymatic hydrolysis and in some
cases, also hydrolyzes the hemicellulose component. Numerous
chemical pretreatment processes known in the art find use in the
present invention, and include, but are not limited to, mild acid
pretreatment at high temperatures and dilute acid, ammonium
pretreatment and/or organic solvent extraction.
[0121] Lignin is a more complex and heterogeneous biopolymer than
either cellulose or hemicellulose and comprises a variety of
phenolic subunits. Enzymatic lignin depolymerization can be
accomplished by lignin peroxidases, manganese peroxidases,
laccases, esterases, and/or cellobiose dehydrogenases (CDH), often
working in synergy. However, as the name suggests, CDH enzymes also
oxidize cellobiose to cellobionolactone. Several reports indicate
that the oxidation of cellobiose by CDH enhances the rate of
cellulose hydrolysis by cellulases by virtue of reducing the
concentrations of cellobiose, which is a potent inhibitor of some
cellulase components (See e.g., Mansfield et al., Appl. Environ.
Microbiol., 63: 3804-3809 [1997]; and Igarishi et al., Eur. J.
Biochem., 253:101-106 [1998]). Recently, it has been reported that
CDHs can enhance the activity of cellulolytic enhancing proteins
from Glycosyl Hydrolase family 61 (See e.g., WO2010/080532A1).
[0122] Thus, as used herein, the term "lignocellulosic biomass"
refers to any plant biomass comprising cellulose and hemicellulose,
bound to lignin. In some embodiments, the biomass may optionally be
pretreated to increase the susceptibility of cellulose to
hydrolysis by chemical, physical and biological pretreatments (such
as steam explosion, pulping, grinding, acid hydrolysis, solvent
exposure, and the like, as well as combinations thereof). Various
lignocellulosic feedstocks find use, including those that comprise
fresh lignocellulosic feedstock, partially dried lignocellulosic
feedstock, fully dried lignocellulosic feedstock, and/or any
combination thereof. In some embodiments, lignocellulosic
feedstocks comprise cellulose in an amount greater than about 20%,
more preferably greater than about 30%, more preferably greater
than about 40% (w/w). For example, in some embodiments, the
lignocellulosic material comprises from about 20% to about 90%
(w/w) cellulose, or any amount therebetween, although in some
embodiments, the lignocellulosic material comprises less than about
19%, less than about 18%, less than about 17%, less than about 16%,
less than about 15%, less than about 14%, less than about 13%, less
than about 12%, less than about 11%, less than about 10%, less than
about 9%, less than about 8%, less than about 7%, less than about
6%, or less than about 5% cellulose (w/w). Furthermore, in some
embodiments, the lignocellulosic feedstock comprises lignin in an
amount greater than about 10%, more typically in an amount greater
than about 15% (w/w). In some embodiments, the lignocellulosic
feedstock comprises small amounts of sucrose, fructose and/or
starch. The lignocellulosic feedstock is generally first subjected
to size reduction by methods including, but not limited to,
milling, grinding, agitation, shredding, compression/expansion, or
other types of mechanical action. Size reduction by mechanical
action can be performed by any type of equipment adapted for the
purpose, for example, but not limited to, hammer mills,
tub-grinders, roll presses, refiners and hydrapulpers. In some
embodiments, at least 90% by weight of the particles produced from
the size reduction have lengths less than between about 1/16 and
about 4 in (the measurement may be a volume or a weight average
length). In some embodiments, the equipment used to reduce the
particle size reduction is a hammer mill or shredder. Subsequent to
size reduction, the feedstock is typically slurried in water, as
this facilitates pumping of the feedstock. In some embodiments,
lignocellulosic feedstocks of particle size less than about 6
inches do not require size reduction.
[0123] As used herein, the term "lignocellulosic feedstock" refers
to any type of lignocellulosic biomass that is suitable for use as
feedstock in saccharification reactions.
[0124] As used herein, the term "pretreated lignocellulosic
feedstock," refers to lignocellulosic feedstocks that have been
subjected to physical and/or chemical processes to make the fiber
more accessible and/or receptive to the actions of cellulolytic
enzymes, as described above.
[0125] As used herein, the term "recovered" refers to the
harvesting, isolating, collecting, or recovering of protein from a
cell and/or culture medium. In the context of saccharification, it
is used in reference to the harvesting the fermentable sugars
produced during the saccharification reaction from the culture
medium and/or cells. In the context of fermentation, it is used in
reference to harvesting the fermentation product from the culture
medium and/or cells. Thus, a process can be said to comprise
"recovering" a product of a reaction (such as a soluble sugar
recovered from saccharification) if the process includes separating
the product from other components of a reaction mixture subsequent
to at least some of the product being generated in the
reaction.
[0126] As used herein, the term "slurry" refers to an aqueous
solution in which are dispersed one or more solid components, such
as a cellulosic substrate.
[0127] As used herein, the term "saccharification" refers to the
process in which substrates (e.g., cellulosic biomass) are broken
down via the action of cellulases to produce fermentable sugars
(e.g. monosaccharides such as but not limited to glucose).
[0128] As used herein, the term "fermentable sugars" refers to
simple sugars (e.g., monosaccharides, disaccharides and short
oligosaccharides), including but not limited to glucose, xylose,
galactose, arabinose, mannose and sucrose. Indeed, a fermentable
sugar is any sugar that a microorganism can utilize or ferment.
[0129] As used herein the term "soluble sugars" refers to
water-soluble hexose monomers and oligomers of up to about six
monomer units.
[0130] As used herein, the term "fermentation" is used broadly to
refer to the cultivation of a microorganism or a culture of
microorganisms that use simple sugars, such as fermentable sugars,
as an energy source to obtain a desired product.
[0131] As used herein, the term "fermenting organism" refers to any
organism, including bacterial and fungal organisms such as yeast
and filamentous fungi, suitable for producing at least one desired
end product. Especially suitable fermenting organisms are able to
ferment (i.e., convert) sugars, such as glucose, fructose, maltose,
xylose, mannose and/or arabinose, directly or indirectly into a
desired end product.
[0132] As used herein, the term "cellodextrin" refers to a glucose
polymer of varying length (i.e., comprising at least two glucose
monomers). Each glucose monomer is linked via a beta-1,4 glycosidic
bond. A cellodextrin is classified by its degree of polymerization
(DP), which indicates the number of glucose monomers the
cellodextrin contains. The most common cellodextrins are:
cellobiose (DP=2); cellotriose (DP=3); cellotetrose (DP=4);
cellopentose (DP=5); and cellohexose (DP=6). In some embodiments,
cellodextrins have a DP of 2-6 (i.e., cellobiose, cellotriose,
cellotetrose, cellopentose, and/or cellohexose). In some
embodiments, cellodextrins have a DP greater than 6. The degree of
polymerization of cellodextin molecules can be measured (e.g., by
mass spectrometry, including but not limited to matrix-assisted
laser desorption/ionization (MALDI) mass spectrometry and
electrospray ionization ion trap (ESI-IT) mass spectrometry).
Methods of measuring the degree of polymerization of cellodextrin
molecules are known in the art (See e.g., Melander et al.,
Biomacromol., 7:1410-1421 [2006]).
[0133] As used herein, the term "cellulase" refers to a category of
enzymes capable of hydrolyzing cellulose (e.g., beta-1,4-glucan or
beta-D-glucosidic linkages) to shorter cellulose chains,
oligosaccharides, cellobiose and/or glucose. Cellulases, as known
in the art and as described herein, are typically found in a
mixture of different types of cellulolytic enzymes. In some
embodiments, "cellulase" includes hemicellulose-hydrolyzing enzymes
such as endoxylanase, beta-xylosidase, arabinofuranosidase,
alpha-glucuronidase, acetylxylan esterase, feruloyl esterase,
alpha-glucuronyl esterase, etc. A "cellulase-producing fungal cell"
is a fungal cell that expresses and secretes at least one cellulose
hydrolyzing enzyme. In some embodiments, the cellulase-producing
fungal cells express and secrete a mixture of cellulose hydrolyzing
enzymes. "Cellulolytic," "cellulose hydrolyzing," "cellulose
degrading," and similar terms refer to cellulase enzymes such as
endoglucanases, cellobiohydrolases (the latter are also referred to
as "exoglucanases"), and beta-glucosidases (also known as
"cellobiases") that act synergistically to break down the cellulose
first to soluble di- or oligosaccharides such as cellobiose, which
are then further hydrolyzed to glucose by beta-glucosidase.
"Cellulases" typically comprise a mixture of different types of
cellulolytic enzymes (e.g., endoglucanases, beta-glucosidases and
cellobiohydrolases, the latter are also referred to as
"exoglucanases") that act synergistically to break down the
cellulose to soluble di- or oligosaccharides such as cellobiose,
which are then further hydrolyzed to glucose by beta-glucosidase.
Cellulase enzymes are produced by a wide variety of microorganisms.
Cellulases, as well as hemicellulases from filamentous fungi and
some bacteria are widely exploited for many industrial applications
that involve processing of natural fibers to sugars.
[0134] Among the cellulase-producing filamentous fungi, there are
those that also produce a variety of enzymes involved in lignin
degradation. For example, organisms of such genera as
Myceliophthora, Chrysosporium, Sporotrichum, Thielavia,
Phanerochaete, Trichoderma and Trametes produce and secrete a
mixture of cellulases, hemicellulases and lignin degrading enzymes.
These types of organisms are commonly called "white rot fungi" by
virtue of their ability to digest lignin and to distinguish them
from the "brown rot" fungi (such as Trichoderma) which typically
cannot digest lignin.
[0135] As used herein, the terms "cellobiose dehydrogenase" and
"CDH" refer to a cellobiose:acceptor 1-oxidoreductase that
catalyzes the conversion of cellobiose in the presence of an
acceptor to cellobiono-1,5-lactone and a reduced acceptor. Examples
of cellobiose dehydrogenases are included in the enzyme
classification (E.C. 1.1.99.18).
[0136] As used herein, the term "endoglucanase" or "EG" refers to a
class of cellulases (E.C.3.2.1.4) that hydrolyze internal beta-1,4
glucosidic linkages in cellulose. The term "endoglucanase" refers
to an endo-1,4-(1,3;1,4)-beta-D-glucan 4-glucanohydrolase (E.C.
3.2.1.4), which catalyses endohydrolysis of 1,4-beta-D-glycosidic
linkages in cellulose, cellulose derivatives (such as carboxymethyl
cellulose and hydroxyethyl cellulose), lichenan, beta-1,4 bonds in
mixed beta-1,3 glucans such as cereal beta-D-glucans or
xyloglucans, and other plant material containing cellulosic
components. Endoglucanase activity can be determined based on a
reduction in substrate viscosity or increase in reducing ends
determined by a reducing sugar assay (See e.g., Zhang et al.,
Biotechnol. Adv., 24: 452-481 [2006]). In some embodiments,
endoglucanase activity is determined using carboxymethyl cellulose
(CMC) hydrolysis (See e.g., Ghose, Pure Appl. Chem., 59: 257-268
[1987]).
[0137] As used herein, "EG1" refers to a carbohydrate active enzyme
expressed from a nucleic acid sequence coding for a glycohydrolase
(GH) Family 7 catalytic domain classified under EC 3.2.1.4 or any
protein, polypeptide or catalytically active fragment thereof. In
some embodiments, the EG1 is functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding domain.
In some embodiments, the EG1 enzyme is EG1b.
[0138] As used herein, the term "EG2" refers to a carbohydrate
active enzyme expressed from a nucleic acid sequence coding for a
glycohydrolase (GH) Family 5 catalytic domain classified under EC
3.2.1.4 or any protein, polypeptide or catalytically active
fragment thereof. In some embodiments, the EG2 is functionally
linked to a carbohydrate binding module (CBM), such as a Family 1
cellulose binding domain.
[0139] As used herein, the term "EG3" refers to a carbohydrate
active enzyme expressed from a nucleic acid sequence coding for a
glycohydrolase (GH) Family 12 catalytic domain classified under EC
3.2.1.4 or any protein, polypeptide or catalytically active
fragment thereof. In some embodiments, the EG3 is functionally
linked to a carbohydrate binding module (CBM), such as a Family 1
cellulose binding domain.
[0140] As used herein, the term "EG4" refers to a carbohydrate
active enzyme expressed from a nucleic acid sequence coding for a
glycohydrolase (GH) Family 61 catalytic domain classified under EC
3.2.1.4 or any protein, polypeptide or fragment thereof. In some
embodiments, the EG4 is functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding
domain.
[0141] As used herein, the term "EG5" refers to a carbohydrate
active enzyme expressed from a nucleic acid sequence coding for a
glycohydrolase (GH) Family 45 catalytic domain classified under EC
3.2.1.4 or any protein, polypeptide or fragment thereof. In some
embodiments, the EG5 is functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding
domain.
[0142] As used herein, the term "EG6" refers to a carbohydrate
active enzyme expressed from a nucleic acid sequence coding for a
glycohydrolase (GH) Family 6 catalytic domain classified under EC
3.2.1.4 or any protein, polypeptide or fragment thereof. In some
embodiments, the EG6 is functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding
domain.
[0143] As used herein, the terms "cellobiohydrolase" and "CBH" are
defined herein as a 1,4-beta-D-glucan cellobiohydrolase (E.C.
3.2.1.91), which catalyzes the hydrolysis of 1,4-beta-D-glucosidic
linkages in cellulose, cellooligosaccharides, or any
beta-1,4-linked glucose containing polymer, releasing cellobiose
from the reducing or non-reducing ends of the chain (See e.g.,
Teeri, Trends Biotechnol., 15:160-167 [1997]; and Teeri et al.,
Biochem. Soc. Trans., 26: 173-178 [1998]). In some embodiments,
cellobiohydrolase activity is determined using a fluorescent
disaccharide derivative 4-methylumbelliferyl-.beta.-D-lactoside
(See e.g., van Tilbeurgh et al., FEBS Lett., 149: 152-156 [1982];
and van Tilbeurgh and Claeyssens, FEBS Lett., 187: 283-288
[1985]).
[0144] As used herein, the terms "CBH1" and "type 1
cellobiohydrolase" refer to a carbohydrate active enzyme expressed
from a nucleic acid sequence coding for a glycohydrolase (GH)
Family 7 catalytic domain classified under EC 3.2.1.91 or any
protein, polypeptide or catalytically active fragment thereof. In
some embodiments, the CBH1 is functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding
domain.
[0145] As used herein, the terms "CBH2" and "type 2
cellobiohydrolase" refer to a carbohydrate active enzyme expressed
from a nucleic sequence coding for a glycohydrolase (GH) Family 6
catalytic domain classified under EC 3.2.1.91 or any protein,
polypeptide or catalytically active fragment thereof. Type 2
cellobiohydrolases are also commonly referred to as "the Cel6
family." The CBH2 may be functionally linked to a carbohydrate
binding module (CBM), such as a Family 1 cellulose binding
domain.
[0146] As used herein, the terms "beta-glucosidase," "cellobiase,"
and "BGL" refers to a category of cellulases (EC 3.2.1.21) that
catalyze the hydrolysis of cellobiose to glucose. More
particularly, the term "beta-glucosidase" refers to
beta-D-glucoside glucohydrolases (E.C. 3.2.1.21), that catalyze the
hydrolysis of terminal non-reducing beta-D-glucose residues with
the release of beta-D-glucose. Beta-glucosidase activity can be
determined using any suitable method (See e.g., Venturi et al., J.
Basic Microbiol., 42: 55-66 [2002]). In some embodiments, one unit
of beta-glucosidase activity is defined as 1.0 pmole of
p-nitrophenol produced per minute at 40.degree. C., at pH 5 from 1
mM p-nitrophenyl-beta-D-glucopyranoside as substrate in 100 mM
sodium citrate containing 0.01% TWEEN.RTM.-20.
[0147] As used herein, the term "glycoside hydrolase 61" and "GH61"
refers to a category of cellulases that enhance cellulose
hydrolysis when used in conjunction with one or more additional
cellulases. The GH61 family of cellulases is described, for
example, in the Carbohydrate Active Enzymes (CAZY) database (See
e.g., Harris et al., Biochem., 49(15):3305-16 [2010]).
[0148] A "hemicellulase" as used herein, refers to a polypeptide
that can catalyze hydrolysis of hemicellulose into small
polysaccharides such as oligosaccharides, or monomeric saccharides.
Hemicellulloses include xylan, glucuonoxylan, arabinoxylan,
glucomannan and xyloglucan. Hemicellulases include, for example,
the following: endoxylanases, b-xylosidases,
a-L-arabinofuranosidases, a-D-glucuronidases, feruloyl esterases,
coumaroyl esterases, a-galactosidases, b-galactosidases,
b-mannanases, and b-mannosidases. In some embodiments, the present
invention provides enzyme mixtures that comprise one or more
hemicellulases.
[0149] As used herein, the terms "xylan degrading activity" and
"xylanolytic activity" are defined as biological activities that
hydrolyze xylan-containing material. The two basic approaches for
measuring xylanolytic activity include: (1) measuring the total
xylanolytic activity, and (2) measuring the individual xylanolytic
activities (endoxylanases, beta-xylosidases, arabinofuranosidases,
alpha-glucuronidases, acetylxylan esterases, feruloyl esterases,
and alpha-glucuronyl esterases) (See e.g., Biely and Puchard, J.
Sci. Food Agricul., 86: 1636-1647 [2006]; Spanikova and Biely, FEBS
Lett., 580: 4597-4601 [2006]; and Herrmann et al., Biochem. J.,
321: 375-381 [1997]). Total xylan degrading activity can be
measured by determining the reducing sugars formed from various
types of xylan, including oat spelt, beechwood, and larchwood
xylans, or by photometric determination of dyed xylan fragments
released from various covalently dyed xylans. A commonly used total
xylanolytic activity assay is based on production of reducing
sugars from polymeric 4-O-methyl glucuronoxylan (See e.g., Bailey
et al., J. Biotechnol., 23(3): 257-270 [1992]). In some
embodiments, xylan degrading activity is determined by measuring
the increase in hydrolysis of birchwood xylan (Sigma) by
xylan-degrading enzyme(s) under the following typical conditions: 1
mL reactions, 5 mg/mL substrate (total solids), 5 mg of xylanolytic
protein/g of substrate, 50 mM sodium acetate at pH 5, 50.degree.
C., for 24 hours, and sugar analysis using p-hydroxybenzoic acid
hydrazide (PHBAH) assay (See e.g., Lever, Anal. Biochem., 47:
273-279 [1972]).
[0150] As used herein, the term "xylanase activity" is defined
herein as a 1,4-beta-D-xylan-xylohydrolase activity (E.C. 3.2.1.8)
that catalyzes the endo-hydrolysis of 1,4-beta-D-xylosidic linkages
in xylans. In some embodiments, xylanase activity is determined
using birchwood xylan as substrate. One unit of xylanase activity
is defined as 1.0 .mu.mole of reducing sugar measured in glucose
equivalents produced per minute during the initial period of
hydrolysis at 50.degree. C., at pH 5 from 2 g of birchwood xylan
per liter as substrate in 50 mM sodium acetate containing 0.01%
TWEEN.RTM.-20 (See e.g., Lever, Anal. Biochem., 47: 273-279
[1972]).
[0151] As used herein, the term "beta-xylosidase activity" is
defined herein as a beta-D-xyloside xylohydrolase (E.C. 3.2.1.37)
that catalyzes the exo-hydrolysis of short beta
(1.fwdarw.4)-xylooligosaccharides, to remove successive D-xylose
residues from the non-reducing termini. In some embodiments, one
unit of beta-xylosidase activity is defined as 1.0 .mu.mole of
p-nitrophenol produced per minute at 40.degree. C., at pH 5 from 1
mM p-nitrophenyl-beta-D-xyloside as substrate in 100 mM sodium
citrate containing 0.01% TWEEN.RTM.-20.
[0152] As used herein, the term "acetylxylan esterase activity" is
defined herein as a carboxylesterase activity (EC 3.1.1.72) that
catalyses the hydrolysis of acetyl groups from polymeric xylan,
acetylated xylose, acetylated glucose, alpha-napthyl acetate, and
p-nitrophenyl acetate. In some embodiments, acetylxylan esterase
activity is determined using 0.5 mM p-nitrophenylacetate as
substrate in 50 mM sodium acetate containing 0.01% TWEEN.RTM.-20,
at pH 5.0. One unit of acetylxylan esterase activity is defined as
the amount of enzyme capable of releasing 1 pmole of
p-nitrophenolate anion per minute at pH 5, and 25.degree. C.
[0153] As used herein, the term "feruloyl esterase activity" is
defined herein as a 4-hydroxy-3-methoxycinnamoyl-sugar hydrolase
activity (EC 3.1.1.73) that catalyzes the hydrolysis of the
4-hydroxy-3-methoxycinnamoyl (feruloyl) group from an esterified
sugar, which is usually arabinose in "natural" substrates, to
produce ferulate (4-hydroxy-3-methoxycinnamate). Feruloyl esterase
is also known as ferulic acid esterase, hydroxycinnamoyl esterase,
FAE-III, cinnamoyl ester hydrolase, FAEA, cinnAE, FAE-I, or FAE-II.
In some embodiments, feruloyl esterase activity is determined using
0.5 mM p-nitrophenylferulate as substrate in 50 mM sodium acetate,
at pH 5.0. One unit of feruloyl esterase activity equals the amount
of enzyme capable of releasing 1 .mu.mole of p-nitrophenolate anion
per minute at pH 5, and 25.degree. C.
[0154] As used herein, the term "alpha-glucuronidase activity" is
defined herein as an alpha-D-glucosiduronate glucuronohydrolase
activity (EC 3.2.1.139) that catalyzes the hydrolysis of an
alpha-D-glucuronoside to D-glucuronate and an alcohol (See e.g., de
Vries, J. Bacteriol., 180: 243-249 [1998]). One unit of
alpha-glucuronidase activity equals the amount of enzyme capable of
releasing 1 pmole of glucuronic or 4-O-methylglucuronic acid per
minute at pH 5, 40.degree. C.
[0155] As used herein, the term "alpha-L-arabinofuranosidase
activity" is defined as an alpha-L-arabinofuranoside
arabinofuranohydrolase activity (EC 3.2.1.55) that catalyzes the
hydrolysis of terminal non-reducing alpha-L-arabinofuranoside
residues in alpha-L-arabinosides. The enzyme activity acts on
alpha-L-arabinofuranosides, alpha-L-arabinans containing (1,3)-
and/or (1,5)-linkages, arabinoxylans, and arabinogalactans.
Alpha-L-arabinofuranosidase is also known as arabinosidase,
alpha-arabinosidase, alpha-L-arabinosidase,
alpha-arabinofuranosidase, arabinofuranosidase, polysaccharide
alpha-L-arabinofuranosidase, alpha-L-arabinofuranoside hydrolase,
L-arabinosidase and alpha-L-arabinanase. In some embodiments,
alpha-L-arabinofuranosidase activity is determined using 5 mg of
medium viscosity wheat arabinoxylan (Megazyme International
Ireland, Ltd., Wicklow, Ireland) per mL of 100 mM sodium acetate pH
5 in a total volume of 200 .mu.L for 30 minutes at 40.degree. C.,
followed by arabinose analysis by AMINEX.RTM.. HPX-87H column
chromatography (Bio-Rad Laboratories, Inc., Hercules, Calif.).
[0156] Enzymatic lignin depolymerization can be accomplished by
lignin peroxidases, manganese peroxidases, laccases, and/or
cellobiose dehydrogenases (CDH), often working in synergy. These
extracellular enzymes, essential for lignin degradation, are often
referred to as "lignin-modifying enzymes" or "LMEs." Three of these
enzymes comprise two glycosylated heme-containing peroxidases:
lignin peroxidase (LIP); Mn-dependent peroxidase (MNP); and, a
copper-containing phenoloxidase laccase (LCC).
[0157] As used herein, the "total available cellulose" is the
amount (wt %) of cellulose that is accessible to enzymatic
hydrolysis. Total available cellulose is typically equal to, or
very close to being equal to, the amount of initial cellulose
present in a hydrolysis reaction.
[0158] As used herein, the "residual cellulose" is the portion (wt
%) of the total available cellulose in the hydrolysis mixture that
remains unhydrolyzed. Residual cellulose can be measured directly
by, for example, IR spectroscopy, or can be measured by, for
example, measuring the amount of glucose generated by concentrated
acid hydrolysis of the residual solids.
[0159] As used herein, the "total hydrolyzed cellulose" is the
portion of the total available cellulose that is hydrolyzed in the
hydrolysis mixture. For example, the total hydrolyzed cellulose can
be calculated as the difference between the "total available
cellulose" and the "residual cellulose." The "theoretical maximum
glucose yield" is the maximum amount (wt %) of glucose that could
be produced under a given condition from the total available
cellulose.
[0160] As used herein, "Gmax" refers to the maximum amount (wt %)
of glucose that could be produced from the total hydrolyzed
cellulose. Gmax can be calculated, for example, by directly
measuring the amount of residual cellulose remaining at the end of
a reaction under a given reaction conditions, subtracting the
amount of residual cellulose from the total available cellulose to
determine the total hydrolyzed cellulose, and then calculating the
amount of glucose that could be produced from the total hydrolyzed
cellulose.
[0161] As used herein, "lipase" includes enzymes that hydrolyze
lipids, fatty acids, and acylglycerides, including
phosphoglycerides, lipoproteins, diacylglycerols, and the like. In
plants, lipids are used as structural components to limit water
loss and pathogen infection. These lipids include waxes derived
from fatty acids, as well as cutin and suberin.
[0162] As used herein, the term "C1" refers to a Chrysosporium
lucknowense fungal strain described by Garg (See, Garg,
Mycopathol., 30: 3-4 [1966]). "Chrysosporium lucknowense" includes
the strains described in U.S. Pat. Nos. 6,015,707, 5,811,381 and
6,573,086; US Pat. Pub. Nos. 2007/0238155, US 2008/0194005, US
2009/0099079; International Pat. Pub. Nos., WO 2008/073914 and WO
98/15633, and include, without limitation, Chrysosporium
lucknowense Garg 27K, VKM-F 3500 D (Accession No. VKM F-3500-D), C1
strain UV13-6 (Accession No. VKM F-3632 D), C1 strain NG7C-19
(Accession No. VKM F-3633 D), and C1 strain UV18-25 (VKM F-3631 D),
all of which have been deposited at the All-Russian Collection of
Microorganisms of Russian Academy of Sciences (VKM), Bakhurhina St.
8, Moscow, Russia, 113184, and any derivatives thereof. Although
initially described as Chrysosporium lucknowense, C1 may currently
be considered a strain of Myceliophthora thermophilia. Other C1
strains include organisms deposited under accession numbers ATCC
44006, CBS (Centraalbureau voor Schimmelcultures) 122188, CBS
251.72, CBS 143.77, CBS 272.77, and VKM F-3500D. Exemplary C1
derivatives include modified organisms in which one or more
endogenous genes or sequences have been deleted or modified and/or
one or more heterologous genes or sequences have been introduced.
Derivatives include UV18#100f .DELTA.alp1, UV18#100f .DELTA.pyr5
.DELTA.alp1, UV18#100.f .DELTA.alp1 .DELTA.pep4 .DELTA.alp2,
UV18#100.f .DELTA.pyr5 .DELTA.alp1 .DELTA.pep4 .DELTA.alp2 and
UV18#100.f .DELTA.pyr4 .DELTA.pyr5 .DELTA.alp1 .DELTA.pep4
.DELTA.alp2, as described in WO2008073914, incorporated herein by
reference.
[0163] Methods for recombinant expression of proteins in fungi and
other organisms are well known in the art, and a number of suitable
expression vectors are available or can be constructed using
routine methods. Protocols for cloning and expression in fungal
hosts and other organisms are well known in the art (See e.g., Zhu
et al., Plasmid 6:128-33 [2009]). Standard references for
techniques and protocols are widely available and known to those in
the art (See e.g., U.S. Pat. Nos. 6,015,707, 5,811,381 and
6,573,086; US Pat. Pub. Nos. US 2003/0187243, US 2007/0238155, US
2008/0194005, US 2009/0099079; WO 2008/073914 and WO 98/15633, each
of which is incorporated by reference herein for all purposes).
[0164] Mutagenesis may be performed in accordance with any of the
techniques known in the art, including random and site-specific
mutagenesis. Directed evolution can be performed with any of the
techniques known in the art to screen for improved promoter
variants including shuffling. Mutagenesis and directed evolution
methods are well known in the art (See e.g., U.S. Pat. Nos.
5,605,793, 5,830,721, 6,132,970, 6,420,175, 6,277,638, 6,365,408,
6,602,986, 7,288,375, 6,287,861, 6,297,053, 6,576,467, 6,444,468,
5,811238, 6,117,679, 6,165,793, 6,180,406, 6,291,242, 6,995,017,
6,395,547, 6,506,602, 6,519,065, 6,506,603, 6,413,774, 6,573,098,
6,323,030, 6,344,356, 6,372,497, 7,868,138, 5,834,252, 5,928,905,
6,489,146, 6,096,548, 6,387,702, 6,391,552, 6,358,742, 6,482,647,
6,335,160, 6,653,072, 6,355,484, 6,03,344, 6,319,713, 6,613,514,
6,455,253, 6,579,678, 6,586,182, 6,406,855, 6,946,296, 7,534,564,
7,776,598, 5,837,458, 6,391,640, 6,309,883, 7,105,297, 7,795,030,
6,326,204, 6,251,674, 6,716,631, 6,528,311, 6,287,862, 6,335,198,
6,352,859, 6,379,964, 7,148,054, 7,629,170, 7,620,500, 6,365,377,
6,358,740, 6,406,910, 6,413,745, 6,436,675, 6,961,664, 7,430,477,
7,873,499, 7,702,464, 7,783,428, 7,747,391, 7,747,393, 7,751,986,
6,376,246, 6,426,224, 6,423,542, 6,479,652, 6,319,714, 6,521,453,
6,368,861, 7,421,347, 7,058,515, 7,024,312, 7,620,502, 7,853,410,
7,957,912, 7,904,249, and all related non-US counterparts; Ling et
al., Anal. Biochem., 254(2):157-78 [1997]; Dale et al., Meth. Mol.
Biol., 57:369-74 [1996]; Smith, Ann. Rev. Genet, 19:423-462 [1985];
Botstein et al., Science, 229:1193-1201 [1985]; Carter, Biochem.
J., 237:1-7 [1986]; Kramer et al., Cell, 38:879-887 [1984]; Wells
et al., Gene, 34:315-323 [1985]; Minshull et al., Curr. Op. Chem.
Biol., 3:284-290 [1999]; Christians et al., Nat. Biotechnol.,
17:259-264 [1999]; Crameri et al., Nature, 391:288-291 [1998];
Crameri, et al., Nat. Biotechnol., 15:436-438 [1997]; Zhang et al.,
Proc. Nat. Acad. Sci. U.S.A., 94:4504-4509 [1997]; Crameri et al.,
Nat. Biotechnol., 14:315-319 [1996]; Stemmer, Nature, 370:389-391
[1994]; Stemmer, Proc. Nat. Acad. Sci. USA, 91:10747-10751 [1994];
WO 95/22625; WO 97/0078; WO 97/35966; WO 98/27230; WO 00/42651; WO
01/75767; and WO 2009/152336, all of which are incorporated herein
by reference).
DETAILED DESCRIPTION OF THE INVENTION
[0165] In some embodiments, the improved fungal strains find use in
hydrolyzing cellulosic material to glucose. In some embodiments,
the improved fungal strains find use in hydrolyzing lignocellulose
material. As indicated herein, the present invention provides
improved fungal strains for the conversion of cellulose to
fermentable sugars (e.g., glucose). In particular, the improved
fungal strains provided herein are genetically modified to reduce
the amount of endogenous protease activity secreted by the cells.
The present invention also provides purified enzymes produced by
the improved fungal strains provided herein.
Genetically Modified Fungal Cells
[0166] The genetically modified fungal cells provided herein
exhibit a reduction in the amount of at least one endogenous
protease activity that is secreted by the cell. It will be readily
appreciated that any suitable genetic modification known in the art
can be employed to reduce the secreted activity of at least one
endogenous protease. For example, as described below, modifications
contemplated herein include modifications that reduce the amount of
at least one protease secreted by the cell. Modifications that
reduce the amount of at least one protease expressed by the cell
are also contemplated. Additional embodiments include modifications
that reduce the transcription level of at least one protease. Still
further embodiments include the complete or partial deletion of a
gene encoding at least one protease. Other embodiments include
modifications that reduce the catalytic efficiency of at least one
protease.
[0167] In some genetically modified fungal cells provided herein,
at least one protease activity secreted by the cell is reduced by
at least about 5%, about 10%, about 15%, about 20%, about 25%,
about 30%, about 35%, about 40%, about 45%, about 50%, about 55%,
about 60%, about 65%, about 70%, about 75%, about 80%, about 85%,
about 90%, about 91%, about 92%, about 93%, about 94%, about 95%,
about 96%, about 97%, about 98%, about 99%, or more, relative to
the level of at least one protease activity secreted by the
unmodified parental fungal cell grown or cultured under essentially
the same culture conditions. In some embodiments, the genetically
modified fungal cells are Myceliophthora. In some embodiments, the
genetically modified fungal cells are M. thermophila that do not
produce at least one polypeptide selected from SEQ ID NOS:3, 6, 9,
and/or 12. In some embodiments, the gene encoding at least one
protease selected from the genes encoding Protease #1, Protease #2,
Protease #3, and/or Protease #4 has been deleted from the
Myceliophthora (e.g., M. thermophila). In some embodiments, at
least one polynucleotide sequence selected from SEQ ID NOS:1, 2, 4,
5, 7, 8, 10, and/or 11 have been deleted from the genome of the
Myceliophthora.
[0168] In some embodiments, the fungal cells of the present
invention have been genetically modified to reduce the amount of at
least one endogenous protease secreted by the cell. A reduction in
the amount of secreted protease(s) can be a complete or partial
reduction of the protease(s) secreted to the extracellular milieu.
Reduction in the amount of secreted protease(s) can be accomplished
by reducing the amount of at least one protease produced by the
cell and/or by reducing the ability of the cell to secrete at least
one protease produced by the cell. Methods for reducing the ability
of the cell to secrete a polypeptide can be performed according to
any of a variety of suitable methods known in the art (See e.g.,
Fass and Engels J. Biol. Chem., 271:15244-15252 [1996], which is
incorporated by reference herein in its entirety). For example, the
gene encoding a secreted polypeptide can be modified to delete or
inactivate a secretion signal peptide. In some embodiments, the
fungal cells have been genetically modified to disrupt the
N-terminal secretion signal peptide of at least one protease. In
some embodiments, the amount of at least one protease secreted by
the cell is reduced by at least about 5%, about 10%, about 15%,
about 20%, about 25%, about 30%, about 35%, about 40%, about 45%,
about 50%, about 55%, about 60%, about 65%, about 70%, about 75%,
about 80%, about 85%, about 90%, about 91%, about 92%, about 93%,
about 94%, about 95%, about 96%, about 97%, about 98%, about 99%,
or more, relative to the secretion of at least one protease in an
unmodified organism grown or cultured under essentially the same
culture conditions.
[0169] Furthermore, in some embodiments, the total amount of at
least one protease activity is reduced by at least about 5%, about
10%, about 15%, about 20%, about 25%, about 30%, about 35%, about
40%, about 45%, about 50%, about 55%, about 60%, about 65%, about
70%, about 75%, about 80%, about 85%, about 90%, about 91%, about
92%, about 93%, about 94%, about 95%, about 96%, about 97%, about
98%, about 99%, or more, relative to the total amount of at least
one protease secreted in an unmodified organism grown or cultured
under essentially the same culture conditions.
[0170] Decreased secretion of at least one protease can be
determined by any of a variety of suitable methods known in the art
for detection of protein or enzyme levels. For example, the levels
of at least one protease in the supernatant of a fungal culture can
be detected using Western blotting techniques, two-dimensional (2D)
gels, or any other suitable protein detection techniques.
Similarly, secreted protease activity in the supernatant of a
fungal culture can be measured using any suitable activity assay as
known in the art.
[0171] In some embodiments, the fungal cells have been genetically
modified to reduce the amount of at least one endogenous protease
expressed by the cell. As used herein, expression refers to
conversion of the information encoded in a gene to the protein
encoded by that gene. Thus, a reduction of the amount of an
expressed protease represents a reduction in the amount of the
protease that is eventually translated by the cell. In some such
embodiments, the reduction in the expression is accomplished by
reducing the amount of mRNA that is transcribed from a gene
encoding protease. In some other embodiments, the reduction in the
expression is accomplished by reducing the amount of protein that
is translated from a mRNA encoding protease.
[0172] The amount of protease expressed by the cell can be reduced
by at least about 5%, about 10%, about 15%, about 20%, about 25%,
about 30%, about 35%, about 40%, about 45%, about 50%, about 55%,
about 60%, about 65%, about 70%, about 75%, about 80%, about 85%,
about 90%, about 91%, about 92%, about 93%, about 94%, about 95%,
about 96%, about 97%, about 98%, about 99%, or more, relative to
the expression of protease in an unmodified fungal cell. In some
such embodiments, the reduction in the expression is accomplished
by reducing the amount of mRNA that is transcribed from a gene
encoding protease in an unmodified organism grown or cultured under
essentially the same culture conditions.
[0173] Furthermore, in some embodiments, a reduction in the
expression level of a protease results in at least about 5%, about
10%, about 15%, about 20%, about 25%, about 30%, about 35%, about
40%, about 45%, about 50%, about 55%, about 60%, about 65%, about
70%, about 75%, about 80%, 85% about, 90%, about 91%, about 92%,
about 93%, about 94%, about 95%, about 96%, about 97%, about 98%,
or about a 99% reduction in the total expression level of protease
activity by the fungal cell relative to an unmodified fungal cell
grown or cultured under essentially the same culture
conditions.
[0174] Decreased expression of a protease can be determined by any
of a variety of methods known in the art for detection of protein
or enzyme levels. For example, the levels of protease in the
supernatant of a fungal culture can be detected using
chromatographic methods, Western blotting techniques or any other
suitable protein detection techniques that use an antibody specific
to protease. Indeed, it is not intended that the present invention
be limited to any particular method.
[0175] Methods for reducing production of a polypeptide are well
known and can be performed using any of a variety of suitable
methods known in the art. For example, the gene encoding a secreted
polypeptide can be modified to disrupt a translation initiation
sequence such as a Shine-Delgarno sequence or a Kozak consensus
sequence. Furthermore, the gene encoding a secreted polypeptide can
be modified to introduce a frameshift mutation in the transcript
encoding the endogenous protease. It will also be recognized that
usage of uncommon codons can result in reduced expression of a
polypeptide. It will be appreciated that in some embodiments, the
gene encoding the protease has at least one nonsense mutation that
results in the translation of a truncated protein.
[0176] Other methods of reducing the amount of expressed
polypeptide include post-transcriptional RNA silencing
methodologies such as antisense RNA and RNA interference. Antisense
techniques are well-established, and include using a nucleotide
sequence complementary to the nucleic acid sequence of the gene.
More specifically, expression of at least one protease-encoding
gene by a fungal cell may be reduced or eliminated by introducing a
nucleotide sequence complementary to the nucleic acid sequence,
which may be transcribed in the cell and is capable of hybridizing
to the mRNA produced in the cell. Under conditions allowing the
complementary anti-sense nucleotide sequence to hybridize to the
mRNA, the amount of protein translated is thus reduced or
eliminated. Methods for expressing antisense RNA are known in the
art (See e.g., Ngiam et al., Appl Environ Microbiol., 66(2):775-82
[2000]; and Zrenner et al., Planta., 190(2):247-52 [1993]), both of
which are hereby incorporated by reference herein in their
entirety). In some embodiments, the mRNA is destabilized though
secondary structure changes (e.g., altered introns). In some
embodiments, destabilization occurs due to alterations in
terminators.
[0177] Furthermore, modification, downregulation or inactivation of
at least one protease encoding gene provided herein may be obtained
via RNA interference (RNAi) techniques (See e.g., Kadotani et al.
Mol. Plant. Microbe Interact., 16:769-76 [2003], which is
incorporated by reference herein in its entirety). RNA interference
methodologies include double stranded RNA (dsRNA), short hairpin
RNAs (shRNAs) and small interfering RNAs (siRNAs). Potent silencing
using dsRNA may be obtained using any suitable technique (See e.g.,
Fire et al., Nature 391:80641 [1998]). Silencing using shRNAs is
also well-established (See e.g., Paddison et al., Genes Dev.,
16:948-958 [2002]). Silencing using siRNA techniques are also known
(See e.g., Miyagishi et al., Nat. Biotechnol., 20:497-500 [2002]).
The content of each of the above-cited references is incorporated
by reference herein in its entirety.
[0178] In some embodiments, the fungal cells of the present
invention have been genetically modified to reduce the
transcription level of a gene encoding at least one endogenous
protease. As used herein, transcription and similar terms refer to
the conversion of the information encoded in a gene to an RNA
transcript. Accordingly, a reduction of the transcription level of
a protease is a reduction in the amount of RNA transcript of an RNA
coding for a protease. In some embodiments, the transcription level
is reduced by at least about 5%, about 10%, about 15%, about 20%,
about 25%, about 30%, about 35%, about 40%, about 45%, about 50%,
about 55%, about 60%, about 65%, about 70%, about 75%, about 80%,
about 85%, about 90%, about 91%, about 92%, about 93%, about 94%,
about 95%, about 96%, about 97%, about 98%, about 99%, or more,
relative to the transcription level of a protease in an unmodified
organism grown or cultured under essentially the same culture
conditions.
[0179] Furthermore, in some embodiments, a reduction in the
transcription level of a protease results in at least about 5%,
about 10%, about 15%, about 20%, about 25%, about 30%, about 35%,
about 40%, about 45%, about 50%, about 55%, about 60%, about 65%,
about 70%, about 75%, about 80%, about 85%, about 90%, about 91%,
about 92%, about 93%, about 94%, about 95%, about 96%, about 97%,
about 98%, or about a 99% reduction in the total protease secreted
by the fungal cell relative to an unmodified organism grown or
cultured under essentially the same culture conditions. Decreased
transcription can be determined by any of a variety of methods
known in the art for detection of transcription levels. For
example, the levels of transcription of a particular mRNA in a
fungal cell can be detected using quantitative RT-PCR techniques or
other RNA detection techniques that specifically detect a
particular mRNA. Methods for reducing transcription level of a gene
can be performed according to any suitable method known in the art,
and include partial or complete deletion of the gene, and
disruption or replacement of the promoter of the gene such that
transcription of the gene is greatly reduced or even inhibited. For
example, the promoter of the gene can be replaced with a weak
promoter (See e.g., U.S. Pat. No. 6,933,133, which is incorporated
by reference herein in its entirety). Thus, where the weak promoter
is operably linked with the coding sequence of an endogenous
polypeptide, transcription of that gene is greatly reduced or
inhibited.
[0180] In some embodiments, the fungal cells of the present
invention have been genetically modified to at least partially
delete a gene encoding the endogenous protease. Typically, this
deletion reduces or eliminates the total amount of endogenous
protease secreted by the fungal cell. In some embodiments, complete
or near-complete deletion of the gene sequence is contemplated.
However, a deletion mutation need not completely remove the entire
gene sequence encoding protease, in order to reduce the amount of
endogenous protease secreted by the fungal cell. For example, in
some embodiments, there is a partial deletion that removes one or
more nucleotides encoding an amino acid in a protease active site,
encoding a secretion signal, or encoding another portion of the
protease that plays a role in endogenous protease activity being
secreted by the fungal cell.
[0181] A deletion in a gene encoding protease in accordance with
the embodiments provided herein includes a deletion of one or more
nucleotides in the gene encoding the protease. In some embodiments,
there is a deletion of at least about 5%, about 10%, about 15%,
about 20%, about 25%, about 30%, about 35%, about 40%, about 45%,
about 50%, about 55%, about 60%, about 65%, about 70%, about 75%,
about 80%, about 85%, about 90%, about 91%, about 92%, about 93%,
about 94%, about 95%, about 96%, about 97%, about 98%, about 99%,
or about 100%, of the gene encoding the protease, wherein the
amount of protease secreted by the cell is reduced.
[0182] Thus, in some embodiments, the deletion results in at least
about 5%, about 10%, about 15%, about 20%, about 25%, about 30%,
about 35%, about 40%, about 45%, about 50%, about 55%, about 60%,
about 65%, about 70%, about 75%, about 80%, about 85%, about 90%,
about 91%, about 92%, about 93%, about 94%, about 95%, about 96%,
about 97%, about 98%, or about a 99% reduction in the activity of
the protease secreted by the fungal cell, relative to the activity
of protease secreted by an unmodified organism grown or cultured
under essentially the same culture conditions.
[0183] Furthermore, in some embodiments, the deletion results in at
least about 5%, about 10%, about 15%, about 20%, about 25%, about
30%, about 35%, about 40%, about 45%, about 50%, about 55%, about
60%, about 65%, about 70%, about 75%, about 80%, about 85%, about
90%, about 91%, about 92%, about 93%, about 94%, about 95%, about
96%, about 97%, about 98%, or about a 99% reduction in the total
protease secreted by the fungal cell relative to an unmodified
fungal cell grown or cultured under essentially the same culture
conditions.
[0184] Deletion of a protease gene can be detected and confirmed by
any of a variety of methods known in the art for detection of gene
deletions, including the methods provided herein. For example, gene
deletion can be confirmed using PCR amplification of the modified
genomic region. It will be appreciated that additional suitable
techniques for confirming deletion can be used and are well known,
including Southern blot techniques, DNA sequencing of the modified
genomic region, and screening for positive or negative markers
incorporated during recombination events. Indeed, any suitable
method known in the art finds use in the present invention.
[0185] Methods for complete and/or partial deletion of a gene are
well-known and the genetically modified fungal cells described
herein can be generated using any of a variety of deletion methods
known in the art that result in a reduction in the amount of at
least one endogenous protease secreted by the cells. Such methods
may advantageously include standard gene disruption using
homologous flanking markers (See e.g., Rothstein, Meth. Enzymol.,
101:202-211 [1983], incorporated herein by reference in its
entirety). Additional techniques for gene deletion include
PCR-based methods for standard deletion (See e.g., Davidson et al.,
Microbiol., 148:2607-2615 [2002], incorporated herein by reference
in its entirety).
[0186] Additional gene deletion techniques include, but are not
limited to "positive-negative" cassettes (See e.g., Chang et al.,
Proc. Natl. Acad. Sci. USA 84:4959-4963 [1987]), cre/lox based
deletion (See e.g., Florea et al., Fung. Genet. Biol., 46:721-730
[2009]), biolistic transformation to increase homologous
recombination, and Agrobacterium-mediated gene disruption.
[0187] Methods to introduce DNA or RNA into fungal cells are known
to those of skill in the art and include, but are not limited to
PEG-mediated transformation of protoplasts, electroporation,
biolistic transformation (See e.g., Davidson et al., Fung. Genet.
Biol., 29:38-48 [2000]), and Agrobacterium-mediated transformation
(See e.g., Wang et al., Curr. Genet., 56:297-307 [2010]).
[0188] Further methods for complete or partial gene deletion
include disruption of the gene. Such gene disruption techniques are
known to those of skill in the art, including, but not limited to
insertional mutagenesis, the use of transposons, and marked
integration. However, it will be appreciated that any suitable
technique that provides for disruption of the coding sequence or
any other functional aspect of a gene finds use in generating the
genetically modified fungal cells provided herein. Methods of
insertional mutagenesis can be performed according to any suitable
method known in the art (See e.g., Combier et al., FEMS Microbiol
Lett., 220:141-8 [2003], which is incorporated by reference herein
in its entirety). In addition, Agrobacterium-mediated insertional
mutagenesis can be used to insert a sequence that disrupts the
function of the encoded gene, such as disruption of the coding
sequence or any other functional aspect of the gene.
[0189] Transposon mutagenesis methodologies provide another means
for gene disruption. Transposon mutagenesis is well known in the
art, and can be performed using in vivo techniques (See e.g., Firon
et al., Eukaryot. Cell 2:247-55 [2003]); or by the use of in vitro
techniques (See e.g., Adachi et al., Curr. Genet., 42:123-7
[2002]); both of these references are incorporated by reference in
their entireties. Thus, targeted gene disruption using transposon
mutagenesis can be used to insert a sequence that disrupts the
function of the encoded gene, such as disruption of the coding
sequence or any other functional aspect of the gene.
[0190] Restriction enzyme-mediated integration (REMI) is another
methodology for gene disruption, and is well known in the art (See
e.g., Thon et al., Mol. Plant Microbe Interact., 13:1356-65 [2000],
which is incorporated by reference herein in its entirety). REMI
generates insertions into genomic restriction sites in an
apparently random manner, some of which cause mutations. Thus,
insertional mutants that demonstrate a disruption in the gene
encoding the endogenous protease can be selected and utilized as
provided herein.
[0191] In some other embodiments, the fungal cell has been
genetically modified to reduce the catalytic efficiency of the
protease. A reduction in catalytic efficiency refers to a reduction
in the activity of protease, relative to unmodified protease, as
measured using standard techniques known in the art. Thus, a
genetic modification that reduces catalytic efficiency can result
in, for example, a translated protein product that has a reduction
in enzymatic activity.
[0192] A reduction in catalytic efficiency is a reduction of
protease activity of about 5%, about 10%, about 15%, about 20%,
about 25%, about 30%, about 35%, about 40%, about 45%, about 50%,
about 55%, about 60%, about 65%, about 70%, about 75%, about 80%,
about 85%, about 90%, about 91%, about 92%, about 93%, about 94%,
about 95%, about 96%, about 97%, about 98%, about 99%, or more,
relative to unmodified protease, as measured using standard
techniques.
[0193] In some further embodiments, the genetic modification
results in a reduction of protease activity of at least about 5%,
about 10%, about 15%, about 20%, about 25%, about 30%, about 35%,
about 40%, about 45%, about 50%, about 55%, about 60%, about 65%,
about 70%, about 75%, about 80%, about 85%, about 90%, about 91%,
about 92%, about 93%, about 94%, about 95%, about 96%, about 97%,
about 98%, or about 99% in the total protease activity secreted by
the fungal cell, as compared to unmodified protease, as measured
using standard techniques.
[0194] Methods for reducing catalytic efficiency of proteases are
well known, and as such, any of a variety of suitable methods known
in the art for reducing catalytic efficiency find use in
genetically modifying the fungal cells provided herein. Thus, for
example, the fungal cell can be genetically modified to inactivate
one or more residues in an active site of the protease. For
example, one or more residues can be modified to decrease substrate
binding, and/or one or more residues can be modified to decrease
the catalytic activity of the protease. Similarly, it will be
apparent that mutation of residues outside an active site can
result in allosteric change in the shape or activity of the
protease, such that the catalytic efficient of the enzyme is
reduced. In some embodiments, other domains are targeted for at
least one mutation which results in a reduced catalytic efficiency
of at least one endogenous protease.
[0195] As provided herein, a fungal cell that has been genetically
modified to reduce the activity of at least one protease typically
has reduced secreted activity of an endogenous protease.
Accordingly, one or more protease enzymes from each of the fungal
species described herein can be targeted for genetic modification.
In some embodiments, the protease is from a fungal species in the
family Chaetomiaceae. In some embodiments, the protease is from a
fungal species selected from Sporotrichum cellulophilum, Thielavia
heterothallica, Corynascus heterothallicus, Thielavia terrestris,
Chaetomium globosum, and Myceliophthora thermophila.
[0196] Certain amino acid sequences encoding protease are provided
herein. For example, in one embodiment, the nucleotide sequences
(gDNA and cDNA) encoding one Myceliophthora thermophila protease
("Protease #1) are set forth herein as SEQ ID NOS:1 and 2, and the
encoded amino acid sequence is set forth as SEQ ID NO:3. In another
embodiment, nucleotide sequences (gDNA and cDNA) encoding another
Myceliophthora thermophila protease ("Protease #2) are set forth
herein as SEQ ID NOS:4 and 5, and the encoded amino acid sequence
is set forth as SEQ ID NO:6. In yet another embodiment, the
nucleotide sequences (gDNA and cDNA) of another Myceliophthora
thermophila protease ("Protease #3) are set forth herein as SEQ ID
NOS:7 and 8, and the encoded amino acid sequence is set forth as
SEQ ID NO:9. In yet another embodiment, the nucleotide sequences
(gDNA and cDNA) of another Myceliophthora thermophila protease
("Protease #4) are set forth herein as SEQ ID NOS:10 and 11, and
the encoded amino acid sequence is set forth as SEQ ID NO:12.
[0197] In some embodiments, the protease is encoded by a nucleic
acid sequence that is at least about 60%, about 61%, about 62%,
about 63%, about 64%, about 65%, about 66%, about 67%, about 68%,
about 69%, about 70%, about 71%, about 72%, about 73%, about 74%,
about 75%, about 76%, about 77%, about 78%, about 79%, about 80%,
about 81%, about 82%, about 83%, about 84%, about 85%, about 86%,
about 87%, about 88%, about 89%, about 90%, about 91%, about 92%,
about 93%, about 94%, about 95%, about 96%, about 97%, about 98%,
about 99%, or about 100% identical to SEQ ID NOS:1, 2, 4, 5, 7, 8,
10, and/or 11. In some embodiments, the protease is encoded by a
nucleic acid sequence that is at least about 60%, about 61%, about
62%, about 63%, about 64%, about 65%, about 66%, about 67%, about
68%, about 69%, about 70%, about 71%, about 72%, about 73%, about
74%, about 75%, about 76%, about 77%, about 78%, about 79%, about
80%, about 81%, about 82%, about 83%, about 84%, about 85%, about
86%, about 87%, about 88%, about 89%, about 90%, about 91%, about
92%, about 93%, about 94%, about 95%, about 96%, about 97%, about
98%, about 99%, or about 100% identical to a nucleic acid sequence
encoding the amino acid sequence set forth as SEQ ID NOS:3, 6, 9,
and/or 12. In some embodiments, the protease is encoded by a
nucleic acid sequence that can selectively hybridize to SEQ ID
NOS:1, 2, 4, 5, 7, 8, 10, and/or 11, under moderately stringent or
stringent conditions, as described hereinabove. In some
embodiments, the protease is encoded by a nucleic acid sequence
that can selectively hybridize under moderately stringent or
stringent conditions to a nucleic acid sequence that encodes SEQ ID
NOS:3, 6, 9, and/or 12. In some embodiments, the protease comprises
an amino acid sequence with at least about 50%, about 51%, about
52%, about 53%, about 54%, about 55%, about 56%, about 57%, about
58%, about 59%, about 60%, about 61%, about 62%, about 63%, about
64%, about 65%, about 66%, about 67%, about 68%, about 69%, about
70%, about 71%, about 72%, about 73%, about 74%, about 75%, about
76%, about 77%, about 78%, about 79%, about 80%, about 81%, about
82%, about 83%, about 84%, about 85% about 86%, about 87%, about
88%, about 89%, about 90%, about 91%, about 92%, about 93%, about
94%, about 95%, about 96%, about 97%, about 98%, about 99%, or
about 100% similarity to the amino acid sequence set forth as SEQ
ID NOS:3, 6, 9, and/or 12. Protease sequences can be identified by
any of a variety of methods known in the art. For example, a
sequence alignment can be conducted against a database, for example
against the NCBI database, and sequences with the lowest HMM
E-value can be selected.
[0198] In some embodiments, the fungal cells of the present
invention have been genetically modified to reduce the amount of
protease activity from two or more endogenous protease enzymes
secreted by the cell. In some embodiments, a first of the two or
more proteases comprises an amino acid sequence that is at least
about 60%, about 61%, about 62%, about 63%, about 64%, about 65%,
about 66%, about 67%, about 68%, about 69%, about 70%, about 71%,
about 72%, about 73%, about 74%, about 75%, about 76%, about 77%,
about 78%, about 79%, about 80%, about 81%, about 82%, about 83%,
about 84%, about 85%, about 86%, about 87%, about 88%, about 89%,
about 90%, about 91%, about 92%, about 93%, about 94%, about 95%,
about 96%, about 97%, about 98%, or about 99% identical to SEQ ID
NO:3, 6, 9, or 12, and a second of the two or more protease enzymes
comprises an amino acid sequence that is at least about 60%, about
61%, about 62%, about 63%, about 64%, about 65%, about 66%, about
67%, about 68%, about 69%, about 70%, about 71%, about 72%, about
73%, about 74%, about 75%, about 76%, about 77%, about 78%, about
79%, about 80%, about 81%, about 82%, about 83%, about 84%, about
85%, about 86%, about 87%, about 88%, about 89%, about 90%, about
91%, about 92%, about 93%, about 94%, about 95%, about 96%, about
97%, about 98%, or about 99% identical to SEQ ID NO:3, 6, 9, or
12.
[0199] As indicated herein, the present invention provides fungal
cells from the family Chaetomiaceae that have been genetically
modified to reduce the amount of endogenous protease activity that
is secreted by the cell, where the fungal cell is capable of
secreting a cellulase-containing enzyme mixture. The Chaetomiaceae
are a family of fungi in the Ascomycota, class Sordariomycetes. The
family Chaetomiaceae includes the genera Achaetomium,
Aporothielavia, Chaetomidium, Chaetomium, Corylomyces, Corynascus,
Farrowia, Thielavia, Zopfiella, and Myceliophthora. In some
embodiments, the genetically modified fungal cell provided herein
is a Chaetomiaceae family member selected from Myceliophthora,
Thielavia, Corynascus, and Chaetomium.
[0200] In some embodiments, the genetically modified fungal cell is
an anamorph or teleomorph of a Chaetomiaceae family member selected
from Myceliophthora, Thielavia, Corynascus, and Chaetomium. In some
embodiments, the genetically modified fungal cell is selected from
Sporotrichum, Chrysosporium, Paecilomyces, Talaromyces and
Acremonium. It is also contemplated that the genetically modified
fungal cell can also be selected from the genera Ctenomyces,
Thermoascus, and Scytalidium, including anamorphs and teleomorphs
of fungal cells of these genera. In some embodiments, the
genetically modified fungal cell is selected from strains of
Sporotrichum cellulophilum, Thielavia heterothallica, Corynascus
heterothallicus, Thielavia terrestris, and Myceliophthora
thermophila, including anamorphs and teleomorphs thereof. It is not
intended that the present invention be limited to any particular
genus within the Chaetomiaceae family. In some further embodiments,
the genetically modified fungal cell is a thermophilic species of
Acremonium, Arthroderma, Corynascus, Thielavia, Myceliophthora,
Thermoascus, Chromocleista, Byssochlamys, Sporotrichum, Chaetomium,
Chrysosporium, Scytalidium, Ctenomyces, Paecilomyces, or
Talaromyces. It will be understood that for all of the
aforementioned species, the genetically modified fungal cell
presented herein encompasses both the perfect and imperfect states,
and other taxonomic equivalents (e.g., anamorphs), regardless of
the species name by which they are known (See e.g., Cannon,
Mycopathol., 111:75-83 [1990]; Moustafa et al., Persoonia
14:173-175 [1990]; Upadhyay et al., Mycopathol., 87:71-80 [1984];
Guarro et al., Mycotaxon 23: 419-427 [1985]; Awao et al., Mycotaxon
16:436-440 [1983]; and von Klopotek, Arch. Microbiol., 98:365-369
[1974]). Those skilled in the art will readily recognize the
identity of appropriate equivalents. Accordingly, it will be
understood that, unless otherwise stated, the use of a particular
species designation in the present disclosure also refers to
species that are related by anamorphic or teleomorphic
relationship.
[0201] In some embodiments provided herein, the fungal cell is
further genetically modified to increase its production of one or
more saccharide hydrolyzing enzymes. For example, in some
embodiments, the fungal cell overexpresses a homologous or
heterologous gene encoding a saccharide hydrolysis enzyme such as
beta-glucosidase. In some embodiments, the one or more saccharide
hydrolysis enzyme is a cellulase enzyme described herein. For
example, in some embodiments, the enzyme is any one of a variety of
endoglucanases, cellobiohydrolases, beta-glucosidases,
endoxylanases, beta-xylosidases, arabinofuranosidases,
alpha-glucuronidases, acetylxylan esterases, feruloyl esterases,
and alpha-glucuronyl esterases, and/or any other enzyme involved in
saccharide hydrolysis. In some embodiments, the fungal cell is
genetically modified to increase expression of beta-glucosidase.
Thus, in some embodiments, the fungal cell comprises a
polynucleotide sequence for increased expression of
beta-glucosidase-encoding polynucleotide. In some embodiments, the
fungal cell is further genetically modified to delete
polynucleotides encoding one or more endogenous protease
enzymes.
[0202] In some embodiments, the saccharide hydrolyzing enzyme is
endogenous to the fungal cell, while in other embodiments, the
saccharide hydrolyzing enzyme is exogenous to the fungal cell. In
some additional embodiments, the enzyme mixture further comprises a
saccharide hydrolyzing enzyme that is heterologous to the fungal
cell. Still further, in some embodiments, the methods for
generating glucose comprise contacting cellulose with an enzyme
mixture that comprises a saccharide hydrolyzing enzyme that is
heterologous to the fungal cell.
[0203] In some embodiments, a fungal cell is genetically modified
to increase the expression of a saccharide hydrolysis enzyme using
any of a variety of suitable methods known to those of skill in the
art. In some embodiments, the hydrolyzing enzyme-encoding
polynucleotide sequence is adapted for increased expression in a
host fungal cell. As used herein, a polynucleotide sequence that
has been adapted for expression is a polynucleotide sequence that
has been inserted into an expression vector or otherwise modified
to contain regulatory elements necessary for expression of the
polynucleotide in the host cell, positioned in such a manner as to
permit expression of the polynucleotide in the host cell. Such
regulatory elements required for expression include promoter
sequences, transcription initiation sequences and, optionally,
enhancer sequences. For example, in some embodiments, a
polynucleotide sequence is inserted into a plasmid vector adapted
for expression in the fungal host cell.
[0204] In some embodiments, the genetically modified fungal cells
provided herein are cellulase-producing fungal cells. In some
embodiments, the cellulase-producing fungal cells express and
secrete a mixture of cellulose hydrolyzing enzymes. In some
embodiments, the genetically modified fungal cells provided herein
are fungal cells from the family Chaetomiaceae that secrete two or
more cellulose hydrolyzing enzymes (e.g., endoglucanase,
cellobiohydrolase, and/or beta-glucosidase). In some additional
embodiments, the cellulase-producing fungal cells produce two or
more of these enzymes, in any combination. Additionally, in some
embodiments, the genetically modified fungal cell is derived from a
lignocellulose-competent parental fungal cell.
[0205] The present invention also provides a fungal culture in a
vessel comprising a genetically modified fungal cell as described
hereinabove. In some embodiments, the vessel comprises a liquid
medium, such as fermentation medium. For example, the vessel can be
a flask, bioprocess reactor, or any suitable container. In some
embodiments, the vessel comprises a solid growth medium. For
example, the solid medium can be an agar medium such as potato
dextrose agar, carboxymethylcellulose, cornmeal agar, and any other
suitable medium. In some embodiments, the fungal cell described
hereinabove is an isolated fungal cell.
Enzyme Mixtures
[0206] Also provided herein are enzyme mixtures that comprise at
least one or more cellulose hydrolyzing enzymes expressed by a
fungal cell that has been genetically modified to reduce the amount
of endogenous protease activity secreted by the cell, as described
herein. Cellulase enzymes are produced by a wide variety of
microorganisms. Cellulases (and hemicellulases) from filamentous
fungi and some bacteria are widely exploited for many industrial
applications that involve processing of natural fibers to sugars.
It is contemplated that mixtures of any enzymes set forth herein
will find use in the present invention.
[0207] As a further guide to the reader, yet without implying any
limitation in the practice of the present invention, exemplary
mixtures of components that may be used as catalysts in a
saccharification reaction to generate fermentable sugars from a
cellulosic substrate are provided herein. Concentrations are given
in wt/vol of each component in the final reaction volume with the
cellulose substrate. Also provided are percentages of each
component (wt/wt) in relation to the total mass of the components
that are listed for addition into each mixture (the "total
protein"). This may be a mixture of purified enzymes and/or enzymes
in a culture supernatant.
[0208] By way of example, the invention embodies mixtures that
comprise at least four, at least five, or all six of the following
components. In some embodiments, cellobiohydrolase 1 (CBH1) finds
use; in some embodiments CBH1 is present at a concentration of
about 0.14 to about 0.23 g/L (about 15% to about 25% of total
protein). Exemplary CBH1 enzymes include, but are not limited to T.
emersonii CBH1(wild-type) (e.g., SEQ ID NO:137), wild-type M.
thermophila CBH1a (e.g., SEQ ID NO:140), and the variants CBH1a-983
(e.g., SEQ ID NO:146) and CBH1a-145 (e.g., SEQ ID NO:143). In some
embodiments, cellobiohydrolase 2 (CBH2) finds use; in some
embodiments, CBH2 is present at a concentration of about 0.14 to
about 0.23 g/L (about 15% to about 25% of total protein). Exemplary
CBH2 enzymes include, but are not limited to wild-type CBH2b from
M. thermophila (wild-type) (e.g., SEQ ID NO:149), and/or variants
CHB2b var. 196 (e.g., SEQ ID NO: 152), CBH2b var. 287 (e.g., SEQ ID
NO:155), and CBH2b var. 962 (e.g, SEQ ID NO:158). In some
embodiments, endoglucanase 2 (EG2) finds use; in some embodiments,
EG2 is present at a concentration of 0 to about 0.05 g/L (0 to
about 5% of total protein). Exemplary EGs include, but are not
limited to wild-type M. thermophila EG2 (e.g., SEQ ID NO:125). In
some further embodiments, endoglucanase 1 (EG1) finds use; in some
embodiments, EG1 is present at a concentration of about 0.05 to
about 0.14 g/L (about 5% to about 15% of total protein). Exemplary
EG1s include, but are not limited to wild-type M. thermophila EG1b
(e.g., SEQ ID NO:122). In some embodiments, beta-glucosidase (BGL)
finds use in the present invention; in some embodiments, BGL is
present at a concentration of about 0.05 to about 0.09 g/L (about
5% to about 10% of total protein). Exemplary beta-glucosidases
include, but are not limited to wild-type M. thermophila BGL1
(e.g., SEQ ID NO:128), as well as variant BGL-900 (e.g., SEQ ID
NO:134), and variant BGL-883 (e.g., SEQ ID NO:131). In some further
embodiments, GH61 protein and/or protein variants find use; in some
embodiments, GH61 enzymes are present at a concentration of about
0.23 to about 0.33 g/L (about 25% to about 35% of total protein).
Exemplary GH61s include, but are not limited to wild-type M.
thermophila GH61a (e.g., SEQ ID NO:14), GH61a Variant 1 (e.g., SEQ
ID NO:17), GH61a Variant 5 (e.g., SEQ ID NO:20), and/or GH61a
Variant 9 (e.g., SEQ ID NO:23), and/or any other GH61a variant
proteins, as well as any of the other GH61 enzymes (e.g., GH61b,
GH61c, GH61d, GH61e, GH61f, GH61g, GH61h, GH161i, GH61j, GH61k,
GH611, GH61m, GH61n, GH61o, GH61p, GH61q, GH61r, GH61s, GH61t,
GH61u, GH61v, GH61w, GH61x, and/or GH61y) as provided herein (e.g.,
polynucleotide and polypeptide sequences including, but not limited
to SEQ ID NOS:25-120).
[0209] In some embodiments, one, two or more than two enzymes are
present in the mixtures of the present invention. In some
embodiments, GH61p is present at a concentration of about 0.05 to
about 0.14 g/L (e.g, about 1% to about 15% of total protein).
Exemplary M. thermophila GH61p enzymes include, but are not limited
to those set forth in SEQ ID NOS:82 and 85. In some embodiments,
GH61f is present at a concentration of about 0.05 to about 0.14 g/L
(about 1% to about 15% of total protein). An exemplary M.
thermophila GH61f is set forth in SEQ ID NO:41. In some additional
embodiments, at least one additional GH61 enzyme provided herein
(e.g., GH61b, GH61c, GH61d, GH61e, GH61g, GH61h, GH61i, GH61j,
GH61k, GH611, GH61m, GH61n, GH61n, GH61o, GH61q, GH61r, GH61 s,
GH61t, GH61u, GH61v, GH61w, GH61x, and/or GH61y, finds use at an
appropriate concentration (e.g., about 0.05 to about 0.14 g/L
[about 1% to about 15% of total protein]).
[0210] In some embodiments, at least one xylanase at a
concentration of about 0.05 to about 0.14 g/L (about 1% to about
15% of total protein) finds use in the present invention. Exemplary
xylanases include but are not limited to the M. thermophila
xylanase-3 (SEQ ID NO:161), xylanase-2 (SEQ ID NO:164), xylanase-1
(SEQ ID NO:167), xylanase-6 (SEQ ID NO:170), and xylanase-5 (SEQ ID
NO:173).
[0211] In some additional embodiments, at least one beta-xylosidase
at a concentration of about 0.05 to about 0.14 g/L (e.g., about 1%
to about 15% of total protein) finds use in the present invention.
Exemplary beta-xylosidases include but are not limited to the M.
thermophila beta-xylosidase (SEQ ID NO:176).
[0212] In still some additional embodiments, at least one acetyl
xylan esterase at a concentration of about 0.05 to about 0.14 g/L
(e.g., about 1% to about 15% of total protein) finds use in the
present invention. Exemplary acetylxylan esterases include but are
not limited to the M. thermophila acetylxylan esterase (SEQ ID
NO:179).
[0213] In some further additional embodiments, at least one ferulic
acid esterase at a concentration of about 0.05 to about 0.14 g/L
(e.g., about 1% to about 15% of total protein) finds use in the
present invention. Exemplary ferulic esterases include but are not
limited to the M. thermophila ferulic acid esterase (SEQ ID
NO:182).
[0214] In some embodiments, the enzyme mixtures comprise at least
one GH61 variant protein as provided herein and at least one
cellulase, including but not limited to any of the enzymes
described herein. In some embodiments, the enzyme mixtures comprise
at least one GH61 variant protein and at least one wild-type GH61
protein. In some embodiments, the enzyme mixtures comprise at least
one GH61 variant protein and at least one non-cellulase enzyme.
Indeed, it is intended that any combination of enzymes will find
use in the enzyme compositions comprising at least one GH61 variant
of the present invention.
[0215] The concentrations listed above are appropriate for a final
reaction volume with the biomass substrate in which all of the
components listed (the "total protein") is about 0.75 g/L, and the
amount of glucan is about 93 g/L, subject to routine optimization.
The user may empirically adjust the amount of each component and
total protein for cellulosic substrates that have different
characteristics and/or are processed at a different concentration.
Any one or more of the components may be supplemented or
substituted with variants with common structural and functional
characteristics, as described below.
[0216] Without implying any limitation, the following mixtures
further describe some embodiments of the present invention.
[0217] Some mixtures comprise CBH1a within a range of about 15% to
about 30% total protein, typically about 20% to about 25%; CBH2
within a range of about 15% to about 30%, typically about 17% to
about 22%; EG2 within a range of about 1% to about 10%, typically
about 2% to about 5%; BGL1 within a range of about 5% to about 15%,
typically about 8% to about 12%; GH61a within a range of about 10%
to about 40%, typically about 20% to about 30%; EG1b within a range
of about 5% to about 25%, typically about 10% to about 18%; and
GH61f within a range of 0% to about 30%; typically about 5% to
about 20%.
[0218] In some mixtures, exemplary BGL1s include the BGL1 variant
900 (SEQ ID NO:134) and/or variant 883 (SEQ ID NO:131). In some
embodiments, other enzymes are M. thermophila wild-type: CBH1a (SEQ
ID NO:140), CBH2b (SEQ ID NO:149), EG2 (SEQ ID NO:125), GH61a (SEQ
ID NO:14), EG1b (SEQ ID NO:122) and GH61f (SEQ ID NO:41). Any one
or more of the components may be supplemented or substituted with
variants having common structural and functional characteristics
with the component being substituted or supplemented, as described
below. In a saccharification reaction, the amount of glucan is
generally about 50 to about 300 g/L, typically about 75 to about
150 g/L. The total protein is about 0.1 to about 10 g/L, typically
about 0.5 to about 2 g/L, or about 0.75 g/L.
[0219] Some mixtures comprise CBH1 within a range of about 10% to
about 30%, typically about 15% to about 25%; CBH2b within a range
of about 10% to about 25%, typically about 15% to about 20%; EG2
within a range of about 1% to about 10%, typically about 2% to
about 5%; EG1b within a range of about 2% to about 25%, typically
about 6% to about 14%; GH61a within a range of about 5% to about
50%, typically about 10% to about 35%; and BGL1 within a range of
about 2% to about 15%, typically about 5% to about 12%. Also
included is copper sulfate to generate a final concentration of
Cu.sup.++ of about 4 .mu.M to about 200 .mu.M, typically about 25
.mu.M to about 60 .mu.M. However, it is not intended that the added
copper be limited to any particular concentration, as any suitable
concentration finds use in the present invention and will be
determined based on the reaction conditions.
[0220] In an additional mixture, an exemplary CBH1 is wild-type
CBH1 from T. emersonii (SEQ ID NO:137), as well as wild-type M.
thermophila CBH1a (SEQ ID NO:140), Variant 983 (SEQ ID NO:146), and
Variant 145 (SEQ ID NO:143); exemplary CBH2 enzymes include the
wild-type (SEQ ID NO:149), Variant 962 (SEQ ID NO:158), Variant 196
(SEQ ID NO:152), and Variant 287 (SEQ ID NO:155); an exemplary EG2
is the wild-type M. thermophila (SEQ ID NO:125); an exemplary EG1b
is the wild-type (SEQ ID NO: 122); exemplary GH61a enzymes include
wild-type M. thermophila (SEQ ID NO:14), Variant 1 (SEQ ID NO:17),
Variant 5 (SEQ ID NO:20), and Variant 9 (SEQ ID NO:23); and
exemplary BGLs include wild-type M. thermophila BGL (SEQ ID
NO:128), Variant 883 (SEQ ID NO:131), and Variant 900 (SEQ ID
NO:134). Any one or more of the components may be supplemented or
substituted with other variants having common structural and
functional characteristics with the component being substituted or
supplemented, as described below. In a saccharification reaction,
the amount of glucan is generally about 50 to about 300 g/L,
typically about 75 to about 150 g/L. The total protein is about 0.1
to about 10 g/L, typically about 0.5 to about 2 g/L, or about 0.75
g/L.
[0221] Any or all of the components listed in the mixtures referred
to above may be supplemented or substituted with variant proteins
that are structurally and functionally related, as described
herein.
[0222] In some embodiments, the CBH1 cellobiohydrolase used in
mixtures of the present invention comprises at least about 80%, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or 100% identical to either SEQ ID NO:140 (M.
thermophila), SEQ ID NO:137 (T. emersonii), or a fragment of either
SEQ ID NO:140 or SEQ ID NO:137 having cellobiohydrolase activity,
as well as variants of M. thermophila CBH1a (e.g., SEQ ID NO:143
and/or SEQ ID NO:146), and/or variant fragment(s) having
cellobiohydrolase activity. Exemplary CBH1 enzymes include, but are
not limited to those described in US Pat. Appln. Publn. No.
2012/0003703 A1, which is hereby incorporated herein by reference
in its entirety for all purposes.
[0223] In some embodiments, the CBH2b cellobiohydrolase used in the
mixtures of the present invention comprises at least about 80%, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or 100% identical to SEQ ID NO:149 and/or a
fragment of SEQ ID NO:149, as well as at least one variant M.
thermophila CBH2b enzyme (e.g., SEQ ID NO:152, 155, and/or 158)
and/or variant fragment(s) having cellobiohydrolase activity.
Exemplary CBH2b enzymes are described in U.S. Pat. Appln. Ser. No.
61/479,800, and Ser. No. 13/459,038, both of which are hereby
incorporated herein by reference in their entirety for all
purposes.
[0224] In some embodiments, the EG2 endoglucanase used in the
mixtures of the present invention comprises at least about 80%, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or 100% identical to SEQ ID NO:125 and/or a
fragment of SEQ ID NO:125 having endoglucanase activity. Exemplary
EG2 enzymes are described in U.S. patent application Ser. No.
13/332,114, and WO 2012/088159, both of which are hereby
incorporated herein by reference in their entirety for all
purposes.
[0225] In some embodiments, the EG1b endoglucanase used in the
mixtures of the present invention comprises at least about 80%, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or 100% identical to SEQ ID NO:122 and/or a
fragment of SEQ ID NO:122 having endoglucanase activity.
[0226] In some embodiments, the BGL1 beta-glucosidase used the
mixtures of the present invention comprises at least about 80%, at
least about 85%, at least about 90%, at least about 91%, at least
about 92%, at least about 93%, at least about 94%, at least about
95%, at least about 96%, at least about 97%, at least about 98%, at
least about 99%, or 100% identical to SEQ ID NOS:128, 131, and/or
134, or a fragment of SEQ ID NOS:128, 131, and/or 134 having
beta-glucosidase activity. Exemplary BGL1 enzymes include, but are
not limited to those described in US Pat. Appln. Publ. No.
2011/0129881, WO 2011/041594, and US Pat. Appln. Publ. No.
2011/0124058 A1, all of which are hereby incorporated herein by
reference in their entireties for all purposes.
[0227] In some embodiments, the GH61f protein used in the mixtures
of the present invention comprises at least about 80%, at least
about 85%, at least about 90%, at least about 91%, at least about
92%, at least about 93%, at least about 94%, at least about 95%, at
least about 96%, at least about 97%, at least about 98%, at least
about 99%, or 100% identical to SEQ ID NO:41, and/or a fragment of
SEQ ID NO:41 having GH61 activity, assayed as described elsewhere
in this disclosure.
[0228] In some embodiments, the GH61p protein used in the mixtures
of the present invention comprises at least about 80%, at least
about 85%, at least about 90%, at least about 91%, at least about
92%, at least about 93%, at least about 94%, at least about 95%, at
least about 96%, at least about 97%, at least about 98%, at least
about 99%, or 100% identical to SEQ ID NO:82, SEQ ID NO:85, and/or
a fragment of such sequence having GH61p activity.
[0229] In some embodiments, the xylanase used in the mixtures of
the present invention comprises at least about 80%, at least about
85%, at least about 90%, at least about 91%, at least about 92%, at
least about 93%, at least about 94%, at least about 95%, at least
about 96%, at least about 97%, at least about 98%, at least about
99%, or 100% identical to SEQ ID NO:161, SEQ ID NO:164, SEQ ID
NO:167, SEQ ID NO:170, and/or SEQ ID NO:173, and/or a fragment of
such sequence having xylanase activity.
[0230] In some embodiments, the xylosidase used in the mixtures of
the present invention comprises at least about 80%, at least about
85%, at least about 90%, at least about 91%, at least about 92%, at
least about 93%, at least about 94%, at least about 95%, at least
about 96%, at least about 97%, at least about 98%, at least about
99%, or 100% identical to SEQ ID NO:176 and/or a fragment of such
sequence having xylosidase activity.
[0231] In still some additional embodiments, at least one acetyl
xylan esterase at a concentration of about 0.05 to about 0.14 g/L
(e.g., about 1% to about 15% of total protein) finds use in the
present invention. Exemplary acetylxylan esterases include but are
not limited to the M. thermophila acetylxylan esterase (SEQ ID
NO:179).
[0232] In some further additional embodiments, at least one ferulic
acid esterase at a concentration of about 0.05 to about 0.14 g/L
(e.g., about 1% to about 15% of total protein) finds use in the
present invention. Exemplary ferulic esterases include but are not
limited to the M. thermophila ferulic acid esterase (SEQ ID
NO:182).
[0233] In some embodiments, the enzyme mixture comprises at least
one or more cellulose hydrolyzing enzymes expressed by a fungal
cell that has been genetically modified to reduce the amount of
endogenous protease activity that is secreted by the cell, as
described herein. In some embodiments, the fungal cell is a
lignocellulose-utilizing cell from the family Chaetomiaceae. In
some embodiments, the genetically modified fungal cell provided
herein is a Chaetomiaceae family member selected from
Myceliophthora, Thielavia, Corynascus, or Chaetomium. In some other
embodiments, the genetically modified fungal cell can also be an
anamorph or teleomorph of a Chaetomiaceae family member selected
from Myceliophthora, Thielavia, Corynascus, or Chaetomium. In
addition, the genetically modified fungal cell can also be selected
from Sporotrichum or Acremonium or Talaromyces. It is also
contemplated that the genetically modified fungal cell be selected
from Ctenomyces, Thermoasms, and Scytalidium, including anamorphs
and teleomorphs of fungal cells from those genera. In some
embodiments, the fungal cell is a species selected from
Sporotrichum cellulophilum, Thielavia heterothallica, Corynascus
heterothallicus, Thielavia terrestris, Chaetomium globosum,
Talaromyces stipitatus, Talaromyces emersonii, and Myceliophthora
thermophila, including anamorphs and teleomorphs thereof.
[0234] In some embodiments, at least one cellulase in the mixtures
of the present invention is produced by any suitable organism. In
some embodiments, at least one cellulase in the mixtures is
produced by Acidothermus cellulolyticus, Thermobifida fusca,
Humicola grisea, Myceliophthora thermophila, Chaetomium
thermophilum, Acremonium sp., Thielavia sp, Trichoderma reesei,
Aspergillus sp., or Chrysosporium sp., and/or at least one enzyme
produced in a heterologous organism. Indeed, it is not intended
that the present invention be limited to enzymes produced by
protease-deficient Myceliophthora. The present invention
encompasses enzyme mixtures comprising enzymes produced by
Myceliophthora in combination with at least one cellulase and/or
other enzymes produced by any other suitable organisms, wherein at
least one cellulase and/or enzyme is either homologous or
heterologous to the cell producing the cellulase(s) and/or other
enzyme(s). In some embodiments, the enzyme mixtures comprise
bacterial, as well as fungal enzymes. In some embodiments,
bacterial enzymes produced by and/or from organisms such as
Bacillus find use. However, it is not intended that the present
invention be limited to any particular bacterial organism and/or
any particular bacterial enzyme, as any suitable organisms and/or
enzymes find use in the present invention. In some embodiments,
cellulase enzymes of the cellulase mixture work together, resulting
in decrystallization and hydrolysis of the cellulose from a biomass
substrate to yield fermentable sugars, such as but not limited to
glucose.
[0235] In some embodiments, the enzyme mixture is contained in a
vessel comprising a genetically modified fungal cell as described
herein. In some embodiments, the vessel comprises a liquid medium.
In some embodiments, the vessel is a flask, bioprocess reactor, or
any other suitable container. In some embodiments, the enzyme
mixture is in a liquid volume. In some embodiments, the liquid
volume can be greater than about 0.01 mL, about 0.1 mL, about 1 mL,
about 10 mL, about 100 mL, about 1000 mL, or greater than about 10
L, about 50 L, about 100 L, about 200 L, about 300 L, about 400 L,
about 500 L, about 600 L, about 700 L, about 800 L, about 900 L,
about 1000 L, about 10,000 L, about 50,000 L, about 100,000 L,
about 250,000 L, about 500,000 L or greater than about 1,000,000
L.
[0236] In addition to the enzymes described above, other enzymes
such as laccases find use in the mixtures of the present invention.
Laccases are copper containing oxidase enzymes that are found in
many plants, fungi and microorganisms. Laccases are enzymatically
active on phenols and similar molecules and perform a one electron
oxidation. Laccases can be polymeric and the enzymatically active
form can be a dimer or trimer.
[0237] Mn-dependent peroxidases also find use in the mixtures of
the present invention. The enzymatic activity of Mn-dependent
peroxidase (MnP) in is dependent on Mn.sup.2+. Without being bound
by theory, it has been suggested that the main role of this enzyme
is to oxidize Mn.sup.2+ to Mn.sup.3+ (See e.g., Glenn et al. Arch.
Biochem. Biophys., 251:688-696 [1986]). Subsequently, phenolic
substrates are oxidized by the Mn.sup.3+ generated.
[0238] Lignin peroxidases also find use in the mixtures of the
present invention. Lignin peroxidase is an extracellular heme that
catalyzes the oxidative depolymerization of dilute solutions of
polymeric lignin in vitro. Some of the substrates of LiP, most
notably 3,4-dimethoxybenzyl alcohol (veratryl alcohol, VA), are
active redox compounds that have been shown to act as redox
mediators. VA is a secondary metabolite produced at the same time
as LiP by ligninolytic cultures of P. chrysosporium and without
being bound by theory, has been proposed to function as a
physiological redox mediator in the LiP-catalysed oxidation of
lignin in vivo (See e.g., Harvey et al., FEBS Lett., 195:242-246
[1986]).
[0239] In some embodiments, it may be advantageous to utilize an
enzyme mixture that is cell-free. A cell-free enzyme mixture
typically comprises enzymes that have been separated from any
cells, including the cells that secreted the enzymes. Cell-free
enzyme mixtures can be prepared using any of a variety of suitable
methodologies that are known in the art (e.g., filtration or
centrifugation). In some embodiments, the enzyme mixture is
partially cell-free, substantially cell-free, or entirely
cell-free.
[0240] In some embodiments, two or more cellulases and any
additional enzymes present in the cellulase enzyme mixture are
secreted from a single genetically modified fungal cell or by
different microbes in combined or separate fermentations.
Similarly, two or more cellulases and any additional enzymes
present in the cellulase enzyme mixture may be expressed
individually or in sub-groups from different strains of different
organisms and the enzymes combined in vitro to make the cellulase
enzyme mixture. It is also contemplated that the cellulases and any
additional enzymes in the enzyme mixture are expressed individually
or in sub-groups from different strains of a single organism, and
the enzymes combined to make the cellulase enzyme mixture.
[0241] In some embodiments, the enzyme mixture comprises at least
one or more cellulose hydrolyzing enzymes expressed by a fungal
cell that has been genetically modified to reduce the amount of
endogenous protease activity that is secreted by the cell, as
described herein. In some embodiments, the fungal cell is a
lignocellulose-utilizing cell from the family Chaetomiaceae. In
some embodiments, the genetically modified fungal cell provided
herein is a Chaetomiaceae family member selected from
Myceliophthora, Thielavia, Corynascus, and Chaetomium. The
genetically modified fungal cell can also be an anamorph or
teleomorph of a Chaetomiaceae family member selected from
Myceliophthora, Thielavia, Corynascus, and Chaetomium. In addition,
the genetically modified fungal cell can also be selected from
Sporotrichum, Acremonium, Ctenomyces, Scytalidium and Thermoascus,
including anamorphs and teleomorphs of fungal cells from these
genera. In some embodiments, the fungal cell is a species selected
from Sporotrichum cellulophilum, Thielavia heterothallica,
Corynascus heterothallicus, Thielavia terrestris, Chaetomium
globosum, Talaromyces stipitatus, Talaromyces emersonii, and
Myceliophthora thermophila, including anamorphs and teleomorphs
thereof.
[0242] In some embodiments, the cellulase enzyme mixture of the
present invention is produced in a fermentation process in which
the fungal cells described herein are grown in submerged liquid
culture fermentation. In some embodiments, submerged liquid
fermentations of fungal cells are incubated using batch, fed-batch
or continuous processing. In a batch process, all the necessary
materials, with the exception of oxygen for aerobic processes, are
placed in a reactor at the start of the operation and the
fermentation is allowed to proceed until completion, at which point
the product is harvested. In some embodiments, batch processes for
producing the enzyme mixture of the present invention are carried
out in a shake-flask or a bioreactor. In some embodiments in which
a fed-batch process is used, the culture is fed continuously or
sequentially with one or more media components without the removal
of the culture fluid. In continuous processes, fresh medium is
supplied and culture fluid is removed continuously at
volumetrically equal rates to maintain the culture at a steady
growth rate. Those of skill in the art will appreciate that
fermentation medium is typically liquid, and comprises a carbon
source, a nitrogen source as well as other nutrients, vitamins and
minerals which can be added to the fermentation media to improve
growth and enzyme production of the fungal cells. These other media
components may be added prior to, simultaneously with or after
inoculation of the culture with the fungal cells.
[0243] In some embodiments of the process for producing the enzyme
mixture of the present invention, the carbon source comprises a
carbohydrate that will induce the expression of the cellulase
enzymes from the fungal cell. For example, in some embodiments, the
carbon source comprises one or more of cellulose, cellobiose,
sophorose, xylan, xylose, xylobiose, and/or related oligo- or
poly-saccharides known to induce expression of cellulases and
beta-glucosidase in such fungal cells. In some embodiments
utilizing batch fermentation, the carbon source is added to the
fermentation medium prior to or simultaneously with inoculation. In
some embodiments utilizing fed-batch or continuous operations, the
carbon source is supplied continuously or intermittently during the
fermentation process. For example, in some embodiments, the carbon
source is supplied at a carbon feed rate of between about 0.2 and
about 2.5 g carbon/L of culture/h, or any suitable amount
therebetween.
[0244] The methods for producing and/or utilizing the enzyme
mixture(s) of the present invention may be carried at any suitable
temperature, typically from about 20.degree. C. to about
100.degree. C., or any suitable temperature therebetween, for
example from about 20.degree. C. to about 80.degree. C., 25.degree.
C. to about 65.degree. C., or any suitable temperature
therebetween, or from about 20.degree. C., about 22.degree. C.,
about 25.degree. C., about 26.degree. C., about 27.degree. C.,
about 28.degree. C., about 29.degree. C., about 30.degree. C.,
about 32.degree. C., about 35.degree. C., about 37.degree. C.,
about 40.degree. C., about 45.degree. C., about 50.degree. C.,
about 55.degree. C., about 60.degree. C., about 65.degree. C.,
about 70.degree. C., about 75.degree. C., about 80.degree. C.,
about 85.degree. C. C, about 90.degree. C., about 95.degree. C.,
and/or any suitable temperature therebetween.
[0245] The methods for producing and/or utilizing the enzyme
mixture(s) of the present invention may be carried out at any
suitable pH, typically from about 3.0 to 8.0, or any suitable pH
therebetween, for example from about pH 3.5 to pH 6.8, or any
suitable pH therebetween, for example from about pH 3.0, about 3.2,
about 3.4, about 3.5, about 3.7, about 3.8, about 4.0, about 4.1,
about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7,
about 4.8, about 4.9, about 5.0, about 5.2, about 5.4, about 5.5,
about 5.7, about 5.8, about 6.0, about 6.2, about 6.5, about 6.8,
about 7.0, about 7.2, about 7.5, about 8.0, or any suitable pH
therebetween.
[0246] In some embodiments, following fermentation, the
fermentation medium containing the fungal cells is used, or the
fermentation medium containing the fungal cells and an exogenously
supplied enzyme mixture is used, or the enzyme mixture is separated
from the fungal cells, for example by filtration or centrifugation,
and the enzyme mixture in the fermentation medium is used. In some
embodiments, low molecular solutes such as unconsumed components of
the fermentation medium are removed by ultrafiltration. In some
embodiments, the enzyme mixture is concentrated by evaporation,
precipitation, sedimentation, filtration, or any suitable means. In
some embodiments, chemicals such as glycerol, sucrose, sorbitol,
etc., are added to stabilize the enzyme mixture. In some
embodiments, other chemicals, such as sodium benzoate or potassium
sorbate, are added to the enzyme mixture to prevent growth of
microbial contaminants.
[0247] The present invention also provides processes for generating
glucose, comprising contacting cellulose with the enzyme mixture
described herein. For example, in some embodiments, the process
comprises contacting cellulose with an enzyme mixture comprising
two or more cellulose hydrolyzing enzymes, wherein at least one of
the two or more cellulose hydrolyzing enzymes is expressed by a
fungal cell as described herein. In some embodiments, the method
for generating glucose from cellulose using the enzyme mixture is
batch hydrolysis, continuous hydrolysis, or a combination thereof.
In some embodiments, the hydrolysis is agitated, unmixed, or a
combination thereof.
Fermentation
[0248] In some embodiments, methods for generating sugar(s)
described herein further comprise fermentation of the resultant
sugar(s) to an end product. Fermentation involves the conversion of
a sugar source (e.g., a soluble sugar) to an end product through
the use of a fermenting organism. Any suitable organism finds use
in the present invention, including bacterial and fungal organisms
(e.g., yeast and filamentous fungi), suitable for producing a
desired end product. Especially suitable fermenting organisms are
able to ferment (i.e., convert), sugars, such as glucose, fructose,
maltose, xylose, mannose and/or arabinose, directly or indirectly
into a desired end product. Examples of fermenting organisms
include fungal organisms such as yeast. In some embodiments, yeast
strains, including but not limited to the following genera find
use: the genus Saccharomyces (e.g., S. cerevisiae and S. uvarum);
Pichia (e.g., P. stipitis and P. pastoris); Candida (e.g., C.
utilis, C. arabinofermentans, C. diddensii, C. sonorensis, C.
shehatae, C. tropicalis, and C. boidinii). Other fermenting
organisms include, but are not limited to strains of Zymomonas,
Hansenula (e.g., H. polymorpha and H. anomala), Kluyveromyces
(e.g., K. fragilis), and Schizosaccharomyces (e.g., S. pombe).
[0249] In some embodiments, the fermenting organisms are strains of
Escherichia (e.g., E. coli), Zymomonas (e.g., Z. mobilis),
Zymobacter (e.g., Z. palmae), Klebsiella (e.g., K. oxytoca),
Leuconostoc (e.g., L. mesenteroides), Clostridium (e.g., C.
butyricum), Enterobacter (e.g., E. aerogenes) and
Thermoanaerobacter (e.g., Thermoanaerobacter BG1L1 [See e.g.,
Georgieva and Ahring, Appl. Microbiol, Biotech., 77: 61-86] T.
ethanolicus, T. thermosaccharolyticum, or T. mathranii),
Lactobacillus, Corynebacterium glutamicum strain R, Bacillus
thermoglucosidaisus, and Geobacillus thermoglucosidasius. It is not
intended that the fermenting organism be limited to these
particular strains, as any suitable organism finds use in the
present invention.
[0250] The fermentation conditions depend on the desired
fermentation product and can easily be determined by one of
ordinary skill in the art. In some embodiments involving ethanol
fermentation by yeast, fermentation is typically ongoing for
between about 1 hour to about 120 hours, or about 12 to about 96
hours. In some embodiments, the fermentation is carried out at a
temperature between about 20.degree. C. to about 40.degree. C., or
between about 26.degree. C. and about 34.degree. C., or about
32.degree. C. In some embodiments, the fermentation pH is from
about pH 3 to about pH 7, while in some other embodiments, the pH
is about 4 to about 6.
[0251] In some embodiments, enzymatic hydrolysis and fermentation
are conducted in separate vessels, so that each biological reaction
can occur under its respective optimal conditions (e.g.,
temperature). In some other embodiments, the methods for producing
glucose from cellulose are conducted simultaneously with
fermentation in a simultaneous saccharification and fermentation
(i.e., "SSF") reaction. In some embodiments, SSF is typically
carried out at temperatures of about 28.degree. C. to about
50.degree. C., or about 30.degree. C. to about 40.degree. C., or
about 35.degree. C. to about 38.degree. C., which is a compromise
between the about 50.degree. C. optimum for most cellulase enzyme
mixtures and the about 28.degree. C. to about 30.degree. C. optimum
for most yeast.
[0252] In some embodiments, the methods for generating glucose
further comprise fermentation of the glucose to a desired end
product. It is not intended that the methods provided herein be
limited to the production of any specific end product. In some
embodiments, end products include fuel alcohols or precursor
industrial chemicals. For example, in some embodiments,
fermentation products include precursor industrial chemicals such
as alcohols (e.g., ethanol, methanol and/or butanol); organic acids
(e.g., butyric acid, citric acid, acetic acid, itaconic acid,
lactic acid, and/or gluconic acid); ketones (e.g., acetone); amino
acids (e.g., glutamic acid); gases (e.g., H.sub.2 and/or CO.sub.2);
antimicrobials (e.g., penicillin and/or tetracycline); enzymes;
vitamins (e.g., riboflavin, B.sub.12, and/or beta-carotene); and/or
hormones. In some embodiments, the end product is a fuel alcohol.
Suitable fuel alcohols are known in the art and include, but are
not limited to lower alcohols such as methanol, ethanol, butanol
and propyl alcohols.
EXPERIMENTAL
[0253] The present invention is described in further detail in the
following Examples, which are not in any way intended to limit the
scope of the invention as claimed.
[0254] In the experimental disclosure below, the following
abbreviations apply: ppm (parts per million); M (molar); mM
(millimolar), uM and .mu.M (micromolar); nM (nanomolar); mol
(moles); gm and g (gram); mg (milligrams); ug and .mu.g
(micrograms); L and 1 (liter); ml and mL (milliliter); cm
(centimeters); mm (millimeters); um and .mu.m (micrometers); sec.
(seconds); min(s) (minute(s)); h(s) (hour(s)); U (units); MW
(molecular weight); rpm (rotations per minute); .degree. C.
(degrees Centigrade); wt % (weight percent); w.r.t. (with regard
to); DNA (deoxyribonucleic acid); RNA (ribonucleic acid); gDNA
(genomic DNA); cDNA (complementary DNA); HPLC (high pressure liquid
chromatography); MS (mass spectroscopy); LC (liquid
chromatography); LC/MS (liquid charomatography/mass spectroscopy);
LC/MS/MS (liquid chromatography/multi-stage mass spectroscopy); HMF
(hydroxymethylfurfural); YPD (Yeast extract 10 g/L; Peptone 20 g/L;
Dextrose 20 g/L); DCPIP (2,6-dichlorophenolindophenol); CV (column
volume); NREL (National Renewable Energy Laboratory, Golden,
Colo.); ARS (ARS Culture Collection or NRRL Culture Collection,
Peoria, Ill.); Lallemand (Lallemand Ethanol Technology, Milwaukee,
Wis.); Cayla (Cayla-InvivoGen, Toulouse, France); Agilent New
Brunswick (New Brunswick Scientific Co., Edison, N.J.); Agilent
Technologies (Agilent Technologies, Inc., Santa Clara, Calif.);
Sigma (Sigma Aldrich, St. Louis, Mo.); Qiagen (Qiagen, Inc.,
Valencia, Calif.); Eppendorf (Eppendorf AG, Hamburg, Germany); GE
Healthcare (GE Healthcare, Waukesha, Wis.); Bruker Optics (Bruker
Optics, Inc., Billerica, Mass.); Specac (Specac, Inc., Cranston,
R.I.); Invitrogen (Invitrogen, Corp., Carlsbad, Calif.); Alphalyse
(Alphalyse, Inc., Palo Alto, Calif.); Promega (Promega, Corp.,
Madison, Wis.); Sartorius (Sartorius-Stedim Biotech, SA, Aubagne,
France); Finnzymes (Finnzymes Oy, Espoo, FI [part of Thermo Fisher
Scientific]), CalBiochem (CalBiochem, EMD Chemicals, Inc.,
Gibbstown, N.J.); and Bio-Rad (Bio-Rad Laboratories, Hercules,
Calif.).
[0255] Genomic, cDNA, and amino acid sequences of the three
proteases of the present invention including Protease #1 (SEQ ID
NOS:1-3), Protease #2 (SEQ ID NOS:4-6), Protease #3 (SEQ ID
NOS:7-9) and Protease #4 (SEQ ID NOS:10-12) are provided below.
Protease #1 comprises contig.sub.--1809, Protease #2 comprises
contig.sub.--690, and Protease #3 comprises contig.sub.--1086 as
described in the Examples.
TABLE-US-00002 Protease #1: gDNA: (SEQ ID NO: 1)
ATGCAGCTCCTTAGTCTCGCCGCTCTCCTCCCCCTTGCCCTTGCGGCACCGGTGATCAAGCCT
CAGGGGCTCCAGCTGATTCCGGGCGACTACATCGTGAAGCTGAAGGACGGTGCGTCCGAGA
GCACTCTCCAGGACACCATCCGGCACCTCCAGGCAGGCGAGGCCAAGCATGTCTACCGCGC
ACGCCGGTTCAAGGGCTTCGCGGCCAAGCTGAGCCCGCAGGTGGTCGATACCCTGAGCAAG
CTGCCCGAGGTTCGTTCGTCGTCTCATGTGTAATTATGTCACAAAAAGGGATATGTAGGATG
CTAATTCAGACCCGCAGGTCGAATACATTGAGCAGGACGCCGTCGTCACCATCCAGGCGCTG
GTCACCCAGGAGGACGTGCCCTGGGGTCTGGCCCGCATCTCGCACCACGAACTGGGTCCCAC
GTCGTACGTATACGACGACAGCGCCGGCGAGGGTACCTGCGCCTATGTCATCGACACGGGC
ATCTATGTGGCCCACTCTGTAAGTCTGGCCGTCAATTCACCCACTCTCCCGCTGCTGCCACCG
AATCTCTATTAGTATCTTGACGACTTTGTTGCGGAGACAACGACGCTGACTCTTTTGACTCCA
GCAGTTCGAAGGCCGCGCGACGTGGCTGGCCAACTTTATCGACAGCAGCGATAGCGAGTCA
GTTTAGCATCCCCCACCCCCTGGTTGTTGCACTTGAATGAGCTGACCTTTCATAAATAAACAG
CGGCGCGGGCCACGGCACGCACGTGTCGGGCACGATCGGCGGCGTGACGTACGGCGTGGCC
AAGAAGACCAAGCTGTTCGCGGTCAAGGTGCTCAACGCGAGCGGGTCGGGGACGGTGTCGT
CGGTGCTGGCGGGGCTCGAGTTCGTCGCGTCGGACGCGCCGGCGCGCGTCGCCTCGGGCGA
GTGCGCCAACGGCGCGGTCGCCAACCTGAGCCTCGGCGGCGGCCGGTCCACCGCCATCAAC
GCCGCCGCCGCCGCCGCCGTCGACGCGGGCGTCTTCGTCGCCGTCGCGGCCGGCAACAGCA
ACACCGACGCCCAGTCCACCTCCCCCGCCAGCGAGCCCAGCGTCTGCACCGTCGGCGCCACC
GACGACAGCGACGCCCGCGCCTACTTCTCCAACTACGGCAGCGTCGTCGACGTCTTTGCTCC
CGGCGTCGACGTCCTCAGCAGCTGGATCGGCGGTGTCGATGCCACTGTGAGTTTTTTTTTTTC
CTTTTCCCGTTTCTTTTTGCTTCTTGTTTTCTCCCCATTTTGATGTTTTACATTACTTTCCTTCTT
CGTTGGCCGGATTCGTTTTCATCCTTTTTTTCTTCTTTCTTCTGTCAAAAGGCGATAACAAGG
GATGATGCGGAAAGAGAGAAGAGGAATAAAAACGGGGAACCAGAACAAGAACATACCAGG
CTGACTGGAAAACAAACAGAACACCATCTCGGGCACCTCGATGGCGACCCCGCATATCGCC
GGCCTCGGGGCCTATCTCCTCGCTCTGCTGGGCCCCAGGTCGCCCGAGGAACTGTGCGAGTA
CATCAAGCAGACGGCCACCATCGGCACCATCACCAGCCTCCCCAGCGGCACCATCAACGCC
ATTGCCTACAACGGTGCTACAGCCTAA cDNA: (SEQ ID NO: 2)
ATGCAGCTCCTTAGTCTCGCCGCTCTCCTCCCCCTTGCCCTTGCGGCACCGGTGATCAAGCCT
CAGGGGCTCCAGCTGATTCCGGGCGACTACATCGTGAAGCTGAAGGACGGTGCGTCCGAGA
GCACTCTCCAGGACACCATCCGGCACCTCCAGGCAGGCGAGGCCAAGCATGTCTACCGCGC
ACGCCGGTTCAAGGGCTTCGCGGCCAAGCTGAGCCCGCAGGTGGTCGATACCCTGAGCAAG
CTGCCCGAGGTCGAATACATTGAGCAGGACGCCGTCGTCACCATCCAGGCGCTGGTCACCCA
GGAGGACGTGCCCTGGGGTCTGGCCCGCATCTCGCACCACGAACTGGGTCCCACGTCGTACG
TATACGACGACAGCGCCGGCGAGGGTACCTGCGCCTATGTCATCGACACGGGCATCTATGTG
GCCCACTCTCAGTTCGAAGGCCGCGCGACGTGGCTGGCCAACTTTATCGACAGCAGCGATAG
CGACGGCGCGGGCCACGGCACGCACGTGTCGGGCACGATCGGCGGCGTGACGTACGGCGTG
GCCAAGAAGACCAAGCTGTTCGCGGTCAAGGTGCTCAACGCGAGCGGGTCGGGGACGGTGT
CGTCGGTGCTGGCGGGGCTCGAGTTCGTCGCGTCGGACGCGCCGGCGCGCGTCGCCTCGGGC
GAGTGCGCCAACGGCGCGGTCGCCAACCTGAGCCTCGGCGGCGGCCGGTCCACCGCCATCA
ACGCCGCCGCCGCCGCCGCCGTCGACGCGGGCGTCTTCGTCGCCGTCGCGGCCGGCAACAGC
AACACCGACGCCCAGTCCACCTCCCCCGCCAGCGAGCCCAGCGTCTGCACCGTCGGCGCCAC
CGACGACAGCGACGCCCGCGCCTACTTCTCCAACTACGGCAGCGTCGTCGACGTCTTTGCTC
CCGGCGTCGACGTCCTCAGCAGCTGGATCGGCGGTGTCGATGCCACTAACACCATCTCGGGC
ACCTCGATGGCGACCCCGCATATCGCCGGCCTCGGGGCCTATCTCCTCGCTCTGCTGGGCCC
CAGGTCGCCCGAGGAACTGTGCGAGTACATCAAGCAGACGGCCACCATCGGCACCATCACC
AGCCTCCCCAGCGGCACCATCAACGCCATTGCCTACAACGGTGCTACAGCCTAA Polypeptide:
(SEQ ID NO: 3)
MQLLSLAALLPLALAAPVIKPQGLQLIPGDYIVKLKDGASESTLQDTIRHLQAGEAKHVYRARRF
KGFAAKLSPQVVDTLSKLPEVEYIEQDAVVTIQALVTQEDVPWGLARISHHELGPTSYVYDDSA
GEGTCAYVIDTGIYVAHSQFEGRATWLANFIDSSDSDGAGHGTHVSGTIGGVTYGVAKKTKLFA
VKVLNASGSGTVSSVLAGLEFVASDAPARVASGECANGAVANLSLGGGRSTAINAAAAAAVDA
GVFVAVAAGNSNTDAQSTSPASEPSVCTVGATDDSDARAYFSNYGSVVDVFAPGVDVLSSWIG
GVDATNTISGTSMATPHIAGLGAYLLALLGPRSPEELCEYIKQTATIGTITSLPSGTINAIAYNGAT
A Protease #2: gDNA: (SEQ ID NO: 4)
ATGAGGTTACTCCGCACCGCGGGAGCGGCAACTCTCTTCCTGTCGCCCGCCACTTTTGCGAC
CAACAACCCTCTGACCCCAGGCAAACTTGAGGCGGACATTAGAACCGAAGAGTATGAGAAG
ACAACAGTGCCAAACCTTTGATCCCTCTCATTCGTTAACGAATATTGCCAAACCAGGTTGCA
AAATGTCCTCTGGAACCTCAATCACATTGCGGTCACCCACGGCGGCAACCGAGCCTTTGGCG
AGCCTGGGTACAAAGCCTCGCTCGACTTTATTCTCGAGCGCGCCCAGACACGCTTCCACAAT
GAGTTTGACACTGTCGTTCAGCCCTTCAACCACACCTACGGCAAGACGAACCAGATCAAGGT
GACTGGACCAGAGGGCGAGGATGTCTTTGTCATCAGCCCATTGTACAATCCCGCCACGCCGC
TGCCTGATGGTATCACCGCTCCCTTGGTAGATACACCGGTCGATGACGAGCGCGGATCGGCG
TGCTTTCCGGACCAGTGGGAGGGGGTCGATGTGAAGGGGAAGCTGGTACTAGTAAAGAGAG
GCATTTGTGCTGTGGCAGATAAGTCGGCCCTTGCTAAGGAGCGCGGGGCACTGGGTGAGCTA
CGTCCTGGCTGACGGGGGAAGCAAACGTTGACGTCGCTCTAGGGGTGATCTTGTATAACGAA
CAGCCGGGTACGAACATCGTCGTCCCGACTCTGGGTGCAGAGAGCATCGGCAAGACTGTTCC
TATCGGAATTATTCCCTTGGAAGTAGGACAGAGCTGGAAGTCCCGGTTGGCAGATGGCGAG
GAGGTGACTGTGCACCTGCTGGTCGATTCCATATCCGATACGCGCGAGACGTGGAACATTAT
TGCCGAGACCAAACAGGGCGACCCCGACAAAGTTATCATGCTCGGTGCACATCTCGACAGC
GTGCAGGCGGGAGCAGGCATCAATGACGACGGCAGCGGCACGGCAGCTCTCCTGGAGATCT
TGACCGCGGTCCGGCGCTACGATGGATTCCCACATAAGATTCGGTTCGCCTGGTGGGCAGCA
GAAGAGAGTGGTCTGGTCGGATCCCTCTACTACACCTCCCACTTGACCGAGGAGGAAGCCG
ACCGCATCAAGTATTACTTCAACTACGACATGATTGGCTCTCCCCATCCCGACTTTGAAATTG
CAAGCGATGGCAACAGCGGAGTCGGGCCGCAGCTTCTGGAGGAATACCTCGTCGAGCAGGG
GAAGGAGATTGTCCACGGGTAAGTAGATCCCACTCCAGCTCCACATCTATTTTGCGTACCTG
GTACCTCTATGATATGTGCAGGTTCCGCTGACCTTGGGATGCAAGCGGCTTCGGTTCTGGCTC
CGATTTTGTGGGCTTCCTCGAGCTTGGCATCCCGAGTACCGCGCTACATACCGGTGCAGGAG
CTCCATTCGACGAATGCTACCACCAGGCGTGTGATGACCTCGACAATATCAACTGGGAGGCG
CTGACCGTCAATGCCAAAGCGGCCGCTCGGGCGGCTGCCCGGCTGGCCAACTCGCTCGAGG
GCGTGCCGCCCCGCAAGAAAACTAGCCTGAATCTTCACACGCGCCGTGGAGTGGTGCAAAA
CTTCCGAAAGTGGGCTTCATTGGCCGAGGAAGCGAGCCACGGGCACACGTGCTCGCACACG
GGAAAGAGGGTCGTAGTGTAA eDNA: (SEQ ID NO: 5)
ATGAGGTTACTCCGCACCGCGGGAGCGGCAACTCTCTTCCTGTCGCCCGCCACTTTTGCGAC
CAACAACCCTCTGACCCCAGGCAAACTTGAGGCGGACATTAGAACCGAAGAGTTGCAAAAT
GTCCTCTGGAACCTCAATCACATTGCGGTCACCCACGGCGGCAACCGAGCCTTTGGCGAGCC
TGGGTACAAAGCCTCGCTCGACTTTATTCTCGAGCGCGCCCAGACACGCTTCCACAATGAGT
TTGACACTGTCGTTCAGCCCTTCAACCACACCTACGGCAAGACGAACCAGATCAAGGTGACT
GGACCAGAGGGCGAGGATGTCTTTGTCATCAGCCCATTGTACAATCCCGCCACGCCGCTGCC
TGATGGTATCACCGCTCCCTTGGTAGATACACCGGTCGATGACGAGCGCGGATCGGCGTGCT
TTCCGGACCAGTGGGAGGGGGTCGATGTGAAGGGGAAGCTGGTACTAGTAAAGAGAGGCAT
TTGTGCTGTGGCAGATAAGTCGGCCCTTGCTAAGGAGCGCGGGGCACTGGGGGTGATCTTGT
ATAACGAACAGCCGGGTACGAACATCGTCGTCCCGACTCTGGGTGCAGAGAGCATCGGCAA
GACTGTTCCTATCGGAATTATTCCCTTGGAAGTAGGACAGAGCTGGAAGTCCCGGTTGGCAG
ATGGCGAGGAGGTGACTGTGCACCTGCTGGTCGATTCCATATCCGATACGCGCGAGACGTGG
AACATTATTGCCGAGACCAAACAGGGCGACCCCGACAAAGTTATCATGCTCGGTGCACATCT
CGACAGCGTGCAGGCGGGAGCAGGCATCAATGACGACGGCAGCGGCACGGCAGCTCTCCTG
GAGATCTTGACCGCGGTCCGGCGCTACGATGGATTCCCACATAAGATTCGGTTCGCCTGGTG
GGCAGCAGAAGAGAGTGGTCTGGTCGGATCCCTCTACTACACCTCCCACTTGACCGAGGAG
GAAGCCGACCGCATCAAGTATTACTTCAACTACGACATGATTGGCTCTCCCCATCCCGACTT
TGAAATTGCAAGCGATGGCAACAGCGGAGTCGGGCCGCAGCTTCTGGAGGAATACCTCGTC
GAGCAGGGGAAGGAGATTGTCCACGGCGGCTTCGGTTCTGGCTCCGATTTTGTGGGCTTCCT
CGAGCTTGGCATCCCGAGTACCGCGCTACATACCGGTGCAGGAGCTCCATTCGACGAATGCT
ACCACCAGGCGTGTGATGACCTCGACAATATCAACTGGGAGGCGCTGACCGTCAATGCCAA
AGCGGCCGCTCGGGCGGCTGCCCGGCTGGCCAACTCGCTCGAGGGCGTGCCGCCCCGCAAG
AAAACTAGCCTGAATCTTCACACGCGCCGTGGAGTGGTGCAAAACTTCCGAAAGTGGGCTTC
ATTGGCCGAGGAAGCGAGCCACGGGCACACGTGCTCGCACACGGGAAAGAGGGTCGTAGTG TAA
Polypeptide: (SEQ ID NO: 6)
MRLLRTAGAATLFLSPATFATNNPLTPGKLEADIRTEELQNVLWNLNHIAVTHGGNRAFGEPGY
KASLDFILERAQTRFHNEFDTVVQPFNHTYGKTNQIKVTGPEGEDVFVISPLYNPATPLPDGITAP
LVDTPVDDERGSACFPDQWEGVDVKGKLVLVKRGICAVADKSALAKERGALGVILYNEQPGTN
IVVPTLGAESIGKTVPIGIIPLEVGQSWKSRLADGEEVTVHLLVDSISDTRETWNIIAETKQGDPDK
VIMLGAHLDSVQAGAGINDDGSGTAALLEILTAVRRYDGFPHKIRFAWWAAEESGLVGSLYYTS
HLTEEEADRIKYYFNYDMIGSPHPDFEIASDGNSGVGPQLLEEYLVEQGKEIVHGGFGSGSDFVG
FLELGIPSTALHTGAGAPFDECYHQACDDLDNINWEALTVNAKAAARAAARLANSLEGVPPRKK
TSLNLHTRRGVVQNFRKWASLAEEASHGHTCSHTGKRVVV Protease #3: gDNA: (SEQ ID
NO: 7)
ATGTGTTGGCTGTGGGAGCGATCAGTGGCAATATTACTGGCGGCCGGCGTGATCGCCAACCC
GCTCCGCCCGCGCCGGATCCCCTGGCCGGAGCCGGTTCCGGCATCTTCCATCGGGCCCATTG
ACTGGTCTTCAATACCGCCTTCTCCCTACAAACACGCCTTGCGGCAGACCAACACCACCACG
ACCAGCAGCAGTAGCAGCAGCAGCAGCAGCAAATATGACAATCAAGTCTACTCGGTACAGG
TCTCGGGATCTTCCTCCTCCCCGCCAGCATCCGTCGACTGGCGCAACCGCGACGGCCAGAAC
TACATCACGACACCGCAGGACCAGGGCGCCTGTAACAGCTGCTGGGCGTTCGCCGTGGCGG
CGCTGATCGAGTCCATGATGCGCATCGAGCACGGGGTCTGGGGCAAGCGCAGCGAGGCCGA
CGTGCACGACGGGGTGGGCGCGGCGTGCGAGAGCGTGGGCAACGCCGAGGACACGCTGGCC
TGGGTGGCCGGGCAGGGGCCCGAATTCGTCGCCGACCCGACCCGGCCCGCCCCGGGCATCG
CCGACTGGGCCTGCGACCCCTACGAGGCGACGGCGCACGCCTACGAGCACTGCGACGACCG
CTCCGGGCGCACGACGCACATTCCCTACTACCAGGCCCTCGGCCTGGTCGAGGACCAGAAGC
GGTGGCTGGACGAGTACGGGCCCATCATCGCCACCTTTGTCCTCTACGACGACTTTGGCTCG
TGGAAGCCGACCGCGGCCGGCGGAAGCGGCGGTGACGTGTACCGGTGGGACGGCGTTTCCG
GCTCGGACGGCAACCACCTCGCCATCGTGATCGGCTACGACGACGAGAAGCAGGCCTGGCT
TATGAAGAACTCATGGGGATCCGGATGGGGGGACGAGGGATTTGTCTACTTTGCGTAAGTCA
GGGGTTCCACTGCTTTTTTTTTTTTCCCCTCCAAAATCGTTTGCCTCTCGGTAATTTTATCCGC
ATCCAGGGAACTGACAACAGATACAGGTACGGCGAGGCCAACATCGACAACTGGACCAAGT
ATGGGCTCGTCAATGTCAACCCGGACCCGTGGACACGCAGGAAGCACCAGAGCGGAAGCAT
GATGCAATCCGGCAACGGCGAGACGCACCGAAACTTTGAGCTGCTCGTCAGCGAGGCCGGG
GGTTCCGGCTTCACGCACGTCTCCCGCGATGGGAACAGTACCCAATGGAGCAAGGTGCTGG
AGGTCTCGGGCAGCGGCAGCGGCAGCGGCCTCGTGGGCCAGCCTGCCATTCTCGGCACCTCC
TTCAACCGGGACTTCCACGCGGTGAGCCTGGATGAGAACCAGGTGGTCCAACAGTGGGCAT
ACAGACAGTCGGAGATGCGCTGGTCCCGGGTCTCGGCCATCGAGGGCACTAAGATCGACGG
CTTTCCCGGTCTCGCCCAGAGCGACGGCTCAACTCTGGTCATGGTGGTCAAGCACGCCGACG
GCACCCTGAACGAGGTAAGCATATCTTGCCGGAAGTCATAATTAACGAAGGAAGATCTTCC
GTAAAAGAAAAGGAAAAGATGAAAAAAAAAAGGTACACGTGCTAACGGCGGATCGCACAA
GTGGCAACAAGCACCCAACAGCACAACCTGGACCCTGGCCAACTCACCCATCGCAAGCGGC
ATCGCCCAGAGCGGGCCGGCGCTCGTGCAGTCCAACGCCGGACTCAACCTCTACGACCGGC
AGCAGGGCGCCTCGCGGGGCAACATCTACACCGTCGCGGTCCGCGAGGACGGCAAGCTGCA
GCTCTTCTGGCGCCCCGGCGCGGACGCGGCCGGGTGGTCGGCCGGGGAGGTGTTCGGCGGC
TCCGGCGTCGTGGACCCCGGCTCGCCGCCCGTCATGATTCAGGACTACTCGGGGACGGCCAA
CGAGACGAGCGTCGGCCGGTTCCAGCTGGCCGTCGCCGTCGGGGGGAGCGTCCAACACTGG
GAGCGGGCCAACGACGACCTCGAGGCCGGGCAGGCCCCGCCCGCGGGGGCAGAAGGGGGG
TCCCCGGCGGGCAGGTGGGAACTGGTCGAGACGGCGGGCACCGGGGTGAAGCGCGTCTGGG
CGCTGCTCCAGGGGAGCTTTGGTGGGAGGCTGCACATGATCACGGAGGGCACGGACGGCCG
GCTGTCGTACTGGGAGCGCGATGAGAAGTGGGTTGAGGTCGAGAAGCTGCCGGCGTTGAGC
GACGCCGCTTGGACGAGATCGGGCCCGGTGAGTGGTGGTTGAGGGTAGTCCCAAGTACCTG
ATTATAATTATATGAAAGAGATGTCCCCCGAATAATTATATGAGTGAACCAACGACCATGAA
GACATGCGGCTTTATCAGCATACCGACGCGACTTGTCCTGGTTGCATCTGCTACGACCCCTG
ATTAATTACAACACCGCACAGCGGCAGAGACGGGGCCAGAAGCTGCACATAGAAAGAAGG
CTGGACAACTTCCCCGAGACGCTATAA cDNA: (SEQ ID NO: 8) ATGTGTTGGC
TGTGGGAGCG ATCAGTGGCA ATATTACTGG CGGCCGGCGT GATCGCCAAC CCGCTCCGCC
CGCGCCGGAT CCCCTGGCCG GAGCCGGTTC CGGCATCTTC CATCGGGCCC ATTGACTGGT
CTTCAATACC GCCTTCTCCC TACAAACACG CCTTGCGGCA GACCAACACC ACCACGACCA
GCAGCAGTAG CAGCAGCAGC AGCAGCAAATATGACAATCAAGTCTACTCG GTACAGGTCT
CGGGATCTTC CTCCTCCCCG CCAGCATCCG TCGACTGGCG CAACCGCGAC GGCCAGAACT
ACATCACGAC ACCGCAGGAC CAGGGCGCCT GTAACAGCTGCTGGGCGTTC GCCGTGGCGG
CGCTGATCGA GTCCATGATG CGCATCGAGC ACGGGGTCTGGGGCAAGCGC AGCGAGGCCG
ACGTGCACGA CGGGGTGGGCGCGGCGTGCGAGAGCGTGGGCAACGCCGAG GACACGCTGG
CCTGGGTGGC CGGGCAGGGG CCCGAATTCG TCGCCGACCCGACCCGGCCC GCCCCGGGCA
TCGCCGACTG GGCCTGCGAC CCCTACGAGG CGACGGCGCACGCCTACGAG CACTGCGACG
ACCGCTCCGG GCGCACGACG CACATTCCCT ACTACCAGGC CCTCGGCCTG GTCGAGGACC
AGAAGCGGTG GCTGGACGAG TACGGGCCCA TCATCGCCAC CTTTGTCCTC TACGACGACT
TTGGCTCGTG GAAGCCGACC GCGGCCGGCG GAAGCGGCGGTGACGTGTAC CGGTGGGACG
GCGTTTCCGG CTCGGACGGC AACCACCTCG CCATCGTGAT CGGCTACGAC GACGAGAAGC
AGGCCTGGCT TATGAAGAACTCATGGGGATCCGGATGGGGGGACGAGGGA TTTGTCTACT
TTGCGTACGG CGAGGCCAAC ATCGACAACT GGACCAAGTA TGGGCTCGTC AATGTCAACC
CGGACCCGTG GACACGCAGG AAGCACCAGAGCGGAAGCATGATGCAATCC GGCAACGGCG
AGACGCACCG AAACTTTGAG CTGCTCGTCA GCGAGGCCGGGGGTTCCGGC TTCACGCACG
TCTCCCGCGA TGGGAACAGT ACCCAATGGA GCAAGGTGCT GGAGGTCTCG GGCAGCGGCA
GCGGCAGCGG CCTCGTGGGC CAGCCTGCCA TTCTCGGCAC CTCCTTCAAC CGGGACTTCC
ACGCGGTGAG CCTGGATGAG AACCAGGTGG TCCAACAGTGGCATACAGA CAGTCGGAGA
TGCGCTGGTC CCGGGTCTCG GCCATCGAGG GCACTAAGAT CGACGGCTTT CCCGGTCTCG
CCCAGAGCGA CGGCTCAACT CTGGTCATGG TGGTCAAGCA CGCCGACGGC ACCCTGAACG
AGTGGCAACA AGCACCCAAC AGCACAACCT GGACCCTGGCCAACTCACCC ATCGCAAGCG
GCATCGCCCA GAGCGGGCCG GCGCTCGTGC AGTCCAACGCGGACTCAAC CTCTACGACC
GGCAGCAGGG CGCCTCGCGG GGCAACATCT ACACCGTCGC GGTCCGCGAG GACGGCAAGC
TGCAGCTCTT CTGGCGCCCC GGCGCGGACG CGGCCGGGTGGTCGGCCGGG GAGGTGTTCG
GCGGCTCCGG CGTCGTGGAC CCCGGCTCGC CGCCCGTCAT GATTCAGGAC TACTCGGGGA
CGGCCAACGA GACGAGCGTC GGCCGGTTCC AGCTGGCCGTCGCCGTCGGG GGGAGCGTCC
AACACTGGGA GCGGGCCAAC GACGACCTCGAGGCCGGGCAGGCCCCGCCC GCGGGGGCAG
AAGGGGGGTC CCGGCGGGCAGGTGGGAACTGGTCGAGACGGCGGGCACC GGGGTGAAGC
GCGTCTGGGC GCTGCTCCAG GGGAGCTTTG GTGGGAGGCT GCACATGATC ACGGAGGGCA
CGGACGGCCG GCTGTCGTAC TGGGAGCGCGATGAGAAGTGGGTTGAGGTC GAGAAGCTGC
CGGCGTTGAG CGACGCCGCT TGGACGAGAT CGGGCCCGGTGAGTGGTGGT TGA
Polypeptide: (SEQ ID NO: 9) MCWLWERSVA ILLAAGVIAN PLRPRRIPWP
EPVPASSIGP IDWSSIPPSP YKHALRQTNT TTTSSSSSSS SSKYDNQVYS VQVSGSSSSP
PASVDWRNRD GQNYITTPQD QGACNSCWAF AVAALIESMM RIEHGVWGKR SEADVHDGVG
AACESVGNAE DTLAWVAGQG PEFVADPTRP APGIADWACD PYEATAHAYE HCDDRSGRTT
HIPYYQALGL VEDQKRWLDE YGPIIATFVL YDDFGSWKPT AAGGSGGDVY
RWDGVSGSDGNHLAIVIGYDDEKQAWLMKNSWGSGWGDEG FVYFAYGEAN IDNWTKYGLV
NVNPDPWTRR KHQSGSMMQS GNGETHRNFE LLVSEAGGSG FTHVSRDGNS TQWSKVLEVS
GSGSGSGLVG QPAILGTSFN RDFHAVSLDE NQVVQQWAYR QSEMRWSRVS AIEGTKIDGF
PGLAQSDGST LVMVVKHADG TLNEWQQAPN STTWTLANSP IASGIAQSGP ALVQSNAGLN
LYDRQQGASR GNIYTVAVRE DGKLQLFWRP GADAAGWSAG EVFGGSGVVD PGSPPVMIQD
YSGTANETSV GRFQLAVAVG GSVQHWERAN DDLEAGQAPP AGAEGGSPAG RWELVETAGT
GVKRVWALLQ GSFGGRLHMI TEGTDGRLSY WERDEKWVEV EKLPALSDAA WTRSGPVSGG
Protease #4: gDNA: (SEQ ID NO:10)
ATGTGTTGGCTGTGGGAGCGATCAGTGGCAATATTACTGGCGGCCGGCGTGATCGCCAACCC
GCTCCGCCCGCGCCGGATCCCCTGGCCGGAGCCGGTTCCGGCATCTTCCATCGGGCCCATTG
ACTGGTCTTCAATACCGCCTTCTCCCTACAAACACGCCTTGCGGCAGACCAACACCACCACG
ACCAGCAGCAGTAGCAGCAGCAGCAGCAGCAAATATGACAATCAAGTCTACTCGGTACAGG
TCTCGGGATCTTCCTCCTCCCCGCCAGCATCCGTCGACTGGCGCAACCGCGACGGCCAGAAC
TACATCACGACACCGCAGGACCAGGGCGCCTGTAACAGCTGCTGGGCGTTCGCCGTGGCGG
CGCTGATCGAGTCCATGATGCGCATCGAGCACGGGGTCTGGGGCAAGCGCAGCGAGGCCGA
CGTGCACGACGGGGTGGGCGCGGCGTGCGAGAGCGTGGGCAACGCCGAGGACACGCTGGCC
TGGGTGGCCGGGCAGGGGCCCGAATTCGTCGCCGACCCGACCCGGCCCGCCCCGGGCATCG
CCGACTGGGCCTGCGACCCCTACGAGGCGACGGCGCACGCCTACGAGCACTGCGACGACCG
CTCCGGGCGCACGACGCACATTCCCTACTACCAGGCCCTCGGCCTGGTCGAGGACCAGAAG
CGGTGGCTGGACGAGTACGGGCCCATCATCGCCACCTTTGTCCTCTACGACGACTTTGGCTC
GTGGAAGCCGACCGCGGCCGGCGGAAGCGGCGGTGACGTGTACCGGTGGGACGGCGTTTCC
GGCTCGGACGGCAACCACCTCGCCATCGTGATCGGCTACGACGACGAGAAGCAGGCCTGGC
TTATGAAGAACTCATGGGGATCCGGATGGGGGGACGAGGGATTTGTCTACTTTGCGTAAGTC
AGGGGTTCCACTGCTTTTTTTTTTTTCCCCTCCAAAATCGTTTGCCTCTCGGTAATTTTATCCG
CATCCAGGGAACTGACAACAGATACAGGTACGGCGAGGCCAACATCGACAACTGGACCAAG
TATGGGCTCGTCAATGTCAACCCGGACCCGTGGACACGCAGGAAGCACCAGAGCGGAAGCA
TGATGCAATCCGGCAACGGCGAGACGCACCGAAACTTTGAGCTGCTCGTCAGCGAGGCCGG
GGGTTCCGGCTTCACGCACGTCTCCCGCGATGGGAACAGTACCCAATGGAGCAAGGTGCTG
GAGGTCTCGGGCAGCGGCAGCGGCAGCGGCCTCGTGGGCCAGCCTGCCATTCTCGGCACCTC
CTTCAACCGGGACTTCCACGCGGTGAGCCTGGATGAGAACCAGGTGGTCCAACAGTGGGCA
TACAGACAGTCGGAGATGCGCTGGTCCCGGGTCTCGGCCATCGAGGGCACTAAGATCGACG
GCTTTCCCGGTCTCGCCCAGAGCGACGGCTCAACTCTGGTCATGGTGGTCAAGCACGCCGAC
GGCACCCTGAACGAGGTAAGCATATCTTGCCGGAAGTCATAATTAACGAAGGAAGATCTTC
CGTAAAAGAAAAGGAAAAGATGAAAAAAAAAAGGTACACGTGCTAACGGCGGATCGCACA
AGTGGCAACAAGCACCCAACAGCACAACCTGGACCCTGGCCAACTCACCCATCGCAAGCGG
CATCGCCCAGAGCGGGCCGGCGCTCGTGCAGTCCAACGCCGGACTCAACCTCTACGACCGG
CAGCAGGGCGCCTCGCGGGGCAACATCTACACCGTCGCGGTCCGCGAGGACGGCAAGCTGC
AGCTCTTCTGGCGCCCCGGCGCGGACGCGGCCGGGTGGTCGGCCGGGGAGGTGTTCGGCGG
CTCCGGCGTCGTGGACCCCGGCTCGCCGCCCGTCATGATTCAGGACTACTCGGGGACGGCCA
ACGAGACGAGCGTCGGCCGGTTCCAGCTGGCCGTCGCCGTCGGGGGGAGCGTCCAACACTG
GGAGCGGGCCAACGACGACCTCGAGGCCGGGCAGGCCCCGCCCGCGGGGGCAGAAGGGGG
GTCCCCGGCGGGCAGGTGGGAACTGGTCGAGACGGCGGGCACCGGGGTGAAGCGCGTCTGG
GCGCTGCTCCAGGGGAGCTTTGGTGGGAGGCTGCACATGATCACGGAGGGCACGGACGGCC
GGCTGTCGTACTGGGAGCGCGATGAGAAGTGGGTTGAGGTCGAGAAGCTGCCGGCGTTGAG
CGACGCCGCTTGGACGAGATCGGGCCCGGTGAGTGGTGGTTGAGGGTAGTCCCAAGTACCT
GATTATAATTATATGAAAGAGATGTCCCCCGAATAATTATATGAGTGAACCAACGACCATGA
AGACATGCGGCTTTATCAGCATACCGACGCGACTTGTCCTGGTTGCATCTGCTACGACCCCT
GATTAATTACAACACCGCACAGCGGCAGAGACGGGGCCAGAAGCTGCACATAGAAAGAAG
GCTGGACAACTTCCCCGAGACGCTA cDNA: (SEQ ID NO: 11)
ATGTGTTGGCTGTGGGAGCGATCAGTGGCAATATTACTGGCGGCCGGCGTGATCGCCAAC
CCGCTCCGCCCGCGCCGGATCCCCTGGCCGGAGCCGGTTCCGGCATCTTCCATCGGGCCC
ATTGACTGGTCTTCAATACCGCCTTCTCCCTACAAACACGCCTTGCGGCAGACCAACACC
ACCACGACCAGCAGCAGTAGCAGCAGCAGCAGCAGCAAATATGACAATCAAGTCTACTCG
GTACAGGTCTCGGGATCTTCCTCCTCCCCGCCAGCATCCGTCGACTGGCGCAACCGCGAC
GGCCAGAACTACATCACGACACCGCAGGACCAGGGCGCCTGTAACAGCTGCTGGGCGTTC
GCCGTGGCGGCGCTGATCGAGTCCATGATGCGCATCGAGCACGGGGTCTGGGGCAAGCGC
AGCGAGGCCGACGTGCACGACGGGGTGGGCGCGGCGTGCGAGAGCGTGGGCAACGCCGAG
GACACGCTGGCCTGGGTGGCCGGGCAGGGGCCCGAATTCGTCGCCGACCCGACCCGGCCC
GCCCCGGGCATCGCCGACTGGGCCTGCGACCCCTACGAGGCGACGGCGCACGCCTACGAG
CACTGCGACGACCGCTCCGGGCGCACGACGCACATTCCCTACTACCAGGCCCTCGGCCTG
GTCGAGGACCAGAAGCGGTGGCTGGACGAGTACGGGCCCATCATCGCCACCTTTGTCCTC
TACGACGACTTTGGCTCGTGGAAGCCGACCGCGGCCGGCGGAAGCGGCGGTGACGTGTAC
CGGTGGGACGGCGTTTCCGGCTCGGACGGCAACCACCTCGCCATCGTGATCGGCTACGAC
GACGAGAAGCAGGCCTGGCTTATGAAGAACTCATGGGGATCCGGATGGGGGGACGAGGGA
TTTGTCTACTTTGCGTACGGCGAGGCCAACATCGACAACTGGACCAAGTATGGGCTCGTCAA
TGTCAACCCGGACCCGTGGACACGCAGGAAGCACCAGAGCGGAAGCATGATGCAATCCGGC
AACGGCGAGACGCACCGAAACTTTGAGCTGCTCGTCAGCGAGGCCGGGGGTTCCGGCTTCA
CGCACGTCTCCCGCGATGGGAACAGTACCCAATGGAGCAAGGTGCTGGAGGTCTCGGGCAG
CGGCAGCGGCAGCGGCCTCGTGGGCCAGCCTGCCATTCTCGGCACCTCCTTCAACCGGGACT
TCCACGCGGTGAGCCTGGATGAGAACCAGGTGGTCCAACAGTGGGCATACAGACAGTCGGA
GATGCGCTGGTCCCGGGTCTCGGCCATCGAGGGCACTAAGATCGACGGCTTTCCCGGTCTCG
CCCAGAGCGACGGCTCAACTCTGGTCATGGTGGTCAAGCACGCCGACGGCACCCTGAACGA
GTGGCAACAAGCACCCAACAGCACAACCTGGACCCTGGCCAACTCACCCATCGCAAGCGGC
ATCGCCCAGAGCGGGCCGGCGCTCGTGCAGTCCAACGCCGGACTCAACCTCTACGACCGGC
AGCAGGGCGCCTCGCGGGGCAACATCTACACCGTCGCGGTCCGCGAGGACGGCAAGCTGCA
GCTCTTCTGGCGCCCCGGCGCGGACGCGGCCGGGTGGTCGGCCGGGGAGGTGTTCGGCGGC
TCCGGCGTCGTGGACCCCGGCTCGCCGCCCGTCATGATTCAGGACTACTCGGGGACGGCCAA
CGAGACGAGCGTCGGCCGGTTCCAGCTGGCCGTCGCCGTCGGGGGGAGCGTCCAACACTGG
GAGCGGGCCAACGACGCCTCGAGGCCGGGCAGGCCCCGCCCGCGGGGGCAGAAGGGGGGT
CCCCGGCGGGCAGGTGGGAACTGGTCGAGACGGCGGGCACCGGGGTGAAGCGCGTCTGGGC
GCTGCTCCAGGGGAGCTTTGGTGGGAGGCTGCACATGATCACGGAGGGCACGGACGGCCGG
CTGTCGTACTGGGAGCGCGATGAGAAGTGGGTTGAGGTCGAGAAGCTGCCGGCGTTGAGCG
ACGCCGCTTGGACGAGATCGGGCCCGGTGAGTGGTGGTTGA Polypeptide: (SEQ ID NO:
12)
MCWLWERSVAILLAAGVIANPLRPRRIPWPEPVPASSIGPIDWSSIPPSPYKHALRQTNTTTTSSSS
SSSSSKYDNQVYSVQVSGSSSSPPASVDWRNRDGQNYITTPQDQGACNSCWAFAVAALIESMMR
IEHGVWGKRSEADVHDGVGAACESVGNAEDTLAWVAGQGPEFVADPTRPAPGIADWACDPYE
ATAHAYEHCDDRSGRTTHLPYYQALGLVEDQKRWLDEYGPIIATFVLYDDFGSWKPTAAGGSG
GDVYRWDGVSGSDGNHLAIVIGYDDEKQAWLMKNSWGSGWGDEGFVYFAYGEANIDNWTKY
GLVNVNPDPWTRRKHQSGSMMQSGNGETHRNFELLVSEAGGSGFTHVSRDGNSTQWSKVLEV
SGSGSGSGLVGQPAILGTSFNRDFHAVSLDENQVVQQWAYRQSEMRWSRVSAIEGTKIDGFPGL
AQSDGSTLVMVVKHADGTLNEWQQAPNSTTWTLANSPIASGIAQSGPALVQSNAGLNLYDRQQ
GASRGNIYTVAVREDGKLQLFWRPGADAAGWSAGEVFGGSGVVDPGSPPVMIQDYSGTANETS
VGRFQLAVAVGGSVQHWERANDDLEAGQAPPAGAEGGSPAGRWELVETAGTGVKRVWALLQ
GSFGGRLHMITEGTDGRLSYWERDEKWVEVEKLPALSDAAWTRSGPRQRRGQKLHIERRLDNF
PETL
[0256] The wild-type M. thermophila C1 GH61a cDNA (SEQ ID NO:13)
and amino acid (SEQ ID NO:14) sequences are provided below. The
signal sequence is underlined in SEQ ID NO:14. SEQ ID NO:15
provides the GH61a sequence without the signal sequence.
TABLE-US-00003 (SEQ ID NO: 13)
ATGTCCAAGGCCTCTGCTCTCCTCGCTGGCCTGACGGGCGCGGCCCTCGTCGCTGCACATGG
CCACGTCAGCCACATCGTCGTCAACGGCGTCTACTACAGGAACTACGACCCCACGACAGACT
GGTACCAGCCCAACCCGCCAACAGTCATCGGCTGGACGGCAGCCGATCAGGATAATGGCTT
CGTTGAACCCAACAGCTTTGGCACGCCAGATATCATCTGCCACAAGAGCGCCACCCCCGGCG
GCGGCCACGCTACCGTTGCTGCCGGAGACAAGATCAACATCGTCTGGACCCCCGAGTGGCCC
GAATCCCACATCGGCCCCGTCATTGACTACCTAGCCGCCTGCAACGGTGACTGCGAGACCGT
CGACAAGTCGTCGCTGCGCTGGTTCAAGATTGACGGCGCCGGCTACGACAAGGCCGCCGGC
CGCTGGGCCGCCGACGCTCTGCGCGCCAACGGCAACAGCTGGCTCGTCCAGATCCCGTCGGA
TCTCAAGGCCGGCAACTACGTCCTCCGCCACGAGATCATCGCCCTCCACGGTGCTCAGAGCC
CCAACGGCGCCCAGGCCTACCCGCAGTGCATCAACCTCCGCGTCACCGGCGGCGGCAGCAA
CCTGCCCAGCGGCGTCGCCGGCACCTCGCTGTACAAGGCGACCGACCCGGGCATCCTCTTCA
ACCCCTACGTCTCCTCCCCGGATTACACCGTCCCCGGCCCGGCCCTCATTGCCGGCGCCGCC
AGCTCGATCGCCCAGAGCACGTCGGTCGCCACTGCCACCGGCACGGCCACCGTTCCCGGCGG
CGGCGGCGCCAACCCTACCGCCACCACCACCGCCGCCACCTCCGCCGCCCCGAGCACCACCC
TGAGGACGACCACTACCTCGGCCGCGCAGACTACCGCCCCGCCCTCCGGCGATGTGCAGACC
AAGTACGGCCAGTGTGGTGGCAACGGATGGACGGGCCCGACGGTGTGCGCCCCCGGCTCGA
GCTGCTCCGTCCTCAACGAGTGGTACTCCCAGTGTTTGTAA (SEQ ID NO: 14)
MSKASALLAGLTGAALVAAHGHVSIEVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGF
VEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPESITIGPVIDYLAACNGDCETVDKSS
LRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRIIEIIALHGAQSPNGAQ
AYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSV
ATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGW
TGPTVCAPGSSCSVLNEWYSQCL (SEQ ID NO: 15)
HGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSEGTPDIICIIKSATPGG
GHATVAAGDKINIVWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRW
AADALRANGNSWLVQIPSDLIKAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSG
VAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTA
TTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYS
QCL
[0257] The cDNA sequence of a M. thermophila GH61a variant
("Variant 1") (SEQ ID NO:16) and amino acid (SEQ ID NO:17) sequence
are provided below. The signal sequence is underlined in SEQ ID
NO:17. SEQ ID NO:18 provides the GH61a Variant 1 sequence without
the signal sequence.
TABLE-US-00004 (SEQ ID NO: 16)
ATGTCCAAGGCCTCTGCTCTCCTCGCTGGCCTGACGGGCGCGGCCCTCGTCGCTGCACACGG
CCACGTCAGCCACATCGTCGTCAACGGCGTCTACTACAGGGGCTACGACCCCACGACAGACT
GGTACCAGCCCAACCCGCCAACAGTCATCGGCTGGACGGCAGCCGATCAGGATAATGGCTT
CGTTGAACCCAACAGCTTTGGCACGCCAGATATCATCTGCCACAAGAGCGCCACCCCCGGCG
GCGGCCACGCTACCGTTGCTGCCGGAGACAAGATCAACATCGTCTGGACCCCCGAGTGGCCC
CACTCCCACATCGGCCCCGTCATTGACTACCTAGCCGCCTGCAACGGTGACTGCGAGACCGT
CGACAAGTCGTCGCTGCGCTGGTTCAAGATTGACGGCGCCGGCTACGACAAGGCCGCCGGC
CGCTGGGCCGCCGACGCTCTGCGCGCCAACGGCAACAGCTGGCTCGTCCAGATCCCGTCGGA
TCTCAAGCCCGGCAACTACGTCCTCCGCCACGAGATCATCGCCCTCCACGGTGCTCAGAGCC
CCAACGGCGCCCAGGCGTACCCGCAGTGCATCAACCTCCGCGTCACCGGCGGCGGCAGCAA
CCTGCCCAGCGGCGTCGCCGGCACCTCGCTGTACAAGGCGACCGACCCGGGCATCCTCTTCA
ACCCCTACGTCTCCTCCCCGGATTACACCGTCCCCGGCCCGGCCCTCATTGCCGGCGCCGCC
AGCTCGATCGCCCAGAGCACGTCGGTCGCCACTGCCACCGGCACGGCCACCGTTCCCGGCGG
CGGCGGCGCCAACCCTACCGCCACCACCACCGCCGCCACCTCCGCCGCCCCGAGCACCACCC
TGAGGACGACCACTACCTCGGCCGCGCAGACTACCGCCCCGCCCTCCGGCGATGTGCAGACC
AAGTACGGCCAGTGTGGTGGCAACGGATGGACGGGCCCGACGGTGTGCGCCCCCGGCTCGA
GCTGCTCCGTCCTCAACGAGTGGTACTCCCAGTGTTTGTAA (SEQ ID NO: 17)
MSKASALLAGLTGAALVAAHGHVSEITVVNGVYYRGYDPTTDWYQPNPPTVIGWTAADQDNGF
VEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPHSHIGPVIDYLAACNGDCETVDKS
SLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKPGNYVLRHEIIALHGAQSPNGAQ
AYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSV
ATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGW
TGPTVCAPGSSCSVLNEWYSQCL (SEQ ID NO: 18)
HGHVSEITVVNGVYYRGYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGG
GHATVAAGDKINIVWTPEWPHSHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRW
AADALRANGNSWLVQIPSDLKPGNYVLRIIEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSG
VAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTA
TTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYS
QCL
[0258] The cDNA sequence of a M. thermophila GH61a variant
("Variant 5") (SEQ ID NO:19) and amino acid (SEQ ID NO:20) sequence
are provided below. The signal sequence is underlined in SEQ ID
NO:20. SEQ ID NO:21 provides the GH61a Variant 5 sequence without
the signal sequence.
TABLE-US-00005 (SEQ ID NO: 19)
ACACAAATGTCCAAGGCCTCTGCTCTCCTCGCTGGCCTGACGGGCGCGGCCCTCGTCGCTGC
ACACGGCCACGTCAGCCACATCGTCGTCAACGGCGTCTACTACAGGAACTACGACCCCACG
ACAGACTGGTACCAGCCCAACCCGCCAACAGTCATCGGCTGGACGGCAGCCGATCAGGATA
ATGGCTTCGTTGAACCCAACAGCTTTGGCACGCCAGATATCATCTGCCACAAGAGCGCCACC
CCCGGCGGCGGCCACGCTACCGTTGCTGCCGGAGACAAGATCAACATCGTATGGACCCCCG
AGTGGCCCCACTCCCACATCGGCCCCGTCATTGACTACCTAGCCGCCTGCAACGGTGACTGC
GAGACCGTCGACAAGTCGTCGCTGCGCTGGTTCAAGATTGACGGCGCCGGCTACGACAAGG
CCGCCGGCCGCTGGGCCGCCGACGCTCTGCGCGCCAACGGCAACAGCTGGCTCGTCCAGATC
CCGTCGGATCTCGCGGCCGGCAACTACGTCCTCCGCCACGAGATCATCGCCCTCCACGGTGC
TCAGAGCCCCAACGGCGCCCAGGCGTACCCGCAGTGCATCAACCTCCGCGTCACCGGCGGC
GGCAGCAACCTGCCCAGCGGCGTCGCCGGCACCTCGCTGTACAAGGCGACCGACCCGGGCA
TCCTCTTCAACCCCTACGTCTCCTCCCCGGATTACACCGTCCCCGGCCCGGCCCTCATTGCCG
GCGCCGCCAGCTCGATCGCCCAGAGCACGTCGGTCGCCACTGCCACCGGCACGGCCACCGTT
CCCGGCGGCGGCGGCGCCAACCCTACCGCCACCACCACCGCCGCCACCTCCGCCGCCCCGA
GCACCACCCTGAGGACGACCACTACCTCGGCCGCGCAGACTACCGCCCCGCCCTCCGGCGAT
GTGCAGACCAAGTACGGCCAGTGTGGTGGCAACGGATGGACGGGCCCGACGGTGTGCGCCC
CCGGCTCGAGCTGCTCCGTCCTCAACGAGTGGTACTCCCAGTGTTTGTAA (SEQ ID NO: 20)
MSKASALLAGLTGAALVAAHGHVSIEVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGF
VEPNSFGTPDIICHKSATPGGGHATVAAGDKINIVWTPEWPHSHIGPVIDYLAACNGDCETVDKS
SLRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLAAGNYVLIMEHALHGAQSPNGAQ
AYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSV
ATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGW
TGPTVCAPGSSCSVLNEWYSQCL (SEQ ID NO: 21)
HGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGG
GHATVAAGDIUNIVWTPEWPHSHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRW
AADALRANGNSWLVQIPSDLAAGNYVLRHEIIALHGAQSPNGAQAYPQCINLRVTGGGSNLPSG
VAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTA
TTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYS
QCL
[0259] The cDNA sequence of a M. thermophila GH61a variant
("Variant 9") (SEQ ID NO:22) and amino acid (SEQ ID NO:23) sequence
are provided below. The signal sequence is underlined in SEQ ID
NO:23. SEQ ID NO:24 provides Variant 9 sequence without the signal
sequence.
TABLE-US-00006 (SEQ ID NO: 22)
ACAAACATGTCCAAGGCCTCTGCTCTCCTCGCTGGCCTGACGGGCGCGGCCCTCGTCGCTGC
ACATGGCCACGTCAGCCACATCGTCGTCAACGGCGTCTACTACAGGAACTACGACCCCACGA
CAGACTGGTACCAGCCCAACCCGCCAACAGTCATCGGCTGGACGGCAGCCGATCAGGATAA
TGGCTTCGTTGAACCCAACAGCTTTGGCACGCCAGATATCATCTGCCACAAGAGCGCCACCC
CCGGCGGCGGCCACGCTACCGTTGCTGCCGGAGACAAGATCAACATCCAGTGGACCCCCGA
GTGGCCCGAATCCCACATCGGCCCCGTCATTGACTACCTAGCCGCCTGCAACGGTGACTGCG
AGACCGTCGACAAGTCGTCGCTGCGCTGGTTCAAGATTGACGGCGCCGGCTACGACAAGGC
CGCCGGCCGCTGGGCCGCCGACGCTCTGCGCGCCAACGGCAACAGCTGGCTCGTCCAGATCC
CGTCGGATCTCAAGGCCGGCAACTACGTCCTCCGCCACGAGATCATCGCCCTCCACGGTGCT
CAGAGCCCCAACGGCGCCCAGAACTACCCGCAGTGCATCAACCTCCGCGTCACCGGCGGCG
GCAGCAACCTGCCCAGCGGCGTCGCCGGCACCTCGCTGTACAAGGCGACCGACCCGGGCAT
CCTCTTCAACCCCTACGTCTCCTCCCCGGATTACACCGTCCCCGGCCCGGCCCTCATTGCCGG
CGCCGCCAGCTCGATCGCCCAGAGCACGTCGGTCGCCACTGCCACCGGCACGGCCACCGTTC
CCGGCGGCGGCGGCGCCAACCCTACCGCCACCACCACCGCCGCCACCTCCGCCGCCCCGAG
CACCACCCTGAGGACGACCACTACCTCGGCCGCGCAGACTACCGCCCCGCCCTCCGGCGATG
TGCAGACCAAGTACGGCCAGTGTGGTGGCAACGGATGGACGGGCCCGACGGTGTGCGCCCC
CGGCTCGAGCTGCTCCGTCCTCAACGAGTGGTACTCCCAGTGTTTGTAA (SEQ ID NO: 23)
MSKASALLAGLTGAALVAAHGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGF
VEPNSFGTPDIICHKSATPGGGHATVAAGDKINIQWTPEWPESIEGPVIDYLAACNGDCETVDKSS
LRWFKIDGAGYDKAAGRWAADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQ
NYPQCINLRVTGGGSNLPSGVAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSV
ATATGTATVPGGGGANPTATTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGW
TGPTVCAPGSSCSVLNEWYSQCL (SEQ ID NO: 24)
HGHVSHIVVNGVYYRNYDPTTDWYQPNPPTVIGWTAADQDNGFVEPNSFGTPDIICHKSATPGG
GHATVAAGDKINIQWTPEWPESHIGPVIDYLAACNGDCETVDKSSLRWFKIDGAGYDKAAGRW
AADALRANGNSWLVQIPSDLKAGNYVLRHEIIALHGAQSPNGAQNYPQCINLRVTGGGSNLPSG
VAGTSLYKATDPGILFNPYVSSPDYTVPGPALIAGAASSIAQSTSVATATGTATVPGGGGANPTA
TTTAATSAAPSTTLRTTTTSAAQTTAPPSGDVQTKYGQCGGNGWTGPTVCAPGSSCSVLNEWYS
QCL
[0260] The polynucleotide (SEQ ID NO:25) and amino acid (SEQ ID
NO:26) sequences of an M. thermophila GH61b are provided below. The
signal sequence is shown underlined in SEQ ID NO:26. SEQ ID NO:27
provides the sequence of this GH61b without the signal
sequence.
TABLE-US-00007 (SEQ ID NO: 25)
ATGAAGCTCTCCCTCTTTTCCGTCCTGGCCACTGCCCTCACCGTCGAGGGGCATGCCATCTTC
CAGAAGGTCTCCGTCAACGGAGCGGACCAGGGCTCCCTCACCGGCCTCCGCGCTCCCAACA
ACAACAACCCCGTGCAGAATGTCAACAGCCAGGACATGATCTGCGGCCAGTCGGGATCGAC
GTCGAACACTATCATCGAGGTCAAGGCCGGCGATAGGATCGGTGCCTGGTATCAGCATGTCA
TCGGCGGTGCCCAGTTCCCCAACGACCCAGACAACCCGATTGCCAAGTCGCACAAGGGCCC
CGTCATGGCCTACCTCGCCAAGGTTGACAATGCCGCAACCGCCAGCAAGACGGGCCTGAAG
TGGTTCAAGATTTGGGAGGATACCTTTAATCCCAGCACCAAGACCTGGGGTGTCGACAACCT
CATCAACAACAACGGCTGGGTGTACTTCAACCTCCCGCAGTGCATCGCCGACGGCAACTACC
TCCTCCGCGTCGAGGTCCTCGCTCTGCACTCGGCCTACTCCCAGGGCCAGGCTCAGTTCTACC
AGTCCTGCGCCCAGATCAACGTATCCGGCGGCGGCTCCTTCACGCCGGCGTCGACTGTCAGC
TTCCCGGGTGCCTACAGCGCCAGCGACCCCGGTATCCTGATCAACATCTACGGCGCCACCGG
CCAGCCCGACAACAACGGCCAGCCGTACACTGCCCCTGGGCCCGCGCCCATCTCCTGC (SEQ ID
NO: 26)
MKLSLFSVLATALTVEGHAIFQKVSVNGADQGSLTGLRAPNNNNPVQNVNSQDMICGQSGSTSN
TIIEVKAGDRIGAWYQHVIGGAQFPNDPDNPIAKSHKGPVMAYLAKVDNAATASKTGLKWFKI
WEDTFNPSTKTWGVDNLINNNGWVYFNLPQCIADGNYLLRVEVLALHSAYSQGQAQFYQSCAQ
INVSGGGSFTPASTVSFPGAYSASDPGILINIYGATGQPDNNGQPYTAPGPAPISC (SEQ ID
NO: 27)
IFQKVSVNGADQGSLTGLRAPNNNNPVQNVNSQDMICGQSGSTSNTIIEVKAGDRIGAWYQHVI
GGAQFPNDPDNPIAKSHKGPVMAYLAKVDNAATASKTGLKWFKIWEDTFNPSTKTWGVDNLIN
NNGWVYFNLPQCIADGNYLLRVEVLALHSAYSQGQAQFYQSCAQINVSGGGSFTPASTVSFPGA
YSASDPGILINIYGATGQPDNNGQPYTAPGPAPISC
[0261] The polynucleotide (SEQ ID NO:28) and amino acid (SEQ ID
NO:29) sequences of an M. thermophila GH61c are provided below. The
signal sequence is shown underlined in SEQ ID NO:29. SEQ ID NO:30
provides the sequence of this GH61c without the signal
sequence.
TABLE-US-00008 (SEQ ID NO: 28)
ATGGCCCTCCAGCTCTTGGCGAGCTTGGCCCTCCTCTCAGTGCCGGCCCTTGCCCACGGTGGC
TTGGCCAACTACACCGTCGGTGATACTTGGTACAGAGGCTACGACCCAAACCTGCCGCCGGA
GACGCAGCTCAACCAGACCTGGATGATCCAGCGGCAATGGGCCACCATCGACCCCGTCTTCA
CCGTGTCGGAGCCGTACCTGGCCTGCAACAACCCGGGCGCGCCGCCGCCCTCGTACATCCCC
ATCCGCGCCGGTGACAAGATCACGGCCGTGTACTGGTACTGGCTGCACGCCATCGGGCCCAT
GAGCGTCTGGCTCGCGCGGTGCGGCGACACGCCCGCGGCCGACTGCCGCGACGTCGACGTC
AACCGGGTCGGCTGGTTCAAGATCTGGGAGGGCGGCCTGCTGGAGGGTCCCAACCTGGCCG
AGGGGCTCTGGTACCAAAAGGACTTCCAGCGCTGGGACGGCTCCCCGTCCCTCTGGCCCGTC
ACGATCCCCAAGGGGCTCAAGAGCGGGACCTACATCATCCGGCACGAGATCCTGTCGCTTCA
CGTCGCCCTCAAGCCCCAGTTTTACCCGGAGTGTGCGCATCTGAATATTACTGGGGGCGGAG
ACTTGCTGCCACCCGAAGAGACTCTGGTGCGGTTTCCGGGGGTTTACAAAGAGGACGATCCC
TCTATCTTCATCGATGTCTACTCGGAGGAGAACGCGAACCGGACAGATTATACGGTTCCGGG
AGGGCCAATCTGGGAAGGG (SEQ ID NO: 29)
MALQLLASLALLSVPALAHGGLANYTVGDTWYRGYDPNLPPETQLNQTWMIQRQWATIDPVFT
VSEPYLACNNPGAPPPSYIPIRAGDKITAVYWYWLHAIGPMSVWLARCGDTPAADCRDVDVNR
VGWFKIWEGGLLEGPNLAEGLWYQKDFQRWDGSPSLWPVTIPKGLKSGTYIIRHEILSLHVALKP
QFYPECAHLNITGGGDLLPPEETLVRFPGVYKEDDPSIFIDVYSEENANRTDYTVPGGPIWEG
(SEQ ID NO: 30)
NYTVGDTWYRGYDPNLPPETQLNQTWMIQRQWATIDPVFTVSEPYLACNNPGAPPPSYIPIRAG
DKITAVYWYWLHAIGPMSVWLARCGDTPAADCRDVDVNRVGWFKIWEGGLLEGPNLAEGLW
YQKDFQRWDGSPSLWPVTIPKGLKSGTYIIRHEILSLHVALKPQFYPECAHLNITGGGDLLPPEET
LVRFPGVYKEDDPSIFIDVYSEENANRTDYTVPGGPIWEG
[0262] The polynucleotide (SEQ ID NO:31) and amino acid (SEQ ID
NO:32) sequences of an M. thermophila GH61d are provided below. The
signal sequence is shown underlined in SEQ ID NO:32. SEQ ID NO:33
provides the sequence of this GH61d without the signal
sequence.
TABLE-US-00009 (SEQ ID NO: 31)
ATGAAGGCCCTCTCTCTCCTTGCGGCTGCCGGGGCAGTCTCTGCGCATACCATCTTCGTCCAG
CTCGAAGCAGACGGCACGAGGTACCCGGTTTCGTACGGGATCCGGGACCCAACCTACGACG
GCCCCATCACCGACGTCACATCCAACGACGTTGCTTGCAACGGCGGTCCGAACCCGACGACC
CCCTCCAGCGACGTCATCACCGTCACCGCGGGCACCACCGTCAAGGCCATCTGGAGGCACAC
CCTCCAATCCGGCCCGGACGATGTCATGGACGCCAGCCACAAGGGCCCGACCCTGGCCTAC
ATCAAGAAGGTCGGCGATGCCACCAAGGACTCGGGCGTCGGCGGTGGCTGGTTCAAGATCC
AGGAGGACGGTTACAACAACGGCCAGTGGGGCACCAGCACCGTTATCTCCAACGGCGGCGA
GCACTACATTGACATCCCGGCCTGCATCCCCGAGGGTCAGTACCTCCTCCGCGCCGAGATGA
TCGCCCTCCACGCGGCCGGGTCCCCCGGCGGCGCTCAGCTCTACATGGAATGTGCCCAGATC
AACATCGTCGGCGGCTCCGGCTCGGTGCCCAGCTCGACGGTCAGCTTCCCCGGCGCGTATAG
CCCCAACGACCCGGGTCTCCTCATCAACATCTATTCCATGTCGCCCTCGAGCTCGTACACCAT
CCCGGGCCCGCCCGTTTTCAAGTGC (SEQ ID NO: 32)
MKALSLLAAAGAVSAHTIFVQLEADGTRYPVSYGIRDPTYDGPITDVTSNDVACNGGPNPTTPSS
DVITVTAGTTVKAIWRHTLQSGPDDVMDASHKGPTLAYIKKVGDATKDSGVGGGWFKIQEDGY
NNGQWGTSTVISNGGEHYIDIPACIPEGQYLLRAEMIALHAAGSPGGAQLYMECAQINIVGGSGS
VPSSTVSFPGAYSPNDPGLLINIYSMSPSSSYTIPGPPVFKC (SEQ ID NO: 33)
HTIFVQLEADGTRYPVSYGIRDPTYDGPITDVTSNDVACNGGPNPTTPSSDVITVTAGTTVKAIWR
HTLQSGPDDVMDASHKGPTLAYIKKVGDATKDSGVGGGWFKIQEDGYNNGQWGTSTVISNGG
EHYIDIPACIPEGQYLLRAEMIALHAAGSPGGAQLYMECAQINIVGGSGSVPSSTVSFPGAYSPND
PGLLINIYSMSPSSSYTIPGPPVFKC
[0263] The polynucleotide (SEQ ID NO:34) and amino acid (SEQ ID
NO:35) sequences of an M. thermophila GH61e are provided below. The
signal sequence is shown underlined in SEQ ID NO:35. SEQ ID NO:36
provides the sequence of this GH61d without the signal
sequence.
TABLE-US-00010 (SEQ ID NO: 34)
ATGAAGTCGTCTACCCCGGCCTTGTTCGCCGCTGGGCTCCTTGCTCAGCATGCTGCGGCCCAC
TCCATCTTCCAGCAGGCGAGCAGCGGCTCGACCGACTTTGATACGCTGTGCACCCGGATGCC
GCCCAACAATAGCCCCGTCACTAGTGTGACCAGCGGCGACATGACCTGCAAAGTCGGCGGC
ACCAAGGGGGTGTCCGGCTTCTGCGAGGTGAACGCCGGCGACGAGTTCACGGTTGAGATGC
ACGCGCAGCCCGGCGACCGCTCGTGCGCCAACGAGGCCATCGGCGGGAACCACTTCGGCCC
GGTCCTCATCTACATGAGCAAGGTCGACGACGCCTCCACCGCCGACGGGTCCGGCGACTGGT
TCAAGGTGGACGAGTTCGGCTACGACGCAAGCACCAAGACCTGGGGCACCGACAAGCTCAA
CGAGAACTGCGGCAAGCGCACCTTCAACATCCCCAGCCACATCCCCGCGGGCGACTATCTCG
TCCGGGCCGAGGCTATCGCGCTACACACTGCCAACCAGCCAGGCGGCGCGCAGTTCTACATG
AGCTGCTATCAAGTCAGGATTTCCGGCGGCGAAGGGGGCCAGCTGCCTGCCGGAGTCAAGA
TCCCGGGCGCGTACAGTGCCAACGACCCCGGCATCCTTGTCGACATCTGGGGTAACGATTTC
AACGACCCTCCAGGACACTCGGCCCGTCACGCCATCATCATCATCAGCAGCAGCAGCAACA
ACAGCGGCGCCAAGATGACCAAGAAGATCCAGGAGCCCACCATCACATCGGTCACGGACCT
CCCCACCGACGAGGCCAAGTGGATCGCGCTCCAAAAGATCTCGTACGTGGACCAGACGGGC
ACGGCGCGGACATACGAGCCGGCGTCGCGCAAGACGCGGTCGCCAAGAGTCTAG (SEQ ID NO:
35)
MKSSTPALFAAGLLAQHAAAHSIFQQASSGSTDFDTLCTRMPPNNSPVTSVTSGDMTCKVGGTK
GVSGFCEVNAGDEFTVEMHAQPGDRSCANEAIGGNHTGPVLIYMSKVDDASTADGSGDWFKVD
EFGYDASTKTWGTDKLNENCGKRTFNIPSHIPAGDYLVRAEAIALHTANQPGGAQFYMSCYQVR
ISGGEGGQLPAGVKIPGAYSANDPGILVDIWGNDFNDPPGHSARHAIIIISSSSNNSGAKMTKKIQE
PTITSVTDLPTDEAKWIALQKISYVDQTGTARTYEPASRKTRSPRV (SEQ ID NO: 36)
HSIFQQASSGSTDFDTLCTRMPPNNSPVTSVTSGDMTCKVGGTKGVSGFCEVNAGDEFTVEMHA
QPGDRSCANEAIGGNHFGPVLIYMSKVDDASTADGSGDWFKVDEFGYDASTKTWGTDKLNENC
GKRTFNIPSHIPAGDYLVRAEAIALHTANQPGGAQFYMSCYQVRISGGEGGQLPAGVKIPGAYSA
NDPGILVDIWGNDFNDPPGHSARHAIIIISSSSNNSGAKMTKKIQEPTITSVTDLPTDEAKWIALQKI
SYVDQTGTARTYEPASRKTRSPRV
[0264] The polynucleotide (SEQ ID NO:37) and amino acid (SEQ ID
NO:38) sequences of an alternative M. thermophila GH61e are
provided below. The signal sequence is shown underlined in SEQ ID
NO:38. SEQ ID NO:39 provides the sequence of this GH61e without the
signal sequence.
TABLE-US-00011 (SEQ ID NO: 37)
ATGAAGTCGTCTACCCCGGCCTTGTTCGCCGCTGGGCTCCTTGCTCAGCATGCTGCGGCCCAC
TCCATCTTCCAGCAGGCGAGCAGCGGCTCGACCGACTTTGATACGCTGTGCACCCGGATGCC
GCCCAACAATAGCCCCGTCACTAGTGTGACCAGCGGCGACATGACCTGCAACGTCGGCGGC
ACCAAGGGGGTGTCGGGCTTCTGCGAGGTGAACGCCGGCGACGAGTTCACGGTTGAGATGC
ACGCGCAGCCCGGCGACCGCTCGTGCGCCAACGAGGCCATCGGCGGGAACCACTTCGGCCC
GGTCCTCATCTACATGAGCAAGGTCGACGACGCCTCCACTGCCGACGGGTCCGGCGACTGGT
TCAAGGTGGACGAGTTCGGCTACGACGCAAGCACCAAGACCTGGGGCACCGACAAGCTCAA
CGAGAACTGCGGCAAGCGCACCTTCAACATCCCCAGCCACATCCCCGCGGGCGACTATCTCG
TCCGGGCCGAGGCTATCGCGCTACACACTGCCAACCAGCCAGGCGGCGCGCAGTTCTACATG
AGCTGCTATCAAGTCAGGATTTCCGGCGGCGAAGGGGGCCAGCTGCCTGCCGGAGTCAAGA
TCCCGGGCGCGTACAGTGCCAACGACCCCGGCATCCTTGTCGACATCTGGGGTAACGATTTC
AACGAGTACGTTATTCCGGGCCCCCCGGTCATCGACAGCAGCTACTTC (SEQ ID NO: 38)
MKSSTPALFAAGLLAQHAAAHSIFQQASSGSTDFDTLCTRMPPNNSPVTSVTSGDMTCNVGGTK
GVSGFCEVNAGDEFTVEMHAQPGDRSCANEAIGGNHFGPVLIYMSKVDDASTADGSGDWFKVD
EFGYDASTKTWGTDKLNENCGKRTFNIPSHIPAGDYLVRAEAIALHTANQPGGAQFYMSCYQVR
ISGGEGGQLPAGVKIPGAYSANDPGILVDIWGNDFNEYVIPGPPVIDSSYF (SEQ ID NO: 39)
HSIFQQASSGSTDFDTLCTRMPPNNSPVTSVTSGDMTCNVGGTKGVSGFCEVNAGDEFTVEMHA
QPGDRSCANEAIGGNHFGPVLIYMSKVDDASTADGSGDWFKVDEFGYDASTKTWGTDKLNENC
GKRTFNIPSHIPAGDYLVRAEAIALHTANQPGGAQFYMSCYQVRISGGEGGQLPAGVKIPGAYSA
NDPGILVDIWGNDFNEYVIPGPPVIDSSYF
[0265] The polynucleotide (SEQ ID NO:40) and amino acid (SEQ ID
NO:41) sequences of a M. thermophila GH61f are provided below. The
signal sequence is shown underlined in SEQ ID NO:41. SEQ ID NO:42
provides the sequence of this GH61f without the signal
sequence.
TABLE-US-00012 (SEQ ID NO: 40)
ATGAAGTCCTTCACCCTCACCACTCTGGCCGCCCTGGCTGGCAACGCCGCCGCTCACGCGAC
CTTCCAGGCCCTCTGGGTCGACGGCGTCGACTACGGCGCGCAGTGTGCCCGTCTGCCCGCGT
CCAACTCGCCGGTCACCGACGTGACCTCCAACGCGATCCGCTGCAACGCCAACCCCTCGCCC
GCTCGGGGCAAGTGCCCGGTCAAGGCCGGCTCGACCGTTACGGTCGAGATGCATCAGCAAC
CCGGTGACCGCTCGTGCAGCAGCGAGGCGATCGGCGGGGCGCACTACGGCCCCGTGATGGT
GTACATGTCCAAGGTGTCGGACGCGGCGTCGGCGGACGGGTCGTCGGGCTGGTTCAAGGTG
TTCGAGGACGGCTGGGCCAAGAACCCGTCCGGCGGGTCGGGCGACGACGACTACTGGGGCA
CCAAGGACCTGAACTCGTGCTGCGGGAAGATGAACGTCAAGATCCCCGCCGACCTGCCCTC
GGGCGACTACCTGCTCCGGGCCGAGGCCCTCGCGCTGCACACGGCCGGCAGCGCGGGCGGC
GCCCAGTTCTACATGACCTGCTACCAGCTCACCGTGACCGGCTCCGGCAGCGCCAGCCCGCC
CACCGTCTCCTTCCCGGGCGCCTACAAGGCCACCGACCCGGGCATCCTCGTCAACATCCACG
CCCCGCTGTCCGGCTACACCGTGCCCGGCCCGGCCGTCTACTCGGGCGGCTCCACCAAGAAG
GCCGGCAGCGCCTGCACCGGCTGCGAGTCCACTTGCGCCGTCGGCTCCGGCCCCACCGCCAC
CGTCTCCCAGTCGCCCGGTTCCACCGCCACCTCGGCCCCCGGCGGCGGCGGCGGCTGCACCG
TCCAGAAGTACCAGCAGTGCGGCGGCCAGGGCTACACCGGCTGCACCAACTGCGCGTCCGG
CTCCACCTGCAGCGCGGTCTCGCCGCCCTACTACTCGCAGTGCGTC (SEQ ID NO: 41)
MKSFTLTTLAALAGNAAAHATFQALWVDGVDYGAQCARLPASNSPVTDVTSNAIRCNANPSPA
RGKCPVKAGSTVTVEMHQQPGDRSCSSEAIGGAHYGPVMVYMSKVSDAASADGSSGWFKVFE
DGWAKNPSGGSGDDDYWGTKDLNSCCGKMNVKIPADLPSGDYLLRAEALALHTAGSAGGAQF
YMTCYQLTVTGSGSASPPTVSFPGAYKATDPGILVNIHAPLSGYTVPGPAVYSGGSTKKAGSACT
GCESTCAVGSGPTATVSQSPGSTATSAPGGGGGCTVQKYQQCGGQGYTGCTNCASGSTCSAVSP
PYYSQCV (SEQ ID NO: 42)
HATFQALWVDGVDYGAQCARLPASNSPVTDVTSNAIRCNANPSPARGKCPVKAGSTVTVEMHQ
QPGDRSCSSEAIGGAHYGPVMVYMSKVSDAASADGSSGWFKVFEDGWAKNPSGGSGDDDYW
GTKDLNSCCGKMNVKIPADLPSGDYLLRAEALALHTAGSAGGAQFYMTCYQLTVTGSGSASPP
TVSFPGAYKATDPGILVNIHAPLSGYTVPGPAVYSGGSTKKAGSACTGCESTCAVGSGPTATVSQ
SPGSTATSAPGGGGGCTVQKYQQCGGQGYTGCTNCASGSTCSAVSPPYYSQCV
[0266] The polynucleotide (SEQ ID NO:43) and amino acid (SEQ ID
NO:44) sequences of an M. thermophila GH61g are provided below. The
signal sequence is shown underlined in SEQ ID NO:44. SEQ ID NO:45
provides the sequence of this GH61g without the signal
sequence.
TABLE-US-00013 (SEQ ID NO: 43)
ATGAAGGGACTCCTCGGCGCCGCCGCCCTCTCGCTGGCCGTCAGCGATGTCTCGGCCCACTA
CATCTTTCAGCAGCTGACGACGGGCGGCGTCAAGCACGCTGTGTACCAGTACATCCGCAAGA
ACACCAACTATAACTCGCCCGTGACCGATCTGACGTCCAACGACCTCCGCTGCAATGTGGGT
GCTACCGGTGCGGGCACCGATACCGTCACGGTGCGCGCCGGCGATTCGTTCACCTTCACGAC
CGATACGCCCGTTTACCACCAGGGCCCGACCTCGATCTACATGTCCAAGGCCCCCGGCAGCG
CGTCCGACTACGACGGCAGCGGCGGCTGGTTCAAGATCAAGGACTGGGCTGACTACACCGC
CACGATTCCGGAATGTATTCCCCCCGGCGACTACCTGCTTCGCATCCAGCAACTCGGCATCC
ACAACCCTTGGCCCGCGGGCATCCCCCAGTTCTACATCTCTTGTGCCCAGATCACCGTGACT
GGTGGCGGCAGTGCCAACCCCGGCCCGACCGTCTCCATCCCAGGCGCCTTCAAGGAGACCG
ACCCGGGCTACACTGTCAACATCTACAACAACTTCCACAACTACACCGTCCCTGGCCCAGCC
GTCTTCACCTGCAACGGTAGCGGCGGCAACAACGGCGGCGGCTCCAACCCAGTCACCACCA
CCACCACCACCACCACCAGGCCGTCCACCAGCACCGCCCAGTCCCAGCCGTCGTCGAGCCCG
ACCAGCCCCTCCAGCTGCACCGTCGCGAAGTGGGGCCAGTGCGGAGGACAGGGTTACAGCG
GCTGCACCGTGTGCGCGGCCGGGTCGACCTGCCAGAAGACCAACGACTACTACAGCCAGTG
CTTGTAG (SEQ ID NO: 44)
MKGLLGAAALSLAVSDVSAHYTFQQLTTGGVKHAVYQYIRKNTNYNSPVTDLTSNDLRCNVGA
TGAGTDTVTVRAGDSFTFTTDTPVYHQGPTSIYMSKAPGSASDYDGSGGWFKIKDWADYTATIP
ECIPPGDYLLRIQQLGIHNPWPAGIPQFYISCAQITVTGGGSANPGPTVSIPGAFKETDPGYTVNIY
NNFHNYTVPGPAVFTCNGSGGNNGGGSNPVTTTTTTTTRPSTSTAQSQPSSSPTSPSSCTVAKWG
QCGGQGYSGCTVCAAGSTCQKTNDYYSQCL (SEQ ID NO: 45)
HYIFQQLTTGGVKHAVYQYIRKNTNYNSPVTDLTSNDLRCNVGATGAGTDTVTVRAGDSFTFTT
DTPVYHQGPTSIYMSKAPGSASDYDGSGGWFKIKDWADYTATIPECIPPGDYLLRIQQLGIHNPW
PAGIPQFYISCAQITVTGGGSANPGPTVSIPGAFKETDPGYTVNIYNNFHNYTVPGPAVFTCNGSG
GNNGGGSNPVTTTTTTTTRPSTSTAQSQPSSSPTSPSSCTVAKWGQCGGQGYSGCTVCAAGSTCQ
KTNDYYSQCL
[0267] The polynucleotide (SEQ ID NO:46) and amino acid (SEQ ID
NO:47) sequences of an alternative M. thermophila GH61g are
provided below. The signal sequence is shown underlined in SEQ ID
NO:47. SEQ ID NO:48 provides the sequence of this GH61g without the
signal sequence.
TABLE-US-00014 (SEQ ID NO: 46)
CTGACGACGGGCGGCGTCAAGCACGCTGTGTACCAGTACATCCGCAAGAACACCAACTATA
ACTCGCCCGTGACCGATCTGACGTCCAACGACCTCCGCTGCAATGTGGGTGCTACCGGTGCG
GGCACCGATACCGTCACGGTGCGCGCCGGCGATTCGTTCACCTTCACGACCGATACGCCCGT
TTACCACCAGGGCCCGACCTCGATCTACATGTCCAAGGCCCCCGGCAGCGCGTCCGACTACG
ACGGCAGCGGCGGCTGGTTCAAGATCAAGGACTGGGGTGCCGACTTTAGCAGCGGCCAGGC
CACCTGGACCTTGGCGTCTGACTACACCGCCACGATTCCGGAATGTATTCCCCCCGGCGACT
ACCTGCTTCGCATCCAGCAACTCGGCATCCACAACCCTTGGCCCGCGGGCATCCCCCAGTTC
TACATCTCTTGTGCCCAGATCACCGTGACTGGTGGCGGCAGTGCCAACCCCGGCCCGACCGT
CTCCATCCCAGGCGCCTTCAAGGAGACCGACCCGGGCTACACTGTCAACATCTACAACAACT
TCCACAACTACACCGTCCCTGGCCCAGCCGTCTTCACCTGCAACGGTAGCGGCGGCAACAAC
GGCGGCGGCTCCAACCCAGTCACCACCACCACCACCACCACCACCAGGCCGTCCACCAGCA
CCGCCCAGTCCCAGCCGTCGTCGAGCCCGACCAGCCCCTCCAGCTGCACCGTCGCGAAGTGG
GGCCAGTGCGGAGGACAGGGTTACAGCGGCTGCACCGTGTGCGCGGCCGGGTCGACCTGCC
AGAAGACCAACGACTACTACAGCCAGTGCTTG (SEQ ID NO: 47)
MKGLLGAAALSLAVSDVSAHYIFQQLTTGGVKHAVYQYIRKNTNYNSPVTDLTSNDLRCNVGA
TGAGTDTVTVRAGDSFTFTTDTPVYHQGPTSIYMSKAPGSASDYDGSGGWFKIKDWGADFSSGQ
ATWTLASDYTATIPECIPPGDYLLRIQQLGIHNPWPAGIPQFYISCAQITVTGGGSANPGPTVSIPG
AFKETDPGYTVNIYNNFHNYTVPGPAVFTCNGSGGNNGGGSNPVTTTTTTTTRPSTSTAQSQPSS
SPTSPSSCTVAKWGQCGGQGYSGCTVCAAGSTCQKTNDYYSQCL (SEQ ID NO: 48)
HYIFQQLTTGGVKHAVYQYIRKNTNYNSPVTDLTSNDLRCNVGATGAGTDTVTVRAGDSFTFTT
DTPVYHQGPTSIYMSKAPGSASDYDGSGGWFKIKDWGADFSSGQATWTLASDYTATIPECIPPG
DYLLRIQQLGIHNPWPAGIPQFYISCAQITVTGGGSANPGPTVSIPGAFKETDPGYTVNIYNNFHN
YTVPGPAVFTCNGSGGNNGGGSNPVTTTTTTTTRPSTSTAQSQPSSSPTSPSSCTVAKWGQCGGQ
GYSGCTVCAAGSTCQKTNDYYSQCL
[0268] The polynucleotide (SEQ ID NO:49) and amino acid (SEQ ID
NO:50) sequences of an M. thermophila GH61h are provided below. The
signal sequence is shown underlined in SEQ ID NO:50. SEQ ID NO:51
provides the sequence of this GH61h without the signal
sequence.
TABLE-US-00015 (SEQ ID NO: 49)
ATGTCTTCCTTCACCTCCAAGGGTCTCCTTTCCGCCCTCATGGGCGCGGCAACGGTTGCCGCC
CACGGTCACGTCACCAACATCGTCATCAACGGCGTCTCATACCAGAACTTCGACCCATTCAC
GCACCCTTATATGCAGAACCCTCCGACGGTTGTCGGCTGGACCGCGAGCAACACGGACAAC
GGCTTCGTCGGCCCCGAGTCCTTCTCTAGCCCGGACATCATCTGCCACAAGTCCGCCACCAA
CGCTGGCGGCCATGCCGTCGTCGCGGCCGGCGATAAGGTCTTCATCCAGTGGGACACCTGGC
CCGAGTCGCACCACGGTCCGGTCATCGACTATCTCGCCGACTGCGGCGACGCGGGCTGCGAG
AAGGTCGACAAGACCACGCTCAAGTTCTTCAAGATCAGCGAGTCCGGCCTGCTCGACGGCA
CTAACGCCCCCGGCAAGTGGGCGTCCGACACGCTGATCGCCAACAACAACTCGTGGCTGGTC
CAGATCCCGCCCAACATCGCCCCGGGCAACTACGTCCTGCGCCACGAGATCATCGCCCTGCA
CAGCGCCGGCCAGCAGAACGGCGCCCAGAACTACCCTCAGTGCTTCAACCTGCAGGTCACC
GGCTCCGGCACTCAGAAGCCCTCCGGCGTCCTCGGCACCGAGCTCTACAAGGCCACCGACGC
CGGCATCCTGGCCAACATCTACACCTCGCCCGTCACCTACCAGATCCCCGGCCCGGCCATCA
TCTCGGGCGCCTCCGCCGTCCAGCAGACCACCTCGGCCATCACCGCCTCTGCTAGCGCCATC
ACCGGCTCCGCTACCGCCGCGCCCACGGCTGCCACCACCACCGCCGCCGCCGCCGCCACCAC
TACCACCACCGCTGGCTCCGGTGCTACCGCCACGCCCTCGACCGGCGGCTCTCCTTCTTCCGC
CCAGCCTGCTCCTACCACCGCTGCCGCTACCTCCAGCCCTGCTCGCCCGACCCGCTGCGCTG
GTCTGAAGAAGCGCCGTCGCCACGCCCGTGACGTCAAGGTTGCCCTC (SEQ ID NO: 50)
MSSFTSKGLLSALMGAATVAAHGHVTNIVINGVSYQNFDPFTHPYMQNPPTVVGWTASNTDNG
FVGPESFSSPDIICHKSATNAGGHAVVAAGDKVFIQWDTWPESHHGPVIDYLADCGDAGCEKVD
KTTLKFFKISESGLLDGTNAPGKWASDTLIANNNSWLVQIPPNIAPGNYVLRHEIIALHSAGQQNG
AQNYPQCFNLQVTGSGTQKPSGVLGTELYKATDAGILANIYTSPVTYQIPGPAIISGASAVQQTTS
AITASASAITGSATAAPTAATTTAAAAATTTTTAGSGATATPSTGGSPSSAQPAPTTAAATSSPAR
PTRCAGLKKRRRHARDVKVAL (SEQ ID NO: 51)
AHGHVTNIVINGVSYQNFDPFTHPYMQNPPTVVGWTASNTDNGFVGPESFSSPDIICHKSATNAG
GHAVVAAGDKVFIQWDTWPESHHGPVIDYLADCGDAGCEKVDKTTLKFFKISESGLLDGTNAP
GKWASDTLIANNNSWLVQIPPNIAPGNYVLRHEIIALHSAGQQNGAQNYPQCFNLQVTGSGTQK
PSGVLGTELYKATDAGILANIYTSPVTYQIPGPAIISGASAVQQTTSAITASASAITGSATAAPTAA
TTTAAAAATTTTTAGSGATATPSTGGSPSSAQPAPTTAAATSSPARPTRCAGLKKRRRHARDVK
VAL
[0269] The polynucleotide (SEQ ID NO:52) and amino acid (SEQ ID
NO:53) sequences of an M. thermophila GH61i are provided below. The
signal sequence is shown underlined in SEQ ID NO:53. SEQ ID NO:54
provides the sequence of this GH61i without the signal
sequence.
TABLE-US-00016 (SEQ ID NO: 52)
ATGAAGACGCTCGCCGCCCTCGTGGTCTCGGCCGCCCTCGTGGCCGCGCACGGCTATGTTGA
CCACGCCACGATCGGTGGCAAGGATTATCAGTTCTACCAGCCGTACCAGGACCCTTACATGG
GCGACAACAAGCCCGATAGGGTTTCCCGCTCCATCCCGGGCAACGGCCCCGTGGAGGACGT
CAACTCCATCGACCTCCAGTGCCACGCCGGTGCCGAACCGGCCAAGCTCCACGCCCCCGCCG
CCGCCGGCTCGACCGTGACGCTCTACTGGACCCTCTGGCCCGACTCCCACGTCGGCCCCGTC
ATCACCTACATGGCTCGCTGCCCCGACACCGGCTGCCAGGACTGGTCCCCGGGAACTAAGCC
CGTTTGGTTCAAGATCAAGGAAGGCGGCCGTGAGGGCACCTCCAATACCCCGCTCATGACG
GCCCCCTCCGCCTACACCTACACGATCCCGTCCTGCCTCAAGAGCGGCTACTACCTCGTCCG
CCACGAGATCATCGCCCTGCACTCGGCCTGGCAGTACCCCGGCGCCCAGTTCTACCCGGGCT
GCCACCAGCTCCAGGTCACCGGCGGCGGCTCCACCGTGCCCTCTACCAACCTGGTCTCCTTC
CCCGGCGCCTACAAGGGGAGCGACCCCGGCATCACCTACGACGCTTACAAGGCGCAACCTT
ACACCATCCCTGGCCCGGCCGTGTTTACCTGCTGA (SEQ ID NO: 53)
MKTLAALVVSAALVAAHGYVDHATIGGKDYQFYQPYQDPYMGDNKPDRVSRSIPGNGPVEDV
NSIDLQCHAGAEPAKLHAPAAAGSTVTLYWTLWPDSHVGPVITYMARCPDTGCQDWSPGTKPV
WFKIKEGGREGTSNTPLMTAPSAYTYTIPSCLKSGYYLVRHEIIALHSAWQYPGAQFYPGCHQLQ
VTGGGSTVPSTNLVSFPGAYKGSDPGITYDAYKAQPYTIPGPAVFTC (SEQ ID NO: 54)
YVDHATIGGKDYQFYQPYQDPYMGDNKYDRVSRSIPGNGPVEDVNSIDLQCHAGAEPAKLHAP
AAAGSTVTLYWTLWPDSHVGPVITYMARCPDTGCQDWSPGTKPVWFKIKEGGREGTSNTPLMT
APSAYTYTIPSCLKSGYYLVRHIIALHSAWQYPGAQFYPGCHQLQVTGGGSTVPSTNLVSFPGA
YKGSDPGITYDAYKAQPYTIPGPAVFTC
[0270] The polynucleotide (SEQ ID NO:55) and amino acid (SEQ ID
NO:56) sequences of an alternative M. thermophila GH61i are
provided below. The signal sequence is shown underlined in SEQ ID
NO:56. SEQ ID NO:57 provides the sequence of this GH61i without the
signal sequence.
TABLE-US-00017 (SEQ ID NO: 55)
ATGAAGACGCTCGCCGCCCTCGTGGTCTCGGCCGCCCTCGTGGCCGCGCACGGCTATGTTGA
CCACGCCACGATCGGTGGCAAGGATTATCAGTTCTACCAGCCGTACCAGGACCCTTACATGG
GCGACAACAAGCCCGATAGGGTTTCCCGCTCCATCCCGGGCAACGGCCCCGTGGAGGACGT
CAACTCCATCGACCTCCAGTGCCACGCCGGTGCCGAACCGGCCAAGCTCCACGCCCCCGCCG
CCGCCGGCTCGACCGTGACGCTCTACTGGACCCTCTGGCCCGACTCCCACGTCGGCCCCGTC
ATCACCTACATGGCTCGCTGCCCCGACACCGGCTGCCAGGACTGGTCCCCGGGAACTAAGCC
CGTTTGGTTCAAGATCAAGGAAGGCGGCCGTGAGGGCACCTCCAATGTCTGGGCTGCTACCC
CGCTCATGACGGCCCCCTCCGCCTACACCTACACGATCCCGTCCTGCCTCAAGAGCGGCTAC
TACCTCGTCCGCCACGAGATCATCGCCCTGCACTCGGCCTGGCAGTACCCCGGCGCCCAGTT
CTACCCGGGCTGCCACCAGCTCCAGGTCACCGGCGGCGGCTCCACCGTGCCCTCTACCAACC
TGGTCTCCTTCCCCGGCGCCTACAAGGGGAGCGACCCCGGCATCACCTACGACGCTTACAAG
GCGCAACCTTACACCATCCCTGGCCCGGCCGTGTTTACCTGC (SEQ ID NO: 56)
MKTLAALVVSAALVAAHGYVDHATIGGKDYQFYQPYQDPYMGDNKPDRVSRSIPGNGPVEDV
NSIDLQCHAGAEPAKLHAPAAAGSTVTLYWTLWPDSHVGPVITYMARCPDTGCQDWSPGTKPV
WFKIKEGGREGTSNVWAATPLMTAPSAYTYTIPSCLKSGYYLVRHEIIALHSAWQYPGAQFYPG
CHQLQVTGGGSTVPSTNLVSFPGAYKGSDPGITYDAYKAQPYTIPGPAVFTC (SEQ ID NO:
57) YVDHATIGGKDYQFYQPYQDPYMGDNKPDRVSRSIPGNGPVEDVNSIDLQCHAGAEPAKLHAP
AAAGSTVTLYWTLWPDSHVGPVITYMARCPDTGCQDWSPGTKPVWFKIKEGGREGTSNVWAA
TPLMTAPSAYTYTIPSCLKSGYYLVRHEIIALHSAWQYPGAQFYPGCHQLQVTGGGSTVPSTNLV
SFPGAYKGSDPGITYDAYKAQPYTIPGPAVFTC
[0271] The polynucleotide (SEQ ID NO:58) and amino acid (SEQ ID
NO:59) sequences of an M. thermophila GH61j are provided below. The
signal sequence is shown underlined in SEQ ID NO:59. SEQ ID NO:60
provides the sequence of this GH61j without the signal
sequence.
TABLE-US-00018 (SEQ ID NO: 58)
ATGAGATACTTCCTCCAGCTCGCTGCGGCCGCGGCCTTTGCCGTGAACAGCGCGGCGGGTCA
CTACATCTTCCAGCAGTTCGCGACGGGCGGGTCCAAGTACCCGCCCTGGAAGTACATCCGGC
GCAACACCAACCCGGACTGGCTGCAGAACGGGCCGGTGACGGACCTGTCGTCGACCGACCT
GCGCTGCAACGTGGGCGGGCAGGTCAGCAACGGGACCGAGACCATCACCTTGAACGCCGGC
GACGAGTTCAGCTTCATCCTCGACACGCCCGTCTACCATGCCGGCCCCACCTCGCTCTACAT
GTCCAAGGCGCCCGGAGCTGTGGCCGACTACGACGGCGGCGGGGCCTGGTTCAAGATCTAC
GACTGGGGTCCGTCGGGGACGAGCTGGACGTTGAGTGGCACGTACACTCAGAGAATTCCCA
AGTGCATCCCTGACGGCGAGTACCTCCTCCGCATCCAGCAGATCGGGCTCCACAACCCCGGC
GCCGCGCCACAGTTCTACATCAGCTGCGCTCAAGTCAAGGTCGTCGATGGCGGCAGCACCAA
TCCGACCCCGACCGCCCAGATTCCGGGAGCCTTCCACAGCAACGACCCTGGCTTGACTGTCA
ATATCTACAACGACCCTCTCACCAACTACGTCGTCCCGGGACCTAGAGTTTCGCACTGG (SEQ ID
NO: 59)
MRYFLQLAAAAAFAVNSAAGHYIFQQFATGGSKYPPWKYIRRNTNPDWLQNGPVTDLSSTDLR
CNVGGQVSNGTETITLNAGDEFSFILDTPVYHAGPTSLYMSKAPGAVADYDGGGAWFKIYDWG
PSGTSWTLSGTYTQRIPKCIPDGEYLLRIQQIGLHNPGAAPQFYISCAQVKVVDGGSTNPTPTAQIP
GAFHSNDPGLTVNIYNDPLTNYVVPGPRVSHW (SEQ ID NO: 60)
HYIFQQFATGGSKYPPWKYIRRNTNPDWLQNGPVTDLSSTDLRCNVGGQVSNGTETITLNAGDE
FSFILDTPVYHAGPTSLYMSKAPGAVADYDGGGAWFKIYDWGPSGTSWTLSGTYTQRIPKCIPD
GEYLLRIQQIGLHNPGAAPQFYISCAQVKVVDGGSTNPTPTAQIPGAFHSNDPGLTVNIYNDPLTN
YVVPGPRVSHW
[0272] The polynucleotide (SEQ ID NO:61) and amino acid (SEQ ID
NO:62) sequences of an M. thermophila GH61k are provided below. The
signal sequence is shown underlined in SEQ ID NO:62. SEQ ID NO:63
provides the sequence of this GH61k without the signal
sequence.
TABLE-US-00019 (SEQ ID NO: 61)
ATGCACCCCTCCCTTCTTTTCACGCTTGGGCTGGCGAGCGTGCTTGTCCCCCTCTCGTCTGCA
CACACTACCTTCACGACCCTCTTCGTCAACGATGTCAACCAAGGTGATGGTACCTGCATTCG
CATGGCGAAGAAGGGCAATGTCGCCACCCATCCTCTCGCAGGCGGTCTCGACTCCGAAGAC
ATGGCCTGTGGTCGGGATGGTCAAGAACCCGTGGCATTTACGTGTCCGGCCCCAGCTGGTGC
CAAGTTGACTCTCGAGTTTCGCATGTGGGCCGATGCTTCGCAGTCCGGATCGATCGATCCAT
CCCACCTTGGCGTCATGGCCATCTACCTCAAGAAGGTTTCCGACATGAAATCTGACGCGGCC
GCTGGCCCGGGCTGGTTCAAGATTTGGGACCAAGGCTACGACTTGGCGGCCAAGAAGTGGG
CCACCGAGAAGCTCATCGACAACAACGGCCTCCTGAGCGTCAACCTTCCAACCGGCTTACCA
ACCGGCTACTACCTCGCCCGCCAGGAGATCATCACGCTCCAAAACGTTACCAATGACAGGCC
AGAGCCCCAGTTCTACGTCGGCTGCGCACAGCTCTACGTCGAGGGCACCTCGGACTCACCCA
TCCCCTCGGACAAGACGGTCTCCATTCCCGGCCACATCAGCGACCCGGCCGACCCGGGCCTG
ACCTTCAACGTCTACACGGGCGACGCATCCACCTACAAGCCGCCCGGCCCCGAGGTTTACTT
CCCCACCACCACCACCACCACCTCCTCCTCCTCCTCCGGAAGCAGCGACAACAAGGGAGCCA
GGCGCCAGCAAACCCCCGACGACAAGCAGGCCGACGGCCTCGTTCCAGCCGACTGCCTCGT
CAAGAACGCGAACTGGTGCGCCGCTGCCCTGCCGCCGTACACCGACGAGGCCGGCTGCTGG
GCCGCCGCCGAGGACTGCAACAAGCAGCTGGACGCGTGCTACACCAGCGCACCCCCCTCGG
GCAGCAAGGGGTGCAAGGTCTGGGAGGAGCAGGTGTGCACCGTCGTCTCGCAGAAGTGCGA
GGCCGGGGATTTCAAGGGGCCCCCGCAGCTCGGGAAGGAGCTCGGCGAGGGGATCGATGAG
CCTATTCCGGGGGGAAAGCTGCCCCCGGCGGTCAACGCGGGAGAGAACGGGAATCATGGCG
GAGGTGGTGGTGATGATGGTGATGATGATAATGATGAGGCCGGGGCTGGGGCAGCGTCGAC
TCCGACTTTTGCTGCTCCTGGTGCGGCCAAGACTCCCCAACCAAACTCCGAGAGGGCCCGGC
GCCGTGAGGCGCATTGGCGGCGACTGGAATCTGCTGAG (SEQ ID NO: 62)
MHPSLLFTLGLASVLVPLSSAHTTFTTLFVNDVNQGDGTCIRMAKKGNVATHPLAGGLDSEDMA
CGRDGQEPVAFTCPAPAGAKLTLEFRMWADASQSGSIDPSHLGVMAIYLKKVSDMKSDAAAGP
GWFKIWDQGYDLAAKKWATEKLIDNNGLLSVNLPTGLPTGYYLARQEIITLQNVTNDRPEPQFY
VGCAQLYVEGTSDSPIPSDKTVSIPGHISDPADPGLTFNVYTGDASTYKPPGPEVYFPTTTTTTSSS
SSGSSDNKGARRQQTPDDKQADGLVPADCLVKNANWCAAALPPYTDEAGCWAAAEDCNKQL
DACYTSAPPSGSKGCKVWEEQVCTVVSQKCEAGDFKGPPQLGKELGEGIDEPIPGGKLPPAVNA
GENGNHGGGGGDDGDDDNDEAGAGAASTPTFAAPGAAKTPQPNSERARRREAHWRRLESAE (SEQ
ID NO: 63)
HTTFTTLFVNDVNQGDGTCIRMAKKGNVATHPLAGGLDSEDMACGRDGQEPVAFTCPAPAGAK
LTLEFRMWADASQSGSIDPSHLGVMAIYLKKVSDMKSDAAAGPGWFKIWDQGYDLAAKKWAT
EKLIDNNGLLSVNLPTGLPTGYYLARQEIITLQNVTNDRPEPQFYVGCAQLYVEGTSDSPIPSDKT
VSIPGHISDPADPGLTFNVYTGDASTYKPPGPEVYFPTTTTTTSSSSSGSSDNKGARRQQTPDDKQ
ADGLVPADCLVKNANWCAAALPPYTDEAGCWAAAEDCNKQLDACYTSAPPSGSKGCKVWEE
QVCTVVSQKCEAGDFKGPPQLGKELGEGIDEPIPGGKLPPAVNAGENGNHGGGGGDDGDDDND
EAGAGAASTPTFAAPGAAKTPQPNSERARRREAHWRRLESAE
[0273] The polynucleotide (SEQ ID NO:64) and amino acid (SEQ ID
NO:65) sequences of a M. thermophila GH611 are provided below. The
signal sequence is shown underlined in SEQ ID NO:65. SEQ ID NO:66
provides the sequence of this GH611 without the signal
sequence.
TABLE-US-00020 (SEQ ID NO: 64)
ATGTTTTCTCTCAAGTTCTTTATCTTGGCCGGTGGGCTTGCTGTCCTCACCGAGGCTCACATA
AGACTAGTGTCGCCCGCCCCTTTTACCAACCCTGACCAGGGCCCCAGCCCACTCCTAGAGGC
TGGCAGCGACTATCCCTGCCACAACGGCAATGGGGGCGGTTATCAGGGAACGCCAACCCAG
ATGGCAAAGGGTTCTAAGCAGCAGCTAGCCTTCCAGGGGTCTGCCGTTCATGGGGGTGGCTC
CTGCCAAGTGTCCATCACCTACGACGAAAACCCGACCGCTCAGAGCTCCTTCAAGGTCATTC
ACTCGATTCAAGGTGGCTGCCCCGCCAGGGCCGAGACGATCCCGGATTGCAGCGCACAAAA
TATCAACGCCTGCAATATAAAGCCCGATAATGCCCAGATGGACACCCCGGATAAGTATGAG
TTCACGATCCCGGAGGATCTCCCCAGTGGCAAGGCCACCCTCGCCTGGACATGGATCAACAC
TATCGGCAACCGCGAGTTTTATATGGCATGCGCCCCGGTTGAGATCACCGGCGACGGCGGTA
GCGAGTCGGCTCTGGCTGCGCTGCCCGACATGGTCATTGCCAACATCCCGTCCATCGGAGGA
ACCTGCGCGACCGAGGAGGGGAAGTACTACGAATATCCCAACCCCGGTAAGTCGGTCGAAA
CCATCCCGGGCTGGACCGATTTGGTTCCCCTGCAAGGCGAATGCGGTGCTGCCTCCGGTGTC
TCGGGCTCCGGCGGAAACGCCAGCAGTGCTACCCCTGCCGCAGGGGCCGCCCCGACTCCTGC
TGTCCGCGGCCGCCGTCCCACCTGGAACGCC (SEQ ID NO: 65)
MFSLKFFILAGGLAVLTEAHIRLVSPAPFTNPDQGPSPLLEAGSDYPCHNGNGGGYQGTPTQMAK
GSKQQLAFQGSAVHGGGSCQVSITYDENPTAQSSFKVIHSIQGGCPARAETIPDCSAQNINACNIK
PDNAQMDTPDKYEFTIPEDLPSGKATLAWTWINTIGNREFYMACAPVEITGDGGSESALAALPD
MVIANIPSIGGTCATEEGKYYEYPNPGKSVETIPGWTDLVPLQGECGAASGVSGSGGNASSATPA
AGAAPTPAVRGRRPTWNA (SEQ ID NO: 66)
HIRLVSPAPFTNPDQGPSPLLEAGSDYPCHNGNGGGYQGTPTQMAKGSKQQLAFQGSAVHGGGS
CQVSITYDENPTAQSSFKVIHSIQGGCPARAETIPDCSAQNINACNIKPDNAQMDTPDKYEFTIPED
LPSGKATLAWTWINTIGNREFYMACAPVEITGDGGSESALAALPDMVIANIPSIGGTCATEEGKY
YEYPNPGKSVETIPGWTDLVPLQGECGAASGVSGSGGNASSATPAAGAAPTPAVRGRRPTWNA
[0274] The polynucleotide (SEQ ID NO:67) and amino acid (SEQ ID
NO:68) sequences of a M. thermophila GH61m are provided below. The
signal sequence is shown underlined in SEQ ID NO:68. SEQ ID NO:69
provides the sequence of this GH61m without the signal
sequence.
TABLE-US-00021 (SEQ ID NO: 67)
ATGAAGCTCGCCACGCTCCTCGCCGCCCTCACCCTCGGGGTGGCCGACCAGCTCAGCGTCGG
GTCCAGAAAGTTTGGCGTGTACGAGCACATTCGCAAGAACACGAACTACAACTCGCCCGTTA
CCGACCTGTCGGACACCAACCTGCGCTGCAACGTCGGCGGGGGCTCGGGCACCAGCACCAC
CGTGCTCGACGTCAAGGCCGGAGACTCGTTCACCTTCTTCAGCGACGTTGCCGTCTACCACC
AGGGGCCCATCTCGCTGTGCGTGGACCGGACCAGTGCAGAGAGCATGGATGGACGGGAACC
GGACATGCGCTGCCGAACTGGCTCACAAGCTGGCTACCTGGCGGTGACTGACTACGACGGG
TCCGGTGACTGTTTCAAGATCTATGACTGGGGACCGACGTTCAACGGGGGCCAGGCGTCGTG
GCCGACGAGGAATTCGTACGAGTACAGCATCCTCAAGTGCATCAGGGACGGCGAATACCTA
CTGCGGATTCAGTCCCTGGCCATCCATAACCCAGGTGCCCTTCCGCAGTTCTACATCAGCTGC
GCCCAGGTGAATGTGACGGGCGGAGGCACCGTCACCCCGAGATCAAGGCGACCGATCCTGA
TCTATTTCAACTTCCACTCGTATATCGTCCCTGGGCCGGCAGTGTTCAAGTGCTAG (SEQ ID
NO: 68)
MKLATLLAALTLGVADQLSVGSRKFGVYEHIRKNTNYNSPVTDLSDTNLRCNVGGGSGTSTTVL
DVKAGDSFTFFSDVAVYHQGPISLCVDRTSAESMDGREPDMRCRTGSQAGYLAVTDYDGSGDC
FKIYDWGPTFNGGQASWPTRNSYEYSILKCIRDGEYLLRIQSLAIHNPGALPQFYISCAQVNVTGG
GTVTPRSRRPILIYFNFHSYIVPGPAVFKC (SEQ ID NO: 69)
DQLSVGSRKFGVYEHIRKNTNYNSPVTDLSDTNLRCNVGGGSGTSTTVLDVKAGDSFTFFSDVA
VYHQGPISLCVDRTSAESMDGREPDMRCRTGSQAGYLAVTDYDGSGDCFKIYDWGPTFNGGQA
SWPTRNSYEYSILKCIRDGEYLLRIQSLAIHNPGALPQFYISCAQVNVTGGGTVTPRSRRPILIYFNF
HSYIVPGPAVFKC
[0275] The polynucleotide (SEQ ID NO:70) and amino acid (SEQ ID
NO:71) sequences of an alternative M. thermophila GH61m are
provided below. The signal sequence is shown underlined in SEQ ID
NO:71. SEQ ID NO:72 provides the sequence of this GH61m without the
signal sequence.
TABLE-US-00022 (SEQ ID NO: 70)
ATGAAGCTCGCCACGCTCCTCGCCGCCCTCACCCTCGGGCTCAGCGTCGGGTCCAGAAAGTT
TGGCGTGTACGAGCACATTCGCAAGAACACGAACTACAACTCGCCCGTTACCGACCTGTCGG
ACACCAACCTGCGCTGCAACGTCGGCGGGGGCTCGGGCACCAGCACCACCGTGCTCGACGT
CAAGGCCGGAGACTCGTTCACCTTCTTCAGCGACGTTGCCGTCTACCACCAGGGGCCCATCT
CGCTGTGCGTGGACCGGACCAGTGCAGAGAGCATGGATGGACGGGAACCGGACATGCGCTG
CCGAACTGGCTCACAAGCTGGCTACCTGGCGGTGACTGTGATGACTGTGACTGACTACGACG
GGTCCGGTGACTGTTTCAAGATCTATGACTGGGGACCGACGTTCAACGGGGGCCAGGCGTCG
TGGCCGACGAGGAATTCGTACGAGTACAGCATCCTCAAGTGCATCAGGGACGGCGAATACC
TACTGCGGATTCAGTCCCTGGCCATCCATAACCCAGGTGCCCTTCCGCAGTTCTACATCAGCT
GCGCCCAGGTGAATGTGACGGGCGGAGGCACCATCTATTTCAACTTCCACTCGTATATCGTC
CCTGGGCCGGCAGTGTTCAAGTGC (SEQ ID NO: 71)
MKLATLLAALTLGLSVGSRKFGVYEHIRKNTNYNSPVTDLSDTNLRCNVGGGSGTSTTVLDVKA
GDSFTFFSDVAVYHQGPISLCVDRTSAESMDGREPDMRCRTGSQAGYLAVTVMTVTDYDGSGD
CFKIYDWGPTFNGGQASWPTRNSYEYSILKCIRDGEYLLRIQSLAIHNPGALPQFYISCAQVNVTG
GGTIYFNFHSYIVPGPAVFKC (SEQ ID NO: 72)
RKFGVYEHIRKNTNYNSPVTDLSDTNLRCNVGGGSGTSTTVLDVKAGDSFTFFSDVAVYHQGPI
SLCVDRTSAESMDGREPDMRCRTGSQAGYLAVTVMTVTDYDGSGDCFKIYDWGPTFNGGQAS
WPTRNSYEYSILKCIRDGEYLLRIQSLAIHNPGALPQFYISCAQVNVTGGGTIYFNFHSYIVPGPAV
FKC
[0276] The polynucleotide (SEQ ID NO:73) and amino acid (SEQ ID
NO:74) sequences of a M. thermophila GH61n are provided below.
TABLE-US-00023 (SEQ ID NO: 73)
ATGACCAAGAATGCGCAGAGCAAGCAGGGCGTTGAGAACCCAACAAGCGGCGACATCCGCT
GCTACACCTCGCAGACGGCGGCCAACGTCGTGACCGTGCCGGCCGGCTCGACCATTCACTAC
ATCTCGACCCAGCAGATCAACCACCCCGGCCCGACTCAGTACTACCTGGCCAAGGTACCCCC
CGGCTCGTCGGCCAAGACCTTTGACGGGTCCGGCGCCGTCTGGTTCAAGATCTCGACCACGA
TGCCTACCGTGGACAGCAACAAGCAGATGTTCTGGCCAGGGCAGAACACTTATGAGACCTC
AAACACCACCATTCCCGCCAACACCCCGGACGGCGAGTACCTCCTTCGCGTCAAGCAGATCG
CCCTCCACATGGCGTCTCAGCCCAACAAGGTCCAGTTCTACCTCGCCTGCACCCAGATCAAG
ATCACCGGTGGTCGCAACGGCACCCCCAGCCCGCTGGTCGCGCTGCCCGGAGCCTACAAGA
GCACCGACCCCGGCATCCTGGTCGACATCTACTCCATGAAGCCCGAATCGTACCAGCCTCCC
GGGCCGCCCGTCTGGCGCGGCTAA (SEQ ID NO: 74)
MTKNAQSKQGVENPTSGDIRCYTSQTAANVVTVPAGSTIHYISTQQINHPGPTQYYLAKVPPGSS
AKTFDGSGAVWFKISTTMPTVDSNKQMFWPGQNTYETSNTTIPANTPDGEYLLRVKQIALHMAS
QPNKVQFYLACTQIKITGGRNGTPSPLVALPGAYKSTDPGILVDIYSMKPESYQPPGPPVWRG
[0277] The polynucleotide (SEQ ID NO:75) and amino acid (SEQ ID
NO:76) sequences of an alternative M. thermophila GH61n are
provided below. The signal sequence is shown underlined in SEQ ID
NO:76. SEQ ID NO:77 provides the sequence of this GH61n without the
signal sequence.
TABLE-US-00024 (SEQ ID NO: 75)
ATGAGGCTTCTCGCAAGCTTGTTGCTCGCAGCTACGGCTGTTCAAGCTCACTTTGTTAACGGA
CAGCCCGAAGAGAGTGACTGGTCAGCCACGCGCATGACCAAGAATGCGCAGAGCAAGCAG
GGCGTTGAGAACCCAACAAGCGGCGACATCCGCTGCTACACCTCGCAGACGGCGGCCAACG
TCGTGACCGTGCCGGCCGGCTCGACCATTCACTACATCTCGACCCAGCAGATCAACCACCCC
GGCCCGACTCAGTACTACCTGGCCAAGGTACCCCCCGGCTCGTCGGCCAAGACCTTTGACGG
GTCCGGCGCCGTCTGGTTCAAGATCTCGACCACGATGCCTACCGTGGACAGCAACAAGCAG
ATGTTCTGGCCAGGGCAGAACACTTATGAGACCTCAAACACCACCATTCCCGCCAACACCCC
GGACGGCGAGTACCTCCTTCGCGTCAAGCAGATCGCCCTCCACATGGCGTCTCAGCCCAACA
AGGTCCAGTTCTACCTCGCCTGCACCCAGATCAAGATCACCGGTGGTCGCAACGGCACCCCC
AGCCCGCTGGTCGCGCTGCCCGGAGCCTACAAGAGCACCGACCCCGGCATCCTGGTCGACAT
CTACTCCATGAAGCCCGAATCGTACCAGCCTCCCGGGCCGCCCGTCTGGCGCGGC (SEQ ID NO:
76) MRLLASLLLAATAVQAHFVNGQPEESDWSATRMTKNAQSKQGVENPTSGDIRCYTSQTAANVV
TVPAGSTIHYISTQQINHPGPTQYYLAKVPPGSSAKTFDGSGAVWFKISTTMPTVDSNKQMFWPG
QNTYETSNTTIPANTPDGEYLLRVKQIALHMASQPNKVQFYLACTQIKITGGRNGTPSPLVALPG
AYKSTDPGILVDIYSMKPESYQPPGPPVWRG (SEQ ID NO: 77)
HFVNGQPEESDWSATRMTKNAQSKQGVENPTSGDIRCYTSQTAANVVTVPAGSTIHYISTQQIN
HPGPTQYYLAKVPPGSSAKTFDGSGAVWFKISTTMPTVDSNKQMFWPGQNTYETSNTTIPANTP
DGEYLLRVKQIALHMASQPNKVQFYLACTQIKITGGRNGTPSPLVALPGAYKSTDPGILVDIYSM
KPESYQPPGPPVWRG
[0278] The polynucleotide (SEQ ID NO:78) and amino acid (SEQ ID
NO:79) sequences of an alternative M. thermophila GH61o are
provided below. The signal sequence is shown underlined in SEQ ID
NO:79. SEQ ID NO:80 provides the sequence of this GH61o without the
signal sequence.
TABLE-US-00025 (SEQ ID NO: 78)
ATGAAGCCCTTTAGCCTCGTCGCCCTGGCGACTGCCGTGAGCGGCCATGCCATCTTCCAGCG
GGTGTCGGTCAACGGGCAGGACCAGGGCCAGCTCAAGGGGGTGCGGGCGCCGTCGAGCAAC
TCCCCGATCCAGAACGTCAACGATGCCAACATGGCCTGCAACGCCAACATTGTGTACCACGA
CAACACCATCATCAAGGTGCCCGCGGGAGCCCGCGTCGGCGCGTGGTGGCAGCACGTCATC
GGCGGGCCGCAGGGCGCCAACGACCCGGACAACCCGATCGCCGCCTCCCACAAGGGCCCCA
TCCAGGTCTACCTGGCCAAGGTGGACAACGCGGCGACGGCGTCGCCGTCGGGCCTCAAGTG
GTTCAAGGTGGCCGAGCGCGGCCTGAACAACGGCGTGTGGGCCTACCTGATGCGCGTCGAG
CTGCTCGCCCTGCACAGCGCCTCGAGCCCCGGCGGCGCCCAGTTCTACATGGGCTGTGCACA
GATCGAAGTCACTGGCTCCGGCACCAACTCGGGCTCCGACTTTGTCTCGTTCCCCGGCGCCT
ACTCGGCCAACGACCCGGGCATCTTGCTGAGCATCTACGACAGCTCGGGCAAGCCCAACAA
TGGCGGGCGCTCGTACCCGATCCCCGGCCCGCGCCCCATCTCCTGCTCCGGCAGCGGCGGCG
GCGGCAACAACGGCGGCGACGGCGGCGACGACAACAACGGTGGTGGCAACAACAACGGCG
GCGGCAGCGTCCCCCTGTACGGGCAGTGCGGCGGCATCGGCTACACGGGCCCGACCACCTG
TGCCCAGGGAACTTGCAAGGTGTCGAACGAATACTACAGCCAGTGCCTCCCC (SEQ ID NO:
79) MKPFSLVALATAVSGHAIFQRVSVNGQDQGQLKGVRAPSSNSPIQNVNDANMACNANIVYHDN
TIIKVPAGARVGAWWQHVIGGPQGANDPDNPIAASHKGPIQVYLAKVDNAATASPSGLKWFKV
AERGLNNGVWAYLMRVELLALHSASSPGGAQFYMGCAQIEVTGSGTNSGSDFVSFPGAYSAND
PGILLSIYDSSGKPNNGGRSYPIPGPRPISCSGSGGGGNNGGDGGDDNNGGGNNNGGGSVPLYGQ
CGGIGYTGPTTCAQGTCKVSNEYYSQCLP (SEQ ID NO: 80)
HAIFQRVSVNGQDQGQLKGVRAPSSNSPIQNVNDANMACNANIVYHDNTIIKVPAGARVGAWW
QHVIGGPQGANDPDNPIAASHKGPIQVYLAKVDNAATASPSGLKWFKVAERGLNNGVWAYLM
RVELLALHSASSPGGAQFYMGCAQIEVTGSGTNSGSDFVSFPGAYSANDPGILLSIYDSSGKPNN
GGRSYPIPGPRPISCSGSGGGGNNGGDGGDDNNGGGNNNGGGSVPLYGQCGGIGYTGPTTCAQG
TCKVSNEYYSQCLP
[0279] The polynucleotide (SEQ ID NO:81) and amino acid (SEQ ID
NO:82) sequences of a M. thermophila GH61p are provided below. The
signal sequence is shown underlined in SEQ ID NO:82. SEQ ID NO:83
provides the sequence of this GH61p without the signal
sequence.
TABLE-US-00026 (SEQ ID NO: 81)
ATGAAGCTCACCTCGTCCCTCGCTGTCCTGGCCGCTGCCGGCGCCCAGGCTCACTATACCTTC
CCTAGGGCCGGCACTGGTGGTTCGCTCTCTGGCGAGTGGGAGGTGGTCCGCATGACCGAGA
ACCATTACTCGCACGGCCCGGTCACCGATGTCACCAGCCCCGAGATGACCTGCTATCAGTCC
GGCGTGCAGGGTGCGCCCCAGACCGTCCAGGTCAAGGCGGGCTCCCAATTCACCTTCAGCGT
GGATCCCTCCATCGGCCACCCCGGCCCTCTCCAGTTCTACATGGCTAAGGTGCCGTCGGGCC
AGACGGCCGCCACCTTTGACGGCACGGGAGCCGTGTGGTTCAAGATCTACCAAGACGGCCC
GAACGGCCTCGGCACCGACAGCATTACCTGGCCCAGCGCCGGCAAAACCGAGGTCTCGGTC
ACCATCCCCAGCTGCATCGAGGATGGCGAGTACCTGCTCCGGGTCGAGCACACCCCCCTCCC
TACAGCGCCAGCAGCGCAAAACCGAGCTCGCTCGTCACCATCCCCAGCTGCATACAAGGCC
ACCGACCCGGGCATCCTCTTCCAGCTCTACTGGCCCATCCCGACCGAGTACATCAACCCCGG
CCCGGCCCCCGTCTCTTGCTAA (SEQ ID NO: 82)
MKLTSSLAVLAAAGAQAHYTFPRAGTGGSLSGEWEVVRMTENHYSHGPVTDVTSPEMTCYQS
GVQGAPQTVQVKAGSQFTFSVDPSIGHPGPLQFYMAKVPSGQTAATFDGTGAVWFKIYQDGPN
GLGTDSITWPSAGKTEVSVTIPSCIEDGEYLLRVEHTPLPTAPAAQNRARSSPSPAAYKATDPGILF
QLYWPIPTEYINPGPAPVSC (SEQ ID NO: 83)
HYTFPRAGTGGSLSGEWEVVRMTENHYSHGPVTDVTSPEMTCYQSGVQGAPQTVQVKAGSQFT
FSVDPSIGHPGPLQFYMAKVPSGQTAATFDGTGAVWFKIYQDGPNGLGTDSITWPSAGKTEVSV
TIPSCIEDGEYLLRVEHTPLPTAPAAQNRARSSPSPAAYKATDPGILFQLYWPIPTEYINPGPAPVSC
[0280] The polynucleotide (SEQ ID NO:84) and amino acid (SEQ ID
NO:85) sequences of an alternative M. thermophila GH61p are
provided below. The signal sequence is shown underlined in SEQ ID
NO:85. SEQ ID NO:86 provides the sequence of this GH61p without the
signal sequence.
TABLE-US-00027 (SEQ ID NO: 84)
ATGAAGCTCACCTCGTCCCTCGCTGTCCTGGCCGCTGCCGGCGCCCAGGCTCACTATACCTTC
CCTAGGGCCGGCACTGGTGGTTCGCTCTCTGGCGAGTGGGAGGTGGTCCGCATGACCGAGAC
CATTACTCGCACGGCCCGGTCACCGATGTCACCAGCCCCGAGATGACCTGCTATCAGTCCGG
CGTGCAGGGTGCGCCCCAGACCGTCCAGGTCAAGGCGGGCTCCCAATTCACCTTCAGCGTGG
ATCCCTCCATCGGCCACCCCGGCCCTCTCCAGTTCTACATGGCTAAGGTGCCGTCGGGCCAG
ACGGCCGCCACCTTTGACGGCACGGGAGCCGTGTGGTTCAAGATCTACCAAGACGGCCCGA
ACGGCCTCGGCACCGACAGCATTACCTGGCCCAGCGCCGGCAAAACCGAGGTCTCGGTCAC
CATCCCCAGCTGCATCGAGGATGGCGAGTACCTGCTCCGGGTCGAGCACATCGCGCTCCACA
GCGCCAGCAGCGTGGGCGGCGCCCAGTTCTACATCGCCTGCGCCCAGCTCTCCGTCACCGGC
GGCTCCGGCACCCTCAACACGGGCTCGCTCGTCTCCCTGCCCGGCGCCTACAAGGCCACCGA
CCCGGGCATCCTCTTCCAGCTCTACTGGCCCATCCCGACCGAGTACATCAACCCCGGCCCGG
CCCCCGTCTCTTGC (SEQ ID NO: 85)
MKLTSSLAVLAAAGAQAHYTFPRAGTGGSLSGEWEVVRMTENHYSHGPVTDVTSPEMTCYQS
GVQGAPQTVQVKAGSQFTFSVDPSIGHPGPLQFYMAKVPSGQTAATFDGTGAVWFKIYQDGPN
GLGTDSITWPSAGKTEVSVTIPSCIEDGEYLLRVEHIALHSASSVGGAQFYIACAQLSVTGGSGTL
NTGSLVSLPGAYKATDPGILFQLYWPIPTEYINPGPAPVSC (SEQ ID NO: 86)
HYTFPRAGTGGSLSGEWEVVRMTENHYSHGPVTDVTSPEMTCYQSGVQGAPQTVQVKAGSQFT
FSVDPSIGHPGPLQFYMAKVPSGQTAATFDGTGAVWFKIYQDGPNGLGTDSITWPSAGKTEVSV
TIPSCIEDGEYLLRVEHIALHSASSVGGAQFYIACAQLSVTGGSGTLNTGSLVSLPGAYKATDPGIL
FQLYWPIPTEYINPGPAPVSC
[0281] The polynucleotide (SEQ ID NO:87) and amino acid (SEQ ID
NO:88) sequences of an alternative M. thermophila GH61q are
provided below. The signal sequence is shown underlined in SEQ ID
NO:88. SEQ ID NO:89 provides the sequence of this GH61q without the
signal sequence.
TABLE-US-00028 (SEQ ID NO: 87)
ATGCCGCCACCACGACTGAGCACCCTCCTTCCCCTCCTAGCCTTAATAGCCCCCACCGCCCTG
GGGCACTCCCACCTCGGGTACATCATCATCAACGGCGAGGTATACCAAGGATTCGACCCGCG
GCCGGAGCAGGCGAACTCGCCGTTGCGCGTGGGCTGGTCGACGGGGGCAATCGACGACGGG
TTCGTGGCGCCGGCCAACTACTCGTCGCCCGACATCATCTGCCACATCGAGGGGGCCAGCCC
GCCGGCGCACGCGCCCGTCCGGGCGGGCGACCGGGTGCACGTGCAATGGAACGGCTGGCCG
CTCGGACACGTGGGGCCGGTGCTGTCGTACCTGGCGCCCTGCGGCGGGCTGGAGGGGTCCG
AGAGCGGGTGCGCCGGGGTGGACAAGCGGCAGCTGCGGTGGACCAAGGTGGACGACTCGCT
GCCGGCGATGGAGCTG (SEQ ID NO: 88)
MPPPRLSTLLPLLALIAPTALGHSHLGYIIINGEVYQGFDPRPEQANSPLRVGWSTGAIDDGFVAP
ANYSSPDIICHIEGASPPAHAPVRAGDRVHVQWNGWPLGHVGPVLSYLAPCGGLEGSESGCAGV
DKRQLRWTKVDDSLPAMEL (SEQ ID NO: 89)
HSHLGYIIINGEVYQGFDPRPEQANSPLRVGWSTGAIDDGFVAPANYSSPDIICHIEGASPPAHAPV
RAGDRVHVQWNGWPLGHVGPVLSYLAPCGGLEGSESGCAGVDKRQLRWTKVDDSLPAMEL
[0282] The polynucleotide (SEQ ID NO:90) and amino acid (SEQ ID
NO:91) sequences of an alternative M. thermophila GH61q are
provided below. The signal sequence is shown underlined in SEQ ID
NO:91. SEQ ID NO:92 provides the sequence of this GH61q without the
signal sequence.
TABLE-US-00029 (SEQ ID NO: 90)
ATGCCGCCACCACGACTGAGCACCCTCCTTCCCCTCCTAGCCTTAATAGCCCCCACCGCCCTG
GGGCACTCCCACCTCGGGTACATCATCATCAACGGCGAGGTATACCAAGGATTCGACCCGCG
GCCGGAGCAGGCGAACTCGCCGTTGCGCGTGGGCTGGTCGACGGGGGCAATCGACGACGGG
TTCGTGGCGCCGGCCAACTACTCGTCGCCCGACATCATCTGCCACATCGAGGGGGCCAGCCC
GCCGGCGCACGCGCCCGTCCGGGCGGGCGACCGGGTGCACGTGCAATGGAAACGGCTGGCC
GCTCGGACACGTGGGGCCGGTGCTGTCGTACCTGGCGCCCTGCGGCGGGCTGGAGGGGTCC
GAGAGCGGGTGGACGACTCGCTGCCGGCGATGGAGCTGGTCGGGGCCGCGGGGGGCGCGG
GGGGCGAGGACGACGGCAGCGGCAGCGACGGCAGCGGCAGCGGCGGCAGCGGACGCGTCG
GCGTGCCCGGGCAGCGCTGGGCCACCGACGTGTTGATCGCGGCCAACAACAGCTGGCAGGT
CGAGATCCCGCGCGGGCTGCGGGACGGGCCGTACGTGCTGCGCCACGAGATCGTCGCGCTG
CACTACGCGGCCGAGCCCGGCGGCGCGCAGAACTACCCGCTCTGCGTCAACCTGTGGGTCG
AGGGCGGCGACGGCAGCATGGAGCTGGACCACTTCGACGCCACCCAGTTCTACCGGCCCGA
CGACCCGGGCATCCTGCTCAACGTGACGGCCGGCCTGCGCTCATACGCCGTGCCGGGCCCGA
CGCTGGCCGCGGGGGCGACGCCGGTGCCGTACGCGCAGCAGAACATCAGCTCGGCGAGGGC
GGATGGAACCCCCGTGATTGTCACCAGGAGCACGGAGACGGTGCCCTTCACCGCGGCACCC
ACGCCAGCCGAGACGGCAGAAGCCAAAGGGGGGAGGTATGATGACCAAACCCGAACTAAA
GACCTAAATGAACGCTTCTTTTATAGTAGCCGGCCAGAACAGAAGAGGCTGACAGCGACCT
CAAGAAGGGAACTAGTTGATCATCGTACCCGGTACCTCTCCGTAGCTGTCTGCGCAGATTTC
GGCGCTCATAAGGCAGCAGAAACCAACCACGAAGCTTTGAGAGGCGGCAATAAGCACCATG
GCGGTGTTTCAGAG (SEQ ID NO: 91)
MPPPRLSTLLPLLALIAPTALGHSHLGYIIINGEVYQGFDPRPEQANSPLRVGWSTGAIDDGFVAP
ANYSSPDIICHIEGASPPAHAPVRAGDRVHVQWKRLAARTRGAGAVVPGALRRAGGVRERVDD
SLPAMELVGAAGGAGGEDDGSGSDGSGSGGSGRVGVPGQRWATDVLIAANNSWQVEIPRGLR
DGPYVLRHEIVALHYAAEPGGAQNYPLCVNLWVEGGDGSMELDHFDATQFYRPDDPGILLNVT
AGLRSYAVPGPTLAAGATPVPYAQQNISSARADGTPVIVTRSTETVPFTAAPTPAETAEAKGGRY
DDQTRTKDLNERFFYSSRPEQKRLTATSRRELVDHRTRYLSVAVCADFGAHKAAETNHEALRG
GNKHFIGGVSE (SEQ ID NO: 92)
HSHLGYIIINGEVYQGFDPRPEQANSPLRVGWSTGAIDDGFVAPANYSSPDIICHIEGASPPAHAPV
RAGDRVHVQWKRLAARTRGAGAVVPGALRRAGGVRERVDDSLPAMELVGAAGGAGGEDDGS
GSDGSGSGGSGRVGVPGQRWATDVLIAANNSWQVEIPRGLRDGPYVLRHEIVALHYAAEPGGA
QNYPLCVNLWVEGGDGSMELDHFDATQFYRPDDPGILLNVTAGLRSYAVPGPTLAAGATPVPY
AQQNISSARADGTPVIVTRSTETVPFTAAPTPAETAEAKGGRYDDQTRTKDLNERFFYSSRPEQK
RLTATSRRELVDHRTRYLSVAVCADFGAHKAAETNHEALRGGNKHHGGVSE
[0283] The polynucleotide (SEQ ID NO:93) and amino acid (SEQ ID
NO:94) sequences of an M. thermophila GH61r are provided below. The
signal sequence is shown underlined in SEQ ID NO:94. SEQ ID NO:95
provides the sequence of this GH61r without the signal
sequence.
TABLE-US-00030 (SEQ ID NO: 93)
ATGAGGTCGACATTGGCCGGTGCCCTGGCAGCCATCGCTGCTCAGAAAGTAGCCGGCCACG
CCACGTTTCAGCAGCTCTGGCACGGCTCCTCCTGTGTCCGCCTTCCGGCTAGCAACTCACCCG
TCACCAATGTGGGAAGCAGAGACTTCGTCTGCAACGCTGGCACCCGCCCCGTCAGTGGCAA
GTGCCCCGTGAAGGCTGGCGGCACCGTCACCATCGAGATGCACCAGCAACCCGGCGACCGC
AGCTGCAACAACGAAGCCATCGGAGGGGCGCATTGGGGCCCCGTCCAGGTGTACCTGACCA
AGGTTCAGGACGCCGCGACGGCCGACGGCTCGACGGGCTGGTTCAAGATCTTCTCCGACTCG
TGGTCCAAGAAGCCCGGGGGCAACTTGGGCGACGACGACAACTGGGGCACGCGCGACCTGA
ACGCCTGCTGCGGGAAGATGGAC (SEQ ID NO: 94)
MRSTLAGALAAIAAQKVAGHATFQQLWHGSSCVRLPASNSPVTNVGSRDFVCNAGTRPVSGKC
PVKAGGTVTIEMHQQPGDRSCNNEAIGGAHWGPVQVYLTKVQDAATADGSTGWFKIFSDSWSK
KPGGNLGDDDNWGTRDLNACCGKMD (SEQ ID NO: 95)
HATFQQLWHGSSCVRLPASNSPVTNVGSRDFVCNAGTRPVSGKCPVKAGGTVTIEMHQQPGDR
SCNNEAIGGAHWGPVQVYLTKVQDAATADGSTGWFKIFSDSWSKKPGGNLGDDDNWGTRDLN
ACCGKMD
[0284] The polynucleotide (SEQ ID NO:96) and amino acid (SEQ ID
NO:97) sequences of an alternative M. thermophila GH61r are
provided below. The signal sequence is shown underlined in SEQ ID
NO:97. SEQ ID NO:98 provides the sequence of this GH61r without the
signal sequence.
TABLE-US-00031 (SEQ ID NO: 96)
ATGAGGTCGACATTGGCCGGTGCCCTGGCAGCCATCGCTGCTCAGAAAGTAGCCGGCCACG
CCACGTTTCAGCAGCTCTGGCACGGCTCCTCCTGTGTCCGCCTTCCGGCTAGCAACTCACCCG
TCACCAATGTGGGAAGCAGAGACTTCGTCTGCAACGCTGGCACCCGCCCCGTCAGTGGCAA
GTGCCCCGTGAAGGCTGGCGGCACCGTCACCATCGAGATGCACCAGCAACCCGGCGACCGC
AGCTGCAACAACGAAGCCATCGGAGGGGCGCATTGGGGCCCCGTCCAGGTGTACCTGACCA
AGGTTCAGGACGCCGCGACGGCCGACGGCTCGACGGGCTGGTTCAAGATCTTCTCCGACTCG
TGGTCCAAGAAGCCCGGGGGCAACTCGGGCGACGACGACAACTGGGGCACGCGCGACCTGA
ACGCCTGCTGCGGGAAGATGGACGTGGCCATCCCGGCCGACATCGCGTCGGGCGACTACCT
GCTGCGGGCCGAGGCGCTGGCCCTGCACACGGCCGGACAGGCCGGCGGCGCCCAGTTCTAC
ATGAGCTGCTACCAGATGACGGTCGAGGGCGGCTCCGGGACCGCCAACCCGCCCACCGTCA
AGTTCCCGGGCGCCTACAGCGCCAACGACCCGGGCATCCTCGTCAACATCCACGCCCCCCTT
TCCAGCTACACCGCGCCCGGCCCGGCCGTCTACGCGGGCGGCACCATCCGCGAGGCCGGCTC
CGCCTGCACCGGCTGCGCGCAGACCTGCAAGGTCGGGTCGTCCCCGAGCGCCGTTGCCCCCG
GCAGCGGCGCGGGCAACGGCGGCGGGTTCCAACCCCGA (SEQ ID NO: 97)
MRSTLAGALAAIAAQKVAGHATFQQLWHGSSCVRLPASNSPVTNVGSRDFVCNAGTRPVSGKC
PVKAGGTVTIEMHQQPGDRSCNNEAIGGAHWGPVQVYLTKVQDAATADGSTGWFKIFSDSWSK
KPGGNSGDDDNWGTRDLNACCGKMDVAIPADIASGDYLLRAEALALHTAGQAGGAQFYMSCY
QMTVEGGSGTANPPTVKFPGAYSANDPGILVNIHAPLSSYTAPGPAVYAGGTIREAGSACTGCAQ
TCKVGSSPSAVAPGSGAGNGGGFQPR (SEQ ID NO: 98)
HATFQQLWHGSSCVRLPASNSPVTNVGSRDFVCNAGTRPVSGKCPVKAGGTVTIEMHQQPGDR
SCNNEAIGGAHWGPVQVYLTKVQDAATADGSTGWFKIFSDSWSKKPGGNSGDDDNWGTRDLN
ACCGKMDVAIPADIASGDYLLRAEALALHTAGQAGGAQFYMSCYQMTVEGGSGTANPPTVKFP
GAYSANDPGILVNIHAPLSSYTAPGPAVYAGGTIREAGSACTGCAQTCKVGSSPSAVAPGSGAGN
GGGFQPR
[0285] The polynucleotide (SEQ ID NO:99) and amino acid (SEQ ID
NO:100) sequences of an M. thermophila GH61s are provided below.
The signal sequence is shown underlined in SEQ ID NO:100. SEQ ID
NO:101 provides the sequence of this GH61s without the signal
sequence.
TABLE-US-00032 (SEQ ID NO: 99)
ATGCTCCTCCTCACCCTAGCCACACTCGTCACCCTCCTGGCGCGCCACGTCTCGGCTCACGCC
CGGCTGTTCCGCGTCTCTGTCGACGGGAAAGACCAGGGCGACGGGCTGAACAAGTACATCC
GCTCGCCGGCGACCAACGACCCCGTGCGCGACCTCTCGAGCGCCGCCATCGTGTGCAACACC
CAGGGGTCCAAGGCCGCCCCGGACTTCGTCAGGGCCGCGGCCGGCGACAAGCTGACCTTCC
TCTGGGCGCACGACAACCCGGACGACCCGGTCGACTACGTCCTCGACCCGTCCCACAAGGG
CGCCATCCTGACCTACGTCGCCGCCTACCCCTCCGGGGACCCGACCGGCCCCATCTGGAGCA
AGCTTGCCGAGGAAGGATTCACCGGCGGGCAGTGGGCGACCATCAAGATGATCGACAACGG
CGGCAAGGTCGACGTGACGCTGCCCGAGGCCCTTGCGCCGGGAAAGTACCTGATCCGCCAG
GAGCTGCTGGCCCTGCACCGGGCCGACTTTGCCTGCGACGACCCGGCCCACCCCAACCGCGG
CGCCGAGTCGTACCCCAACTGCGTCCAGGTGGAGGTGTCGGGCAGCGGCGACAAGAAGCCG
GACCAGAACTTTGACTTCAACAAGGGCTATACCTGCGATAACAAAGGACTCCACTTTAAGAT
CTACATCGGTCAGGACAGCCAGTATGTGGCCCCGGGGCCGCGGCCTTGGAATGGGAGC (SEQ ID
NO: 100)
MLLLTLATLVTLLARHVSAHARLFRVSVDGKDQGDGLNKYIRSPATNDPVRDLSSAAIVCNTQG
SKAAPDFVRAAAGDKLTFLWAHDNPDDPVDYVLDPSHKGAILTYVAAYPSGDPTGPIWSKLAE
EGFTGGQWATIKMIDNGGKVDVTLPEALAPGKYLIRQELLALHRADFACDDPAHPNRGAESYPN
CVQVEVSGSGDKKPDQNFDFNKGYTCDNKGLHFKIYIGQDSQYVAPGPRPWNGS (SEQ ID NO:
101)
HARLFRVSVDGKDQGDGLNKYIRSPATNDPVRDLSSAAIVCNTQGSKAAPDFVRAAAGDKLTFL
WAHDNPDDPVDYVLDPSHKGAILTYVAAYPSGDPTGPIWSKLAEEGFTGGQWATIKMIDNGGK
VDVTLPEALAPGKYLIRQELLALHRADFACDDPAHPNRGAESYPNCVQVEVSGSGDKKPDQNFD
FNKGYTCDNKGLHFKIYIGQDSQYVAPGPRPWNGS
[0286] The polynucleotide (SEQ ID NO:102) and amino acid (SEQ ID
NO:103) sequences of an M. thermophila GH61t are provided
below.
TABLE-US-00033 (SEQ ID NO: 102)
ATGTTCACTTCGCTTTGCATCACAGATCATTGGAGGACTCTTAGCAGCCACTCTGGGCCAGTC
ATGAACTATCTCGCCCATTGCACCAATGACGACTGCAAGTCTTTCAAGGGCGACAGCGGCAA
CGTCTGGGTCAAGATCGAGCAGCTCGCGTACAACCCGTCAGCCAACCCCCCCTGGGCGTCTG
ACCTCCTCCGTGAGCACGGTGCCAAGTGGAAGGTGACGATCCCGCCCAGTCTTGTCCCCGGC
GAATATCTGCTGCGGCACGAGATCCTGGGGTTGCACGTCGCAGGAACCGTGATGGGCGCCC
AGTTCTACCCCGGCTGCACCCAGATCAGGGTCACCGAAGGCGGGAGCACGCAGCTGCCCTC
GGGTATTGCGCTCCCAGGCGCTTACGGCCCACAAGACGAGGGTATCTTGGTCGACTTGTGGA
GGGTTAACCAGGGCCAGGTCAACTACACGGCGCCTGGAGGACCCGTTTGGAGCGAAGCGTG
GGACACCGAGTTTGGCGGGTCCAACACGACCGAGTGCGCCACCATGCTCGACGACCTGCTC
GACTACATGGCGGCCAACGACGAGTGGATCGGCTGGACGGCCTAG (SEQ ID NO: 103)
MFTSLCITDHWRTLSSHSGPVMNYLAHCTNDDCKSFKGDSGNVWVKIEQLAYNPSANPPWASD
LLREHGAKWKVTIPPSLVPGEYLLRHEILGLHVAGTVMGAQFYPGCTQIRVTEGGSTQLPSGIAL
PGAYGPQDEGILVDLWRVNQGQVNYTAPGGPVWSEAWDTEFGGSNTTECATMLDDLLDYMA
ANDEWIGWTA
[0287] The polynucleotide (SEQ ID NO:104) and amino acid (SEQ ID
NO:105) sequences of an alternative M. thermophila GH61t are
provided below.
TABLE-US-00034 (SEQ ID NO: 104)
ATGAACTATCTCGCCCATTGCACCAATGACGACTGCAAGTCTTTCAAGGGCGACAGCGGCAA
CGTCTGGGTCAAGATCGAGCAGCTCGCGTACAACCCGTCAGCCAACCCCCCCTGGGCGTCTG
ACCTCCTCCGTGAGCACGGTGCCAAGTGGAAGGTGACGATCCCGCCCAGTCTTGTCCCCGGC
GAATATCTGCTGCGGCACGAGATCCTGGGGTTGCACGTCGCAGGAACCGTGATGGGCGCCC
AGTTCTACCCCGGCTGCACCCAGATCAGGGTCACCGAAGGCGGGAGCACGCAGCTGCCCTC
GGGTATTGCGCTCCCAGGCGCTTACGGCCCACAAGACGAGGGTATCTTGGTCGACTTGTGGA
GGGTTAACCAGGGCCAGGTCAACTACACGGCGCCTGGAGGACCCGTTTGGAGCGAAGCGTG
GGACACCGAGTTTGGCGGGTCCAACACGACCGAGTGCGCCACCATGCTCGACGACCTGCTC
GACTACATGGCGGCCAACGACGACCCATGCTGCACCGACCAGAACCAGTTCGGGAGTCTCG
AGCCGGGGAGCAAGGCGGCCGGCGGCTCGCCGAGCCTGTACGATACCGTCTTGGTCCCCGTT
CTCCAGAAGAAAGTGCCGACAAAGCTGCAGTGGAGCGGACCGGCGAGCGTCAACGGGGAT
GAGTTGACAGAGAGGCCC (SEQ ID NO: 105)
MNYLAHCTNDDCKSFKGDSGNVWVKIEQLAYNPSANPPWASDLLREHGAKWKVTIPPSLVPGE
YLLRHEILGLHVAGTVMGAQFYPGCTQIRVTEGGSTQLPSGIALPGAYGPQDEGILVDLWRVNQ
GQVNYTAPGGPVWSEAWDTEFGGSNTTECATMLDDLLDYMAANDDPCCTDQNQFGSLEPGSK
AAGGSPSLYDTVLVPVLQKKVPTKLQWSGPASVNGDELTERP
[0288] The polynucleotide (SEQ ID NO:106) and amino acid (SEQ ID
NO:107) sequences of an M. thermophila GH61u are provided below.
The signal sequence is shown underlined in SEQ ID NO:107. SEQ ID
NO:108 provides the sequence of this GH61u without the signal
sequence.
TABLE-US-00035 (SEQ ID NO: 106)
ATGAAGCTGAGCGCTGCCATCGCCGTGCTCGCGGCCGCCCTTGCCGAGGGGCACTATACCTT
CCCCAGCATCGCCAACACGGCCGACTGGCAATATGTGCGCATCACGACCAACTTCCAGAGC
AACGGCCCCGTGACGGACGTCAACTCGGACCAGATCCGGTGCTACGAGCGCAACCCGGGCA
CCGGCGCCCCCGGCATCTACAACGTCACGGCCGGCACAACCATCAACTACAACGCCAAGTC
GTCCATCTCCCACCCGGGACCCATGGCCTTCTACATTGCCAAGGTTCCCGCCGGCCAGTCGG
CCGCCACCTGGGACGGTAAGGGCGCCGTCTGGTCCAAGATCCACCAGGAGATGCCGCACTTT
GGCACCAGCCTCACCTGGGACTCCAACGGCCGCACCTCCATGCCCGTCACCATCCCCCGCTG
TCTGCAGGACGGCGAGTATCTGCTGCGTGCAGAGCACATTGCCCTCCACAGCGCCGGCAGCC
CCGGCGGCGCCCAGTTCTACATTTCTTGTGCCCAGCTCTCAGTCACCGGCGGCAGCGGGACC
TGGAACCCCAGGAACAAGGTGTCGTTCCCCGGCGCCTACAAGGCCACTGACCCGGGCATCCT
GATCAACATCTACTACCCCGTCCCGACTAGCTACACTCCCGCTGGTCCCCCCGTCGACACCTGC
(SEQ ID NO: 107)
MKLSAAIAVLAAALAEGHYTFPSIANTADWQYVRITTNFQSNGPVTDVNSDQIRCYERNPGTGA
PGIYNVTAGTTINYNAKSSISHPGPMAFYIAKVPAGQSAATWDGKGAVWSKIHQEMPHFGTSLT
WDSNGRTSMPVTIPRCLQDGEYLLRAEHIALHSAGSPGGAQFYISCAQLSVTGGSGTWNPRNKV
SFPGAYKATDPGILINIYYPVPTSYTPAGPPVDTC (SEQ ID NO: 108)
HYTFPSIANTADWQYVRITTNFQSNGPVTDVNSDQIRCYERNPGTGAPGIYNVTAGTTINYNAKS
SISHPGPMAFYIAKVPAGQSAATWDGKGAVWSKIHQEMPHFGTSLTWDSNGRTSMPVTIPRCLQ
DGEYLLRAEHIALHSAGSPGGAQFYISCAQLSVTGGSGTWNPRNKVSFPGAYKATDPGILINIYYP
VPTSYTPAGPPVDTC
[0289] The polynucleotide (SEQ ID NO:109) and amino acid (SEQ ID
NO:110) sequences of an M. thermophila GH61v are provided below.
The signal sequence is shown underlined in SEQ ID NO:110. SEQ ID
NO:111 provides the sequence of this GH61v without the signal
sequence.
TABLE-US-00036 (SEQ ID NO: 109)
ATGTACCGCACGCTCGGTTCCATTGCCCTGCTCGCGGGGGGCGCTGCCGC
CCACGGCGCCGTGACCAGCTACAACATTGCGGGCAAGGACTACCCTGGAT
ACTCGGGCTTCGCCCCTACCGGCCAGGATGTCATCCAGTGGCAATGGCCC
GACTATAACCCCGTGCTGTCCGCCAGCGACCCCAAGCTCCGCTGCAACGG
CGGCACCGGGGCGGCGCTGTATGCCGAGGCGGCCCCCGGCGACACCATCA
CGGCCACCTGGGCCCAGTGGACGCACTCCCAGGGCCCGATCCTGGTGTGG
ATGTACAAGTGCCCCGGCGACTTCAGCTCCTGCGACGGCTCCGGCGCGGG
TTGGTTCAAGATCGACGAGGCCGGCTTCCACGGCGACGGCACGACCGTCT
TCCTCGACACCGAGACCCCCTCGGGCTGGGACATTGCCAAGCTGGTCGGC
GGCAACAAGTCGTGGAGCAGCAAGATCCCTGACGGCCTCGCCCCGGGCAA
TTACCTGGTCCGCCACGAGCTCATCGCCCTGCACCAGGCCAACAACCCGC
AATTCTACCCCGAGTGCGCCCAGATCAAGGTCACCGGCTCTGGCACCGCC
GAGCCCGCCGCCTCCTACAAGGCCGCCATCCCCGGCTACTGCCAGCAGAG
CGACCCCAACATTTCGTTCAACATCAACGACCACTCCCTCCCGCAGGAGT
ACAAGATCCCCGGTCCCCCGGTCTTCAAGGGCACCGCCTCCGCCAAGGCT CGCGCTTTCCAGGCC
(SEQ ID NO: 110) MYRTLGSIALLAGGAAAHGAVTSYNIAGKDYPGYSGFAPTGQDVIQWQWP
DYNPVLSASDPKLRCNGGTGAALYAEAAPGDTITATWAQWTHSQGPILVW
MYKCPGDFSSCDGSGAGWFKIDEAGFHGDGTTVFLDTETPSGWDIAKLVG
GNKSWSSKIPDGLAPGNYLVRHELIALHQANNPQFYPECAQIKVTGSGTA
EPAASYKAAIPGYCQQSDPNISFNINDHSLPQEYKIPGPPVFKGTASAKA RAFQA (SEQ ID
NO: 111) AVTSYNIAGKDYPGYSGFAPTGQDVIQWQWPDYNPVLSASDPKLRCNGGT
GAALYAEAAPGDTITATWAQWTHSQGPILVWMYKCPGDFSSCDGSGAGWF
KIDEAGFHGDGTTVFLDTETPSGWDIAKLVGGNKSWSSKIPDGLAPGNYL
VRHELIALHQANNPQFYPECAQIKVTGSGTAEPAASYKAAIPGYCQQSDP
NISFNINDHSLPQEYKIPGPPVFKGTASAKARAFQA
[0290] The polynucleotide (SEQ ID NO:112) and amino acid (SEQ ID
NO:113) sequences of an M. thermophila GH61w are provided below.
The signal sequence is shown underlined in SEQ ID NO:113. SEQ ID
NO:114 provides the sequence of this GH61w without the signal
sequence.
TABLE-US-00037 (SEQ ID NO: 112)
ATGCTGACAACAACCTTCGCCCTCCTGACGGCCGCTCTCGGCGTCAGCGC
CCATTATACCCTCCCCAGGGTCGGGACCGGTTCCGACTGGCAGCACGTGC
GGCGGGCTGACAACTGGCAAAACAACGGCTTCGTCGGCGACGTCAACTCG
GAGCAGATCAGGTGCTTCCAGGCGACCCCTGCCGGCGCCCAAGACGTCTA
CACTGTTCAGGCGGGATCGACCGTGACCTACCACGCCAACCCCAGTATCT
ACCACCCCGGCCCCATGCAGTTCTACCTGGCCCGCGTTCCGGACGGACAG
GACGTCAAGTCGTGGACCGGCGAGGGTGCCGTGTGGTTCAAGGTGTACGA
GGAGCAGCCTCAATTTGGCGCCCAGCTGACCTGGCCTAGCAACGGCAAGA
GCTCGTTCGAGGTTCCTATCCCCAGCTGCATTCGGGCGGGCAACTACCTC
CTCCGCGCTGAGCACATCGCCCTGCACGTTGCCCAAAGCCAGGGCGGCGC
CCAGTTCTACATCTCGTGCGCCCAGCTCCAGGTCACTGGTGGCGGCAGCA
CCGAGCCTTCTCAGAAGGTTTCCTTCCCGGGTGCCTACAAGTCCACCGAC
CCCGGCATTCTTATCAACATCAACTACCCCGTCCCTACCTCGTACCAGAA
TCCGGGTCCGGCTGTCTTCCGTTGC (SEQ ID NO: 113)
MLTTTFALLTAALGVSAHYTLPRVGTGSDWQHVRRADNWQNNGFVGDVNS
EQIRCFQATPAGAQDVYTVQAGSTVTYHANPSIYHPGPMQFYLARVPDGQ
DVKSWTGEGAVWFKVYEEQPQFGAQLTWPSNGKSSFEVPIPSCIRAGNYL
LRAEHIALHVAQSQGGAQFYISCAQLQVTGGGSTEPSQKVSFPGAYKSTD
PGILININYPVPTSYQNPGPAVFRC (SEQ ID NO: 114)
HYTLPRVGTGSDWQHVRRADNWQNNGFVGDVNSEQIRCFQATPAGAQDVY
TVQAGSTVTYHANPSIYHPGPMQFYLARVPDGQDVKSWTGEGAVWFKVYE
EQPQFGAQLTWPSNGKSSFEVPIPSCIRAGNYLLRAEHIALHVAQSQGGA
QFYISCAQLQVTGGGSTEPSQKVSFPGAYKSTDPGILININYPVPTSYQN PGPAVFRC
[0291] The polynucleotide (SEQ ID NO:115) and amino acid (SEQ ID
NO:116) sequences of a M. thermophila GH61x are provided below. The
signal sequence is shown underlined in SEQ ID NO:116. SEQ ID NO:117
provides the sequence of this GH61x without the signal
sequence.
TABLE-US-00038 (SEQ ID NO: 115)
ATGAAGGTTCTCGCGCCCCTGATTCTGGCCGGTGCCGCCAGCGCCCACAC
CATCTTCTCATCCCTCGAGGTGGGCGGCGTCAACCAGGGCATCGGGCAGG
GTGTCCGCGTGCCGTCGTACAACGGTCCGATCGAGGACGTGACGTCCAAC
TCGATCGCCTGCAACGGGCCCCCCAACCCGACGACGCCGACCAACAAGGT
CATCACGGTCCGGGCCGGCGAGACGGTGACGGCCGTCTGGCGGTACATGC
TGAGCACCACCGGCTCGGCCCCCAACGACATCATGGACAGCAGCCACAAG
GGCCCGACCATGGCCTACCTCAAGAAGGTCGACAACGCCACCACCGACTC
GGGCGTCGGCGGCGGCTGGTTCAAGATCCAGGAGGACGGCCTTACCAACG
GCGTCTGGGGCACCGAGCGCGTCATCAACGGCCAGGGCCGCCACAACATC
AAGATCCCCGAGTGCATCGCCCCCGGCCAGTACCTCCTCCGCGCCGAGAT
GCTTGCCCTGCACGGAGCTTCCAACTACCCCGGCGCTCAGTTCTACATGG
AGTGCGCCCAGCTCAATATCGTCGGCGGCACCGGCAGCAAGACGCCGTCC
ACCGTCAGCTTCCCGGGCGCTTACAAGGGTACCGACCCCGGAGTCAAGAT
CAACATCTACTGGCCCCCCGTCACCAGCTACCAGATTCCCGGCCCCGGCG TGTTCACCTGC (SEQ
ID NO: 116) MKVLAPLILAGAASAHTIFSSLEVGGVNQGIGQGVRVPSYNGPIEDVTSN
SIACNGPPNPTTPTNKVITVRAGETVTAVWRYMLSTTGSAPNDIMDSSHK
GPTMAYLKKVDNATTDSGVGGGWFKIQEDGLINGVWGTERVINGQGRHNI
KIPECIAPGQYLLRAEMLALHGASNYPGAQFYMECAQLNIVGGTGSKTPS
TVSFPGAYKGTDPGVKINIYWPPVTSYQIPGPGVFTC (SEQ ID NO: 117)
HTIFSSLEVGGVNQGIGQGVRVPSYNGPIEDVTSNSIACNGPPNPTTPTN
KVITVRAGETVTAVWRYMLSTTGSAPNDIMDSSHKGPTMAYLKKVDNATT
DSGVGGGWFKIQEDGLTNGVWGTERVINGQGRHNIKIPECIAPGQYLLRA
EMLALHGASNYPGAQFYMECAQLNIVGGTGSKTPSTVSFPGAYKGTDPGV
KINIYWPPVTSYQIPGPGVFTC
[0292] The polynucleotide (SEQ ID NO:118) and amino acid (SEQ ID
NO:119) sequences of an M. thermophila GH61y are provided below.
The signal sequence is underlined in SEQ ID NO:119. SEQ ID NO:120
provides the sequence of GH61y, without the signal sequence.
TABLE-US-00039 (SEQ ID NO: 118)
ATGATCGACAACCTCCCTGATGACTCCCTACAACCCGCCTGCCTCCGCCC
GGGCCACTACCTCGTCCGCCACGAGATCATCGCGCTGCACTCGGCCTGGG
CCGAGGGCGAGGCCCAGTTCTACCCCTTCCCCCTTTTTCCTTTTTTTCCC
TCCCTTCTTTTGTCCGGTAACTACACGATTCCCGGTCCCGCGATCTGGAA
GTGCCCAGAGGCACAGCAGAACGAG (SEQ ID NO: 119)
MIDNLPDDSLQPACLRPGHYLVRHEIIALHSAWAEGEAQFYPFPLFPFFP
SLLLSGNYTIPGPAIWKCPEAQQNE (SEQ ID NO: 120)
HYLVRHEIIALHSAWAEGEAQFYPFPLFPFFPSLLLSGNYTIPGPAIWKC PEAQQNE
[0293] Wild-type EG1b cDNA (SEQ ID NO:121) and amino acid (SEQ ID
NO:122) sequences are provided below. The signal sequence is
underlined in SEQ ID NO:122. SEQ ID NO:123 provides the sequence of
EG1b, without the signal sequence.
TABLE-US-00040 (SEQ ID NO: 121)
ATGGGGCAGAAGACTCTCCAGGGGCTGGTGGCGGCGGCGGCACTGGCAGC
CTCGGTGGCGAACGCGCAGCAACCGGGCACCTTCACGCCCGAGGTGCATC
CGACGCTGCCGACGTGGAAGTGCACGACGAGCGGCGGGTGCGTCCAGCAG
GACACGTCGGTGGTGCTCGACTGGAACTACCGCTGGTTCCACACCGAGGA
CGGTAGCAAGTCGTGCATCACCTCTAGCGGCGTCGACCGGACCCTGTGCC
CGGACGAGGCGACGTGCGCCAAGAACTGCTTCGTCGAGGGCGTCAACTAC
ACGAGCAGCGGGGTCGAGACGTCCGGCAGCTCCCTCACCCTCCGCCAGTT
CTTCAAGGGCTCCGACGGCGCCATCAACAGCGTCTCCCCGCGCGTCTACC
TGCTCGGGGGAGACGGCAACTATGTCGTGCTCAAGCTCCTCGGCCAGGAG
CTGAGCTTCGACGTGGACGTATCGTCGCTCCCGTGCGGCGAGAACGCGGC
CCTGTACCTGTCCGAGATGGACGCGACGGGAGGACGGAACGAGTACAACA
CGGGCGGGGCCGAGTACGGGTCGGGCTACTGTGACGCCCAGTGCCCCGTG
CAGAACTGGAACAACGGGACGCTCAACACGGGCCGGGTGGGCTCGTGCTG
CAACGAGATGGACATCCTCGAGGCCAACTCCAAGGCCGAGGCCTTCACGC
CGCACCCCTGCATCGGCAACTCGTGCGACAAGAGCGGGTGCGGCTTCAAC
GCGTACGCGCGCGGTTACCACAACTACTGGGCCCCCGGCGGCACGCTCGA
CACGTCCCGGCCTTTCACCATGATCACCCGCTTCGTCACCGACGACGGCA
CCACCTCGGGCAAGCTCGCCCGCATCGAGCGCGTCTACGTCCAGGACGGC
AAGAAGGTGCCCAGCGCGGCGCCCGGGGGGGACGTCATCACGGCCGACGG
GTGCACCTCCGCGCAGCCCTACGGCGGCCTTTCCGGCATGGGCGACGCCC
TCGGCCGCGGCATGGTCCTGGCCCTGAGCATCTGGAACGACGCGTCCGGG
TACATGAACTGGCTCGACGCCGGCAGCAACGGCCCCTGCAGCGACACCGA
GGGTAACCCGTCCAACATCCTGGCCAACCACCCGGACGCCCACGTCGTGC
TCTCCAACATCCGCTGGGGCGACATCGGCTCCACCGTCGACACCGGCGAT
GGCGACAACAACGGCGGCGGCCCCAACCCGTCATCCACCACCACCGCTAC
CGCTACCACCACCTCCTCCGGCCCGGCCGAGCCTACCCAGACCCACTACG
GCCAGTGTGGAGGGAAAGGATGGACGGGCCCTACCCGCTGCGAGACGCCC
TACACCTGCAAGTACCAGAACGACTGGTACTCGCAGTGCCTGTAG (SEQ ID NO: 122)
MGQKTLQGLVAAAALAASVANAQQPGTFTPEVHPTLPTWKCTTSGGCVQQ
DTSVVLDWNYRWFHTEDGSKSCITSSGVDRTLCPDEATCAKNCFVEGVNY
TSSGVETSGSSLTLRQFFKGSDGAINSVSPRVYLLGGDGNYVVLKLLGQE
LSFDVDVSSLPCGENAALYLSEMDATGGRNEYNTGGAEYGSGYCDAQCPV
QNWNNGTLNTGRVGSCCNEMDILEANSKAEAFTPHPCIGNSCDKSGCGFN
AYARGYHNYWAPGGTLDTSRPFTMITRFVTDDGTTSGKLARIERVYVQDG
KKVPSAAPGGDVITADGCTSAQPYGGLSGMGDALGRGMVLALSIWNDASG
YMNWLDAGSNGPCSDTEGNPSNILANHPDAHVVLSNIRWGDIGSTVDTGD
GDNNGGGPNPSSTTTATATTTSSGPAEPTQTHYGQCGGKGWTGPTRCETP YTCKYQNDWYSQCL
(SEQ ID NO: 123) QQPGTFTPEVHPTLPTWKCTTSGGCVQQDTSVVLDWNYRWFHTEDGSKSC
ITSSGVDRTLCPDEATCAKNCFVEGVNYTSSGVETSGSSLTLRQFFKGSD
GAINSVSPRVYLLGGDGNYVVLKLLGQELSFDVDVSSLPCGENAALYLSE
MDATGGRNEYNTGGAEYGSGYCDAQCPVQNWNNGTLNTGRVGSCCNEMDI
LEANSKAEAFTPHPCIGNSCDKSGCGFNAYARGYHNYWAPGGTLDTSRPF
TMITRFVTDDGTTSGKLARIERVYVQDGKKVPSAAPGGDVITADGCTSAQ
PYGGLSGMGDALGRGMVLALSIWNDASGYMNWLDAGSNGPCSDTEGNPSN
ILANHPDAHVVLSNIRWGDIGSTVDTGDGDNNGGGPNPSSTTTATATTTS
SGPAEPTQTHYGQCGGKGWTGPTRCETPYTCKYQNDWYSQCL
[0294] Wild-type M. thermophila EG2 polynucleotide (SEQ ID NO:124)
and amino acid (SEQ ID NO:125) sequences are provided below. The
signal sequence is underlined in SEQ ID NO:125. SEQ ID NO:126
provides the sequence of EG2, without the signal sequence.
TABLE-US-00041 (SEQ ID NO: 124)
ATGAAGTCCTCCATCCTCGCCAGCGTCTTCGCCACGGGCGCCGTGGCTCA
AAGTGGTCCGTGGCAGCAATGTGGTGGCATCGGATGGCAAGGATCGACCG
ACTGTGTGTCGGGTTACCACTGCGTCTACCAGAACGATTGGTACAGCCAG
TGCGTGCCTGGCGCGGCGTCGACAACGCTCCAGACATCTACCACGTCCAG
GCCCACCGCCACCAGCACCGCCCCTCCGTCGTCCACCACCTCGCCTAGCA
AGGGCAAGCTCAAGTGGCTCGGCAGCAACGAGTCGGGCGCCGAGTTCGGG
GAGGGCAACTACCCCGGCCTCTGGGGCAAGCACTTCATCTTCCCGTCGAC
TTCGGCGATTCAGACGCTCATCAATGATGGATACAACATCTTCCGGATCG
ACTTCTCGATGGAGCGTCTGGTGCCCAACCAGTTGACGTCGTCCTTCGAC
GAGGGCTACCTCCGCAACCTGACCGAGGTGGTCAACTTCGTGACGAACGC
GGGCAAGTACGCCGTCCTGGACCCGCACAACTACGGCCGGTACTACGGCA
ACGTCATCACGGACACGAACGCGTTCCGGACCTTCTGGACCAACCTGGCC
AAGCAGTTCGCCTCCAACTCGCTCGTCATCTTCGACACCAACAACGAGTA
CAACACGATGGACCAGACCCTGGTGCTCAACCTCAACCAGGCCGCCATCG
ACGGCATCCGGGCCGCCGGCGCGACCTCGCAGTACATCTTCGTCGAGGGC
AACGCGTGGAGCGGGGCCTGGAGCTGGAACACGACCAACACCAACATGGC
CGCCCTGACGGACCCGCAGAACAAGATCGTGTACGAGATGCACCAGTACC
TCGACTCGGACAGCTCGGGCACCCACGCCGAGTGCGTCAGCAGCAACATC
GGCGCCCAGCGCGTCGTCGGAGCCACCCAGTGGCTCCGCGCCAACGGCAA
GCTCGGCGTCCTCGGCGAGTTCGCCGGCGGCGCCAACGCCGTCTGCCAGC
AGGCCGTCACCGGCCTCCTCGACCACCTCCAGGACAACAGCGACGTCTGG
CTGGGTGCCCTCTGGTGGGCCGCCGGTCCCTGGTGGGGCGACTACATGTA
CTCGTTCGAGCCTCCTTCGGGCACCGGCTATGTCAACTACAACTCGATCC
TAAAGAAGTACTTGCCGTAA (SEQ ID NO: 125)
MKSSILASVFATGAVAQSGPWQQCGGIGWQGSTDCVSGYHCVYQNDWYSQ
CVPGAASTTLQTSTTSRPTATSTAPPSSTTSPSKGKLKWLGSNESGAEFG
EGNYPGLWGKHFIFPSTSAIQTLINDGYNIFRIDFSMERLVPNQLTSSFD
EGYLRNLTEVVNFVTNAGKYAVLDPHNYGRYYGNVITDTNAFRTFWTNLA
KQFASNSLVIFDTNNEYNTMDQTLVLNLNQAAIDGIRAAGATSQYIFVEG
NAWSGAWSWNTTNTNMAALTDPQNKIVYEMHQYLDSDSSGTHAECVSSNI
GAQRVVGATQWLRANGKLGVLGEFAGGANAVCQQAVTGLLDHLQDNSEVW
LGALWWAAGPWWGDYMYSFEPPSGTGYVNYNSILKKYLP (SEQ ID NO: 126)
QSGPWQQCGGIGWQGSTDCVSGYHCVYQNDWYSQCVPGAASTTLQTSTTS
RPTATSTAPPSSTTSPSKGKLKWLGSNESGAEFGEGNYPGLWGKHFIFPS
TSAIQTLINDGYNIFRIDFSMERLVPNQLTSSFDEGYLRNLTEVVNFVTN
AGKYAVLDPHNYGRYYGNVITDTNAFRTFWTNLAKQFASNSLVIFDTNNE
YNTMDQTLVLNLNQAAIDGIRAAGATSQYIFVEGNAWSGAWSWNTTNTNM
AALTDPQNKIVYEMHQYLDSDSSGTHAECVSSNIGAQRVVGATQWLRANG
KLGVLGEFAGGANAVCQQAVTGLLDHLQDNSEVWLGALWWAAGPWWGDYM
YSFEPPSGTGYVNYNSILKKYLP
[0295] The polynucleotide (SEQ ID NO:127) and amino acid (SEQ ID
NO:128) sequences of a wild-type BGL are provided below. The signal
sequence is underlined in SEQ ID NO:128. SEQ ID NO:129 provides the
polypeptide sequence without the signal sequence.
TABLE-US-00042 (SEQ ID NO: 127)
ATGAAGGCTGCTGCGCTTTCCTGCCTCTTCGGCAGTACCCTTGCCGTTGC
AGGCGCCATTGAATCGAGAAAGGTTCACCAGAAGCCCCTCGCGAGATCTG
AACCTTTTTACCCGTCGCCATGGATGAATCCCAACGCCGACGGCTGGGCG
GAGGCCTATGCCCAGGCCAAGTCCTTTGTCTCCCAAATGACTCTGCTAGA
GAAGGTCAACTTGACCACGGGAGTCGGCTGGGGGGCTGAGCAGTGCGTCG
GCCAAGTGGGCGCGATCCCTCGCCTTGGACTTCGCAGTCTGTGCATGCAT
GACTCCCCTCTCGGCATCCGAGGAGCCGACTACAACTCAGCGTTCCCCTC
TGGCCAGACCGTTGCTGCTACCTGGGATCGCGGTCTGATGTACCGTCGCG
GCTACGCAATGGGCCAGGAGGCCAAAGGCAAGGGCATCAATGTCCTTCTC
GGACCAGTCGCCGGCCCCCTTGGCCGCATGCCCGAGGGCGGTCGTAACTG
GGAAGGCTTCGCTCCGGATCCCGTCCTTACCGGCATCGGCATGTCCGAGA
CGATCAAGGGCATTCAGGATGCTGGCGTCATCGCTTGTGCGAAGCACTTT
ATTGGAAACGAGCAGGAGCACTTCAGACAGGTGCCAGAAGCCCAGGGATA
CGGTTACAACATCAGCGAAACCCTCTCCTCCAACATTGACGACAAGACCA
TGCACGAGCTCTACCTTTGGCCGTTTGCCGATGCCGTCCGGGCCGGCGTC
GGCTCTGTCATGTGCTCGTACCAGCAGGTCAACAACTCGTACGCCTGCCA
GAACTCGAAGCTGCTGAACGACCTCCTCAAGAACGAGCTTGGGTTTCAGG
GCTTCGTCATGAGCGACTGGCAGGCACAGCACACTGGCGCAGCAAGCGCC
GTGGCTGGTCTCGATATGTCCATGCCGGGCGACACCCAGTTCAACACTGG
CGTCAGTTTCTGGGGCGCCAATCTCACCCTCGCCGTCCTCAACGGCACAG
TCCCTGCCTACCGTCTCGACGACATGGCCATGCGCATCATGGCCGCCCTC
TTCAAGGTCACCAAGACCACCGACCTGGAACCGATCAACTTCTCCTTCTG
GACCGACGACACTTATGGCCCGATCCACTGGGCCGCCAAGCAGGGCTACC
AGGAGATTAATTCCCACGTTGACGTCCGCGCCGACCACGGCAACCTCATC
CGGGAGATTGCCGCCAAGGGTACGGTGCTGCTGAAGAATACCGGCTCTCT
ACCCCTGAACAAGCCAAAGTTCGTGGCCGTCATCGGCGAGGATGCTGGGT
CGAGCCCCAACGGGCCCAACGGCTGCAGCGACCGCGGCTGTAACGAAGGC
ACGCTCGCCATGGGCTGGGGATCCGGCACAGCCAACTATCCGTACCTCGT
TTCCCCCGACGCCGCGCTCCAGGCCCGGGCCATCCAGGACGGCACGAGGT
ACGAGAGCGTCCTGTCCAACTACGCCGAGGAAAAGACAAAGGCTCTGGTC
TCGCAGGCCAATGCAACCGCCATCGTCTTCGTCAATGCCGACTCAGGCGA
GGGCTACATCAACGTGGACGGTAACGAGGGCGACCGTAAGAACCTGACTC
TCTGGAACAACGGTGATACTCTGGTCAAGAACGTCTCGAGCTGGTGCAGC
AACACCATCGTCGTCATCCACTCGGTCGGCCCGGTCCTCCTGACCGATTG
GTACGACAACCCCAACATCACGGCCATTCTCTGGGCTGGTCTTCCGGGCC
AGGAGTCGGGCAACTCCATCACCGACGTGCTTTACGGCAAGGTCAACCCC
GCCGCCCGCTCGCCCTTCACTTGGGGCAAGACCCGCGAAAGCTATGGCGC
GGACGTCCTGTACAAGCCGAATAATGGCAATGGTGCGCCCCAACAGGACT
TCACCGAGGGCGTCTTCATCGACTACCGCTACTTCGACAAGGTTGACGAT
GACTCGGTCATCTACGAGTTCGGCCACGGCCTGAGCTACACCACCTTCGA
GTACAGCAACATCCGCGTCGTCAAGTCCAACGTCAGCGAGTACCGGCCCA
CGACGGGCACCACGGCCCAGGCCCCGACGTTTGGCAACTTCTCCACCGAC
CTCGAGGACTATCTCTTCCCCAAGGACGAGTTCCCCTACATCTACCAGTA
CATCTACCCGTACCTCAACACGACCGACCCCCGGAGGGCCTCGGCCGATC
CCCACTACGGCCAGACCGCCGAGGAGTTCCTCCCGCCCCACGCCACCGAT
GACGACCCCCAGCCGCTCCTCCGGTCCTCGGGCGGAAACTCCCCCGGCGG
CAACCGCCAGCTGTACGACATTGTCTACACAATCACGGCCGACATCACGA
ATACGGGCTCCGTTGTAGGCGAGGAGGTACCGCAGCTCTACGTCTCGCTG
GGCGGTCCCGAGGATCCCAAGGTGCAGCTGCGCGACTTTGACAGGATGCG
GATCGAACCCGGCGAGACGAGGCAGTTCACCGGCCGCCTGACGCGCAGAG
ATCTGAGCAACTGGGACGTCACGGTGCAGGACTGGGTCATCAGCAGGTAT
CCCAAGACGGCATATGTTGGGAGGAGCAGCCGGAAGTTGGATCTCAAGAT TGAGCTTCCTTGA
(SEQ ID NO: 128) MKAAALSCLFGSTLAVAGAIESRKVHQKPLARSEPFYPSPWMNPNADGWA
EAYAQAKSFVSQMTLLEKVNLTTGVGWGAEQCVGQVGAIPRLGLRSLCMH
DSPLGIRGADYNSAFPSGQTVAATWDRGLMYRRGYAMGQEAKGKGINVLL
GPVAGPLGRMPEGGRNWEGFAPDPVLTGIGMSETIKGIQDAGVIACAKHF
IGNEQEHFRQVPEAQGYGYNISETLSSNIDDKTMHELYLWPFADAVRAGV
GSVMCSYQQVNNSYACQNSKLLNDLLKNELGFQGFVMSDWQAQHTGAASA
VAGLDMSMPGDTQFNTGVSFWGANLTLAVLNGTVPAYRLDDMAMRIMAAL
FKVTKTTDLEPINFSFWTDDTYGPIHWAAKQGYQEINSHVDVRADHGNLI
REIAAKGTVLLKNTGSLPLNKPKFVAVIGEDAGSSPNGPNGCSDRGCNEG
TLAMGWGSGTANYPYLVSPDAALQARAIQDGTRYESVLSNYAEEKTKALV
SQANATAIVFVNADSGEGYINVDGNEGDRKNLTLWNNGDTLVKNVSSWCS
NTIVVIHSVGPVLLTDWYDNPNITAILWAGLPGQESGNSITDVLYGKVNP
AARSPFTWGKTRESYGADVLYKPNNGNGAPQQDFTEGVFIDYRYFDKVDD
DSVIYEFGHGLSYTTFEYSNIRVVKSNVSEYRPTTGTTAQAPTFGNFSTD
LEDYLFPKDEFPYIYQYIYPYLNTTDPRRASADPHYGQTAEEFLPPHATD
DDPQPLLRSSGGNSPGGNRQLYDIVYTITADITNTGSVVGEEVPQLYVSL
GGPEDPKVQLRDFDRMRIEPGETRQFTGRLTRRDLSNWDVTVQDWVISRY
PKTAYVGRSSRKLDLKIELP (SEQ ID NO: 129)
IESRKVHQKPLARSEPFYPSPWMNPNADGWAEAYAQAKSFVSQMTLLEKV
NLTTGVGWGAEQCVGQVGAIPRLGLRSLCMHDSPLGIRGADYNSAFPSGQ
TVAATWDRGLMYRRGYAMGQEAKGKGINVLLGPVAGPLGRMPEGGRNWEG
FAPDPVLTGIGMSETIKGIQDAGVIACAKHFIGNEQEHFRQVPEAQGYGY
NISETLSSNIDDKTMHELYLWPFADAVRAGVGSVMCSYQQVNNSYACQNS
KLLNDLLKNELGFQGFVMSDWQAQHTGAASAVAGLDMSMPGDTQFNTGVS
FWGANLTLAVLNGTVPAYRLDDMAMRIMAALFKVTKTTDLEPINFSFWTD
DTYGPIHWAAKQGYQEINSHVDVRADHGNLIREIAAKGTVLLKNTGSLPL
NKPKFVAVIGEDAGSSPNGPNGCSDRGCNEGTLAMGWGSGTANYPYLVSP
DAALQARAIQDGTRYESVLSNYAEEKTKALVSQANATAIVFVNADSGEGY
INVDGNEGDRKNLTLWNNGDTLVKNVSSWCSNTIVVIHSVGPVLLTDWYD
NPNITAILWAGLPGQESGNSITDVLYGKVNPAARSPFTWGKTRESYGADV
LYKPNNGNGAPQQDFTEGVFIDYRYFDKVDDDSVIYEFGHGLSYTTFEYS
NIRVVKSNVSEYRPTTGTTAQAPTFGNFSTDLEDYLFPKDEFPYIYQYIY
PYLNTTDPRRASADPHYGQTAEEFLPPHATDDDPQPLLRSSGGNSPGGNR
QLYDIVYTITADITNTGSVVGEEVPQLYVSLGGPEDPKVQLRDFDRMRIE
PGETRQFTGRLTRRDLSNWDVTVQDWVISRYPKTAYVGRSSRKLDLKIEL P
[0296] The polynucleotide (SEQ ID NO:130) and amino acid (SEQ ID
NO:131) sequences of a BGL variant ("Variant 883") are provided
below. The signal sequence is underlined in SEQ ID NO:131. SEQ ID
NO:132 provides the sequence of this BGL variant, without the
signal sequence.
TABLE-US-00043 (SEQ ID NO: 130)
ATGAAGGCTGCTGCGCTTTCCTGCCTCTTCGGCAGTACCCTTGCCGTTGC
AGGCGCCATTGAATCGAGAAAGGTTCACCAGAAGCCCCTCGCGAGATCTG
AACCTTTTTACCCGTCGCCATGGATGAATCCCAACGCCGACGGCTGGGCG
GAGGCCTATGCCCAGGCCAAGTCCTTTGTCTCCCAAATGACTCTGCTAGA
GAAGGTCAACTTGACCACGGGAGTCGGCTGGGGGGCTGAGCAGTGCGTCG
GCCAAGTGGGCGCGATCCCTCGCCTTGGACTTCGCAGTCTGTGCATGCAT
GACTCCCCTCTCGGCATCCGAGGAGCCGACTACAACTCAGCGTTCCCCTC
TGGCCAGACCGTTGCTGCTACCTGGGATCGCGGTCTGATGTACCGTCGCG
GCTACGCAATGGGCCAGGAGGCCAAAGGCAAGGGCATCAATGTCCTTCTC
GGACCAGTCGCCGGCCCCCTTGGCCGCATGCCCGAGGGCGGTCGTAACTG
GGAAGGCTTCGCTCCGGATCCCGTCCTTACCGGCATCGGCATGTCCGAGA
CGATCAAGGGCATTCAGGATGCTGGCGTCATCGCTTGTGCGAAGCACTTT
ATTGGAAACGAGCAGGAGCACTTCAGACAGGTGCCAGAAGCCCAGGGATA
CGGTTACAACATCAGCGAAACCCTCTCCTCCAACATTGACGACAAGACCA
TGCACGAGCTCTACCTTTGGCCGTTTGCCGATGCCGTCCGGGCCGGCGTC
GGCTCTGTCATGTGCTCGTACAACCAGGTCAACAACTCGTACGCCTGCCA
GAACTCGAAGCTGCTGAACGACCTCCTCAAGAACGAGCTTGGGTTTCAGG
GCTTCGTCATGAGCGACTGGTGGGCACAGCACACTGGCGCAGCAAGCGCC
GTGGCTGGTCTCGATATGTCCATGCCGGGCGACACCATGTTCAACACTGG
CGTCAGTTTCTGGGGCGCCAATCTCACCCTCGCCGTCCTCAACGGCACAG
TCCCTGCCTACCGTCTCGACGACATGGCCATGCGCATCATGGCCGCCCTC
TTCAAGGTCACCAAGACCACCGACCTGGAACCGATCAACTTCTCCTTCTG
GACCCGCGACACTTATGGCCCGATCCACTGGGCCGCCAAGCAGGGCTACC
AGGAGATTAATTCCCACGTTGACGTCCGCGCCGACCACGGCAACCTCATC
CGGAACATTGCCGCCAAGGGTACGGTGCTGCTGAAGAATACCGGCTCTCT
ACCCCTGAACAAGCCAAAGTTCGTGGCCGTCATCGGCGAGGATGCTGGGC
CGAGCCCCAACGGGCCCAACGGCTGCAGCGACCGCGGCTGTAACGAAGGC
ACGCTCGCCATGGGCTGGGGATCCGGCACAGCCAACTATCCGTACCTCGT
TTCCCCCGACGCCGCGCTCCAGTTGCGGGCCATCCAGGACGGCACGAGGT
ACGAGAGCGTCCTGTCCAACTACGCCGAGGAAAATACAAAGGCTCTGGTC
TCGCAGGCCAATGCAACCGCCATCGTCTTCGTCAATGCCGACTCAGGCGA
GGGCTACATCAACGTGGACGGTAACGAGGGCGACCGTAAGAACCTGACTC
TCTGGAACAACGGTGATACTCTGGTCAAGAACGTCTCGAGCTGGTGCAGC
AACACCATCGTCGTCATCCACTCGGTCGGCCCGGTCCTCCTGACCGATTG
GTACGACAACCCCAACATCACGGCCATTCTCTGGGCTGGTCTTCCGGGCC
AGGAGTCGGGCAACTCCATCACCGACGTGCTTTACGGCAAGGTCAACCCC
GCCGCCCGCTCGCCCTTCACTTGGGGCAAGACCCGCGAAAGCTATGGCGC
GGACGTCCTGTACAAGCCGAATAATGGCAATTGGGCGCCCCAACAGGACT
TCACCGAGGGCGTCTTCATCGACTACCGCTACTTCGACAAGGTTGACGAT
GACTCGGTCATCTACGAGTTCGGCCACGGCCTGAGCTACACCACCTTCGA
GTACAGCAACATCCGCGTCGTCAAGTCCAACGTCAGCGAGTACCGGCCCA
CGACGGGCACCACGATTCAGGCCCCGACGTTTGGCAACTTCTCCACCGAC
CTCGAGGACTATCTCTTCCCCAAGGACGAGTTCCCCTACATCCCGCAGTA
CATCTACCCGTACCTCAACACGACCGACCCCCGGAGGGCCTCGGCCGATC
CCCACTACGGCCAGACCGCCGAGGAGTTCCTCCCGCCCCACGCCACCGAT
GACGACCCCCAGCCGCTCCTCCGGTCCTCGGGCGGAAACTCCCCCGGCGG
CAACCGCCAGCTGTACGACATTGTCTACACAATCACGGCCGACATCACGA
ATACGGGCTCCGTTGTAGGCGAGGAGGTACCGCAGCTCTACGTCTCGCTG
GGCGGTCCCGAGGATCCCAAGGTGCAGCTGCGCGACTTTGACAGGATGCG
GATCGAACCCGGCGAGACGAGGCAGTTCACCGGCCGCCTGACGCGCAGAG
ATCTGAGCAACTGGGACGTCACGGTGCAGGACTGGGTCATCAGCAGGTAT
CCCAAGACGGCATATGTTGGGAGGAGCAGCCGGAAGTTGGATCTCAAGAT TGAGCTTCCTTGA
(SEQ ID NO: 131) MKAAALSCLFGSTLAVAGAIESRKVHQKPLARSEPFYPSPWMNPNADGWA
EAYAQAKSFVSQMTLLEKVNLTTGVGWGAEQCVGQVGAIPRLGLRSLCMH
DSPLGIRGADYNSAFPSGQTVAATWDRGLMYRRGYAMGQEAKGKGINVLL
GPVAGPLGRMPEGGRNWEGFAPDPVLTGIGMSETIKGIQDAGVIACAKHF
IGNEQEHFRQVPEAQGYGYNISETLSSNIDDKTMHELYLWPFADAVRAGV
GSVMCSYNQVNNSYACQNSKLLNDLLKNELGFQGFVMSDWWAQHTGAASA
VAGLDMSMPGDTMFNTGVSFWGANLTLAVLNGTVPAYRLDDMAMRIMAAL
FKVTKTTDLEPINFSFWTRDTYGPIHWAAKQGYQEINSHVDVRADHGNLI
RNIAAKGTVLLKNTGSLPLNKPKYVAVIGEDAGPSPNGPNGCSDRGCNEG
TLAMGWGSGTANYPYLVSPDAALQLRAIQDGTRYESVLSNYAEENTKALV
SQANATAIVFVNADSGEGYINVDGNEGDRKNLTLWNNGDTLVKNVSSWCS
NTIVVIHSVGPVLLTDWYDNPNITAILWAGLPGQESGNSITDVLYGKVNP
AARSPFTWGKTRESYGADVLYKPNNGNWAPQQDFTEGVFIDYRYFDKVDD
DSVIYEFGHGLSYTTFEYSNIRVVKSNVSEYRPTTGTTIQAPTFGNFSTD
LEDYLFPKDEFPYIPQYIYPYLNTTDPRRASADPHYGQTAEEFLPPHATD
DDPQPLLRSSGGNSPGGNRQLYDIVYTITADITNTGSVVGEEVPQLYVSL
GGPEDPKVQLRDFDRMRIEPGETRQFTGRLTRRDLSNWDVTVQDWVISRY
PKTAYVGRSSRKLDLKIELP (SEQ ID NO: 132)
IESRKVHQKPLARSEPFYPSPWMNPNADGWAEAYAQAKSFVSQMTLLEKV
NLTTGVGWGAEQCVGQVGAIPRLGLRSLCMHDSPLGIRGADYNSAFPSGQ
TVAATWDRGLMYRRGYAMGQEAKGKGINVLLGPVAGPLGRMPEGGRNWEG
FAPDPVLTGIGMSETIKGIQDAGVIACAKHFIGNEQEHFRQVPEAQGYGY
NISETLSSNIDDKTMHELYLWPFADAVRAGVGSVMCSYNQVNNSYACQNS
KLLNDLLKNELGFQGFVMSDWWAQHTGAASAVAGLDMSMPGDTMFNTGVS
FWGANLTLAVLNGTVPAYRLDDMAMRIMAALFKVTKTTDLEPINFSFWTR
DTYGPIHWAAKQGYQEINSHVDVRADHGNLIRNIAAKGTVLLKNTGSLPL
NKPKFVAVIGEDAGPSPNGPNGCSDRGCNEGTLAMGWGSGTANYPYLVSP
DAALQLRAIQDGTRYESVLSNYAEENTKALVSQANATAIVFVNADSGEGY
INVDGNEGDRKNLTLWNNGDTLVKNVSSWCSNTIVVIHSVGPVLLTDWYD
NPNITAILWAGLPGQESGNSITDVLYGKVNPAARSPFTWGKTRESYGADV
LYKPNNGNWAPQQDFTEGVFIDYRYFDKVDDDSVIYEFGHGLSYTTFEYS
NIRVVKSNVSEYRPTTGTTIQAPTFGNFSTDLEDYLFPKDEFPYIPQYIY
PYLNTTDPRRASADPHYGQTAEEFLPPHATDDDPQPLLRSSGGNSPGGNR
QLYDIVYTITADITNTGSVVGEEVPQLYVSLGGPEDPKVQLRDFDRMRIE
PGETRQFTGRLTRRDLSNWDVTVQDWVISRYPKTAYVGRSSRKLDLKIEL P
[0297] The polynucleotide (SEQ ID NO:133) and amino acid (SEQ ID
NO:134) sequences of a BGL variant ("Variant 900") are provided
below. The signal sequence is underlined in SEQ ID NO:134. SEQ ID
NO:135 provides the sequence of this BGL variant, without the
signal sequence.
TABLE-US-00044 (SEQ ID NO: 133)
ATGAAGGCTGCTGCGCTTTCCTGCCTCTTCGGCAGTACCCTTGCCGTTGC
AGGCGCCATTGAATCGAGAAAGGTTCACCAGAAGCCCCTCGCGAGATCTG
AACCTTTTTACCCGTCGCCATGGATGAATCCCAACGCCATCGGCTGGGCG
GAGGCCTATGCCCAGGCCAAGTCCTTTGTCTCCCAAATGACTCTGCTAGA
GAAGGTCAACTTGACCACGGGAGTCGGCTGGGGGGAGGAGCAGTGCGTCG
GCAACGTGGGCGCGATCCCTCGCCTTGGACTTCGCAGTCTGTGCATGCAT
GACTCCCCTCTCGGCGTGCGAGGAACCGACTACAACTCAGCGTTCCCCTC
TGGCCAGACCGTTGCTGCTACCTGGGATCGCGGTCTGATGTACCGTCGCG
GCTACGCAATGGGCCAGGAGGCCAAAGGCAAGGGCATCAATGTCCTTCTC
GGACCAGTCGCCGGCCCCCTTGGCCGCATGCCCGAGGGCGGTCGTAACTG
GGAAGGCTTCGCTCCGGATCCCGTCCTTACCGGCATCGGCATGTCCGAGA
CGATCAAGGGCATTCAGGATGCTGGCGTCATCGCTTGTGCGAAGCACTTT
ATTGGAAACGAGCAGGAGCACTTCAGACAGGTGCCAGAAGCCCAGGGATA
CGGTTACAACATCAGCGAAACCCTCTCCTCCAACATTGACGACAAGACCA
TGCACGAGCTCTACCTTTGGCCGTTTGCCGATGCCGTCCGGGCCGGCGTC
GGCTCTGTCATGTGCTCGTACAACCAGGGCAACAACTCGTACGCCTGCCA
GAACTCGAAGCTGCTGAACGACCTCCTCAAGAACGAGCTTGGGTTTCAGG
GCTTCGTCATGAGCGACTGGTGGGCACAGCACACTGGCGCAGCAAGCGCC
GTGGCTGGTCTCGATATGTCCATGCCGGGCGACACCATGGTCAACACTGG
CGTCAGTTTCTGGGGCGCCAATCTCACCCTCGCCGTCCTCAACGGCACAG
TCCCTGCCTACCGTCTCGACGACATGTGCATGCGCATCATGGCCGCCCTC
TTCAAGGTCACCAAGACCACCGACCTGGAACCGATCAACTTCTCCTTCTG
GACCCGCGACACTTATGGCCCGATCCACTGGGCCGCCAAGCAGGGCTACC
AGGAGATTAATTCCCACGTTGACGTCCGCGCCGACCACGGCAACCTCATC
CGGAACATTGCCGCCAAGGGTACGGTGCTGCTGAAGAATACCGGCTCTCT
ACCCCTGAACAAGCCAAAGTTCGTGGCCGTCATCGGCGAGGATGCTGGGC
CGAGCCCCAACGGGCCCAACGGCTGCAGCGACCGCGGCTGTAACGAAGGC
ACGCTCGCCATGGGCTGGGGATCCGGCACAGCCAACTATCCGTACCTCGT
TTCCCCCGACGCCGCGCTCCAGGCGCGGGCCATCCAGGACGGCACGAGGT
ACGAGAGCGTCCTGTCCAACTACGCCGAGGAAAATACAAAGGCTCTGGTC
TCGCAGGCCAATGCAACCGCCATCGTCTTCGTCAATGCCGACTCAGGCGA
GGGCTACATCAACGTGGACGGTAACGAGGGCGACCGTAAGAACCTGACTC
TCTGGAACAACGGTGATACTCTGGTCAAGAACGTCTCGAGCTGGTGCAGC
AACACCATCGTCGTCATCCACTCGGTCGGCCCGGTCCTCCTGACCGATTG
GTACGACAACCCCAACATCACGGCCATTCTCTGGGCTGGTCTTCCGGGCC
AGGAGTCGGGCAACTCCATCACCGACGTGCTTTACGGCAAGGTCAACCCC
GCCGCCCGCTCGCCCTTCACTTGGGGCAAGACCCGCGAAAGCTATGGCGC
GGACGTCCTGTACAAGCCGAATAATGGCAATTGGGCGCCCCAACAGGACT
TCACCGAGGGCGTCTTCATCGACTACCGCTACTTCGACAAGGTTGACGAT
GACTCGGTCATCTACGAGTTCGGCCACGGCCTGAGCTACACCACCTTCGA
GTACAGCAACATCCGCGTCGTCAAGTCCAACGTCAGCGAGTACCGGCCCA
CGACGGGCACCACGATTCAGGCCCCGACGTTTGGCAACTTCTCCACCGAC
CTCGAGGACTATCTCTTCCCCAAGGACGAGTTCCCCTACATCCCGCAGTA
CATCTACCCGTACCTCAACACGACCGACCCCCGGAGGGCCTCGGGCGATC
CCCACTACGGCCAGACCGCCGAGGAGTTCCTCCCGCCCCACGCCACCGAT
GACGACCCCCAGCCGCTCCTCCGGTCCTCGGGCGGAAACTCCCCCGGCGG
CAACCGCCAGCTGTACGACATTGTCTACACAATCACGGCCGACATCACGA
ATACGGGCTCCGTTGTAGGCGAGGAGGTACCGCAGCTCTACGTCTCGCTG
GGCGGTCCCGAGGATCCCAAGGTGCAGCTGCGCGACTTTGACAGGATGCG
GATCGAACCCGGCGAGACGAGGCAGTTCACCGGCCGCCTGACGCGCAGAG
ATCTGAGCAACTGGGACGTCACGGTGCAGGACTGGGTCATCAGCAGGTAT
CCCAAGACGGCATATGTTGGGAGGAGCAGCCGGAAGTTGGATCTCAAGAT TGAGCTTCCTTGA
(SEQ ID NO: 134) MKAAALSCLFGSTLAVAGAIESRKVHQKPLARSEPFYPSPWMNPNAIGWA
EAYAQAKSFVSQMTLLEKVNLTTGVGWGEEQCVGNVGAIPRLGLRSLCMH
DSPLGVRGTDYNSAFPSGQTVAATWDRGLMYRRGYAMGQEAKGKGINVLL
GPVAGPLGRMPEGGRNWEGFAPDPVLTGIGMSETIKGIQDAGVIACAKHF
IGNEQEHFRQVPEAQGYGYNISETLSSNIDDKTMHELYLWPFADAVRAGV
GSVMCSYNQGNNSYACQNSKLLNDLLKNELGFQGFVMSDWWAQHTGAASA
VAGLDMSMPGDTMVNTGVSFWGANLTLAVLNGTVPAYRLDDMCMRIMAAL
FKVTKTTDLEPINFSFWTRDTYGPIHWAAKQGYQEINSHVDVRADHGNLI
RNIAAKGTVLLKNTGSLPLNKPKFVAVIGEDAGPSPNGPNGCSDRGCNEG
TLAMGWGSGTANYPYLVSPDAALQARAIQDGTRYESVLSNYAEENTKALV
SQANATAIVFVNADSGEGYINVDGNEGDRKNLTLWNNGDTLVKNVSSWCS
NTIVVIHSVGPVLLTDWYDNPNITAILWAGLPGQESGNSITDVLYGKVNP
AARSPFTWGKTRESYGADVLYKPNNGNWAPQQDFTEGVFIDYRYFDKVDD
DSVIYEFGHGLSYTTFEYSNIRVVKSNVSEYRPTTGTTIQAPTFGNFSTD
LEDYLFPKDEFPYIPQYIYPYLNTTDPRRASGDPHYGQTAEEFLPPHATD
DDPQPLLRSSGGNSPGGNRQLYDIVYTITADITNTGSVVGEEVPQLYVSL
GGPEDPKVQLRDFDRMRIEPGETRQFTGRLTRRDLSNWDVTVQDWVISRY
PKTAYVGRSSRKLDLKIELP (SEQ ID NO: 135)
IESRKVHQKPLARSEPFYPSPWMNPNAIGWAEAYAQAKSFVSQMTLLEKV
NLTTGVGWGEEQCVGNVGAIPRLGLRSLCMHDSPLGVRGTDYNSAFPSGQ
TVAATWDRGLMYRRGYAMGQEAKGKGINVLLGPVAGPLGRMPEGGRNWEG
FAPDPVLTGIGMSETIKGIQDAGVIACAKHFIGNEQEHFRQVPEAQGYGY
NISETLSSNIDDKTMHELYLWPFADAVRAGVGSVMCSYNQGNNSYACQNS
KLLNDLLKNELGFQGFVMSDWWAQHTGAASAVAGLDMSMPGDTMVNTGVS
FWGANLTLAVLNGTVPAYRLDDMCMRIMAALFKVTKTTDLEPINFSFWTR
DTYGPIHWAAKQGYQEINSHVDVRADHGNLIRNIAAKGTVLLKNTGSLPL
NKPKFVAVIGEDAGPSPNGPNGCSDRGCNEGTLAMGWGSGTANYPYLVSP
DAALQARAIQDGTRYESVLSNYAEENTKALVSQANATAIVFVNADSGEGY
INVDGNEGDRKNLTLWNNGDTLVKNVSSWCSNTIVVIHSVGPVLLTDWYD
NPNITAILWAGLPGQESGNSITDVLYGKVNPAARSPFTWGKTRESYGADV
LYKPNNGNWAPQQDFTEGVFIDYRYFDKVDDDSVIYEFGHGLSYTTFEYS
NIRVVKSNVSEYRPTTGTTIQAPTFGNFSTDLEDYLFPKDEFPYIPQYIY
PYLNTTDPRRASGDPHYGQTAEEFLPPHATDDDPQPLLRSSGGNSPGGNR
QLYDIVYTITADITNTGSVVGEEVPQLYVSLGGPEDPKVQLRDFDRMRIE
PGETRQFTGRLTRRDLSNWDVTVQDWVISRYPKTAYVGRSSRKLDLKIEL P
[0298] The polynucleotide (SEQ ID NO:136) and amino acid (SEQ ID
NO:137) sequences of wild-type Talaromyces emersonii CBH1 are
provided below. The signal sequence is shown underlined in SEQ ID
NO:137. SEQ ID NO:138 provides the sequence of this CBH1, without
the signal sequence.
TABLE-US-00045 (SEQ ID NO: 136)
ATGCTTCGACGGGCTCTTCTTCTATCCTCTTCCGCCATCCTTGCTGTCAA
GGCACAGCAGGCCGGCACGGCGACGGCAGAGAACCACCCGCCCCTGACAT
GGCAGGAATGCACCGCCCCTGGGAGCTGCACCACCCAGAACGGGGCGGTC
GTTCTTGATGCGAACTGGCGTTGGGTGCACGATGTGAACGGATACACCAA
CTGCTACACGGGCAATACCTGGGACCCCACGTACTGCCCTGACGACGAAA
CCTGCGCCCAGAACTGTGCGCTGGACGGCGCGGATTACGAGGGCACCTAC
GGCGTGACTTCGTCGGGCAGCTCCTTGAAACTCAATTTCGTCACCGGGTC
GAACGTCGGATCCCGTCTCTACCTGCTGCAGGACGACTCGACCTATCAGA
TCTTCAAGCTTCTGAACCGCGAGTTCAGCTTTGACGTCGATGTCTCCAAT
CTTCCGTGCGGATTGAACGGCGCTCTGTACTTTGTCGCCATGGACGCCGA
CGGCGGCGTGTCCAAGTACCCGAACAACAAGGCTGGTGCCAAGTACGGAA
CCGGGTATTGCGACTCCCAATGCCCACGGGACCTCAAGTTCATCGACGGC
GAGGCCAACGTCGAGGGCTGGCAGCCGTCTTCGAACAACGCCAACACCGG
AATTGGCGACCACGGCTCCTGCTGTGCGGAGATGGATGTCTGGGAAGCAA
ACAGCATCTCCAATGCGGTCACTCCGCACCCGTGCGACACGCCAGGCCAG
ACGATGTGCTCTGGAGATGACTGCGGTGGCACATACTCTAACGATCGCTA
CGCGGGAACCTGCGATCCTGACGGCTGTGACTTCAACCCTTACCGCATGG
GCAACACTTCTTTCTACGGGCCTGGCAAGATCATCGATACCACCAAGCCC
TTCACTGTCGTGACGCAGTTCCTCACTGATGATGGTACGGATACTGGAAC
TCTCAGCGAGATCAAGCGCTTCTACATCCAGAACAGCAACGTCATTCCGC
AGCCCAACTCGGACATCAGTGGCGTGACCGGCAACTCGATCACGACGGAG
TTCTGCACTGCTCAGAAGCAGGCCTTTGGCGACACGGACGACTTCTCTCA
GCACGGTGGCCTGGCCAAGATGGGAGCGGCCATGCAGCAGGGTATGGTCC
TGGTGATGAGTTTGTGGGACGACTACGCCGCGCAGATGCTGTGGTTGGAT
TCCGACTACCCGACGGATGCGGACCCCACGACCCCTGGTATTGCCCGTGG
AACGTGTCCGACGGACTCGGGCGTCCCATCGGATGTCGAGTCGCAGAGCC
CCAACTCCTACGTGACCTACTCGAACATTAAGTTTGGTCCGATCAACTCG
ACCTTCACCGCTTCGTGA (SEQ ID NO: 137)
MLRRALLLSSSAILAVKAQQAGTATAENHPPLTWQECTAPGSCTTQNGAV
VLDANWRWVHDVNGYTNCYTGNTWDPTYCPDDETCAQNCALDGADYEGTY
GVTSSGSSLKLNFVTGSNVGSRLYLLQDDSTYQIFKLLNREFSEDVDVSN
LPCGLNGALYFVAMDADGGVSKYPNNKAGAKYGTGYCDSQCPRDLKFIDG
EANVEGWQPSSNNANTGIGDHGSCCAEMDVWEANSISNAVTPHPCDTPGQ
TMCSGDDCGGTYSNDRYAGTCDPDGCDFNPYRMGNTSFYGPGKIIDTTKP
FTVVTQFLTDDGTDTGTLSEIKRFYIQNSNVIPQPNSDISGVTGNSITTE
FCTAQKQAFGDTDDFSQHGGLAKMGAAMQQGMVLVMSLWDDYAAQMLWLD
SDYPTDADPTTPGIARGTCPTDSGVPSDVESQSPNSYVTYSNIKFGPINS TFTAS (SEQ ID
NO: 138) QQAGTATAENHPPLTWQECTAPGSCTTQNGAVVLDANWRWVHDVNGYTNC
YTGNTWDPTYCPDDETCAQNCALDGADYEGTYGVTSSGSSLKLNFVTGSN
VGSRLYLLQDDSTYQIFKLLNREFSFDVDVSNLPCGLNGALYFVAMDADG
GVSKYPNNKAGAKYGTGYCDSQCPRDLKFIDGEANVEGWQPSSNNANTGI
GDHGSCCAEMDVWEANSISNAVTPHPCDTPGQTMCSGDDCGGTYSNDRYA
GTCDPDGCDFNPYRMGNTSFYGPGKIIDTTKPFTVVTQFLTDDGTDTGTL
SEIKRFYIQNSNVIPQPNSDISGVTGNSITTEFCTAQKQAFGDTDDFSQH
GGLAKMGAAMQQGMVLVMSLWDDYAAQMLWLDSDYPTDADPTTPGIARGT
CPTDSGVPSDVESQSPNSYVTYSNIKFGPINSTFTAS
[0299] The polynucleotide (SEQ ID NO:139) and amino acid (SEQ ID
NO:140) sequences of wild-type M. thermophila CBH1a are provided
below. The signal sequence is shown underlined in SEQ ID NO:140.
SEQ ID NO:141 provides the sequence of this CBH1a, without the
signal sequence.
TABLE-US-00046 (SEQ ID NO: 139)
ATGTACGCCAAGTTCGCGACCCTCGCCGCCCTTGTGGCTGGCGCCGCTGC
TCAGAACGCCTGCACTCTGACCGCTGAGAACCACCCCTCGCTGACGTGGT
CCAAGTGCACGTCTGGCGGCAGCTGCACCAGCGTCCAGGGTTCCATCACC
ATCGACGCCAACTGGCGGTGGACTCACCGGACCGATAGCGCCACCAACTG
CTACGAGGGCAACAAGTGGGATACTTCGTACTGCAGCGATGGTCCTTCTT
GCGCCTCCAAGTGCTGCATCGACGGCGCTGACTACTCGAGCACCTATGGC
ATCACCACGAGCGGTAACTCCCTGAACCTCAAGTTCGTCACCAAGGGCCA
GTACTCGACCAACATCGGCTCGCGTACCTACCTGATGGAGAGCGACACCA
AGTACCAGATGTTCCAGCTCCTCGGCAACGAGTTCACCTTCGATGTCGAC
GTCTCCAACCTCGGCTGCGGCCTCAATGGCGCCCTCTACTTCGTGTCCAT
GGATGCCGATGGTGGCATGTCCAAGTACTCGGGCAACAAGGCAGGTGCCA
AGTACGGTACCGGCTACTGTGATTCTCAGTGCCCCCGCGACCTCAAGTTC
ATCAACGGCGAGGCCAACGTAGAGAACTGGCAGAGCTCGACCAACGATGC
CAACGCCGGCACGGGCAAGTACGGCAGCTGCTGCTCCGAGATGGACGTCT
GGGAGGCCAACAACATGGCCGCCGCCTTCACTCCCCACCCTTGCACCGTG
ATCGGCCAGTCGCGCTGCGAGGGCGACTCGTGCGGCGGTACCTACAGCAC
CGACCGCTATGCCGGCATCTGCGACCCCGACGGATGCGACTTCAACTCGT
ACCGCCAGGGCAACAAGACCTTCTACGGCAAGGGCATGACGGTCGACACG
ACCAAGAAGATCACGGTCGTCACCCAGTTCCTCAAGAACTCGGCCGGCGA
GCTCTCCGAGATCAAGCGGTTCTACGTCCAGAACGGCAAGGTCATCCCCA
ACTCCGAGTCCACCATCCCGGGCGTCGAGGGCAACTCCATCACCCAGGAC
TGGTGCGACCGCCAGAAGGCCGCCTTCGGCGACGTGACCGACTTCCAGGA
CAAGGGCGGCATGGTCCAGATGGGCAAGGCCCTCGCGGGGCCCATGGTCC
TCGTCATGTCCATCTGGGACGACCACGCCGTCAACATGCTCTGGCTCGAC
TCCACCTGGCCCATCGACGGCGCCGGCAAGCCGGGCGCCGAGCGCGGTGC
CTGCCCCACCACCTCGGGCGTCCCCGCTGAGGTCGAGGCCGAGGCCCCCA
ACTCCAACGTCATCTTCTCCAACATCCGCTTCGGCCCCATCGGCTCCACC
GTCTCCGGCCTGCCCGACGGCGGCAGCGGCAACCCCAACCCGCCCGTCAG
CTCGTCCACCCCGGTCCCCTCCTCGTCCACCACATCCTCCGGTTCCTCCG
GCCCGACTGGCGGCACGGGTGTCGCTAAGCACTATGAGCAATGCGGAGGA
ATCGGGTTCACTGGCCCTACCCAGTGCGAGAGCCCCTACACTTGCACCAA
GCTGAATGACTGGTACTCGCAGTGCCTGTAA (SEQ ID NO: 140)
MYAKFATLAALVAGAAAQNACTLTAENHPSLTYSKCTSGGSCTSVQGSIT
IDANWRWTHRTDSATNCYEGNKWDTSWCSDGPSCASKCCIDGADYSSTYG
ITTSGNSLNLKFVTKGQYSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVD
VSNLGCGLNGALYFVSMDADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKF
INGEANVENWQSSTNDANAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTV
IGQSRCEGDSCGGTYSTDRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDT
TKKITVVTQFLKNSAGELSEIKRFYVQNGKVIPNSESTIPGVEGNSITQD
WCDRQKAAFGDVTDFQDKGGMVQMGKALAGPMVLVMSIWDDHAVNMLWLD
STWPIDGAGKPGAERGACPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGST
VSGLPDGGSGNPNPPVSSSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGG
IGFTGPTQCESPYTCTKLNDWYSQCL (SEQ ID NO: 141)
QNACTLTAENHPSLTYSKCTSGGSCTSVQGSITIDANWRWTHRTDSATNC
YEGNKWDTSWCSDGPSCASKCCIDGADYSSTYGITTSGNSLNLKFVTKGQ
YSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVDVSNLGCGLNGALYFVSM
DADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKFINGEANVENWQSSTNDA
NAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTVIGQSRCEGDSCGGTYST
DRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDTTIKKITVVTQFLKNSAG
ELSEIKRFYVQNGKVIPNSESTIPGVEGNSITQDWCDRQKAAFGDVTDFQ
DKGGMVQMGKALAGPMVLVMSIWDDHAVNMLWLDSTWPIDGAGKPGAERG
ACPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGSTVSGLPDGGSGNPNPPV
SSSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGGIGFTGPTQCESPYTCT KLNDWYSQCL
[0300] The polynucleotide (SEQ ID NO:142) and amino acid (SEQ ID
NO:143) sequences of a M. thermophila CBH1a variant ("Variant 145")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:143. SEQ ID NO:144 provides the sequence of this CBH1a,
without the signal sequence.
TABLE-US-00047 (SEQ ID NO: 142)
ATGTACGCCAAGTTCGCGACCCTCGCCGCCCTTGTGGCTGGCGCCGCTGC
TCAGAACGCCTGCACTCTGACCGCTGAGAACCACCCCTCGCTGACGTGGT
CCAAGTGCACGTCTGGCGGCAGCTGCACCAGCGTCCAGGGTTCCATCACC
ATCGACGCCAACTGGCGGTGGACTCACCGGACCGATAGCGCCACCAACTG
CTACGAGGGCAACAAGTGGGATACTTCGTGGTGCAGCGATGGTCCTTCTT
GCGCCTCCAAGTGCTGCATCGACGGCGCTGACTACTCGAGCACCTATGGC
ATCACCACGAGCGGTAACTCCCTGAACCTCAAGTTCGTCACCAAGGGCCA
GTACTCGACCAACATCGGCTCGCGTACCTACCTGATGGAGAGCGACACCA
AGTACCAGATGTTCCAGCTCCTCGGCAACGAGTTCACCTTCGATGTCGAC
GTCTCCAACCTCGGCTGCGGCCTCAATGGCGCCCTCTACTTCGTGTCCAT
GGATGCCGATGGTGGCATGTCCAAGTACTCGGGCAACAAGGCAGGTGCCA
AGTACGGTACCGGCTACTGTGATTCTCAGTGCCCCCGCGACCTCAAGTTC
ATCAACGGCGAGGCCAACGTAGAGAACTGGCAGAGCTCGACCAACGATGC
CAACGCCGGCACGGGCAAGTACGGCAGCTGCTGCTCCGAGATGGACGTCT
GGGAGGCCAACAACATGGCCGCCGCCTTCACTCCCCACCCTTGCACCGTG
ATCGGCCAGTCGCGCTGCGAGGGCGACTCGTGCGGCGGTACCTACAGCAC
CGACCGCTATGCCGGCATCTGCGACCCCGACGGATGCGACTTCAACTCGT
ACCGCCAGGGCAACAAGACCTTCTACGGCAAGGGCATGACGGTCGACACG
ACCAAGAAGATCACGGTCGTCACCCAGTTCCTCAAGAACTCGGCCGGCGA
GCTCTCCGAGATCAAGCGGTTCTACGTCCAGAACGGCAAGGTCATCCCCA
ACTCCGAGTCCACCATCCCGGGCGTCGAGGGCAACTCCATCACCCAGGAC
TGGTGCGACCGCCAGAAGGCCGCCTTCGGCGACGTGACCGACTTCCAGGA
CAAGGGCGGCATGGTCCAGATGGGCAAGGCCCTCGCGGGGCCCATGGTCC
TCGTCATGTCCATCTGGGACGACCACGCCGTCAACATGCTCTGGCTCGAC
TCCACCTGGCCCATCGACGGCGCCGGCAAGCCGGGCGCCGAGCGCGGTGC
CTGCCCCACCACCTCGGGCGTCCCCGCTGAGGTCGAGGCCGAGGCCCCCA
ACTCCAACGTCATCTTCTCCAACATCCGCTTCGGCCCCATCGGCTCCACC
GTCTCCGGCCTGCCCGACGGCGGCAGCGGCAACCCCAACCCGCCCGTCAG
CTCGTCCACCCCGGTCCCCTCCTCGTCCACCACATCCTCCGGTTCCTCCG
GCCCGACTGGCGGCACGGGTGTCGCTAAGCACTATGAGCAATGCGGAGGA
ATCGGGTTCACTGGCCCTACCCAGTGCGAGAGCCCCTACACTTGCACCAA
GCTGAATGACTGGTACTCGCAGTGCCTGTAA (SEQ ID NO: 143)
MYAKFATLAALVAGAAAQNACTLTAENHPSLTWSKCTSGGSCTSVQGSIT
IDANWRWTHRTDSATNCYEGNKWDTSWCSDGPSCASKCCIDGADYSSTYG
ITTSGNSLNLKFVTKGQYSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVD
VSNLGCGLNGALYFVSMDADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKF
INGEANVENWQSSTNDANAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTV
IGQSRCEGDSCGGTYSTDRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDT
TKKITVVTQFLKNSAGELSEIKRFYVQNGKVIPNSESTIPGVEGNSITQD
WCDRQKAAFGDVTDFQDKGGMVQMGKALAGPMVLVMSIWDDHAVNMLWLD
STWPIDGAGKPGAERGACPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGST
VSGLPDGGSGNPNPPVSSSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGG
IGFTGPTQCESPYTCTKLNDWYSQCL (SEQ ID NO: 144)
QNACTLTAENHPSLTWSKCTSGGSCTSVQGSITIDANWRWTHRTDSATNC
YEGNKWDTSWCSDGPSCASKCCIDGADYSSTYGITTSGNSLNLKFVTKGQ
YSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVDVSNLGCGLNGALYFVSM
DADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKFINGEANVENWQSSTNDA
NAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTVIGQSRCEGDSCGGTYST
DRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDTTKKITVVTQFLKNSAGE
LSEIKRFYVQNGKVIPNSESTIPGVEGNSITQDWCDRQKAAFGDVTDFQD
KGGMVQMGKALAGPMVLVMSIWDDHAVNMLWLDSTWPIDGAGKPGAERGA
CPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGSTVSGLPDGGSGNPNPPVS
SSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGGIGFTGPTQCESPYTCTK LNDWYSQCL
[0301] The polynucleotide (SEQ ID NO:145) and amino acid (SEQ ID
NO:146) sequences of a M. thermophila CBH1a variant ("Variant 983")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:146. SEQ ID NO:147 provides the sequence of this CBH1a
variant, without the signal sequence.
TABLE-US-00048 (SEQ ID NO: 145)
ATGTACGCCAAGTTCGCGACCCTCGCCGCCCTTGTGGCTGGCGCCGCTGC
TCAGAACGCCTGCACTCTGAACGCTGAGAACCACCCCTCGCTGACGTGGT
CCAAGTGCACGTCTGGCGGCAGCTGCACCAGCGTCCAGGGTTCCATCACC
ATCGACGCCAACTGGCGGTGGACTCACCGGACCGATAGCGCCACCAACTG
CTACGAGGGCAACAAGTGGGATACTTCGTACTGCAGCGATGGTCCTTCTT
GCGCCTCCAAGTGCTGCATCGACGGCGCTGACTACTCGAGCACCTATGGC
ATCACCACGAGCGGTAACTCCCTGAACCTCAAGTTCGTCACCAAGGGCCA
GTACTCGACCAACATCGGCTCGCGTACCTACCTGATGGAGAGCGACACCA
AGTACCAGATGTTCCAGCTCCTCGGCAACGAGTTCACCTTCGATGTCGAC
GTCTCCAACCTCGGCTGCGGCCTCAATGGCGCCCTCTACTTCGTGTCCAT
GGATGCCGATGGTGGCATGTCCAAGTACTCGGGCAACAAGGCAGGTGCCA
AGTACGGTACCGGCTACTGTGATTCTCAGTGCCCCCGCGACCTCAAGTTC
ATCAACGGCGAGGCCAACGTAGAGAACTGGCAGAGCTCGACCAACGATGC
CAACGCCGGCACGGGCAAGTACGGCAGCTGCTGCTCCGAGATGGACGTCT
GGGAGGCCAACAACATGGCCGCCGCCTTCACTCCCCACCCTTGCACCGTG
ATCGGCCAGTCGCGCTGCGAGGGCGACTCGTGCGGCGGTACCTACAGCAC
CGACCGCTATGCCGGCATCTGCGACCCCGACGGATGCGACTTCAACTCGT
ACCGCCAGGGCAACAAGACCTTCTACGGCAAGGGCATGACGGTCGACACG
ACCAAGAAGATCACGGTCGTCACCCAGTTCCTCAAGAACTCGGCCGGCGA
GCTCTCCGAGATCAAGCGGTTCTACGTCCAGAACGGCAAGGTCATCCCCA
ACTCCGAGTCCACCATCCCGGGCGTCGAGGGCAACTCCATCACCCAGGAG
TACTGCGACCGCCAGAAGGCCGCCTTCGGCGACGTGACCGACTTCCAGGA
CAAGGGCGGCATGGTCCAGATGGGCAAGGCCCTCGCGGGGCCCATGGTCC
TCGTCATGTCCATCTGGGACGACCACGCCGACAACATGCTCTGGCTCGAC
TCCACCTGGCCCATCGACGGCGCCGGCAAGCCGGGCGCCGAGCGCGGTGC
CTGCCCCACCACCTCGGGCGTCCCCGCTGAGGTCGAGGCCGAGGCCCCCA
ACTCCAACGTCATCTTCTCCAACATCCGCTTCGGCCCCATCGGCTCCACC
GTCTCCGGCCTGCCCGACGGCGGCAGCGGCAACCCCAACCCGCCCGTCAG
CTCGTCCACCCCGGTCCCCTCCTCGTCCACCACATCCTCCGGTTCCTCCG
GCCCGACTGGCGGCACGGGTGTCGCTAAGCACTATGAGCAATGCGGAGGA
ATCGGGTTCACTGGCCCTACCCAGTGCGAGAGCCCCTACACTTGCACCAA
GCTGAATGACTGGTACTCGCAGTGCCTGTAA (SEQ ID NO: 146)
MYAKFATLAALVAGAAAQNACTLNAENHPSLTWSKCTSGGSCTSVQGSIT
IDANWRWTHRTDSATNCYEGNKWDTSYCSDGPSCASKCCIDGADYSSTYG
ITTSGNSLNLKFVTKGQYSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVD
VSNLGCGLNGALYFVSMDADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKF
INGEANVENWQSSTNDANAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTV
IGQSRCEGDSCGGTYSTDRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDT
TKKITVVTQFLKNSAGELSEIKRFYVQNGKVIPNSESTIPGVEGNSITQE
YCDRQKAAFGDVTDFQDKGGMVQMGKALAGPMVLVMSIWDDHADNMLWLD
STWPIDGAGKPGAERGACPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGST
VSGLPDGGSGNPNPPVSSSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGG
IGFTGPTQCESPYTCTKLNDWYSQCL (SEQ ID NO: 147)
QNACTLNAENHPSLTWSKCTSGGSCTSVQGSITIDANWRWTHRTDSATNC
YEGNKWDTSYCSDGPSCASKCCIDGADYSSTYGITTSGNSLNLKFVTKGQ
YSTNIGSRTYLMESDTKYQMFQLLGNEFTFDVDVSNLGCGLNGALYFVSM
DADGGMSKYSGNKAGAKYGTGYCDSQCPRDLKFINGEANVENWQSSTNDA
NAGTGKYGSCCSEMDVWEANNMAAAFTPHPCTVIGQSRCEGDSCGGTYST
DRYAGICDPDGCDFNSYRQGNKTFYGKGMTVDTTKKITVVTQFLKNSAGE
LSEIKRFYVQNGKVIPNSESTIPGVEGNSITQEYCDRQKAAFGDVTDFQD
KGGMVQMGKALAGPMVLVMSIWDDHADNMLWLDSTWPIDGAGKPGAERGA
CPTTSGVPAEVEAEAPNSNVIFSNIRFGPIGSTVSGLPDGGSGNPNPPVS
SSTPVPSSSTTSSGSSGPTGGTGVAKHYEQCGGIGFTGPTQCESPYTCTK LNDWYSQCL
[0302] The polynucleotide (SEQ ID NO:148) and amino acid (SEQ ID
NO:149) sequences of wild-type M. thermophila CBH2b are provided
below. The signal sequence is shown underlined in SEQ ID NO:149.
SEQ ID NO:150 provides the sequence of this CBH2b, without the
signal sequence.
TABLE-US-00049 (SEQ ID NO: 148)
ATGGCCAAGAAGCTTTTCATCACCGCCGCGCTTGCGGCTGCCGTGTTGGC
GGCCCCCGTCATTGAGGAGCGCCAGAACTGCGGCGCTGTGTGGACTCAAT
GCGGCGGTAACGGGTGGCAAGGTCCCACATGCTGCGCCTCGGGCTCGACC
TGCGTTGCGCAGAACGAGTGGTACTCTCAGTGCCTGCCCAACAGCCAGGT
GACGAGTTCCACCACTCCGTCGTCGACTTCCACCTCGCAGCGCAGCACCA
GCACCTCCAGCAGCACCACCAGGAGCGGCAGCTCCTCCTCCTCCTCCACC
ACGCCCCCGCCCGTCTCCAGCCCCGTGACCAGCATTCCCGGCGGTGCGAC
CTCCACGGCGAGCTACTCTGGCAACCCCTTCTCGGGCGTCCGGCTCTTCG
CCAACGACTACTACAGGTCCGAGGTCCACAATCTCGCCATTCCTAGCATG
ACTGGTACTCTGGCGGCCAAGGCTTCCGCCGTCGCCGAAGTCCCTAGCTT
CCAGTGGCTCGACCGGAACGTCACCATCGACACCCTGATGGTCCAGACTC
TGTCCCAGGTCCGGGCTCTCAATAAGGCCGGTGCCAATCCTCCCTATGCT
GCCCAACTCGTCGTCTACGACCTCCCCGACCGTGACTGTGCCGCCGCTGC
GTCCAACGGCGAGTTTTCGATTGCAAACGGCGGCGCCGCCAACTACAGGA
GCTACATCGACGCTATCCGCAAGCACATCATTGAGTACTCGGACATCCGG
ATCATCCTGGTTATCGAGCCCGACTCGATGGCCAACATGGTGACCAACAT
GAACGTGGCCAAGTGCAGCAACGCCGCGTCGACGTACCACGAGTTGACCG
TGTACGCGCTCAAGCAGCTGAACCTGCCCAACGTCGCCATGTATCTCGAC
GCCGGCCACGCCGGCTGGCTCGGCTGGCCCGCCAACATCCAGCCCGCCGC
CGAGCTGTTTGCCGGCATCTACAATGATGCCGGCAAGCCGGCTGCCGTCC
GCGGCCTGGCCACTAACGTCGCCAACTACAACGCCTGGAGCATCGCTTCG
GCCCCGTCGTACACGTCGCCTAACCCTAACTACGACGAGAAGCACTACAT
CGAGGCCTTCAGCCCGCTCTTGAACTCGGCCGGCTTCCCCGCACGCTTCA
TTGTCGACACTGGCCGCAACGGCAAACAACCTACCGGCCAACAACAGTGG
GGTGACTGGTGCAATGTCAAGGGCACCGGCTTTGGCGTGCGCCCGACGGC
CAACACGGGCCACGAGCTGGTCGATGCCTTTGTCTGGGTCAAGCCCGGCG
GCGAGTCCGACGGCACAAGCGACACCAGCGCCGCCCGCTACGACTACCAC
TGCGGCCTGTCCGATGCCCTGCAGCCTGCCCCCGAGGCTGGACAGTGGTT
CCAGGCCTACTTCGAGCAGCTGCTCACCAACGCCAACCCGCCCTTCTAA (SEQ ID NO: 149)
MAKKLFITAALAAAVLAAPVIEERQNCGAVWTQCGGNGWQGPTCCASGST
CVAQNEWYSQCLPNSQVTSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSST
TPPPVSSPVTSIPGGATSTASYSGNPFSGVRLFANDYYRSEVHNLAIPSM
TGTLAAKASAVAEVPSFQWLDRNVTIDTLMVQTLSQVRALNKAGANPPYA
AQLVVYDLPDRDCAAAASNGEFSIANGGAANYRSYIDAIRKHIIEYSDIR
IILVIEPDSMANMVTNMNVAKCSNAASTYHELTVYALKQLNLPNVAMYLD
AGHAGWLGWPANIQPAAELFAGIYNDAGKPAAVRGLATNVANYNAWSIAS
APSYTSPNPNYDEKHYIEAFSPLLNSAGFPARFIVDTGRNGKQPTGQQQW
GDWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYH
CGLSDALQPAPEAGQWFQAYFEQLLTNANPPF (SEQ ID NO: 150)
APVIEERQNCGAVWTQCGGNGWQGPTCCASGSTCVAQNEWYSQCLPNSQV
TSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSSTTPPPVSSPVTSIPGGAT
STASYSGNPFSGVRLFANDYYRSEVHNLAIPSMTGTLAAKASAVAEVPSF
QWLDRNVTIDTLMVQTLSQVRALNKAGANPPYAAQLVVYDLPDRDCAAAA
SNGEFSIANGGAANYRSYIDAIRKHIIEYSDIRIILVIEPDSMANMVTNM
NVAKCSNAASTYHELTVYALKQLNLPNVAMYLDAGHAGWLGWPANIQPAA
ELFAGIYNDAGKPAAVRGLATNVANYNAWSIASAPSYTSPNPNYDEKHYI
EAFSPLLNSAGFPARFIVDTGRNGKQPTGQQQWGDWCNVKGTGFGVRPTA
NTGHELVDAFVWVKPGGESDGTSDTSAARYDYHCGLSDALQPAPEAGQWF
QAYFEQLLTNANPPF
[0303] The polynucleotide (SEQ ID NO:151) and amino acid (SEQ ID
NO:152) sequences of a M. thermophila CBH2b variant ("Variant 196")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:152. SEQ ID NO:153 provides the sequence of this CBH2b
variant, without the signal sequence.
TABLE-US-00050 (SEQ ID NO: 151)
ATGGCCAAGAAGCTTTTCATCACCGCCGCGCTTGCGGCTGCCGTGTTGGC
GGCCCCCGTCATTGAGGAGCGCCAGAACTGCGGCGCTGTGTGGACTCAAT
GCGGCGGTAACGGGTGGCAAGGTCCCACATGCTGCGCCTCGGGCTCGACC
TGCGTTGCGCAGAACGAGTGGTACTCTCAGTGCCTGCCCAACAGCCAGGT
GACGAGTTCCACCACTCCGTCGTCGACTTCCACCTCGCAGCGCAGCACCA
GCACCTCCAGCAGCACCACCAGGAGCGGCAGCTCCTCCTCCTCCTCCACC
ACGCCCACCCCCGTCTCCAGCCCCGTGACCAGCATTCCCGGCGGTGCGAC
CTCCACGGCGAGCTACTCTGGCAACCCCTTCTCGGGCGTCCGGCTCTTCG
CCAACGACTACTACAGGTCCGAGGTCCACAATCTCGCCATTCCTAGCATG
ACTGGTACTCTGGCGGCCAAGGCTTCCGCCGTCGCCGAAGTCCCTAGCTT
CCAGTGGCTCGACCGGAACGTCACCATCGACACCCTGATGGTCCCGACTC
TGTCCCGCGTCCGGGCTCTCAATAAGGCCGGTGCCAATCCTCCCTATGCT
GCCCAACTCGTCGTCTACGACCTCCCCGACCGTGACTGTGCCGCCGCTGC
GTCCAACGGCGAGTTTTCGATTGCAAACGGCGGCGCCGCCAACTACAGGA
GCTACATCGACGCTATCCGCAAGCACATCATTGAGTACTCGGACATCCGG
ATCATCCTGGTTATCGAGCCCGACTCGATGGCCAACATGGTGACCAACAT
GAACGTGGCCAAGTGCAGCAACGCCGCGTCGACGTACCACGAGTTGACCG
TGTACGCGCTCAAGCAGCTGAACCTGCCCAACGTCGCCATGTATCTCGAC
GCCGGCCACGCCGGCTGGCTCGGCTGGCCCGCCAACATCCAGCCCGCCGC
CGAGCTGTTTGCCGGCATCTACAATGATGCCGGCAAGCCGGCTGCCGTCC
GCGGCCTGGCCACTAACGTCGCCAACTACAACGCCTGGAGCATCGCTTCG
GCCCCGTCGTACACGTCGCCTAACCCTAACTACGACGAGAAGCACTACAT
CGAGGCCTTCAGCCCGCTCTTGAACTCGGCCGGCTTCCCCGCACGCTTCA
TTGTCGACACTGGCCGCAACGGCAAACAACCTACCGGCCAACAACAGTGG
GGTGACTGGTGCAATGTCAAGGGCACCGGCTTTGGCGTGCGCCCGACGGC
CAACACGGGCCACGAGCTGGTCGATGCCTTTGTCTGGGTCAAGCCCGGCG
GCGAGTCCGACGGCACAAGCGACACCAGCGCCGCCCGCTACGACTACCAC
TGCGGCCTGTCCGATGCCCTGCAGCCTGCCCCCGAGGCTGGACAGTGGTT
CCAGGCCTACTTCGAGCAGCTGCTCACCAACGCCAACCCGCCCTTCTAA (SEQ ID NO: 152)
MAKKLFITAALAAAVLAAPVIEERQNCGAVWTQCGGNGWQGPTCCASGST
CVAQNEWYSQCLPNSQVTSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSST
TPTPVSSPVTSIPGGATSTASYSGNPFSGVRLFANDYYRSEVHNLAIPSM
TGTLAAKASAVAEVPSFQWLDRNVTIDTLMVPTLSRVRALNKAGANPPYA
AQLVVYDLPDRDCAAAASNGEFSIANGGAANYRSYIDAIRKHIIEYSDIR
IILVIEPDSMANMVTNMNVAKCSNAASTYHELTVYALKQLNLPNVAMYLD
AGHAGWLGWPANIQPAAELFAGIYNDAGKPAAVRGLATNVANYNAWSIAS
APSYTSPNPNYDEKEYIEAFSPLLNSAGFPARFIVDTGRNGKQPTGQQQW
GDWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYH
CGLSDALQPAPEAGQWFQAYFEQLLTNANPPF (SEQ ID NO: 153)
APVIEERQNCGAVWTQCGGNGWQGPTCCASGSTCVAQNEWYSQCLPNSQV
TSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSSTTPTPVSSPVTSIPGGAT
STASYSGNPFSGVRLFANDYYRSEVHNLAIPSMTGTLAAKASAVAEVPSF
QWLDRNVTIDTLMVPTLSRVRALNKAGANPPYAAQLVVYDLPDRDCAAAA
SNGEFSIANGGAANYRSYIDAIRKHIIEYSDIRIILVIEPDSMANMVTNM
NVAKCSNAASTYHELTVYALKQLNLPNVAMYLDAGHAGWLGWPANIQPAA
ELFAGIYNDAGKPAAVRGLATNVANYNAWSIASAPSYTSPNPNYDEKHYI
EAFSPLLNSAGFPARFIVDTGRNGKQPTGQQQWGDWCNVKGTGFGVRPTA
NTGHELVDAFVWVKPGGESDGTSDTSAARYDYHCGLSDALQPAPEAGQWF
QAYFEQLLTNANPPF
[0304] The polynucleotide (SEQ ID NO:154) and amino acid (SEQ ID
NO:155) sequences of a M. thermophila CBH2b variant ("Variant 287")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:155. SEQ ID NO:156 provides the sequence of this CBH2b
variant, without the signal sequence.
TABLE-US-00051 (SEQ ID NO: 154)
ATGGCCAAGAAGCTTTTCATCACCGCCGCGCTTGCGGCTGCCGTGTTGGC
GGCCCCCGTCATTGAGGAGCGCCAGAACTGCGGCGCTGTGTGGACTCAAT
GCGGCGGTAACGGGTGGCAAGGTCCCACATGCTGCGCCTCGGGCTCGACC
TGCGTTGCGCAGAACGAGTGGTACTCTCAGTGCCTGCCCAACAGCCAGGT
GACGAGTTCCACCACTCCGTCGTCGACTTCCACCTCGCAGCGCAGCACCA
GCACCTCCAGCAGCACCACCAGGAGCGGCAGCTCCTCCTCCTCCTCCACC
ACGCCCCCGCCCGTCTCCAGCCCCGTGACCAGCATTCCCGGCGGTGCGAC
CTCCACGGCGAGCTACTCTGGCAACCCCTTCTCGGGCGTCCGGCTCTTCG
CCAACGACTACTACAGGTCCGAGGTCCACAATCTCGCCATTCCTAGCATG
ACTGGTACTCTGGCGGCCAAGGCTTCCGCCGTCGCCGAAGTCCCTAGCTT
CCAGTGGCTCGACCGGAACGTCACCATCGACACCCTGATGGTCCCGACTC
TGTCCCGCGTCCGGGCTCTCAATAAGGCCGGTGCCAATCCTCCCTATGCT
GCCCAACTCGTCGTCTACGACCTCCCCGACCGTGACTGTGCCGCCGCTGC
GTCCAACGGCGAGTTTTCGATTGCAAACGGCGGCGCCGCCAACTACAGGA
GCTACATCGACGCTATCCGCAAGCACATCAAGGAGTACTCGGACATCCGG
ATCATCCTGGTTATCGAGCCCGACTCGATGGCCAACATGGTGACCAACAT
GAACGTGGCCAAGTGCAGCAACGCCGCGTCGACGTACCACGAGTTGACCG
TGTACGCGCTCAAGCAGCTGAACCTGCCCAACGTCGCCATGTATCTCGAC
GCCGGCCACGCCGGCTGGCTCGGCTGGCCCGCCAACATCCAGCCCGCCGC
CGAGCTGTTTGCCGGCATCTACAATGATGCCGGCAAGCCGGCTGCCGTCC
GCGGCCTGGCCACTAACGTCGCCAACTACAACGCCTGGAGCATCGCTTCG
GCCCCGTCGTACACGTCGCCTAACCCTAACTACGACGAGAAGCACTACAT
CGAGGCCTTCAGCCCGCTCTTGAACGACGCCGGCTTCCCCGCACGCTTCA
TTGTCGACACTGGCCGCAACGGCAAACAACCTACCGGCCAACAACAGTGG
GGTGACTGGTGCAATGTCAAGGGCACCGGCTTTGGCGTGCGCCCGACGGC
CAACACGGGCCACGAGCTGGTCGATGCCTTTGTCTGGGTCAAGCCCGGCG
GCGAGTCCGACGGCACAAGCGACACCAGCGCCGCCCGCTACGACTACCAC
TGCGGCCTGTCCGATGCCCTGCAGCCTGCCCCCGAGGCTGGACAGTGGTT
CCAGGCCTACTTCGAGCAGCTGCTCACCAACGCCAACCCGCCCTTCTAA (SEQ ID NO: 155)
MAKKLFITAALAAAVLAAPVIEERQNCGAVWTQCGGNGWQGPTCCASGST
CVAQNEWYSQCLPNSQVTSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSST
TPPPVSSPVTSIPGGATSTASYSGNPFSGVRLFANDYYRSEVHNLAIPSM
TGTLAAKASAVAEVPSFQWLDRNVTIDTLMVPTLSRVRALNKAGANPPYA
AQLVVYDLPDRDCAAAASNGEFSIANGGAANYRSYIDAIRKHIKEYSDIR
IILVIEPDSMANMVTNMNVAKCSNAASTYHELTVYALKQLNLPNVAMYLD
AGHAGWLGWPANIQPAAELFAGIYNDAGKPAAVRGLATNVANYNAWSIAS
APSYTSPNPNYDEKHYIEAFSPLLNDAGFPARFIVDTGRNGKQPTGQQQW
GDWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYH
CGLSDALQPAPEAGQWFQAYFEQLLTNANPPF (SEQ ID NO: 156)
APVIEERQNCGAVWTQCGGNGWQGPTCCASGSTCVAQNEWYSQCLPNSQV
TSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSSTTPPPVSSPVTSIPGGAT
STASYSGNPFSGVRLFANDYYRSEVHNLAIPSMTGTLAAKASAVAEVPSF
QWLDRNVTIDTLMVPTLSRVRALNKAGANPPYAAQLVVYDLPDRDCAAAA
SNGEFSIANGGAANYRSYIDAIRKHIKEYSDIRIILVIEPDSMANMVTNM
NVAKCSNAASTYHELTVYALKQLNLPNVAMYLDAGHAGWLGWPANIQPAA
ELFAGIYNDAGKPAAVRGLATNVANYNAWSIASAPSYTSPNPNYDEKHYI
EAFSPLLNDAGFPARFIVDTGRNGKQPTGQQQWGDWCNVKGTGFGVRPTA
NTGHELVDAFVWVKPGGESDGTSDTSAARYDYHCGLSDALQPAPEAGQWF
QAYFEQLLTNANPPF
[0305] The polynucleotide (SEQ ID NO:157) and amino acid (SEQ ID
NO:158) sequences of a M. thermophila CBH2b variant ("Variant 962")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:158. SEQ ID NO:159 provides the sequence of this CBH2b
variant, without the signal sequence.
TABLE-US-00052 (SEQ ID NO: 157)
ATGGCCAAGAAGCTTTTCATCACCGCCGCGCTTGCGGCTGCCGTGTTGGC
GGCCCCCGTCATTGAGGAGCGCCAGAACTGCGGCGCTGTGTGGACTCAAT
GCGGCGGTAACGGGTGGCAAGGTCCCACATGCTGCGCCTCGGGCTCGACC
TGCGTTGCGCAGAACGAGTGGTACTCTCAGTGCCTGCCCAACAGCCAGGT
GACGAGTTCCACCACTCCGTCGTCGACTTCCACCTCGCAGCGCAGCACCA
GCACCTCCAGCAGCACCACCAGGAGCGGCAGCTCCTCCTCCTCCTCCACC
ACGCCCACCCCCGTCTCCAGCCCCGTGACCAGCATTCCCGGCGGTGCGAC
CTCCACGGCGAGCTACTCTGGCAACCCCTTCTCGGGCGTCCGGCTCTTCG
CCAACGACTACTACAGGTCCGAGGTCATGAATCTCGCCATTCCTAGCATG
ACTGGTACTCTGGCGGCCAAGGCTTCCGCCGTCGCCGAAGTCCCTAGCTT
CCAGTGGCTCGACCGGAACGTCACCATCGACACCCTGATGGTCACCACTC
TGTCCCAGGTCCGGGCTCTCAATAAGGCCGGTGCCAATCCTCCCTATGCT
GCCCAACTCGTCGTCTACGACCTCCCCGACCGTGACTGTGCCGCCGCTGC
GTCCAACGGCGAGTTTTCGATTGCAAACGGCGGCAGCGCCAACTACAGGA
GCTACATCGACGCTATCCGCAAGCACATCATTGAGTACTCGGACATCCGG
ATCATCCTGGTTATCGAGCCCGACTCGATGGCCAACATGGTGACCAACAT
GAACGTGGCCAAGTGCAGCAACGCCGCGTCGACGTACCACGAGTTGACCG
TGTACGCGCTCAAGCAGCTGAACCTGCCCAACGTCGCCATGTATCTCGAC
GCCGGCCACGCCGGCTGGCTCGGCTGGCCCGCCAACATCCAGCCCGCCGC
CGAGCTGTTTGCCGGCATCTACAATGATGCCGGCAAGCCGGCTGCCGTCC
GCGGCCTGGCCACTAACGTCGCCAACTACAACGCCTGGAGCATCGCTTCG
GCCCCGTCGTACACGCAGCCTAACCCTAACTACGACGAGAAGCACTACAT
CGAGGCCTTCAGCCCGCTCTTGAACTCGGCCGGCTTCCCCGCACGCTTCA
TTGTCGACACTGGCCGCAACGGCAAACAACCTACCGGCCAACAACAGTGG
GGTGACTGGTGCAATGTCAAGGGCACCGGCTTTGGCGTGCGCCCGACGGC
CAACACGGGCCACGAGCTGGTCGATGCCTTTGTCTGGGTCAAGCCCGGCG
GCGAGTCCGACGGCACAAGCGACACCAGCGCCGCCCGCTACGACTACCAC
TGCGGCCTGTCCGATGCCCTGCAGCCTGCCCCCGAGGCTGGACAGTGGTT
CCAGGCCTACTTCGAGCAGCTGCTCACCAACGCCAACCCGCCCTTCTAA (SEQ ID NO: 158)
MAKKLFITAALAAAVLAAPVIEERQNCGAVWTQCGGNGWQGPTCCASGST
CVAQNEWYSQCLPNSQVTSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSST
TPTPVSSPVTSIPGGATSTASYSGNPFSGVRLFANDYYRSEVMNLAIPSM
TGTLAAKASAVAEVPSFQWLDRNVTIDTLMVTTLSQVRALNKAGANPPYA
AQLVVYDLPDRDCAAAASNGEFSIANGGSANYRSYIDAIRKHIIEYSDIR
IILVIEPDSMANMVTNMNVAKCSNAASTYHELTVYALKQLNLPNVAMYLD
AGHAGWLGWPANIQPAAELFAGIYNDAGKPAAVRGLATNVANYNAWSIAS
APSYTQPNPNYDEKHYIEAFSPLLNSAGFPARFIVDTGRNGKQPTGQQQW
GDWCNVKGTGFGVRPTANTGHELVDAFVWVKPGGESDGTSDTSAARYDYH
CGLSDALQPAPEAGQWFQAYFEQLLTNANPPF (SEQ ID NO: 159)
APVIEERQNCGAVWTQCGGNGWQGPTCCASGSTCVAQNEWYSQCLPNSQV
TSSTTPSSTSTSQRSTSTSSSTTRSGSSSSSSTTPTPVSSPVTSIPGGAT
STASYSGNPFSGVRLFANDYYRSEVMNLAIPSMTGTLAAKASAVAEVPSF
QWLDRNVTIDTLMVTTLSQVRALNKAGANPPYAAQLVVYDLPDRDCAAAA
SNGEFSIANGGSANYRSYIDAIRKHIIEYSDIRIILVIEPDSMANMVTNM
NVAKCSNAASTYHELTVYALKQLNLPNVAMYLDAGHAGWLGWPANIQPAA
ELFAGIYNDGKPAAVRGLATNVANYNAWSIASAPSYTQPNPNYDEKHYIE
AFSPLLNSAGFPARFIVDTGRNGKQPTGQQQWGDWCNVKGTGFGVRPTAN
TGRELVDAFVWVKPGGESDGTSDTSAARYDYHCGLSDALQPAPEAGQWFQ
AYFEQLLTNANPPF
[0306] The polynucleotide (SEQ ID NO:160) and amino acid (SEQ ID
NO:161) sequences of another wild-type M. thermophila xylanase
("Xyl3") are provided below. The signal sequence is shown
underlined in SEQ ID NO:161. SEQ ID NO:162 provides the sequence of
this xylanase without the signal sequence.
TABLE-US-00053 (SEQ ID NO: 160)
ATGCACTCCAAAGCTTTCTTGGCAGCGCTTCTTGCGCCTGCCGTCTCAGG
GCAACTGAACGACCTCGCCGTCAGGGCTGGACTCAAGTACTTTGGTACTG
CTCTTAGCGAGAGCGTCATCAACAGTGATACTCGGTATGCTGCCATCCTC
AGCGACAAGAGCATGTTCGGCCAGCTCGTCCCCGAGAATGGCATGAAGTG
GGATGCTACTGAGCCGTCCCGTGGCCAGTTCAACTACGCCTCGGGCGACA
TCACGGCCAACACGGCCAAGAAGAATGGCCAGGGCATGCGTTGCCACACC
ATGGTCTGGTACAGCCAGCTCCCGAGCTGGGTCTCCTCGGGCTCGTGGAC
CAGGGACTCGCTCACCTCGGTCATCGAGACGCACATGAACAACGTCATGG
GCCACTACAAGGGCCAATGCTACGCCTGGGATGTCATCAACGAGGCCATC
AATGACGACGGCAACTCCTGGCGCGACAACGTCTTTCTCCGGACCTTTGG
GACCGACTACTTCGCCCTGTCCTTCAACCTAGCCAAGAAGGCCGATCCCG
ATACCAAGCTGTACTACAACGACTACAACCTCGAGTACAACCAGGCCAAG
ACGGACCGCGCTGTTGAGCTCGTCAAGATGGTCCAGGCCGCCGGCGCGCC
CATCGACGGTGTCGGCTTCCAGGGCCACCTCATTGTCGGCTCGACCCCGA
CGCGCTCGCAGCTGGCCACCGCCCTCCAGCGCTTCACCGCGCTCGGCCTC
GAGGTCGCCTACACCGAGCTCGACATCCGCCACTCGAGCCTGCCGGCCTC
TTCGTCGGCGCTCGCGACCCAGGGCAACGACTTCGCCAACGTGGTCGGCT
CTTGCCTCGACACCGCCGGCTGCGTCGGCGTCACCGTCTGGGGCTTCACC
GATGCGCACTCGTGGATCCCGAACACGTTCCCCGGCCAGGGCGACGCCCT
GATCTACGACAGCAACTACAACAAGAAGCCCGCGTGGACCTCGATCTCGT
CCGTCCTGGCCGCCAAGGCCACCGGCGCCCCGCCCGCCTCGTCCTCCACC
ACCCTCGTCACCATCACCACCCCTCCGCCGGCATCCACCACCGCCTCCTC
CTCCTCCAGTGCCACGCCCACGAGCGTCCCGACGCAGACGAGGTGGGGAC
AGTGCGGCGGCATCGGATGGACGGGGCCGACCCAGTGCGAGAGCCCATGG
ACCTGCCAGAAGCTGAACGACTGGTACTGGCAGTGCCTG (SEQ ID NO: 161)
MHSKAFLAALLAPAVSGQLNDLAVRAGLKYFGTALSESVINSDTRYAAIL
SDKSMFGQLVPENGMKWDATEPSRGQFNYASGDITANTAKKNGQGMRCHT
MVWYSQLPSWVSSGSWTRDSLTSVIETHMNNVMGHYKGQCYAWDVINEAI
NDDGNSWRDNVFLRTFGTDYFALSFNLAKKADPDTKLYYNDYNLEYNQAK
TDRAVELVKMVQAAGAPIDGVGFQGHLIVGSTPTRSQLATALQRFTALGL
EVAYTELDIRHSSLPASSSALATQGNDFANVVGSCLDTAGCVGVTVWGFT
DAHSWIPNTFPGQGDALIYDSNYNKKPAWTSISSVLAAKATGAPPASSST
TLVTITTPPPASTTASSSSSATPTSVPTQTRWGQCGGIGWTGPTQCESPW TCQKLNDWYWQCL
(SEQ ID NO: 162) QLNDLAVRAGLKYFGTALSESVINSDTRYAAILSDKSMFGQLVPENGMKW
DATEPSRGQFNYASGDITANTAKKNGQGMRCHTMVWYSQLPSWVSSGSWT
RDSLTSVIETHMNNVMGHYKGQCYAWDVINEAINDDGNSWRDNVFLRTFG
TDYFALSFNLAKKADPDTKLYYNDYNLEYNQAKTDRAVELVKMVQAAGAP
IDGVGFQGHLIVGSTPTRSQLATALQRFTALGLEVAYTELDIRHSSLPAS
SSALATQGNDFANVVGSCLDTAGCVGVTVWGFTDAHSWIPNTFPGQGDAL
IYDSNYNKKPAWTSISSVLAAKATGAPPASSSTTLVTITTPPPASTTASS
SSSATPTSVPTQTRWGQCGGIGWTGPTQCESPWTCQKLNDWYWQCL
[0307] The polynucleotide (SEQ ID NO:163) and amino acid (SEQ ID
NO:164) sequences of a wild-type M. thermophila xylanase ("Xyl 2")
are provided below. The signal sequence is shown underlined in SEQ
ID NO:164. SEQ ID NO:165 provides the sequence of this xylanase
without the signal sequence.
TABLE-US-00054 (SEQ ID NO: 163)
ATGGTCTCGTTCACTCTCCTCCTCACGGTCATCGCCGCTGCGGTGACGAC
GGCCAGCCCTCTCGAGGTGGTCAAGCGCGGCATCCAGCCGGGCACGGGCA
CCCACGAGGGGTACTTCTACTCGTTCTGGACCGACGGCCGTGGCTCGGTC
GACTTCAACCCCGGGCCCCGCGGCTCGTACAGCGTCACCTGGAACAACGT
CAACAACTGGGTTGGCGGCAAGGGCTGGAACCCGGGCCCGCCGCGCAAGA
TTGCGTACAACGGCACCTGGAACAACTACAACGTGAACAGCTACCTCGCC
CTGTACGGCTGGACTCGCAACCCGCTGGTCGAGTATTACATCGTGGAGGC
ATACGGCACGTACAACCCCTCGTCGGGCACGGCGCGGCTGGGCACCATCG
AGGACGACGGCGGCGTGTACGACATCTACAAGACGACGCGGTACAACCAG
CCGTCCATCGAGGGGACCTCCACCTTCGACCAGTACTGGTCCGTCCGCCG
CCAGAAGCGCGTCGGCGGCACTATCGACACGGGCAAGCACTTTGACGAGT
GGAAGCGCCAGGGCAACCTCCAGCTCGGCACCTGGAACTACATGATCATG
GCCACCGAGGGCTACCAGAGCTCTGGTTCGGCCACTATCGAGGTCCGGGA GGCC (SEQ ID NO:
164) MVSFTLLLTVIAAAVTTASPLEVVKRGIQPGTGTHEGYFYSFWTDGRGSV
DFNPGPRGSYSVTWNNVNNWVGGKGWNPGPPRKIAYNGTWNNYNVNSYLA
LYGWTRNPLVEYYIVEAYGTYNPSSGTARLGTIEDDGGVYDIYKTTRYNQ
PSIEGTSTFDQYWSVRRQKRVGGTIDTGKHFDEWKRQGNLQLGTWNYMIM
ATEGYQSSGSATIEVREA (SEQ ID NO: 165)
MVSFTLLLTVIAAAVTTASPLEVVKRGIQPGTGTHEGYFYSFWTDGRGSV
DFNPGPRGSYSVTWNNVNNWVGGKGWNPGPPRKIAYNGTWNNYNVNSYLA
LYGWTRNPLVEYYIVEAYGTYNPSSGTARLGTIEDDGGVYDIYKTTRYNQ
PSIEGTSTFDQYWSVRRQKRVGGTIDTGKHFDEWKRQGNLQLGTWNYMIM
ATEGYQSSGSATIEVREA
[0308] The polynucleotide (SEQ ID NO:166) and amino acid (SEQ ID
NO:167) sequences of another wild-type M. thermophila xylanase
("Xyl1") are provided below. The signal sequence is shown
underlined in SEQ ID NO:167. SEQ ID NO:168 provides the sequence of
this xylanase without the signal sequence.
TABLE-US-00055 (SEQ ID NO: 166)
ATGCGTACTCTTACGTTCGTGCTGGCAGCCGCCCCGGTGGCTGTGCTTGC
CCAATCTCCTCTGTGGGGCCAGTGCGGCGGTCAAGGCTGGACAGGTCCCA
CGACCTGCGTTTCTGGCGCAGTATGCCAATTCGTCAATGACTGGTACTCC
CAATGCGTGCCCGGATCGAGCAACCCTCCTACGGGCACCACCAGCAGCAC
CACTGGAAGCACCCCGGCTCCTACTGGCGGCGGCGGCAGCGGAACCGGCC
TCCACGACAAATTCAAGGCCAAGGGCAAGCTCTACTTCGGAACCGAGATC
GATCACTACCATCTCAACAACAATGCCTTGACCAACATTGTCAAGAAAGA
CTTTGGTCAAGTCACTCACGAGAACAGCTTGAAGTGGGATGCTACTGAGC
CGAGCCGCAATCAATTCAACTTTGCCAACGCCGACGCGGTTGTCAACTTT
GCCCAGGCCAACGGCAAGCTCATCCGCGGCCACACCCTCCTCTGGCACTC
TCAGCTGCCGCAGTGGGTGCAGAACATCAACGACCGCAACACCTTGACCC
AGGTCATCGAGAACCACGTCACCACCCTTGTCACTCGCTACAAGGGCAAG
ATCCTCCACTGGGACGTCGTTAACGAGATCTTTGCCGAGGACGGCTCGCT
CCGCGACAGCGTCTTCAGCCGCGTCCTCGGCGAGGACTTTGTCGGCATCG
CCTTCCGCGCCGCCCGCGCCGCCGATCCCAACGCCAAGCTCTACATCAAC
GACTACAACCTCGACATTGCCAACTACGCCAAGGTGACCCGGGGCATGGT
CGAGAAGGTCAACAAGTGGATCGCCCAGGGCATCCCGATCGACGGCATCG
GCACCCAGTGCCACCTGGCCGGGCCCGGCGGGTGGAACACGGCCGCCGGC
GTCCCCGACGCCCTCAAGGCCCTCGCCGCGGCCAACGTCAAGGAGATCGC
CATCACCGAGCTCGACATCGCCGGCGCCTCCGCCAACGACTACCTCACCG
TCATGAACGCCTGCCTCCAGGTCTCCAAGTGCGTCGGCATCACCGTCTGG
GGCGTCTCTGACAAGGACAGCTGGAGGTCGAGCAGCAACCCGCTCCTCTT
CGACAGCAACTACCAGCCAAAGGCGGCATACAATGCTCTGATTAATGCCT TGTAA (SEQ ID
NO: 167) MRTLTFVLAAAPVAVLAQSPLWGQCGGQGWTGPTTCVSGAVCQFVNDWYS
QCVPGSSNPPTGTTSSTTGSTPAPTGGGGSGTGLHDKFKAKGKLYFGTEI
DHYHLNNNALTNIVKKDFGQVTHENSLKWDATEPSRNQFNFANADAVVNF
AQANGKLIRGHTLLWHSQLPQWVQNINDRNTLTQVIENHVTTLVTRYKGK
ILHWDVVNEIFAEDGSLRDSVFSRVLGEDFVGIAFRAARAADPNAKLYIN
DYNLDIANYAKVTRGMVEKVNKWIAQGIPIDGIGTQCHLAGPGGWNTAAG
VPDALKALAAANVKEIAITELDIAGASANDYLTVMNACLQVSKCVGITVW
GVSDKDSWRSSSNPLLFDSNYQPKAAYNALINAL (SEQ ID NO: 168)
QSPLWGQCGGQGWTGPTTCVSGAVCQFVNDWYSQCVPGSSNPPTGTTSST
TGSTPAPTGGGGSGTGLHDKFKAKGKLYFGTEIDHYHLNNNALTNIVKKD
FGQVTHENSLKWDATEPSRNQFNFANADAVVNFAQANGKLIRGHTLLWHS
QLPQWVQNINDRNTLTQVIENHVTTLVTRYKGKILHWDVVNEIFAEDGSL
RDSVFSRVLGEDFVGIAFRAARAADPNAKLYINDYNLDIANYAKVTRGMV
EKVNKWIAQGIPIDGIGTQCHLAGPGGWNTAAGVPDALKALAAANVKEIA
ITELDIAGASANDYLTVMNACLQVSKCVGITVWGVSDKDSWRSSSNPLLF
DSNYQPKAAYNALINAL
[0309] The polynucleotide (SEQ ID NO:169) and amino acid (SEQ ID
NO:170) sequences of another wild-type M. thermophila xylanase
("Xyl6") are provided below. The signal sequence is shown
underlined in SEQ ID NO:170. SEQ ID NO:171 provides the sequence of
this xylanase without the signal sequence.
TABLE-US-00056 (SEQ ID NO: 169)
ATGGTCTCGCTCAAGTCCCTCCTCCTCGCCGCGGCGGCGACGTTGACGGC
GGTGACGGCGCGCCCGTTCGACTTTGACGACGGCAACTCGACCGAGGCGC
TGGCCAAGCGCCAGGTCACGCCCAACGCGCAGGGCTACCACTCGGGCTAC
TTCTACTCGTGGTGGTCCGACGGCGGCGGCCAGGCCACCTTCACCCTGCT
CGAGGGCAGCCACTACCAGGTCAACTGGAGGAACACGGGCAACTTTGTCG
GTGGCAAGGGCTGGAACCCGGGTACCGGCCGGACCATCAACTACGGCGGC
TCGTTCAACCCGAGCGGCAACGGCTACCTGGCCGTCTACGGCTGGACGCA
CAACCCGCTGATCGAGTACTACGTGGTCGAGTCGTACGGGACCTACAACC
CGGGCAGCCAGGCCCAGTACAAGGGCAGCTTCCAGAGCGACGGCGGCACC
TACAACATCTACGTCTCGACCCGCTACAACGCGCCCTCGATCGAGGGCAC
CCGCACCTTCCAGCAGTACTGGTCCATCCGCACCTCCAAGCGCGTCGGCG
GCTCCGTCACCATGCAGAACCACTTCAACGCCTGGGCCCAGCACGGCATG
CCCCTCGGCTCCCACGACTACCAGATCGTCGCCACCGAGGGCTACCAGAG
CAGCGGCTCCTCCGACATCTACGTCCAGACTCACTAG (SEQ ID NO: 170)
MVSLKSLLLAAAATLTAVTARPFDFDDGNSTEALAKRQVTPNAQGYHSGY
FYSWWSDGGGQATFTLLEGSHYQVNWRNTGNFVGGKGWNPGTGRTINYGG
SFNPSGNGYLAVYGWTHNPLIEYYVVESYGTYNPGSQAQYKGSFQSDGGT
YNIYVSTRYNAPSIEGTRTFQQYWSIRTSKRVGGSVTMQNHFNAWAQHGM
PLGSHDYQIVATEGYQSSGSSDIYVQTH (SEQ ID NO: 171)
RPFDFDDGNSTEALAKRQVTPNAQGYHSGYFYSWWSDGGGQATFTLLEGS
HYQVNWRNTGNFVGGKGWNPGTGRTINYGGSFNPSGNGYLAVYGWTHNPL
IEYYVVESYGTYNPGSQAQYKGSFQSDGGTYNIYVSTRYNAPSIEGTRTF
QQYWSIRTSKRVGGSVTMQNHFNAWAQHGMPLGSHDYQIVATEGYQSSGS SDIYVQTH
[0310] The polynucleotide (SEQ ID NO:172) and amino acid (SEQ ID
NO:173) sequences of another wild-type M. thermophila xylanase
("Xyl5") are provided below. The signal sequence is shown
underlined in SEQ ID NO:173. SEQ ID NO:174 provides the sequence of
this xylanase, without the signal sequence.
TABLE-US-00057 (SEQ ID NO: 172)
ATGGTTACCCTCACTCGCCTGGCGGTCGCCGCGGCGGCCATGATCTCCAG
CACTGGCCTGGCTGCCCCGACGCCCGAAGCTGGCCCCGACCTTCCCGACT
TTGAGCTCGGGGTCAACAACCTCGCCCGCCGCGCGCTGGACTACAACCAG
AACTACAGGACCAGCGGCAACGTCAACTACTCGCCCACCGACAACGGCTA
CTCGGTCAGCTTCTCCAACGCGGGAGATTTTGTCGTCGGGAAGGGCTGGA
GGACGGGAGCCACCAGAAACATCACCTTCTCGGGATCGACACAGCATACC
TCGGGCACCGTGCTCGTCTCCGTCTACGGCTGGACCCGGAACCCGCTGAT
CGAGTACTACGTGCAGGAGTACACGTCCAACGGGGCCGGCTCCGCTCAGG
GCGAGAAGCTGGGCACGGTCGAGAGCGACGGGGGCACGTACGAGATCTGG
CGGCACCAGCAGGTCAACCAGCCGTCGATCGAGGGCACCTCGACCTTCTG
GCAGTACATCTCGAACCGCGTGTCCGGCCAGCGGCCCAACGGCGGCACCG
TCACCCTCGCCAACCACTTCGCCGCCTGGCAGAAGCTCGGCCTGAACCTG
GGCCAGCACGACTACCAGGTCCTGGCCACCGAGGGCTGGGGCAACGCCGG
CGGCAGCTCCCAGTACACCGTCAGCGGCTGA (SEQ ID NO: 173)
MVTLTRLAVAAAAMISSTGLAAPTPEAGPDLPDFELGVNNLARRALDYNQ
NYRTSGNVNYSPTDNGYSVSFSNAGDFVVGKGWRTGATRNITFSGSTQHT
SGTVLVSVYGWTRNPLIEYYVQEYTSNGAGSAQGEKLGTVESDGGTYEIW
RHQQVNQPSIEGTSTFWQYISNRVSGQRPNGGTVTLANHFAAWQKLGLNL
GQHDYQVLATEGWGNAGGSSQYTVSG (SEQ ID NO: 174)
APTPEAGPDLPDFELGVNNLARRALDYNQNYRTSGNVNYSPTDNGYSVSF
SNAGDFVVGKGWRTGATRNITFSGSTQHTSGTVLVSVYGWTRNPLIEYYV
QEYTSNGAGSAQGEKLGTVESDGGTYEIWRHQQVNQPSIEGTSTFWQYIS
NRVSGQRPNGGTVTLANHFAAWQKLGLNLGQHDYQVLATEGWGNAGGSSQ YTVSG
[0311] The polynucleotide (SEQ ID NO:175) and amino acid (SEQ ID
NO:176) sequences of a wild-type M. thermophila beta-xylosidase are
provided below. The signal sequence is shown underlined in SEQ ID
NO:176. SEQ ID NO:177 provides the sequence of this xylanase
without the signal sequence.
TABLE-US-00058 (SEQ ID NO: 175)
ATGTTCTTCGCTTCTCTGCTGCTCGGTCTCCTGGCGGGCGTGTCCGCTTC
ACCGGGACACGGGCGGAATTCCACCTTCTACAACCCCATCTTCCCCGGCT
TCTACCCCGATCCGAGCTGCATCTACGTGCCCGAGCGTGACCACACCTTC
TTCTGTGCCTCGTCGAGCTTCAACGCCTTCCCGGGCATCCCGATTCATGC
CAGCAAGGACCTGCAGAACTGGAAGTTGATCGGCCATGTGCTGAATCGCA
AGGAACAGCTTCCCCGGCTCGCTGAGACCAACCGGTCGACCAGCGGCATC
TGGGCACCCACCCTCCGGTTCCATGACGACACCTTCTGGTTGGTCACCAC
ACTAGTGGACGACGACCGGCCGCAGGAGGACGCTTCCAGATGGGACAATA
TTATCTTCAAGGCAAAGAATCCGTATGATCCGAGGTCCTGGTCCAAGGCC
GTCCACTTCAACTTCACTGGCTACGACACGGAGCCTTTCTGGGACGAAGA
TGGAAAGGTGTACATCACCGGCGCCCATGCTTGGCATGTTGGCCCATACA
TCCAGCAGGCCGAAGTCGATCTCGACACGGGGGCCGTCGGCGAGTGGCGC
ATCATCTGGAACGGAACGGGCGGCATGGCTCCTGAAGGGCCGCACATCTA
CCGCAAAGATGGGTGGTACTACTTGCTGGCTGCTGAAGGGGGGACCGGCA
TCGACCATATGGTGACCATGGCCCGGTCGAGAAAAATCTCCAGTCCTTAC
GAGTCCAACCCAAACAACCCCGTGTTGACCAACGCCAACACGACCAGTTA
CTTTCAAACCGTCGGGCATTCAGACCTGTTCCATGACAGACATGGGAACT
GGTGGGCAGTCGCCCTCTCCACCCGCTCCGGTCCAGAATATCTTCACTAC
CCCATGGGCCGCGAGACCGTCATGACAGCCGTGAGCTGGCCGAAGGACGA
GTGGCCAACCTTCACCCCCATATCTGGCAAGATGAGCGGCTGGCCGATGC
CTCCTTCGCAGAAGGACATTCGCGGAGTCGGCCCCTACGTCAACTCCCCC
GACCCGGAACACCTGACCTTCCCCCGCTCGGCGCCCCTGCCGGCCCACCT
CACCTACTGGCGATACCCGAACCCGTCCTCCTACACGCCGTCCCCGCCCG
GGCACCCCAACACCCTCCGCCTGACCCCGTCCCGCCTGAACCTGACCGCC
CTCAACGGCAACTACGCGGGGGCCGACCAGACCTTCGTCTCGCGCCGGCA
GCAGCACACCCTCTTCACCTACAGCGTCACGCTCGACTACGCGCCGCGGA
CCGCCGGGGAGGAGGCCGGCGTGACCGCCTTCCTGACGCAGAACCACCAC
CTCGACCTGGGCGTCGTCCTGCTCCCTCGCGGCTCCGCCACCGCGCCCTC
GCTGCCGGGCCTGAGTAGTAGTACAACTACTACTAGTAGTAGTAGTAGTC
GTCCGGACGAGGAGGAGGAGCGCGAGGCGGGCGAAGAGGAAGAAGAGGGC
GGACAAGACTTGATGATCCCGCATGTGCGGTTCAGGGGCGAGTCGTACGT
GCCCGTCCCGGCGCCCGTCGTGTACCCGATACCCCGGGCCTGGAGAGGCG
GGAAGCTTGTGTTAGAGATCCGGGCTTGTAATTCGACTCACTTCTCGTTC
CGTGTCGGGCCGGACGGGAGACGGTCTGAGCGGACGGTGGTCATGGAGGC
TTCGAACGAGGCCGTTAGCTGGGGCTTTACTGGAACGCTGCTGGGCATCT
ATGCGACCAGTAATGGTGGCAACGGAACCACGCCGGCGTATTTTTCGGAT
TGGAGGTACACACCATTGGAGCAGTTTAGGGAT (SEQ ID NO: 176)
MFFASLLLGLLAGVSASPGHGRNSTFYNPIFPGFYPDPSCIYVPERDHTF
FCASSSFNAFPGIPIHASKDLQNWKLIGHVLNRKEQLPRLAETNRSTSGI
WAPTLRFHDDTFWLVTTLVDDDRPQEDASRWDNIIFKAKNPYDPRSWSKA
VHFNFTGYDTEPFWDEDGKVYITGAHAWHVGPYIQQAEVDLDTGAVGEWR
IIWNGTGGMAPEGPHIYRKDGWYYLLAAEGGTGIDHMVTMARSRKISSPY
ESNPNNPVLTNANTTSYFQTVGHSDLFHDRHGNWWAVALSTRSGPEYLHY
PMGRETVMTAVSWPKDEWPTFTPISGKMSGWPMPPSQKDIRGVGPYVNSP
DPEHLTFPRSAPLPAHLTYWRYPNPSSYTPSPPGHPNTLRLTPSRLNLTA
LNGNYAGADQTFVSRRQQHTLFTYSVTLDYAPRTAGEEAGVTAFLTQNHH
LDLGVVLLPRGSATAPSLPGLSSSTTTTSSSSSRPDEEEEREAGEEEEEG
GQDLMIPHVRFRGESYVPVPAPVVYPIPRAWRGGKLVLEIRACNSTHFSF
RVGPDGRRSERTVVMEASNEAVSWGFTGTLLGIYATSNGGNGTTPAYFSD WRYTPLEQFRD (SEQ
ID NO: 177) SPGHGRNSTFYNPIFPGFYPDPSCIYVPERDHTFFCASSSFNAFPGIPIH
ASKDLQNWKLIGHVLNRKEQLPRLAETNRSTSGIWAPTLRFHDDTFWLVT
TLVDDDRPQEDASRWDNIIFKAKNPYDPRSWSKAVHFNFTGYDTEPFWDE
DGKVYITGAHAWHVGPYIQQAEVDLDTGAVGEWRIIWNGTGGMAPEGPIH
YRKDGWYYLLAAEGGTGIDHMVTMARSRKISSPYESNPNNPVLTNANTTS
YFQTVGHSDLFHDRHGNWWAVALSTRSGPEYLHYPMGRETVMTAVSWPKD
EWPTFTPISGKMSGWPMPPSQKDIRGVGPYVNSPDPEHLTFPRSAPLPAH
LTYWRYPNPSSYTPSPPGHPNTLRLTPSRLNLTALNGNYAGADQTFVSRR
QQHTLFTYSVTLDYAPRTAGEEAGVTAFLTQNHHLDLGVVLLPRGSATAP
SLPGLSSSTTTTSSSSSRPDEEEEREAGEEEEEGGQDLMIPHVRFRGESY
VPVPAPVVYPIPRAWRGGKLVLEIRACNSTHFSFRVGPDGRRSERTVVME
ASNEAVSWGFTGTLLGIYATSNGGNGTTPAYFSDWRYTPLEQFRD
[0312] The polynucleotide (SEQ ID NO:178) and amino acid (SEQ ID
NO:179) sequences of a wild-type M. thermophila acetylxylan
esterase ("Axe3") are provided below. The signal sequence is shown
underlined in SEQ ID NO:179. SEQ ID NO:180 provides the sequence of
this acetylxylan esterase without the signal sequence.
TABLE-US-00059 (SEQ ID NO: 178)
ATGAAGCTCCTGGGCAAACTCTCGGCGGCACTCGCCCTCGCGGGCAGCAG
GCTGGCTGCCGCGCACCCGGTCTTCGACGAGCTGATGCGGCCGACGGCGC
CGCTGGTGCGCCCGCGGGCGGCCCTGCAGCAGGTGACCAACTTTGGCAGC
AACCCGTCCAACACGAAGATGTTCATCTACGTGCCCGACAAGCTGGCCCC
CAACCCGCCCATCATAGTGGCCATCCACTACTGCACCGGCACCGCCCAGG
CCTACTACTCGGGCTCCCCTTACGCCCGCCTCGCCGACCAGAAGGGCTTC
ATCGTCATCTACCCGGAGTCCCCCTACAGCGGCACCTGTTGGGACGTCTC
GTCGCGCGCCGCCCTGACCCACAACGGCGGCGGCGACAGCAACTCGATCG
CCAACATGGTCACCTACACCCTCGAAAAGTACAATGGCGACGCCAGCAAG
GTCTTTGTCACCGGCTCCTCGTCCGGCGCCATGATGACGAACGTGATGGC
CGCCGCGTACCCGGAACTGTTCGCGGCAGGAATCGCCTACTCGGGCGTGC
CCGCCGGCTGCTTCTACAGCCAGTCCGGAGGCACCAACGCGTGGAACAGC
TCGTGCGCCAACGGGCAGATCAACTCGACGCCCCAGGTGTGGGCCAAGAT
GGTCTTCGACATGTACCCGGAATACGACGGCCCGCGCCCCAAGATGCAGA
TCTACCACGGCTCGGCCGACGGCACGCTCAGACCCAGCAACTACAACGAG
ACCATCAAGCAGTGGTGCGGCGTCTTCGGCTTCGACTACACCCGCCCCGA
CACCACCCAGGCCAACTCCCCGCAGGCCGGCTACACCACCTACACCTGGG
GCGAGCAGCAGCTCGTCGGCATCTACGCCCAGGGCGTCGGACACACGGTC
CCCATCCGCGGCAGCGACGACATGGCCTTCTTTGGCCTGTGA (SEQ ID NO: 179)
MKLLGKLSAALALAGSRLAAAHPVFDELMRPTAPLVRPRAALQQVTNFGS
NPSNTKMFIYVPDKLAPNPPIIVAIHYCTGTAQAYYSGSPYARLADQKGF
IVIYPESPYSGTCWDVSSRAALTHNGGGDSNSIANMVTYTLEKYNGDASK
VFVTGSSSGAMMTNVMAAAYPELFAAGIAYSGVPAGCFYSQSGGTNAWNS
SCANGQINSTPQVWAKMVFDMYPEYDGPRPKMQIYHGSADGTLRPSNYNE
TIKQWCGVFGFDYTRPDTTQANSPQAGYTTYTWGEQQLVGIYAQGVGHTV PIRGSDDMAFFGL
(SEQ ID NO: 180) HPVFDELMRPTAPLVRPRAALQQVTNFGSNPSNTKMFIYVPDKLAPNPPI
IVAIHYCTGTAQAYYSGSPYARLADQKGFIVIYPESPYSGTCWDVSSRAA
LTHNGGGDSNSIANMVTYTLEKYNGDASKVFVTGSSSGAMMTNVMAAAYP
ELFAAGIAYSGVPAGCFYSQSGGTNAWNSSCANGQINSTPQVWAKMVFDM
YPEYDGPRPKMQIYHGSADGTLRPSNYNETIKQWCGVFGFDYTRPDTTQA
NSPQAGYTTYTWGEQQLVGIYAQGVGHTVPIRGSDDMAFFGL
[0313] The polynucleotide (SEQ ID NO:181) and amino acid (SEQ ID
NO:182) sequences of a wild-type M. thermophila ferulic acid
esterase ("FAE") are provided below. The signal sequence is shown
underlined in SEQ ID NO:182. SEQ ID NO:183 provides the sequence of
this xylanase without the signal sequence
TABLE-US-00060 (SEQ ID NO: 181)
ATGATCTCGGTTCCTGCTCTCGCTCTGGCCCTTCTGGCCGCCGTCCAGGT
CGTCGAGTCTGCCTCGGCTGGCTGTGGCAAGGCGCCCCCTTCCTCGGGCA
CCAAGTCGATGACGGTCAACGGCAAGCAGCGCCAGTACATTCTCCAGCTG
CCCAACAACTACGACGCCAACAAGGCCCACAGGGTGGTGATCGGGTACCA
CTGGCGCGACGGATCCATGAACGACGTGGCCAACGGCGGCTTCTACGATC
TGCGGTCCCGGGCGGGCGACAGCACCATCTTCGTTGCCCCCAACGGCCTC
AATGCCGGATGGGCCAACGTGGGCGGCGAGGACATCACCTTTACGGACCA
GATCGTAGACATGCTCAAGAACGACCTCTGCGTGGACGAGACCCAGTTCT
TTGCTACGGGCTGGAGCTATGGCGGTGCCATGAGCCATAGCGTGGCTTGT
TCTCGGCCAGACGTCTTCAAGGCCGTCGCGGTCATCGCCGGGGCCCAGCT
GTCCGGCTGCGCCGGCGGCACGACGCCCGTGGCGTACCTAGGCATCCACG
GAGCCGCCGACAACGTCCTGCCCATCGACCTCGGCCGCCAGCTGCGCGAC
AAGTGGCTGCAGACCAACGGCTGCAACTACCAGGGCGCCCAGGACCCCGC
GCCGGGCCAGCAGGCCCACATCAAGACCACCTACAGCTGCTCCCGCGCGC
CCGTCACCTGGATCGGCCACGGGGGCGGCCACGTCCCCGACCCCACGGGC
AACAACGGCGTCAAGTTTGCGCCCCAGGAGACCTGGGACTTCTTTGATGC
CGCCGTCGGAGCGGCCGGCGCGCAGAGCCCGATGACATAA (SEQ ID NO: 182)
MISVPALALALLAAVQVVESASAGCGKAPPSSGTKSMTVNGKQRQYILQL
PNNYDANKAHRVVIGYHWRDGSMNDVANGGFYDLRSRAGDSTIFVAPNGL
NAGWANVGGEDITFTDQIVDMLKNDLCVDETQFFATGWSYGGAMSHSVAC
SRPDVFKAVAVIAGAQLSGCAGGTTPVAYLGIHGAADNVLPIDLGRQLRD
KWLQTNGCNYQGAQDPAPGQQAHIKTTYSCSRAPVTWIGHGGGHVPDPTG
NNGVKFAPQETWDFFDAAVGAAGAQSPMT (SEQ ID NO: 183)
ASAGCGKAPPSSGTKSMTVNGKQRQYILQLPNNYDANKAHRVVIGYHWRD
GSMNDVANGGFYDLRSRAGDSTIFVAPNGLNAGWANVGGEDITFTDQIVD
MLKNDLCVDETQFFATGWSYGGAMSHSVACSRPDVFKAVAVIAGAQLSGC
AGGTTPVAYLGIHGAADNVLPIDLGRQLRDKWLQTNGCNYQGAQDPAPGQ
QAHIKTTYSCSRAPVTWIGHGGGHVPDPTGNNGVKFAPQETWDFFDAAVG AAGAQSPMT
Example 1
Protease Deletion Strain Production and Testing
[0314] In this Example, methods used to produce M. thermophila
strains deficient in protease production are described.
Method One:
[0315] Genomic DNA was isolated from a M. thermophila strain
("CF-409") that contained a deletion of the alp1 gene. The DNA was
isolated using the following method: hyphal inoculum was seeded
into a standard fungal growth medium and allowed to grow for 72
hours at 35.degree. C. The mycelial mat was collected and genomic
DNA was extracted using standard methods known in the art.
[0316] A DNA fragment of the 1 kb internal region of gene
"contig.sub.--1809.g1" from genomic M. thermophila DNA was
amplified by primers cdxp001 (SEQ ID NO:184) and cdxp002 (SEQ ID
NO:185), shown below. The PCR reaction was performed by using the
PHUSION.RTM. polymerase (NEB) using PHUSION.RTM. GC buffer (NEB) at
98.degree. C. for 30 sec., followed by 35 cycles of 98.degree. C.
for 10 sec., 72.degree. C. for 1 min., and final extension at
72.degree. C. for 5 min. The resultant DNA fragment was cloned into
plasmid C1V16.1809.g1 (See, FIG. 1) using the IN-FUSION.RTM.
cloning technique (IN-FUSION.RTM. Advantage PCR cloning kit with
cloning enhancer, Clontech, Cat. No 639617), using the
manufacturer's protocol.
TABLE-US-00061 Primer Name Sequence(5'-3') cdxp001
ACCGCGGTGGCGGCCAGGTTCGTTCGTCGTCTCATGTGT (SEQ ID NO: 184) cdxp002
CAATAGACATCAGCATCCGGCCAACGAAGAAGGAAAGTA (SEQ ID NO: 185)
Protoplast Preparation
[0317] First, 10.sup.6 spores/ml of M. thermophila cells
(W1L100L.DELTA.Alp1.DELTA.chi1.DELTA.pyr5.DELTA.bg11::pyr5.DELTA.ku70::Hy-
g) were inoculated into 100 ml standard fungal growth medium. The
culture was incubated for 24 hours at 35.degree. C., 250 rpm. To
harvest the mycelium, the culture was filtered through a sterile
Myracloth filter (Calbiochem) and washed with 100 ml 1700 mosmol
NaCl/CaCl.sub.2 solution (0.6 M NaCl, 0.27 M CaCl.sub.2*H.sub.2O).
The washed mycelia were transferred into a clean tube and weighed.
Caylase (20 mg/g mycelia) was dissolved in 1700 mosmol
NaCl/CaCl.sub.2 and UV-sterilized for 90 sec. Then, 3 ml of sterile
Caylase solution was added to the washed mycelia and mixed. Then,
15 ml of 1700 mosmol NaCl/CaCl.sub.2 solution was added into the
tube and mixed. The mycelia/Caylase suspension was incubated at
30.degree. C., 70 rpm for 2 hours. Protoplasts were harvested by
filtering through a sterile Myracloth filter into a sterile 50 ml
tube. Then, 25 ml cold STC (1.2 M sorbitol, 50 mM
CaCl.sub.2*H.sub.2O, 35 mM NaCl, 10 mM Tris-HCl) was added to the
flow through and the protoplasts were spun down at 2720 rpm for 10
min at 4.degree. C. The pellet was re-suspended in 50 ml STC and
centrifuged again. After the washing steps, the pellet was
resuspended in 1 ml STC.
Transformation
[0318] Transformation was carried out in M. thermophila strain
(W1L100L.DELTA.Alp1.DELTA.chi1.DELTA.pyr5.DELTA.bg11::pyr5.DELTA.ku70::Hy-
g) protoplasts, where homologous integration of the construct would
disrupt contig.sub.--1809.g1, as described below. First, 5 .mu.g
plasmid DNA, 1 .mu.l aurintricarboxylic acid, and 100 .mu.l of the
protoplast suspension were mixed together and incubated at room
temperature for 25 min. Then, 1.7 ml PEG4000 solution (60% PEG4000
[polyethylene glycol, average molecular weight 4000 daltons], 50 mM
CaCl.sub.2*H.sub.2O, 35 mM NaCl, 10 mM Tris-HCl) was added and
mixed thoroughly. The solution was kept at room temperature for 20
min. The tube was filled with STC, mixed and centrifuged at 2500
rpm for 10 min at 4.degree. C. The STC was poured off and the
pellet was re-suspended in the remaining STC and plated on
acetamide selective media plates, as known in the art. The plates
were incubated for 5 days at 35.degree. C. Colonies were
re-streaked and checked by PCR for the presence of the integrated
plasmid disrupting the protease coding region.
Testing the Effect of Protease Deletion
[0319] The protease-deleted strain was grown in fungal growth
medium and incubated at 35.degree. C., 250 rpm, 85% humidity for 2
days. An aliquot (10%) of this culture was then used to inoculate
fungal growth medium comprising glucose, amino acids, minerals, a
and pen/strep, and incubated at 35.degree. C., 300 rpm, 85%
humidity for 4 days.
[0320] The proteolytic activity present in the fermentation medium
was determined in microtiter plate assays. In order to determine
whether there was protease activity capable of clipping purified M.
thermophila CBH1a in the fermentation medium, purified CBH1a was
diluted to 1 g/l in 50 mM Na acetate buffer, pH5.0 and mixed with
fermentation medium supernatant, at a ratio of 1:3
(enzyme:fermentation medium). The control was fermentation medium
obtained from a culture of unmodified M. thermophila strain at the
same ratio of enzyme to fermentation medium (i.e., 1:3;
enzyme:fermentation broth).
[0321] In order to determine whether there was protease activity
capable of clipping purified M. thermophila GH61a in the
fermentation medium, purified GH61a was diluted to 0.5 g/l in 50 mM
Na acetate buffer, pH5.0 and mixed with fermentation medium at a
ratio of 1:4 (enzyme:fermentation medium). The control was
fermentation medium obtained from a culture of unmodified M.
thermophila strain at the same ratio of enzyme to fermentation
medium (i.e., 1:4; enzyme:fermentation broth).
[0322] Additional controls included 4 fold diluted pure 1 g/l CBH1a
in 50 mM Na acetate buffer (pH5.0), and 5 fold diluted pure 0.5 g/l
GH61a in 50 mM Na acetate buffer (pH5.0). In these experiments,
0.25 volume 50 mM Na acetate buffer (pH5.0) was added to each
sample.
[0323] Samples were taken from time 0 and after 72 h shaking at
38.degree. C., 900 rpm. The 0 time point and 72 h time point
samples were run on SDS-PAGE and the proteolytic activity of the
fermentation supernatants were assessed based on the level of CBH1a
or GH61a lysis in comparison to the controls. The SDS-PAGE results
showed that the deletion of the protease encoded by
contig.sub.--1809.g1 eliminated GH61a and CBH1a clipping, in
contrast to the fermentation medium from the unmodified M.
thermophila strain.
Example 2
Protease Deletion Strain Development and Testing
[0324] In this Example, methods used to produce M. thermophila
strains deficient in protease production are described.
[0325] Genomic DNA was isolated from the CF-409 strain using
standard methods known in the art. Genomic DNA fragments flanking
the contig.sub.--690.g5 gene were cloned using primers cdxp003 and
cdxp004 (upstream homology) and primers cdxp003 and cdxp004
(downstream homology). The PCR reaction was performed by using the
GOTAQ.RTM. polymerase (Promega) at 95.degree. C. for 2 min.,
followed by 35 cycles of 95.degree. C. for 30 sec., 53.degree. C.
for 30 sec., 72.degree. C. for 1 min., and final extension at
72.degree. C. for 5 min. The resultant DNA fragments were cloned
into plasmid pUC19, along with a HygR selection marker using the
GeneArt cloning technique (GENEART.RTM. Seamless Cloning and
Assembly Kit, Invitrogen Cat. No. A13288), according to the
manufacturer's protocol to create "pUC19-690.g5." For gene
contig.sub.--690.g5 knock-out, the split-marker method was
employed, as known in the art. The two DNA fragments were amplified
from the puc19-690.g5 plasmid construct by cdxp007-cdxp008 and
cdxp009-cdxp010 primers, respectively. The two fragments were
co-transformed in equal amounts (2.5 and 2.5 .mu.g) into CF-409
fungal protoplasts to obtain gene deleted strains, as described
above.
TABLE-US-00062 Primer Name Sequence(5'-3') cdxp003
AAGAGTGCAAGAGTGAAGGCAGGC (SEQ ID NO: 186) cdxp004
CTAGCACAGTCAGACCTCCACATACCATCGTACTCGCAACTGACGCTCGTT (SEQ ID NO:
187) cdxp005 GCAGTCGCAGCATTTACATCAGGCTGGTATGTGGAGGTCTGACTGTGCTAG
(SEQ ID NO: 188) cdxp006 GCCCGCTGTCATTCAAGACATTGC (SEQ ID NO: 189)
cdxp007 GCCAAGCTTGCATGCCATCACTGTTGATGACGCTCTCGCT (SEQ ID NO: 190)
cdxp008 TGTTGGCGACCTCGTATTGGGAAT (SEQ ID NO: 191) cdxp009
TCTCGGAGGGCGAAGAATCTCGTG (SEQ ID NO: 192) cdxp010
AATTCGAGCTCGGTACTTGTGCATTTACGGTGCTGTGACG (SEQ ID NO: 193)
[0326] Transformation was carried out into
UV18#100f.DELTA.Alp1.DELTA.pyr5.DELTA.ku70::pyr5 M. thermophila
strain. The transformants were incubated for 5 days at 35.degree.
C. under standard hygromycin-selective conditions known in the art.
Colonies were re-streaked and checked for the deletion of the
protease using PCR, as described in Example 1, above.
[0327] The protease-deleted strain was grown in a fungal growth
medium at pH 5.0 and an unmodified strain (control) was grown in
the same fungal growth medium at pH 5.0 and pH 6.7. Protein
profiles were compared using 2D gel electrophoresis, using standard
methods known in the art. Comparison of the 2D gels showed that
CBH1a lysis was significantly reduced in the protease-deleted
strain.
Example 3
Protease Deletion Strain Development and Testing
[0328] In this Example, methods used to produce M. thermophila
strains deficient in protease production are described.
[0329] Genomic DNA was isolated from an M. thermophila strain
("CF-409") with a deletion of the alp 1 gene. The DNA was isolated
using standard methods known in the art. To produce knockout of
gene 1086.g13 (v4chr4-45825 m24; SEQ ID NO:7), the split-marker
method was employed, as known in the art. The 3' and 5' homolog
arms (i.e., "flanks") of 1086.g13 were amplified from genomic DNA
by cdx111006-cdx111007 and cdx111008-cdx111009 primers,
respectively, as described below.
TABLE-US-00063 Primer Name Sequence(5'-3') cdx111006
CCGTCTCTCCGCATGCCAGAAAGATTCCTTCCCTTGCTCCTTCACACTG (SEQ ID NO: 194)
cdx111007 CCCCTCCCCTACCTATCTTGTGTCT (SEQ ID NO: 195) cdx111008 GGA
TAA GAG TGA ACA ACG ACG AGC (SEQ ID NO: 196) cdx111009
GTAACACCCAATACGCCGGCCGAACAAAAGCCATTCTTCCTCCGAGAC (SEQ ID NO: 197)
cdx10177 TGTTGGCGACCTCGTATTGGGAAT (SEQ ID NO: 198)
[0330] Primers were designed with 24 bp long adapters (first 24 bp
in primers Cdx 111006 and Cdx 111009) complementary to 5' and 3'
ends of the HYGRO (i.e., hygromycin B phosphotransferase;
"hygromycin gene") selection marker cassette. The 24 bp long
adapter part of the Cdx111006 primer is complementary to the
promoter region of HYGRO cassette, while the cdx111009 primer
carries an adapter complementary to the terminator region of the
HYGRO cassette. The whole HYGRO fragment is 2554 bp in length. The
overlapping homolog arms of hygromycin gene are indicated herein as
"HYG" and "GRO." The 1559 bp long HYG arm (5' arm) was amplified
with cdx 10176-cdx 10177 primers. The 1607 bp long GRO arm (3' arm)
was amplified with cdx10178-cdx10179 primers. The overlap between
the HYG and GRO arms is 612 bp long.
TABLE-US-00064 Primer Corresponding Name Primer Sequence Region
cdx10176 TCTTTCTGGCATGCGGAGAGACGG HYG (5'arm) (SEQ ID NO: 199)
forward cdx10177 TGTTGGCGACCTCGTATTGGGAAT HYG (5'arm) (SEQ ID NO:
198) reverse cdx10178 TCTCGGAGGGCGAAGAATCTCGTG GRO(3'arm) (SEQ ID
NO: 199) forward cdx10179 TTCGGCCGGCGTATTGGGTGTTAC GRO(3'arm) (SEQ
ID NO: 200) reverse
[0331] The HYG 5' homolog arm was amplified using the following PCR
parameters: denaturation at 95.degree. C. for 2 min, followed by 35
cycles of 95.degree. C. for 20 sec, 60.degree. C. for 20 sec,
72.degree. C. for 1 min, and final extension at 72.degree. C. for 3
min. The 50 .mu.l reaction volume contained 10 .mu.l 5.times.
HERCULASE.RTM. II reaction buffer (Agilent Technologies), 0.5 .mu.l
25 mM dNTPs, 1 .mu.l primer Cdx10176 (10 mM), 1 .mu.l primer
Cdx10177 (10 mM), 3% DMSO, 1 .mu.l DNA template, HERCULASE.RTM. II
Fusion Enzyme (Agilent Technologies) with dNTPs Combo (Agilent
Technologies), H.sub.2O was added to 50 .mu.l final volume.
[0332] GRO 3' homolog arm was amplified using the following PCR
parameters: denaturation at 95.degree. C. for 2 min, followed by 35
cycles of 95.degree. C. for 20 sec, 60.degree. C. for 20 sec,
72.degree. C. for 1 min, and final extension at 72.degree. C. for 3
min. The 50 .mu.l reaction volume contained 10 .mu.l 5.times.
HERCULASE.RTM. II reaction buffer (Agilent Technologies), 0.5 .mu.l
25 mM dNTPs, 1 .mu.l primer Cdx10178 (10 mM), 1 .mu.l primer
Cdx10179 (10 mM), 3% DMSO, 1 .mu.l DNA template, HERCULASE.RTM. II
Fusion Enzyme (Agilent Technologies) with dNTPs Combo (Agilent
Technologies), H.sub.2O was added to 50 .mu.l final volume.
[0333] The 943 bp long 1086.g13 3' homolog arm was amplified using
the following PCR parameters: denaturation at 98.degree. C. for 30
sec, followed by 35 cycles of 98.degree. C. for 10 sec, 62.degree.
C. for 20 sec, and 72.degree. C. for 30 sec, followed by final
extension at 72.degree. C. for 5 min. The 50 .mu.l reaction volume
contained 10 .mu.l 5.times. PHUSION.RTM. GC buffer, 0.5 .mu.l 25 mM
dNTPs, 1 .mu.l Cdx111006 (10 mM), 1 .mu.l primer Cdx111007 (10 mM),
3% DMSO, 1 .mu.l DNA template, 0.5 .mu.l PHUSION.RTM. Hot Start
High-Fidelity Polymerase (Finnzymes), H.sub.2O was added to 50
.mu.l final volume.
[0334] The 852 bp long 1086.g13 5' homolog arm was amplified using
the following PCR parameters: denaturation at 95.degree. C. for 2
min, followed by 35 cycles of 95.degree. C. for 20 sec, 62.degree.
C. for 20 sec, 72.degree. C. for 30 sec, and final extension at
72.degree. C. for 3 min. The 50 .mu.l reaction volume contained 10
.mu.l 5.times. HERCULASE.RTM. II reaction buffer (Agilent
Technologies), 0.5 .mu.l 25 mM dNTPs, 1 .mu.l primer Cdx111008 (10
mM), 1 .mu.l primer Cdx111009 (10 mM), 3% DMSO, 1 .mu.l DNA
template, HERCULASE.RTM. II Fusion Enzyme (Agilent Technologies)
with dNTPs Combo (Agilent Technologies), H.sub.2O was added to 50
.mu.l final volume.
[0335] The sizes of the PCR fragments were checked on precast 1.2%
EtBr E-gel (Invitrogen). Fragments were spin column purified
(QIAQUICK.RTM. PCR Purification Kit; Qiagen), and eluted in 50
.mu.l elution buffer.
[0336] To attach the 1086.g13 3' homolog arm to HygR fragment, a 50
.mu.l reaction volume containing 10 .mu.l 5.times. HERCULASE.RTM.
II reaction buffer (Agilent Technologies), 0.5 .mu.l 25 mM dNTPs, 1
.mu.l primer cdx111007 (10 mM), 1 .mu.l primer cdx10177 (10 mM), 3%
DMSO, 0.5 .mu.l 3' arm (20 ng), 0.5 .mu.l HYG fragment (20 ng),
HERCULASE.RTM. II Fusion Enzyme (Agilent Technologies) with dNTPs
Combo (Agilent Technologies), with H.sub.2O added to 50 .mu.l final
volume. The primers used were Cdx111007 and Cdx10177. The following
PCR parameters were used: denaturation at 95.degree. C. for 2 min,
followed by 35 cycles of 95.degree. C. for 20 sec, 61.degree. C.
for 20 sec, and 72.degree. C. for 1.5 min, followed by final
extension at 72.degree. C. for 3 min. The size of the 1086-13'+HYG
construct was 2502 bp.
[0337] In order to attach the 1086.g13 5' homolog arm to the GRO
fragment, a 50 .mu.l reaction volume containing 10 .mu.l 5.times.
HERCULASE.RTM. II reaction buffer (Agilent Technologies), 0.5 .mu.l
25 mM dNTPs, 1 .mu.l primer cdx 111008 (10 mM), 1 .mu.l primer
cdx10178 (10 mM), 3% DMSO, 0.5 .mu.l 5' arm (20 ng), 0.5 .mu.l GRO
fragment (20 ng), HERCULASE.RTM. II Fusion Enzyme (Agilent
Technologies) with dNTPs Combo (Agilent Technologies), with
H.sub.2O added to 50 .mu.l final volume. The PCR parameters used
were as follows: denaturation at 95.degree. C. for 2 min, followed
by 35 cycles of 95.degree. C. for 20 sec, 58.degree. C. for 20 sec,
and 72.degree. C. for 1.5 min, followed by final extension at
72.degree. C. for 3 min. The size of the 1086-5'+GRO construct was
2459 bp.
TABLE-US-00065 Primer name Sequence(5'-3') cdx111008
GGATAAGAGTGAACAACGACGAGC (SEQ ID NO: 196) cdx10178
TCTCGGAGGGCGAAGAATCTCGTG (SEQ ID NO: 200)
[0338] Both constructs (1086-3'+HYG 1086-5' GRO) and were checked
on precast 1.2% EtBr E-gel (Invitrogen). They were spin column
purified (QIAQUICK.RTM. PCR Purification Kit; Qiagen), and eluted
in 50 .mu.l elution buffer. The two constructs were co-transformed
in equal amounts (2 .mu.g each) into CF-409 fungal protoplasts to
obtain gene deleted strains, as described below.
[0339] Transformation into M. thermophila cells
(W1L100L.DELTA.Alp1.DELTA.chi1.DELTA.pyr5.DELTA.bg11::pyr5.DELTA.ku70::Hy-
g) was performed as described in Example 1. The transformants were
incubated for 5 days at 35.degree. C. under standard
hygromycin-selective conditions known in the art. Colonies were
re-streaked and checked for the deletion of the protease using PCR,
as described in Example 1, above.
[0340] The protease-deleted strain was grown in fungal growth
medium and incubated at 35.degree. C., 250 rpm, 85% humidity for 2
days. An aliquot (10%) of this culture was then used to inoculate
fungal growth medium comprising glucose, CSS (corn stover solids),
minerals and incubated at 35.degree. C. at pH=5.0 for 4 days. The
clipping of the enzyme CBH1a was determined using 2D gel (Biorad)
which showed detectable decrease of the clipping in the protease
deleted strain compared to the control.
Sequence CWU 1
1
20111635DNAMyceliophthora thermophila 1atgcagctcc ttagtctcgc
cgctctcctc ccccttgccc ttgcggcacc ggtgatcaag 60cctcaggggc tccagctgat
tccgggcgac tacatcgtga agctgaagga cggtgcgtcc 120gagagcactc
tccaggacac catccggcac ctccaggcag gcgaggccaa gcatgtctac
180cgcgcacgcc ggttcaaggg cttcgcggcc aagctgagcc cgcaggtggt
cgataccctg 240agcaagctgc ccgaggttcg ttcgtcgtct catgtgtaat
tatgtcacaa aaagggatat 300gtaggatgct aattcagacc cgcaggtcga
atacattgag caggacgccg tcgtcaccat 360ccaggcgctg gtcacccagg
aggacgtgcc ctggggtctg gcccgcatct cgcaccacga 420actgggtccc
acgtcgtacg tatacgacga cagcgccggc gagggtacct gcgcctatgt
480catcgacacg ggcatctatg tggcccactc tgtaagtctg gccgtcaatt
cacccactct 540cccgctgctg ccaccgaatc tctattagta tcttgacgac
tttgttgcgg agacaacgac 600gctgactctt ttgactccag cagttcgaag
gccgcgcgac gtggctggcc aactttatcg 660acagcagcga tagcgagtca
gtttagcatc ccccaccccc tggttgttgc acttgaatga 720gctgaccttt
cataaataaa cagcggcgcg ggccacggca cgcacgtgtc gggcacgatc
780ggcggcgtga cgtacggcgt ggccaagaag accaagctgt tcgcggtcaa
ggtgctcaac 840gcgagcgggt cggggacggt gtcgtcggtg ctggcggggc
tcgagttcgt cgcgtcggac 900gcgccggcgc gcgtcgcctc gggcgagtgc
gccaacggcg cggtcgccaa cctgagcctc 960ggcggcggcc ggtccaccgc
catcaacgcc gccgccgccg ccgccgtcga cgcgggcgtc 1020ttcgtcgccg
tcgcggccgg caacagcaac accgacgccc agtccacctc ccccgccagc
1080gagcccagcg tctgcaccgt cggcgccacc gacgacagcg acgcccgcgc
ctacttctcc 1140aactacggca gcgtcgtcga cgtctttgct cccggcgtcg
acgtcctcag cagctggatc 1200ggcggtgtcg atgccactgt gagttttttt
ttttcctttt cccgtttctt tttgcttctt 1260gttttctccc cattttgatg
ttttacatta ctttccttct tcgttggccg gattcgtttt 1320catccttttt
ttcttctttc ttctgtcaaa aggcgataac aagggatgat gcggaaagag
1380agaagaggaa taaaaacggg gaaccagaac aagaacatac caggctgact
ggaaaacaaa 1440cagaacacca tctcgggcac ctcgatggcg accccgcata
tcgccggcct cggggcctat 1500ctcctcgctc tgctgggccc caggtcgccc
gaggaactgt gcgagtacat caagcagacg 1560gccaccatcg gcaccatcac
cagcctcccc agcggcacca tcaacgccat tgcctacaac 1620ggtgctacag cctaa
163521164DNAMyceliophthora thermophila 2atgcagctcc ttagtctcgc
cgctctcctc ccccttgccc ttgcggcacc ggtgatcaag 60cctcaggggc tccagctgat
tccgggcgac tacatcgtga agctgaagga cggtgcgtcc 120gagagcactc
tccaggacac catccggcac ctccaggcag gcgaggccaa gcatgtctac
180cgcgcacgcc ggttcaaggg cttcgcggcc aagctgagcc cgcaggtggt
cgataccctg 240agcaagctgc ccgaggtcga atacattgag caggacgccg
tcgtcaccat ccaggcgctg 300gtcacccagg aggacgtgcc ctggggtctg
gcccgcatct cgcaccacga actgggtccc 360acgtcgtacg tatacgacga
cagcgccggc gagggtacct gcgcctatgt catcgacacg 420ggcatctatg
tggcccactc tcagttcgaa ggccgcgcga cgtggctggc caactttatc
480gacagcagcg atagcgacgg cgcgggccac ggcacgcacg tgtcgggcac
gatcggcggc 540gtgacgtacg gcgtggccaa gaagaccaag ctgttcgcgg
tcaaggtgct caacgcgagc 600gggtcgggga cggtgtcgtc ggtgctggcg
gggctcgagt tcgtcgcgtc ggacgcgccg 660gcgcgcgtcg cctcgggcga
gtgcgccaac ggcgcggtcg ccaacctgag cctcggcggc 720ggccggtcca
ccgccatcaa cgccgccgcc gccgccgccg tcgacgcggg cgtcttcgtc
780gccgtcgcgg ccggcaacag caacaccgac gcccagtcca cctcccccgc
cagcgagccc 840agcgtctgca ccgtcggcgc caccgacgac agcgacgccc
gcgcctactt ctccaactac 900ggcagcgtcg tcgacgtctt tgctcccggc
gtcgacgtcc tcagcagctg gatcggcggt 960gtcgatgcca ctaacaccat
ctcgggcacc tcgatggcga ccccgcatat cgccggcctc 1020ggggcctatc
tcctcgctct gctgggcccc aggtcgcccg aggaactgtg cgagtacatc
1080aagcagacgg ccaccatcgg caccatcacc agcctcccca gcggcaccat
caacgccatt 1140gcctacaacg gtgctacagc ctaa 11643387PRTMyceliophthora
thermophila 3Met Gln Leu Leu Ser Leu Ala Ala Leu Leu Pro Leu Ala
Leu Ala Ala 1 5 10 15 Pro Val Ile Lys Pro Gln Gly Leu Gln Leu Ile
Pro Gly Asp Tyr Ile 20 25 30 Val Lys Leu Lys Asp Gly Ala Ser Glu
Ser Thr Leu Gln Asp Thr Ile 35 40 45 Arg His Leu Gln Ala Gly Glu
Ala Lys His Val Tyr Arg Ala Arg Arg 50 55 60 Phe Lys Gly Phe Ala
Ala Lys Leu Ser Pro Gln Val Val Asp Thr Leu 65 70 75 80 Ser Lys Leu
Pro Glu Val Glu Tyr Ile Glu Gln Asp Ala Val Val Thr 85 90 95 Ile
Gln Ala Leu Val Thr Gln Glu Asp Val Pro Trp Gly Leu Ala Arg 100 105
110 Ile Ser His His Glu Leu Gly Pro Thr Ser Tyr Val Tyr Asp Asp Ser
115 120 125 Ala Gly Glu Gly Thr Cys Ala Tyr Val Ile Asp Thr Gly Ile
Tyr Val 130 135 140 Ala His Ser Gln Phe Glu Gly Arg Ala Thr Trp Leu
Ala Asn Phe Ile 145 150 155 160 Asp Ser Ser Asp Ser Asp Gly Ala Gly
His Gly Thr His Val Ser Gly 165 170 175 Thr Ile Gly Gly Val Thr Tyr
Gly Val Ala Lys Lys Thr Lys Leu Phe 180 185 190 Ala Val Lys Val Leu
Asn Ala Ser Gly Ser Gly Thr Val Ser Ser Val 195 200 205 Leu Ala Gly
Leu Glu Phe Val Ala Ser Asp Ala Pro Ala Arg Val Ala 210 215 220 Ser
Gly Glu Cys Ala Asn Gly Ala Val Ala Asn Leu Ser Leu Gly Gly 225 230
235 240 Gly Arg Ser Thr Ala Ile Asn Ala Ala Ala Ala Ala Ala Val Asp
Ala 245 250 255 Gly Val Phe Val Ala Val Ala Ala Gly Asn Ser Asn Thr
Asp Ala Gln 260 265 270 Ser Thr Ser Pro Ala Ser Glu Pro Ser Val Cys
Thr Val Gly Ala Thr 275 280 285 Asp Asp Ser Asp Ala Arg Ala Tyr Phe
Ser Asn Tyr Gly Ser Val Val 290 295 300 Asp Val Phe Ala Pro Gly Val
Asp Val Leu Ser Ser Trp Ile Gly Gly 305 310 315 320 Val Asp Ala Thr
Asn Thr Ile Ser Gly Thr Ser Met Ala Thr Pro His 325 330 335 Ile Ala
Gly Leu Gly Ala Tyr Leu Leu Ala Leu Leu Gly Pro Arg Ser 340 345 350
Pro Glu Glu Leu Cys Glu Tyr Ile Lys Gln Thr Ala Thr Ile Gly Thr 355
360 365 Ile Thr Ser Leu Pro Ser Gly Thr Ile Asn Ala Ile Ala Tyr Asn
Gly 370 375 380 Ala Thr Ala 385 41687DNAMyceliophthora thermophila
4atgaggttac tccgcaccgc gggagcggca actctcttcc tgtcgcccgc cacttttgcg
60accaacaacc ctctgacccc aggcaaactt gaggcggaca ttagaaccga agagtatgag
120aagacaacag tgccaaacct ttgatccctc tcattcgtta acgaatattg
ccaaaccagg 180ttgcaaaatg tcctctggaa cctcaatcac attgcggtca
cccacggcgg caaccgagcc 240tttggcgagc ctgggtacaa agcctcgctc
gactttattc tcgagcgcgc ccagacacgc 300ttccacaatg agtttgacac
tgtcgttcag cccttcaacc acacctacgg caagacgaac 360cagatcaagg
tgactggacc agagggcgag gatgtctttg tcatcagccc attgtacaat
420cccgccacgc cgctgcctga tggtatcacc gctcccttgg tagatacacc
ggtcgatgac 480gagcgcggat cggcgtgctt tccggaccag tgggaggggg
tcgatgtgaa ggggaagctg 540gtactagtaa agagaggcat ttgtgctgtg
gcagataagt cggcccttgc taaggagcgc 600ggggcactgg gtgagctacg
tcctggctga cgggggaagc aaacgttgac gtcgctctag 660gggtgatctt
gtataacgaa cagccgggta cgaacatcgt cgtcccgact ctgggtgcag
720agagcatcgg caagactgtt cctatcggaa ttattccctt ggaagtagga
cagagctgga 780agtcccggtt ggcagatggc gaggaggtga ctgtgcacct
gctggtcgat tccatatccg 840atacgcgcga gacgtggaac attattgccg
agaccaaaca gggcgacccc gacaaagtta 900tcatgctcgg tgcacatctc
gacagcgtgc aggcgggagc aggcatcaat gacgacggca 960gcggcacggc
agctctcctg gagatcttga ccgcggtccg gcgctacgat ggattcccac
1020ataagattcg gttcgcctgg tgggcagcag aagagagtgg tctggtcgga
tccctctact 1080acacctccca cttgaccgag gaggaagccg accgcatcaa
gtattacttc aactacgaca 1140tgattggctc tccccatccc gactttgaaa
ttgcaagcga tggcaacagc ggagtcgggc 1200cgcagcttct ggaggaatac
ctcgtcgagc aggggaagga gattgtccac gggtaagtag 1260atcccactcc
agctccacat ctattttgcg tacctggtac ctctatgata tgtgcaggtt
1320ccgctgacct tgggatgcaa gcggcttcgg ttctggctcc gattttgtgg
gcttcctcga 1380gcttggcatc ccgagtaccg cgctacatac cggtgcagga
gctccattcg acgaatgcta 1440ccaccaggcg tgtgatgacc tcgacaatat
caactgggag gcgctgaccg tcaatgccaa 1500agcggccgct cgggcggctg
cccggctggc caactcgctc gagggcgtgc cgccccgcaa 1560gaaaactagc
ctgaatcttc acacgcgccg tggagtggtg caaaacttcc gaaagtgggc
1620ttcattggcc gaggaagcga gccacgggca cacgtgctcg cacacgggaa
agagggtcgt 1680agtgtaa 168751482DNAMyceliophthora thermophila
5atgaggttac tccgcaccgc gggagcggca actctcttcc tgtcgcccgc cacttttgcg
60accaacaacc ctctgacccc aggcaaactt gaggcggaca ttagaaccga agagttgcaa
120aatgtcctct ggaacctcaa tcacattgcg gtcacccacg gcggcaaccg
agcctttggc 180gagcctgggt acaaagcctc gctcgacttt attctcgagc
gcgcccagac acgcttccac 240aatgagtttg acactgtcgt tcagcccttc
aaccacacct acggcaagac gaaccagatc 300aaggtgactg gaccagaggg
cgaggatgtc tttgtcatca gcccattgta caatcccgcc 360acgccgctgc
ctgatggtat caccgctccc ttggtagata caccggtcga tgacgagcgc
420ggatcggcgt gctttccgga ccagtgggag ggggtcgatg tgaaggggaa
gctggtacta 480gtaaagagag gcatttgtgc tgtggcagat aagtcggccc
ttgctaagga gcgcggggca 540ctgggggtga tcttgtataa cgaacagccg
ggtacgaaca tcgtcgtccc gactctgggt 600gcagagagca tcggcaagac
tgttcctatc ggaattattc ccttggaagt aggacagagc 660tggaagtccc
ggttggcaga tggcgaggag gtgactgtgc acctgctggt cgattccata
720tccgatacgc gcgagacgtg gaacattatt gccgagacca aacagggcga
ccccgacaaa 780gttatcatgc tcggtgcaca tctcgacagc gtgcaggcgg
gagcaggcat caatgacgac 840ggcagcggca cggcagctct cctggagatc
ttgaccgcgg tccggcgcta cgatggattc 900ccacataaga ttcggttcgc
ctggtgggca gcagaagaga gtggtctggt cggatccctc 960tactacacct
cccacttgac cgaggaggaa gccgaccgca tcaagtatta cttcaactac
1020gacatgattg gctctcccca tcccgacttt gaaattgcaa gcgatggcaa
cagcggagtc 1080gggccgcagc ttctggagga atacctcgtc gagcagggga
aggagattgt ccacggcggc 1140ttcggttctg gctccgattt tgtgggcttc
ctcgagcttg gcatcccgag taccgcgcta 1200cataccggtg caggagctcc
attcgacgaa tgctaccacc aggcgtgtga tgacctcgac 1260aatatcaact
gggaggcgct gaccgtcaat gccaaagcgg ccgctcgggc ggctgcccgg
1320ctggccaact cgctcgaggg cgtgccgccc cgcaagaaaa ctagcctgaa
tcttcacacg 1380cgccgtggag tggtgcaaaa cttccgaaag tgggcttcat
tggccgagga agcgagccac 1440gggcacacgt gctcgcacac gggaaagagg
gtcgtagtgt aa 14826493PRTMyceliophthora thermophila 6Met Arg Leu
Leu Arg Thr Ala Gly Ala Ala Thr Leu Phe Leu Ser Pro 1 5 10 15 Ala
Thr Phe Ala Thr Asn Asn Pro Leu Thr Pro Gly Lys Leu Glu Ala 20 25
30 Asp Ile Arg Thr Glu Glu Leu Gln Asn Val Leu Trp Asn Leu Asn His
35 40 45 Ile Ala Val Thr His Gly Gly Asn Arg Ala Phe Gly Glu Pro
Gly Tyr 50 55 60 Lys Ala Ser Leu Asp Phe Ile Leu Glu Arg Ala Gln
Thr Arg Phe His 65 70 75 80 Asn Glu Phe Asp Thr Val Val Gln Pro Phe
Asn His Thr Tyr Gly Lys 85 90 95 Thr Asn Gln Ile Lys Val Thr Gly
Pro Glu Gly Glu Asp Val Phe Val 100 105 110 Ile Ser Pro Leu Tyr Asn
Pro Ala Thr Pro Leu Pro Asp Gly Ile Thr 115 120 125 Ala Pro Leu Val
Asp Thr Pro Val Asp Asp Glu Arg Gly Ser Ala Cys 130 135 140 Phe Pro
Asp Gln Trp Glu Gly Val Asp Val Lys Gly Lys Leu Val Leu 145 150 155
160 Val Lys Arg Gly Ile Cys Ala Val Ala Asp Lys Ser Ala Leu Ala Lys
165 170 175 Glu Arg Gly Ala Leu Gly Val Ile Leu Tyr Asn Glu Gln Pro
Gly Thr 180 185 190 Asn Ile Val Val Pro Thr Leu Gly Ala Glu Ser Ile
Gly Lys Thr Val 195 200 205 Pro Ile Gly Ile Ile Pro Leu Glu Val Gly
Gln Ser Trp Lys Ser Arg 210 215 220 Leu Ala Asp Gly Glu Glu Val Thr
Val His Leu Leu Val Asp Ser Ile 225 230 235 240 Ser Asp Thr Arg Glu
Thr Trp Asn Ile Ile Ala Glu Thr Lys Gln Gly 245 250 255 Asp Pro Asp
Lys Val Ile Met Leu Gly Ala His Leu Asp Ser Val Gln 260 265 270 Ala
Gly Ala Gly Ile Asn Asp Asp Gly Ser Gly Thr Ala Ala Leu Leu 275 280
285 Glu Ile Leu Thr Ala Val Arg Arg Tyr Asp Gly Phe Pro His Lys Ile
290 295 300 Arg Phe Ala Trp Trp Ala Ala Glu Glu Ser Gly Leu Val Gly
Ser Leu 305 310 315 320 Tyr Tyr Thr Ser His Leu Thr Glu Glu Glu Ala
Asp Arg Ile Lys Tyr 325 330 335 Tyr Phe Asn Tyr Asp Met Ile Gly Ser
Pro His Pro Asp Phe Glu Ile 340 345 350 Ala Ser Asp Gly Asn Ser Gly
Val Gly Pro Gln Leu Leu Glu Glu Tyr 355 360 365 Leu Val Glu Gln Gly
Lys Glu Ile Val His Gly Gly Phe Gly Ser Gly 370 375 380 Ser Asp Phe
Val Gly Phe Leu Glu Leu Gly Ile Pro Ser Thr Ala Leu 385 390 395 400
His Thr Gly Ala Gly Ala Pro Phe Asp Glu Cys Tyr His Gln Ala Cys 405
410 415 Asp Asp Leu Asp Asn Ile Asn Trp Glu Ala Leu Thr Val Asn Ala
Lys 420 425 430 Ala Ala Ala Arg Ala Ala Ala Arg Leu Ala Asn Ser Leu
Glu Gly Val 435 440 445 Pro Pro Arg Lys Lys Thr Ser Leu Asn Leu His
Thr Arg Arg Gly Val 450 455 460 Val Gln Asn Phe Arg Lys Trp Ala Ser
Leu Ala Glu Glu Ala Ser His 465 470 475 480 Gly His Thr Cys Ser His
Thr Gly Lys Arg Val Val Val 485 490 72479DNAMyceliophthora
thermophila 7atgtgttggc tgtgggagcg atcagtggca atattactgg cggccggcgt
gatcgccaac 60ccgctccgcc cgcgccggat cccctggccg gagccggttc cggcatcttc
catcgggccc 120attgactggt cttcaatacc gccttctccc tacaaacacg
ccttgcggca gaccaacacc 180accacgacca gcagcagtag cagcagcagc
agcagcaaat atgacaatca agtctactcg 240gtacaggtct cgggatcttc
ctcctccccg ccagcatccg tcgactggcg caaccgcgac 300ggccagaact
acatcacgac accgcaggac cagggcgcct gtaacagctg ctgggcgttc
360gccgtggcgg cgctgatcga gtccatgatg cgcatcgagc acggggtctg
gggcaagcgc 420agcgaggccg acgtgcacga cggggtgggc gcggcgtgcg
agagcgtggg caacgccgag 480gacacgctgg cctgggtggc cgggcagggg
cccgaattcg tcgccgaccc gacccggccc 540gccccgggca tcgccgactg
ggcctgcgac ccctacgagg cgacggcgca cgcctacgag 600cactgcgacg
accgctccgg gcgcacgacg cacattccct actaccaggc cctcggcctg
660gtcgaggacc agaagcggtg gctggacgag tacgggccca tcatcgccac
ctttgtcctc 720tacgacgact ttggctcgtg gaagccgacc gcggccggcg
gaagcggcgg tgacgtgtac 780cggtgggacg gcgtttccgg ctcggacggc
aaccacctcg ccatcgtgat cggctacgac 840gacgagaagc aggcctggct
tatgaagaac tcatggggat ccggatgggg ggacgaggga 900tttgtctact
ttgcgtaagt caggggttcc actgcttttt tttttttccc ctccaaaatc
960gtttgcctct cggtaatttt atccgcatcc agggaactga caacagatac
aggtacggcg 1020aggccaacat cgacaactgg accaagtatg ggctcgtcaa
tgtcaacccg gacccgtgga 1080cacgcaggaa gcaccagagc ggaagcatga
tgcaatccgg caacggcgag acgcaccgaa 1140actttgagct gctcgtcagc
gaggccgggg gttccggctt cacgcacgtc tcccgcgatg 1200ggaacagtac
ccaatggagc aaggtgctgg aggtctcggg cagcggcagc ggcagcggcc
1260tcgtgggcca gcctgccatt ctcggcacct ccttcaaccg ggacttccac
gcggtgagcc 1320tggatgagaa ccaggtggtc caacagtggg catacagaca
gtcggagatg cgctggtccc 1380gggtctcggc catcgagggc actaagatcg
acggctttcc cggtctcgcc cagagcgacg 1440gctcaactct ggtcatggtg
gtcaagcacg ccgacggcac cctgaacgag gtaagcatat 1500cttgccggaa
gtcataatta acgaaggaag atcttccgta aaagaaaagg aaaagatgaa
1560aaaaaaaagg tacacgtgct aacggcggat cgcacaagtg gcaacaagca
cccaacagca 1620caacctggac cctggccaac tcacccatcg caagcggcat
cgcccagagc gggccggcgc 1680tcgtgcagtc caacgccgga ctcaacctct
acgaccggca gcagggcgcc tcgcggggca 1740acatctacac cgtcgcggtc
cgcgaggacg gcaagctgca gctcttctgg cgccccggcg 1800cggacgcggc
cgggtggtcg gccggggagg tgttcggcgg ctccggcgtc gtggaccccg
1860gctcgccgcc cgtcatgatt caggactact cggggacggc caacgagacg
agcgtcggcc 1920ggttccagct ggccgtcgcc gtcgggggga gcgtccaaca
ctgggagcgg gccaacgacg 1980acctcgaggc cgggcaggcc ccgcccgcgg
gggcagaagg ggggtccccg gcgggcaggt 2040gggaactggt cgagacggcg
ggcaccgggg tgaagcgcgt ctgggcgctg ctccagggga 2100gctttggtgg
gaggctgcac atgatcacgg agggcacgga cggccggctg tcgtactggg
2160agcgcgatga gaagtgggtt gaggtcgaga agctgccggc gttgagcgac
gccgcttgga 2220cgagatcggg cccggtgagt ggtggttgag ggtagtccca
agtacctgat tataattata 2280tgaaagagat gtcccccgaa taattatatg
agtgaaccaa cgaccatgaa gacatgcggc 2340tttatcagca taccgacgcg
acttgtcctg gttgcatctg ctacgacccc tgattaatta 2400caacaccgca
cagcggcaga gacggggcca gaagctgcac atagaaagaa ggctggacaa
2460cttccccgag acgctataa 247982040DNAMyceliophthora thermophila
8atgtgttggc tgtgggagcg atcagtggca atattactgg cggccggcgt gatcgccaac
60ccgctccgcc cgcgccggat cccctggccg gagccggttc cggcatcttc catcgggccc
120attgactggt cttcaatacc gccttctccc tacaaacacg ccttgcggca
gaccaacacc 180accacgacca gcagcagtag cagcagcagc agcagcaaat
atgacaatca agtctactcg 240gtacaggtct cgggatcttc ctcctccccg
ccagcatccg tcgactggcg caaccgcgac 300ggccagaact acatcacgac
accgcaggac cagggcgcct gtaacagctg ctgggcgttc 360gccgtggcgg
cgctgatcga gtccatgatg cgcatcgagc acggggtctg gggcaagcgc
420agcgaggccg acgtgcacga cggggtgggc gcggcgtgcg agagcgtggg
caacgccgag 480gacacgctgg cctgggtggc cgggcagggg cccgaattcg
tcgccgaccc gacccggccc 540gccccgggca tcgccgactg ggcctgcgac
ccctacgagg cgacggcgca cgcctacgag 600cactgcgacg accgctccgg
gcgcacgacg cacattccct actaccaggc cctcggcctg 660gtcgaggacc
agaagcggtg gctggacgag tacgggccca tcatcgccac ctttgtcctc
720tacgacgact ttggctcgtg gaagccgacc gcggccggcg gaagcggcgg
tgacgtgtac 780cggtgggacg gcgtttccgg ctcggacggc aaccacctcg
ccatcgtgat cggctacgac 840gacgagaagc aggcctggct tatgaagaac
tcatggggat ccggatgggg ggacgaggga 900tttgtctact ttgcgtacgg
cgaggccaac atcgacaact ggaccaagta tgggctcgtc 960aatgtcaacc
cggacccgtg gacacgcagg aagcaccaga gcggaagcat gatgcaatcc
1020ggcaacggcg agacgcaccg aaactttgag ctgctcgtca gcgaggccgg
gggttccggc 1080ttcacgcacg tctcccgcga tgggaacagt acccaatgga
gcaaggtgct ggaggtctcg 1140ggcagcggca gcggcagcgg cctcgtgggc
cagcctgcca ttctcggcac ctccttcaac 1200cgggacttcc acgcggtgag
cctggatgag aaccaggtgg tccaacagtg gcatacagac 1260agtcggagat
gcgctggtcc cgggtctcgg ccatcgaggg cactaagatc gacggctttc
1320ccggtctcgc ccagagcgac ggctcaactc tggtcatggt ggtcaagcac
gccgacggca 1380ccctgaacga gtggcaacaa gcacccaaca gcacaacctg
gaccctggcc aactcaccca 1440tcgcaagcgg catcgcccag agcgggccgg
cgctcgtgca gtccaacgcg gactcaacct 1500ctacgaccgg cagcagggcg
cctcgcgggg caacatctac accgtcgcgg tccgcgagga 1560cggcaagctg
cagctcttct ggcgccccgg cgcggacgcg gccgggtggt cggccgggga
1620ggtgttcggc ggctccggcg tcgtggaccc cggctcgccg cccgtcatga
ttcaggacta 1680ctcggggacg gccaacgaga cgagcgtcgg ccggttccag
ctggccgtcg ccgtcggggg 1740gagcgtccaa cactgggagc gggccaacga
cgacctcgag gccgggcagg ccccgcccgc 1800gggggcagaa ggggggtccc
ggcgggcagg tgggaactgg tcgagacggc gggcaccggg 1860gtgaagcgcg
tctgggcgct gctccagggg agctttggtg ggaggctgca catgatcacg
1920gagggcacgg acggccggct gtcgtactgg gagcgcgatg agaagtgggt
tgaggtcgag 1980aagctgccgg cgttgagcga cgccgcttgg acgagatcgg
gcccggtgag tggtggttga 20409680PRTMyceliophthora thermophila 9Met
Cys Trp Leu Trp Glu Arg Ser Val Ala Ile Leu Leu Ala Ala Gly 1 5 10
15 Val Ile Ala Asn Pro Leu Arg Pro Arg Arg Ile Pro Trp Pro Glu Pro
20 25 30 Val Pro Ala Ser Ser Ile Gly Pro Ile Asp Trp Ser Ser Ile
Pro Pro 35 40 45 Ser Pro Tyr Lys His Ala Leu Arg Gln Thr Asn Thr
Thr Thr Thr Ser 50 55 60 Ser Ser Ser Ser Ser Ser Ser Ser Lys Tyr
Asp Asn Gln Val Tyr Ser 65 70 75 80 Val Gln Val Ser Gly Ser Ser Ser
Ser Pro Pro Ala Ser Val Asp Trp 85 90 95 Arg Asn Arg Asp Gly Gln
Asn Tyr Ile Thr Thr Pro Gln Asp Gln Gly 100 105 110 Ala Cys Asn Ser
Cys Trp Ala Phe Ala Val Ala Ala Leu Ile Glu Ser 115 120 125 Met Met
Arg Ile Glu His Gly Val Trp Gly Lys Arg Ser Glu Ala Asp 130 135 140
Val His Asp Gly Val Gly Ala Ala Cys Glu Ser Val Gly Asn Ala Glu 145
150 155 160 Asp Thr Leu Ala Trp Val Ala Gly Gln Gly Pro Glu Phe Val
Ala Asp 165 170 175 Pro Thr Arg Pro Ala Pro Gly Ile Ala Asp Trp Ala
Cys Asp Pro Tyr 180 185 190 Glu Ala Thr Ala His Ala Tyr Glu His Cys
Asp Asp Arg Ser Gly Arg 195 200 205 Thr Thr His Ile Pro Tyr Tyr Gln
Ala Leu Gly Leu Val Glu Asp Gln 210 215 220 Lys Arg Trp Leu Asp Glu
Tyr Gly Pro Ile Ile Ala Thr Phe Val Leu 225 230 235 240 Tyr Asp Asp
Phe Gly Ser Trp Lys Pro Thr Ala Ala Gly Gly Ser Gly 245 250 255 Gly
Asp Val Tyr Arg Trp Asp Gly Val Ser Gly Ser Asp Gly Asn His 260 265
270 Leu Ala Ile Val Ile Gly Tyr Asp Asp Glu Lys Gln Ala Trp Leu Met
275 280 285 Lys Asn Ser Trp Gly Ser Gly Trp Gly Asp Glu Gly Phe Val
Tyr Phe 290 295 300 Ala Tyr Gly Glu Ala Asn Ile Asp Asn Trp Thr Lys
Tyr Gly Leu Val 305 310 315 320 Asn Val Asn Pro Asp Pro Trp Thr Arg
Arg Lys His Gln Ser Gly Ser 325 330 335 Met Met Gln Ser Gly Asn Gly
Glu Thr His Arg Asn Phe Glu Leu Leu 340 345 350 Val Ser Glu Ala Gly
Gly Ser Gly Phe Thr His Val Ser Arg Asp Gly 355 360 365 Asn Ser Thr
Gln Trp Ser Lys Val Leu Glu Val Ser Gly Ser Gly Ser 370 375 380 Gly
Ser Gly Leu Val Gly Gln Pro Ala Ile Leu Gly Thr Ser Phe Asn 385 390
395 400 Arg Asp Phe His Ala Val Ser Leu Asp Glu Asn Gln Val Val Gln
Gln 405 410 415 Trp Ala Tyr Arg Gln Ser Glu Met Arg Trp Ser Arg Val
Ser Ala Ile 420 425 430 Glu Gly Thr Lys Ile Asp Gly Phe Pro Gly Leu
Ala Gln Ser Asp Gly 435 440 445 Ser Thr Leu Val Met Val Val Lys His
Ala Asp Gly Thr Leu Asn Glu 450 455 460 Trp Gln Gln Ala Pro Asn Ser
Thr Thr Trp Thr Leu Ala Asn Ser Pro 465 470 475 480 Ile Ala Ser Gly
Ile Ala Gln Ser Gly Pro Ala Leu Val Gln Ser Asn 485 490 495 Ala Gly
Leu Asn Leu Tyr Asp Arg Gln Gln Gly Ala Ser Arg Gly Asn 500 505 510
Ile Tyr Thr Val Ala Val Arg Glu Asp Gly Lys Leu Gln Leu Phe Trp 515
520 525 Arg Pro Gly Ala Asp Ala Ala Gly Trp Ser Ala Gly Glu Val Phe
Gly 530 535 540 Gly Ser Gly Val Val Asp Pro Gly Ser Pro Pro Val Met
Ile Gln Asp 545 550 555 560 Tyr Ser Gly Thr Ala Asn Glu Thr Ser Val
Gly Arg Phe Gln Leu Ala 565 570 575 Val Ala Val Gly Gly Ser Val Gln
His Trp Glu Arg Ala Asn Asp Asp 580 585 590 Leu Glu Ala Gly Gln Ala
Pro Pro Ala Gly Ala Glu Gly Gly Ser Pro 595 600 605 Ala Gly Arg Trp
Glu Leu Val Glu Thr Ala Gly Thr Gly Val Lys Arg 610 615 620 Val Trp
Ala Leu Leu Gln Gly Ser Phe Gly Gly Arg Leu His Met Ile 625 630 635
640 Thr Glu Gly Thr Asp Gly Arg Leu Ser Tyr Trp Glu Arg Asp Glu Lys
645 650 655 Trp Val Glu Val Glu Lys Leu Pro Ala Leu Ser Asp Ala Ala
Trp Thr 660 665 670 Arg Ser Gly Pro Val Ser Gly Gly 675 680
102476DNAMyceliophthora thermophila 10atgtgttggc tgtgggagcg
atcagtggca atattactgg cggccggcgt gatcgccaac 60ccgctccgcc cgcgccggat
cccctggccg gagccggttc cggcatcttc catcgggccc 120attgactggt
cttcaatacc gccttctccc tacaaacacg ccttgcggca gaccaacacc
180accacgacca gcagcagtag cagcagcagc agcagcaaat atgacaatca
agtctactcg 240gtacaggtct cgggatcttc ctcctccccg ccagcatccg
tcgactggcg caaccgcgac 300ggccagaact acatcacgac accgcaggac
cagggcgcct gtaacagctg ctgggcgttc 360gccgtggcgg cgctgatcga
gtccatgatg cgcatcgagc acggggtctg gggcaagcgc 420agcgaggccg
acgtgcacga cggggtgggc gcggcgtgcg agagcgtggg caacgccgag
480gacacgctgg cctgggtggc cgggcagggg cccgaattcg tcgccgaccc
gacccggccc 540gccccgggca tcgccgactg ggcctgcgac ccctacgagg
cgacggcgca cgcctacgag 600cactgcgacg accgctccgg gcgcacgacg
cacattccct actaccaggc cctcggcctg 660gtcgaggacc agaagcggtg
gctggacgag tacgggccca tcatcgccac ctttgtcctc 720tacgacgact
ttggctcgtg gaagccgacc gcggccggcg gaagcggcgg tgacgtgtac
780cggtgggacg gcgtttccgg ctcggacggc aaccacctcg ccatcgtgat
cggctacgac 840gacgagaagc aggcctggct tatgaagaac tcatggggat
ccggatgggg ggacgaggga 900tttgtctact ttgcgtaagt caggggttcc
actgcttttt tttttttccc ctccaaaatc 960gtttgcctct cggtaatttt
atccgcatcc agggaactga caacagatac aggtacggcg 1020aggccaacat
cgacaactgg accaagtatg ggctcgtcaa tgtcaacccg gacccgtgga
1080cacgcaggaa gcaccagagc ggaagcatga tgcaatccgg caacggcgag
acgcaccgaa 1140actttgagct gctcgtcagc gaggccgggg gttccggctt
cacgcacgtc tcccgcgatg 1200ggaacagtac ccaatggagc aaggtgctgg
aggtctcggg cagcggcagc ggcagcggcc 1260tcgtgggcca gcctgccatt
ctcggcacct ccttcaaccg ggacttccac gcggtgagcc 1320tggatgagaa
ccaggtggtc caacagtggg catacagaca gtcggagatg cgctggtccc
1380gggtctcggc catcgagggc actaagatcg acggctttcc cggtctcgcc
cagagcgacg 1440gctcaactct ggtcatggtg gtcaagcacg ccgacggcac
cctgaacgag gtaagcatat 1500cttgccggaa gtcataatta acgaaggaag
atcttccgta aaagaaaagg aaaagatgaa 1560aaaaaaaagg tacacgtgct
aacggcggat cgcacaagtg gcaacaagca cccaacagca 1620caacctggac
cctggccaac tcacccatcg caagcggcat cgcccagagc gggccggcgc
1680tcgtgcagtc caacgccgga ctcaacctct acgaccggca gcagggcgcc
tcgcggggca 1740acatctacac cgtcgcggtc cgcgaggacg gcaagctgca
gctcttctgg cgccccggcg 1800cggacgcggc cgggtggtcg gccggggagg
tgttcggcgg ctccggcgtc gtggaccccg 1860gctcgccgcc cgtcatgatt
caggactact cggggacggc caacgagacg agcgtcggcc 1920ggttccagct
ggccgtcgcc gtcgggggga gcgtccaaca ctgggagcgg gccaacgacg
1980acctcgaggc cgggcaggcc ccgcccgcgg gggcagaagg ggggtccccg
gcgggcaggt 2040gggaactggt cgagacggcg ggcaccgggg tgaagcgcgt
ctgggcgctg ctccagggga 2100gctttggtgg gaggctgcac atgatcacgg
agggcacgga cggccggctg tcgtactggg 2160agcgcgatga gaagtgggtt
gaggtcgaga agctgccggc gttgagcgac gccgcttgga 2220cgagatcggg
cccggtgagt ggtggttgag ggtagtccca agtacctgat tataattata
2280tgaaagagat gtcccccgaa taattatatg agtgaaccaa cgaccatgaa
gacatgcggc 2340tttatcagca taccgacgcg acttgtcctg gttgcatctg
ctacgacccc tgattaatta 2400caacaccgca cagcggcaga gacggggcca
gaagctgcac atagaaagaa ggctggacaa 2460cttccccgag acgcta
2476112042DNAMyceliophthora thermophila 11atgtgttggc tgtgggagcg
atcagtggca atattactgg cggccggcgt gatcgccaac 60ccgctccgcc cgcgccggat
cccctggccg gagccggttc cggcatcttc catcgggccc 120attgactggt
cttcaatacc gccttctccc tacaaacacg ccttgcggca gaccaacacc
180accacgacca gcagcagtag cagcagcagc agcagcaaat atgacaatca
agtctactcg 240gtacaggtct cgggatcttc ctcctccccg ccagcatccg
tcgactggcg caaccgcgac 300ggccagaact acatcacgac accgcaggac
cagggcgcct gtaacagctg ctgggcgttc 360gccgtggcgg cgctgatcga
gtccatgatg cgcatcgagc acggggtctg gggcaagcgc 420agcgaggccg
acgtgcacga cggggtgggc gcggcgtgcg agagcgtggg caacgccgag
480gacacgctgg cctgggtggc cgggcagggg cccgaattcg tcgccgaccc
gacccggccc 540gccccgggca tcgccgactg ggcctgcgac ccctacgagg
cgacggcgca cgcctacgag 600cactgcgacg accgctccgg gcgcacgacg
cacattccct actaccaggc cctcggcctg 660gtcgaggacc agaagcggtg
gctggacgag tacgggccca tcatcgccac ctttgtcctc 720tacgacgact
ttggctcgtg gaagccgacc gcggccggcg gaagcggcgg tgacgtgtac
780cggtgggacg gcgtttccgg ctcggacggc aaccacctcg ccatcgtgat
cggctacgac 840gacgagaagc aggcctggct tatgaagaac tcatggggat
ccggatgggg ggacgaggga 900tttgtctact ttgcgtacgg cgaggccaac
atcgacaact ggaccaagta tgggctcgtc 960aatgtcaacc cggacccgtg
gacacgcagg aagcaccaga gcggaagcat gatgcaatcc 1020ggcaacggcg
agacgcaccg aaactttgag ctgctcgtca gcgaggccgg gggttccggc
1080ttcacgcacg tctcccgcga tgggaacagt acccaatgga gcaaggtgct
ggaggtctcg 1140ggcagcggca gcggcagcgg cctcgtgggc cagcctgcca
ttctcggcac ctccttcaac 1200cgggacttcc acgcggtgag cctggatgag
aaccaggtgg tccaacagtg ggcatacaga 1260cagtcggaga tgcgctggtc
ccgggtctcg gccatcgagg gcactaagat cgacggcttt 1320cccggtctcg
cccagagcga cggctcaact ctggtcatgg tggtcaagca cgccgacggc
1380accctgaacg agtggcaaca agcacccaac agcacaacct ggaccctggc
caactcaccc 1440atcgcaagcg gcatcgccca gagcgggccg gcgctcgtgc
agtccaacgc cggactcaac 1500ctctacgacc ggcagcaggg cgcctcgcgg
ggcaacatct acaccgtcgc ggtccgcgag 1560gacggcaagc tgcagctctt
ctggcgcccc ggcgcggacg cggccgggtg gtcggccggg 1620gaggtgttcg
gcggctccgg cgtcgtggac cccggctcgc cgcccgtcat gattcaggac
1680tactcgggga cggccaacga gacgagcgtc ggccggttcc agctggccgt
cgccgtcggg 1740gggagcgtcc aacactggga gcgggccaac gacgcctcga
ggccgggcag gccccgcccg 1800cgggggcaga aggggggtcc ccggcgggca
ggtgggaact ggtcgagacg gcgggcaccg 1860gggtgaagcg cgtctgggcg
ctgctccagg ggagctttgg tgggaggctg cacatgatca 1920cggagggcac
ggacggccgg ctgtcgtact gggagcgcga tgagaagtgg gttgaggtcg
1980agaagctgcc ggcgttgagc gacgccgctt ggacgagatc gggcccggtg
agtggtggtt 2040ga 204212697PRTMyceliophthora thermophila 12Met Cys
Trp Leu Trp Glu Arg Ser Val Ala Ile Leu Leu Ala Ala Gly 1 5 10 15
Val Ile Ala Asn Pro Leu Arg Pro Arg Arg Ile Pro Trp Pro Glu Pro 20
25 30 Val Pro Ala Ser Ser Ile Gly Pro Ile Asp Trp Ser Ser Ile Pro
Pro 35 40 45 Ser Pro Tyr Lys His Ala Leu Arg Gln Thr Asn Thr Thr
Thr Thr Ser 50 55 60 Ser Ser Ser Ser Ser Ser Ser Ser Lys Tyr Asp
Asn Gln Val Tyr Ser 65 70 75 80 Val Gln Val Ser Gly Ser Ser Ser Ser
Pro Pro Ala Ser Val Asp Trp 85 90 95 Arg Asn Arg Asp Gly Gln Asn
Tyr Ile Thr Thr Pro Gln Asp Gln Gly 100 105 110 Ala Cys Asn Ser Cys
Trp Ala Phe Ala Val Ala Ala Leu Ile Glu Ser 115 120 125 Met Met Arg
Ile Glu His Gly Val Trp Gly Lys Arg Ser Glu Ala Asp 130 135 140 Val
His Asp Gly Val Gly Ala Ala Cys Glu Ser Val Gly Asn Ala Glu 145 150
155 160 Asp Thr Leu Ala Trp Val Ala Gly Gln Gly Pro Glu Phe Val Ala
Asp 165 170 175 Pro Thr Arg Pro Ala Pro Gly Ile Ala Asp Trp Ala Cys
Asp Pro Tyr 180 185 190 Glu Ala Thr Ala His Ala Tyr Glu His Cys Asp
Asp Arg Ser Gly Arg 195 200 205 Thr Thr His Ile Pro Tyr Tyr Gln Ala
Leu Gly Leu Val Glu Asp Gln 210 215 220 Lys Arg Trp Leu Asp Glu Tyr
Gly Pro Ile Ile Ala Thr Phe Val Leu 225 230 235 240 Tyr Asp Asp Phe
Gly Ser Trp Lys Pro Thr Ala Ala Gly Gly Ser Gly 245 250 255 Gly Asp
Val Tyr Arg Trp Asp Gly Val Ser Gly Ser Asp Gly Asn His 260 265 270
Leu Ala Ile Val Ile Gly Tyr Asp Asp Glu Lys Gln Ala Trp Leu Met 275
280 285 Lys Asn Ser Trp Gly Ser Gly Trp Gly Asp Glu Gly Phe Val Tyr
Phe 290 295 300 Ala Tyr Gly Glu Ala Asn Ile Asp Asn Trp Thr Lys Tyr
Gly Leu Val 305 310 315 320 Asn Val Asn Pro Asp Pro Trp Thr Arg Arg
Lys His Gln Ser Gly Ser 325 330 335 Met Met Gln Ser Gly Asn Gly Glu
Thr His Arg Asn Phe Glu Leu Leu 340 345 350 Val Ser Glu Ala Gly Gly
Ser Gly Phe Thr His Val Ser Arg Asp Gly 355 360 365 Asn Ser Thr Gln
Trp Ser Lys Val Leu Glu Val Ser Gly Ser Gly Ser 370 375 380 Gly Ser
Gly Leu Val Gly Gln Pro Ala Ile Leu Gly Thr Ser Phe Asn 385 390 395
400 Arg Asp Phe His Ala Val Ser Leu Asp Glu Asn Gln Val Val Gln Gln
405 410 415 Trp Ala Tyr Arg Gln Ser Glu Met Arg Trp Ser Arg Val Ser
Ala Ile 420 425 430 Glu Gly Thr Lys Ile Asp Gly Phe Pro Gly Leu Ala
Gln Ser Asp Gly 435 440 445 Ser Thr Leu Val Met Val Val Lys His Ala
Asp Gly Thr Leu Asn Glu 450 455 460 Trp Gln Gln Ala Pro Asn Ser Thr
Thr Trp Thr Leu Ala Asn Ser Pro 465 470 475 480 Ile Ala Ser Gly Ile
Ala Gln Ser Gly Pro Ala Leu Val Gln Ser Asn 485 490 495 Ala Gly Leu
Asn Leu Tyr Asp Arg Gln Gln Gly Ala Ser Arg Gly Asn 500 505 510 Ile
Tyr Thr Val Ala Val Arg Glu Asp Gly Lys Leu Gln Leu Phe Trp 515 520
525 Arg Pro Gly Ala Asp Ala Ala Gly Trp Ser Ala Gly Glu Val Phe Gly
530 535 540 Gly Ser Gly Val Val Asp Pro Gly Ser Pro Pro Val Met Ile
Gln Asp 545 550 555 560 Tyr Ser Gly Thr Ala Asn Glu Thr Ser Val Gly
Arg Phe Gln Leu Ala 565 570 575 Val Ala Val Gly Gly Ser Val Gln His
Trp Glu Arg Ala Asn Asp Asp 580 585 590 Leu Glu Ala Gly Gln Ala Pro
Pro Ala Gly Ala Glu Gly Gly Ser Pro 595 600 605 Ala Gly Arg Trp Glu
Leu Val Glu Thr Ala Gly Thr Gly Val Lys Arg 610 615 620 Val Trp Ala
Leu Leu Gln Gly Ser Phe Gly Gly Arg Leu His Met Ile 625 630 635 640
Thr Glu Gly Thr Asp Gly Arg Leu Ser Tyr Trp Glu Arg Asp Glu Lys
645
650 655 Trp Val Glu Val Glu Lys Leu Pro Ala Leu Ser Asp Ala Ala Trp
Thr 660 665 670 Arg Ser Gly Pro Arg Gln Arg Arg Gly Gln Lys Leu His
Ile Glu Arg 675 680 685 Arg Leu Asp Asn Phe Pro Glu Thr Leu 690 695
131029DNAMyceliophthora thermophila 13atgtccaagg cctctgctct
cctcgctggc ctgacgggcg cggccctcgt cgctgcacat 60ggccacgtca gccacatcgt
cgtcaacggc gtctactaca ggaactacga ccccacgaca 120gactggtacc
agcccaaccc gccaacagtc atcggctgga cggcagccga tcaggataat
180ggcttcgttg aacccaacag ctttggcacg ccagatatca tctgccacaa
gagcgccacc 240cccggcggcg gccacgctac cgttgctgcc ggagacaaga
tcaacatcgt ctggaccccc 300gagtggcccg aatcccacat cggccccgtc
attgactacc tagccgcctg caacggtgac 360tgcgagaccg tcgacaagtc
gtcgctgcgc tggttcaaga ttgacggcgc cggctacgac 420aaggccgccg
gccgctgggc cgccgacgct ctgcgcgcca acggcaacag ctggctcgtc
480cagatcccgt cggatctcaa ggccggcaac tacgtcctcc gccacgagat
catcgccctc 540cacggtgctc agagccccaa cggcgcccag gcctacccgc
agtgcatcaa cctccgcgtc 600accggcggcg gcagcaacct gcccagcggc
gtcgccggca cctcgctgta caaggcgacc 660gacccgggca tcctcttcaa
cccctacgtc tcctccccgg attacaccgt ccccggcccg 720gccctcattg
ccggcgccgc cagctcgatc gcccagagca cgtcggtcgc cactgccacc
780ggcacggcca ccgttcccgg cggcggcggc gccaacccta ccgccaccac
caccgccgcc 840acctccgccg ccccgagcac caccctgagg acgaccacta
cctcggccgc gcagactacc 900gccccgccct ccggcgatgt gcagaccaag
tacggccagt gtggtggcaa cggatggacg 960ggcccgacgg tgtgcgcccc
cggctcgagc tgctccgtcc tcaacgagtg gtactcccag 1020tgtttgtaa
102914342PRTMyceliophthora thermophila 14Met Ser Lys Ala Ser Ala
Leu Leu Ala Gly Leu Thr Gly Ala Ala Leu 1 5 10 15 Val Ala Ala His
Gly His Val Ser His Ile Val Val Asn Gly Val Tyr 20 25 30 Tyr Arg
Asn Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro Asn Pro Pro 35 40 45
Thr Val Ile Gly Trp Thr Ala Ala Asp Gln Asp Asn Gly Phe Val Glu 50
55 60 Pro Asn Ser Phe Gly Thr Pro Asp Ile Ile Cys His Lys Ser Ala
Thr 65 70 75 80 Pro Gly Gly Gly His Ala Thr Val Ala Ala Gly Asp Lys
Ile Asn Ile 85 90 95 Val Trp Thr Pro Glu Trp Pro Glu Ser His Ile
Gly Pro Val Ile Asp 100 105 110 Tyr Leu Ala Ala Cys Asn Gly Asp Cys
Glu Thr Val Asp Lys Ser Ser 115 120 125 Leu Arg Trp Phe Lys Ile Asp
Gly Ala Gly Tyr Asp Lys Ala Ala Gly 130 135 140 Arg Trp Ala Ala Asp
Ala Leu Arg Ala Asn Gly Asn Ser Trp Leu Val 145 150 155 160 Gln Ile
Pro Ser Asp Leu Lys Ala Gly Asn Tyr Val Leu Arg His Glu 165 170 175
Ile Ile Ala Leu His Gly Ala Gln Ser Pro Asn Gly Ala Gln Ala Tyr 180
185 190 Pro Gln Cys Ile Asn Leu Arg Val Thr Gly Gly Gly Ser Asn Leu
Pro 195 200 205 Ser Gly Val Ala Gly Thr Ser Leu Tyr Lys Ala Thr Asp
Pro Gly Ile 210 215 220 Leu Phe Asn Pro Tyr Val Ser Ser Pro Asp Tyr
Thr Val Pro Gly Pro 225 230 235 240 Ala Leu Ile Ala Gly Ala Ala Ser
Ser Ile Ala Gln Ser Thr Ser Val 245 250 255 Ala Thr Ala Thr Gly Thr
Ala Thr Val Pro Gly Gly Gly Gly Ala Asn 260 265 270 Pro Thr Ala Thr
Thr Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr Thr 275 280 285 Leu Arg
Thr Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala Pro Pro Ser 290 295 300
Gly Asp Val Gln Thr Lys Tyr Gly Gln Cys Gly Gly Asn Gly Trp Thr 305
310 315 320 Gly Pro Thr Val Cys Ala Pro Gly Ser Ser Cys Ser Val Leu
Asn Glu 325 330 335 Trp Tyr Ser Gln Cys Leu 340
15323PRTMyceliophthora thermophila 15His Gly His Val Ser His Ile
Val Val Asn Gly Val Tyr Tyr Arg Asn 1 5 10 15 Tyr Asp Pro Thr Thr
Asp Trp Tyr Gln Pro Asn Pro Pro Thr Val Ile 20 25 30 Gly Trp Thr
Ala Ala Asp Gln Asp Asn Gly Phe Val Glu Pro Asn Ser 35 40 45 Phe
Gly Thr Pro Asp Ile Ile Cys His Lys Ser Ala Thr Pro Gly Gly 50 55
60 Gly His Ala Thr Val Ala Ala Gly Asp Lys Ile Asn Ile Val Trp Thr
65 70 75 80 Pro Glu Trp Pro Glu Ser His Ile Gly Pro Val Ile Asp Tyr
Leu Ala 85 90 95 Ala Cys Asn Gly Asp Cys Glu Thr Val Asp Lys Ser
Ser Leu Arg Trp 100 105 110 Phe Lys Ile Asp Gly Ala Gly Tyr Asp Lys
Ala Ala Gly Arg Trp Ala 115 120 125 Ala Asp Ala Leu Arg Ala Asn Gly
Asn Ser Trp Leu Val Gln Ile Pro 130 135 140 Ser Asp Leu Lys Ala Gly
Asn Tyr Val Leu Arg His Glu Ile Ile Ala 145 150 155 160 Leu His Gly
Ala Gln Ser Pro Asn Gly Ala Gln Ala Tyr Pro Gln Cys 165 170 175 Ile
Asn Leu Arg Val Thr Gly Gly Gly Ser Asn Leu Pro Ser Gly Val 180 185
190 Ala Gly Thr Ser Leu Tyr Lys Ala Thr Asp Pro Gly Ile Leu Phe Asn
195 200 205 Pro Tyr Val Ser Ser Pro Asp Tyr Thr Val Pro Gly Pro Ala
Leu Ile 210 215 220 Ala Gly Ala Ala Ser Ser Ile Ala Gln Ser Thr Ser
Val Ala Thr Ala 225 230 235 240 Thr Gly Thr Ala Thr Val Pro Gly Gly
Gly Gly Ala Asn Pro Thr Ala 245 250 255 Thr Thr Thr Ala Ala Thr Ser
Ala Ala Pro Ser Thr Thr Leu Arg Thr 260 265 270 Thr Thr Thr Ser Ala
Ala Gln Thr Thr Ala Pro Pro Ser Gly Asp Val 275 280 285 Gln Thr Lys
Tyr Gly Gln Cys Gly Gly Asn Gly Trp Thr Gly Pro Thr 290 295 300 Val
Cys Ala Pro Gly Ser Ser Cys Ser Val Leu Asn Glu Trp Tyr Ser 305 310
315 320 Gln Cys Leu 161029DNAArtificial SequenceSynthetic
polynucleotide of M. thermophila GH61a "Variant 1" 16atgtccaagg
cctctgctct cctcgctggc ctgacgggcg cggccctcgt cgctgcacac 60ggccacgtca
gccacatcgt cgtcaacggc gtctactaca ggggctacga ccccacgaca
120gactggtacc agcccaaccc gccaacagtc atcggctgga cggcagccga
tcaggataat 180ggcttcgttg aacccaacag ctttggcacg ccagatatca
tctgccacaa gagcgccacc 240cccggcggcg gccacgctac cgttgctgcc
ggagacaaga tcaacatcgt ctggaccccc 300gagtggcccc actcccacat
cggccccgtc attgactacc tagccgcctg caacggtgac 360tgcgagaccg
tcgacaagtc gtcgctgcgc tggttcaaga ttgacggcgc cggctacgac
420aaggccgccg gccgctgggc cgccgacgct ctgcgcgcca acggcaacag
ctggctcgtc 480cagatcccgt cggatctcaa gcccggcaac tacgtcctcc
gccacgagat catcgccctc 540cacggtgctc agagccccaa cggcgcccag
gcgtacccgc agtgcatcaa cctccgcgtc 600accggcggcg gcagcaacct
gcccagcggc gtcgccggca cctcgctgta caaggcgacc 660gacccgggca
tcctcttcaa cccctacgtc tcctccccgg attacaccgt ccccggcccg
720gccctcattg ccggcgccgc cagctcgatc gcccagagca cgtcggtcgc
cactgccacc 780ggcacggcca ccgttcccgg cggcggcggc gccaacccta
ccgccaccac caccgccgcc 840acctccgccg ccccgagcac caccctgagg
acgaccacta cctcggccgc gcagactacc 900gccccgccct ccggcgatgt
gcagaccaag tacggccagt gtggtggcaa cggatggacg 960ggcccgacgg
tgtgcgcccc cggctcgagc tgctccgtcc tcaacgagtg gtactcccag
1020tgtttgtaa 102917342PRTArtificial SequenceSynthetic polypeptide
of M. thermophila GH61a "Variant 1" 17Met Ser Lys Ala Ser Ala Leu
Leu Ala Gly Leu Thr Gly Ala Ala Leu 1 5 10 15 Val Ala Ala His Gly
His Val Ser His Ile Val Val Asn Gly Val Tyr 20 25 30 Tyr Arg Gly
Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro Asn Pro Pro 35 40 45 Thr
Val Ile Gly Trp Thr Ala Ala Asp Gln Asp Asn Gly Phe Val Glu 50 55
60 Pro Asn Ser Phe Gly Thr Pro Asp Ile Ile Cys His Lys Ser Ala Thr
65 70 75 80 Pro Gly Gly Gly His Ala Thr Val Ala Ala Gly Asp Lys Ile
Asn Ile 85 90 95 Val Trp Thr Pro Glu Trp Pro His Ser His Ile Gly
Pro Val Ile Asp 100 105 110 Tyr Leu Ala Ala Cys Asn Gly Asp Cys Glu
Thr Val Asp Lys Ser Ser 115 120 125 Leu Arg Trp Phe Lys Ile Asp Gly
Ala Gly Tyr Asp Lys Ala Ala Gly 130 135 140 Arg Trp Ala Ala Asp Ala
Leu Arg Ala Asn Gly Asn Ser Trp Leu Val 145 150 155 160 Gln Ile Pro
Ser Asp Leu Lys Pro Gly Asn Tyr Val Leu Arg His Glu 165 170 175 Ile
Ile Ala Leu His Gly Ala Gln Ser Pro Asn Gly Ala Gln Ala Tyr 180 185
190 Pro Gln Cys Ile Asn Leu Arg Val Thr Gly Gly Gly Ser Asn Leu Pro
195 200 205 Ser Gly Val Ala Gly Thr Ser Leu Tyr Lys Ala Thr Asp Pro
Gly Ile 210 215 220 Leu Phe Asn Pro Tyr Val Ser Ser Pro Asp Tyr Thr
Val Pro Gly Pro 225 230 235 240 Ala Leu Ile Ala Gly Ala Ala Ser Ser
Ile Ala Gln Ser Thr Ser Val 245 250 255 Ala Thr Ala Thr Gly Thr Ala
Thr Val Pro Gly Gly Gly Gly Ala Asn 260 265 270 Pro Thr Ala Thr Thr
Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr Thr 275 280 285 Leu Arg Thr
Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala Pro Pro Ser 290 295 300 Gly
Asp Val Gln Thr Lys Tyr Gly Gln Cys Gly Gly Asn Gly Trp Thr 305 310
315 320 Gly Pro Thr Val Cys Ala Pro Gly Ser Ser Cys Ser Val Leu Asn
Glu 325 330 335 Trp Tyr Ser Gln Cys Leu 340 18323PRTArtificial
SequenceSynthetic polypeptide of M. thermophila GH61a "Variant 1"
18His Gly His Val Ser His Ile Val Val Asn Gly Val Tyr Tyr Arg Gly 1
5 10 15 Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro Asn Pro Pro Thr Val
Ile 20 25 30 Gly Trp Thr Ala Ala Asp Gln Asp Asn Gly Phe Val Glu
Pro Asn Ser 35 40 45 Phe Gly Thr Pro Asp Ile Ile Cys His Lys Ser
Ala Thr Pro Gly Gly 50 55 60 Gly His Ala Thr Val Ala Ala Gly Asp
Lys Ile Asn Ile Val Trp Thr 65 70 75 80 Pro Glu Trp Pro His Ser His
Ile Gly Pro Val Ile Asp Tyr Leu Ala 85 90 95 Ala Cys Asn Gly Asp
Cys Glu Thr Val Asp Lys Ser Ser Leu Arg Trp 100 105 110 Phe Lys Ile
Asp Gly Ala Gly Tyr Asp Lys Ala Ala Gly Arg Trp Ala 115 120 125 Ala
Asp Ala Leu Arg Ala Asn Gly Asn Ser Trp Leu Val Gln Ile Pro 130 135
140 Ser Asp Leu Lys Pro Gly Asn Tyr Val Leu Arg His Glu Ile Ile Ala
145 150 155 160 Leu His Gly Ala Gln Ser Pro Asn Gly Ala Gln Ala Tyr
Pro Gln Cys 165 170 175 Ile Asn Leu Arg Val Thr Gly Gly Gly Ser Asn
Leu Pro Ser Gly Val 180 185 190 Ala Gly Thr Ser Leu Tyr Lys Ala Thr
Asp Pro Gly Ile Leu Phe Asn 195 200 205 Pro Tyr Val Ser Ser Pro Asp
Tyr Thr Val Pro Gly Pro Ala Leu Ile 210 215 220 Ala Gly Ala Ala Ser
Ser Ile Ala Gln Ser Thr Ser Val Ala Thr Ala 225 230 235 240 Thr Gly
Thr Ala Thr Val Pro Gly Gly Gly Gly Ala Asn Pro Thr Ala 245 250 255
Thr Thr Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr Thr Leu Arg Thr 260
265 270 Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala Pro Pro Ser Gly Asp
Val 275 280 285 Gln Thr Lys Tyr Gly Gln Cys Gly Gly Asn Gly Trp Thr
Gly Pro Thr 290 295 300 Val Cys Ala Pro Gly Ser Ser Cys Ser Val Leu
Asn Glu Trp Tyr Ser 305 310 315 320 Gln Cys Leu 191035DNAArtificial
SequenceSynthetic polynucleotide of M. thermophila GH61a "Variant
5" 19acacaaatgt ccaaggcctc tgctctcctc gctggcctga cgggcgcggc
cctcgtcgct 60gcacacggcc acgtcagcca catcgtcgtc aacggcgtct actacaggaa
ctacgacccc 120acgacagact ggtaccagcc caacccgcca acagtcatcg
gctggacggc agccgatcag 180gataatggct tcgttgaacc caacagcttt
ggcacgccag atatcatctg ccacaagagc 240gccacccccg gcggcggcca
cgctaccgtt gctgccggag acaagatcaa catcgtatgg 300acccccgagt
ggccccactc ccacatcggc cccgtcattg actacctagc cgcctgcaac
360ggtgactgcg agaccgtcga caagtcgtcg ctgcgctggt tcaagattga
cggcgccggc 420tacgacaagg ccgccggccg ctgggccgcc gacgctctgc
gcgccaacgg caacagctgg 480ctcgtccaga tcccgtcgga tctcgcggcc
ggcaactacg tcctccgcca cgagatcatc 540gccctccacg gtgctcagag
ccccaacggc gcccaggcgt acccgcagtg catcaacctc 600cgcgtcaccg
gcggcggcag caacctgccc agcggcgtcg ccggcacctc gctgtacaag
660gcgaccgacc cgggcatcct cttcaacccc tacgtctcct ccccggatta
caccgtcccc 720ggcccggccc tcattgccgg cgccgccagc tcgatcgccc
agagcacgtc ggtcgccact 780gccaccggca cggccaccgt tcccggcggc
ggcggcgcca accctaccgc caccaccacc 840gccgccacct ccgccgcccc
gagcaccacc ctgaggacga ccactacctc ggccgcgcag 900actaccgccc
cgccctccgg cgatgtgcag accaagtacg gccagtgtgg tggcaacgga
960tggacgggcc cgacggtgtg cgcccccggc tcgagctgct ccgtcctcaa
cgagtggtac 1020tcccagtgtt tgtaa 103520342PRTArtificial
SequenceSynthetic polypeptide of M. thermophila GH61a "Variant 5"
20Met Ser Lys Ala Ser Ala Leu Leu Ala Gly Leu Thr Gly Ala Ala Leu 1
5 10 15 Val Ala Ala His Gly His Val Ser His Ile Val Val Asn Gly Val
Tyr 20 25 30 Tyr Arg Asn Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro
Asn Pro Pro 35 40 45 Thr Val Ile Gly Trp Thr Ala Ala Asp Gln Asp
Asn Gly Phe Val Glu 50 55 60 Pro Asn Ser Phe Gly Thr Pro Asp Ile
Ile Cys His Lys Ser Ala Thr 65 70 75 80 Pro Gly Gly Gly His Ala Thr
Val Ala Ala Gly Asp Lys Ile Asn Ile 85 90 95 Val Trp Thr Pro Glu
Trp Pro His Ser His Ile Gly Pro Val Ile Asp 100 105 110 Tyr Leu Ala
Ala Cys Asn Gly Asp Cys Glu Thr Val Asp Lys Ser Ser 115 120 125 Leu
Arg Trp Phe Lys Ile Asp Gly Ala Gly Tyr Asp Lys Ala Ala Gly 130 135
140 Arg Trp Ala Ala Asp Ala Leu Arg Ala Asn Gly Asn Ser Trp Leu Val
145 150 155 160 Gln Ile Pro Ser Asp Leu Ala Ala Gly Asn Tyr Val Leu
Arg His Glu 165 170 175 Ile Ile Ala Leu His Gly Ala Gln Ser Pro Asn
Gly Ala Gln Ala Tyr 180 185 190 Pro Gln Cys Ile Asn Leu Arg Val Thr
Gly Gly Gly Ser Asn Leu Pro 195 200 205 Ser Gly Val Ala Gly Thr Ser
Leu Tyr Lys Ala Thr Asp Pro Gly Ile 210 215 220 Leu Phe Asn Pro Tyr
Val Ser Ser Pro Asp Tyr Thr Val Pro Gly Pro 225 230 235 240 Ala Leu
Ile Ala Gly Ala Ala Ser Ser Ile Ala Gln Ser Thr Ser Val 245 250 255
Ala Thr Ala Thr Gly Thr Ala Thr Val Pro Gly Gly Gly Gly Ala Asn 260
265 270 Pro Thr Ala Thr Thr Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr
Thr 275 280 285 Leu Arg Thr Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala
Pro Pro Ser 290 295 300 Gly Asp Val Gln Thr Lys Tyr Gly Gln Cys Gly
Gly Asn Gly Trp Thr 305 310 315 320 Gly Pro Thr Val Cys Ala Pro Gly
Ser Ser Cys Ser Val Leu Asn Glu 325 330 335 Trp Tyr Ser Gln Cys Leu
340 21323PRTArtificial SequenceSynthetic polypeptide of M.
thermophila GH61a "Variant 5" 21His Gly His Val Ser His Ile Val Val
Asn Gly Val Tyr Tyr Arg Asn 1 5
10 15 Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro Asn Pro Pro Thr Val
Ile 20 25 30 Gly Trp Thr Ala Ala Asp Gln Asp Asn Gly Phe Val Glu
Pro Asn Ser 35 40 45 Phe Gly Thr Pro Asp Ile Ile Cys His Lys Ser
Ala Thr Pro Gly Gly 50 55 60 Gly His Ala Thr Val Ala Ala Gly Asp
Lys Ile Asn Ile Val Trp Thr 65 70 75 80 Pro Glu Trp Pro His Ser His
Ile Gly Pro Val Ile Asp Tyr Leu Ala 85 90 95 Ala Cys Asn Gly Asp
Cys Glu Thr Val Asp Lys Ser Ser Leu Arg Trp 100 105 110 Phe Lys Ile
Asp Gly Ala Gly Tyr Asp Lys Ala Ala Gly Arg Trp Ala 115 120 125 Ala
Asp Ala Leu Arg Ala Asn Gly Asn Ser Trp Leu Val Gln Ile Pro 130 135
140 Ser Asp Leu Ala Ala Gly Asn Tyr Val Leu Arg His Glu Ile Ile Ala
145 150 155 160 Leu His Gly Ala Gln Ser Pro Asn Gly Ala Gln Ala Tyr
Pro Gln Cys 165 170 175 Ile Asn Leu Arg Val Thr Gly Gly Gly Ser Asn
Leu Pro Ser Gly Val 180 185 190 Ala Gly Thr Ser Leu Tyr Lys Ala Thr
Asp Pro Gly Ile Leu Phe Asn 195 200 205 Pro Tyr Val Ser Ser Pro Asp
Tyr Thr Val Pro Gly Pro Ala Leu Ile 210 215 220 Ala Gly Ala Ala Ser
Ser Ile Ala Gln Ser Thr Ser Val Ala Thr Ala 225 230 235 240 Thr Gly
Thr Ala Thr Val Pro Gly Gly Gly Gly Ala Asn Pro Thr Ala 245 250 255
Thr Thr Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr Thr Leu Arg Thr 260
265 270 Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala Pro Pro Ser Gly Asp
Val 275 280 285 Gln Thr Lys Tyr Gly Gln Cys Gly Gly Asn Gly Trp Thr
Gly Pro Thr 290 295 300 Val Cys Ala Pro Gly Ser Ser Cys Ser Val Leu
Asn Glu Trp Tyr Ser 305 310 315 320 Gln Cys Leu 221035DNAArtificial
SequenceSynthetic polynucleotide of M. thermophila GH61a "Variant
9" 22acaaacatgt ccaaggcctc tgctctcctc gctggcctga cgggcgcggc
cctcgtcgct 60gcacatggcc acgtcagcca catcgtcgtc aacggcgtct actacaggaa
ctacgacccc 120acgacagact ggtaccagcc caacccgcca acagtcatcg
gctggacggc agccgatcag 180gataatggct tcgttgaacc caacagcttt
ggcacgccag atatcatctg ccacaagagc 240gccacccccg gcggcggcca
cgctaccgtt gctgccggag acaagatcaa catccagtgg 300acccccgagt
ggcccgaatc ccacatcggc cccgtcattg actacctagc cgcctgcaac
360ggtgactgcg agaccgtcga caagtcgtcg ctgcgctggt tcaagattga
cggcgccggc 420tacgacaagg ccgccggccg ctgggccgcc gacgctctgc
gcgccaacgg caacagctgg 480ctcgtccaga tcccgtcgga tctcaaggcc
ggcaactacg tcctccgcca cgagatcatc 540gccctccacg gtgctcagag
ccccaacggc gcccagaact acccgcagtg catcaacctc 600cgcgtcaccg
gcggcggcag caacctgccc agcggcgtcg ccggcacctc gctgtacaag
660gcgaccgacc cgggcatcct cttcaacccc tacgtctcct ccccggatta
caccgtcccc 720ggcccggccc tcattgccgg cgccgccagc tcgatcgccc
agagcacgtc ggtcgccact 780gccaccggca cggccaccgt tcccggcggc
ggcggcgcca accctaccgc caccaccacc 840gccgccacct ccgccgcccc
gagcaccacc ctgaggacga ccactacctc ggccgcgcag 900actaccgccc
cgccctccgg cgatgtgcag accaagtacg gccagtgtgg tggcaacgga
960tggacgggcc cgacggtgtg cgcccccggc tcgagctgct ccgtcctcaa
cgagtggtac 1020tcccagtgtt tgtaa 103523342PRTArtificial
SequenceSynthetic polypeptide of M. thermophila GH61a "Variant 9"
23Met Ser Lys Ala Ser Ala Leu Leu Ala Gly Leu Thr Gly Ala Ala Leu 1
5 10 15 Val Ala Ala His Gly His Val Ser His Ile Val Val Asn Gly Val
Tyr 20 25 30 Tyr Arg Asn Tyr Asp Pro Thr Thr Asp Trp Tyr Gln Pro
Asn Pro Pro 35 40 45 Thr Val Ile Gly Trp Thr Ala Ala Asp Gln Asp
Asn Gly Phe Val Glu 50 55 60 Pro Asn Ser Phe Gly Thr Pro Asp Ile
Ile Cys His Lys Ser Ala Thr 65 70 75 80 Pro Gly Gly Gly His Ala Thr
Val Ala Ala Gly Asp Lys Ile Asn Ile 85 90 95 Gln Trp Thr Pro Glu
Trp Pro Glu Ser His Ile Gly Pro Val Ile Asp 100 105 110 Tyr Leu Ala
Ala Cys Asn Gly Asp Cys Glu Thr Val Asp Lys Ser Ser 115 120 125 Leu
Arg Trp Phe Lys Ile Asp Gly Ala Gly Tyr Asp Lys Ala Ala Gly 130 135
140 Arg Trp Ala Ala Asp Ala Leu Arg Ala Asn Gly Asn Ser Trp Leu Val
145 150 155 160 Gln Ile Pro Ser Asp Leu Lys Ala Gly Asn Tyr Val Leu
Arg His Glu 165 170 175 Ile Ile Ala Leu His Gly Ala Gln Ser Pro Asn
Gly Ala Gln Asn Tyr 180 185 190 Pro Gln Cys Ile Asn Leu Arg Val Thr
Gly Gly Gly Ser Asn Leu Pro 195 200 205 Ser Gly Val Ala Gly Thr Ser
Leu Tyr Lys Ala Thr Asp Pro Gly Ile 210 215 220 Leu Phe Asn Pro Tyr
Val Ser Ser Pro Asp Tyr Thr Val Pro Gly Pro 225 230 235 240 Ala Leu
Ile Ala Gly Ala Ala Ser Ser Ile Ala Gln Ser Thr Ser Val 245 250 255
Ala Thr Ala Thr Gly Thr Ala Thr Val Pro Gly Gly Gly Gly Ala Asn 260
265 270 Pro Thr Ala Thr Thr Thr Ala Ala Thr Ser Ala Ala Pro Ser Thr
Thr 275 280 285 Leu Arg Thr Thr Thr Thr Ser Ala Ala Gln Thr Thr Ala
Pro Pro Ser 290 295 300 Gly Asp Val Gln Thr Lys Tyr Gly Gln Cys Gly
Gly Asn Gly Trp Thr 305 310 315 320 Gly Pro Thr Val Cys Ala Pro Gly
Ser Ser Cys Ser Val Leu Asn Glu 325 330 335 Trp Tyr Ser Gln Cys Leu
340 24323PRTArtificial SequenceSynthetic polypeptide of M.
thermophila GH61a "Variant 9" 24His Gly His Val Ser His Ile Val Val
Asn Gly Val Tyr Tyr Arg Asn 1 5 10 15 Tyr Asp Pro Thr Thr Asp Trp
Tyr Gln Pro Asn Pro Pro Thr Val Ile 20 25 30 Gly Trp Thr Ala Ala
Asp Gln Asp Asn Gly Phe Val Glu Pro Asn Ser 35 40 45 Phe Gly Thr
Pro Asp Ile Ile Cys His Lys Ser Ala Thr Pro Gly Gly 50 55 60 Gly
His Ala Thr Val Ala Ala Gly Asp Lys Ile Asn Ile Gln Trp Thr 65 70
75 80 Pro Glu Trp Pro Glu Ser His Ile Gly Pro Val Ile Asp Tyr Leu
Ala 85 90 95 Ala Cys Asn Gly Asp Cys Glu Thr Val Asp Lys Ser Ser
Leu Arg Trp 100 105 110 Phe Lys Ile Asp Gly Ala Gly Tyr Asp Lys Ala
Ala Gly Arg Trp Ala 115 120 125 Ala Asp Ala Leu Arg Ala Asn Gly Asn
Ser Trp Leu Val Gln Ile Pro 130 135 140 Ser Asp Leu Lys Ala Gly Asn
Tyr Val Leu Arg His Glu Ile Ile Ala 145 150 155 160 Leu His Gly Ala
Gln Ser Pro Asn Gly Ala Gln Asn Tyr Pro Gln Cys 165 170 175 Ile Asn
Leu Arg Val Thr Gly Gly Gly Ser Asn Leu Pro Ser Gly Val 180 185 190
Ala Gly Thr Ser Leu Tyr Lys Ala Thr Asp Pro Gly Ile Leu Phe Asn 195
200 205 Pro Tyr Val Ser Ser Pro Asp Tyr Thr Val Pro Gly Pro Ala Leu
Ile 210 215 220 Ala Gly Ala Ala Ser Ser Ile Ala Gln Ser Thr Ser Val
Ala Thr Ala 225 230 235 240 Thr Gly Thr Ala Thr Val Pro Gly Gly Gly
Gly Ala Asn Pro Thr Ala 245 250 255 Thr Thr Thr Ala Ala Thr Ser Ala
Ala Pro Ser Thr Thr Leu Arg Thr 260 265 270 Thr Thr Thr Ser Ala Ala
Gln Thr Thr Ala Pro Pro Ser Gly Asp Val 275 280 285 Gln Thr Lys Tyr
Gly Gln Cys Gly Gly Asn Gly Trp Thr Gly Pro Thr 290 295 300 Val Cys
Ala Pro Gly Ser Ser Cys Ser Val Leu Asn Glu Trp Tyr Ser 305 310 315
320 Gln Cys Leu 25738DNAMyceliophthora thermophila 25atgaagctct
ccctcttttc cgtcctggcc actgccctca ccgtcgaggg gcatgccatc 60ttccagaagg
tctccgtcaa cggagcggac cagggctccc tcaccggcct ccgcgctccc
120aacaacaaca accccgtgca gaatgtcaac agccaggaca tgatctgcgg
ccagtcggga 180tcgacgtcga acactatcat cgaggtcaag gccggcgata
ggatcggtgc ctggtatcag 240catgtcatcg gcggtgccca gttccccaac
gacccagaca acccgattgc caagtcgcac 300aagggccccg tcatggccta
cctcgccaag gttgacaatg ccgcaaccgc cagcaagacg 360ggcctgaagt
ggttcaagat ttgggaggat acctttaatc ccagcaccaa gacctggggt
420gtcgacaacc tcatcaacaa caacggctgg gtgtacttca acctcccgca
gtgcatcgcc 480gacggcaact acctcctccg cgtcgaggtc ctcgctctgc
actcggccta ctcccagggc 540caggctcagt tctaccagtc ctgcgcccag
atcaacgtat ccggcggcgg ctccttcacg 600ccggcgtcga ctgtcagctt
cccgggtgcc tacagcgcca gcgaccccgg tatcctgatc 660aacatctacg
gcgccaccgg ccagcccgac aacaacggcc agccgtacac tgcccctggg
720cccgcgccca tctcctgc 73826246PRTMyceliophthora thermophila 26Met
Lys Leu Ser Leu Phe Ser Val Leu Ala Thr Ala Leu Thr Val Glu 1 5 10
15 Gly His Ala Ile Phe Gln Lys Val Ser Val Asn Gly Ala Asp Gln Gly
20 25 30 Ser Leu Thr Gly Leu Arg Ala Pro Asn Asn Asn Asn Pro Val
Gln Asn 35 40 45 Val Asn Ser Gln Asp Met Ile Cys Gly Gln Ser Gly
Ser Thr Ser Asn 50 55 60 Thr Ile Ile Glu Val Lys Ala Gly Asp Arg
Ile Gly Ala Trp Tyr Gln 65 70 75 80 His Val Ile Gly Gly Ala Gln Phe
Pro Asn Asp Pro Asp Asn Pro Ile 85 90 95 Ala Lys Ser His Lys Gly
Pro Val Met Ala Tyr Leu Ala Lys Val Asp 100 105 110 Asn Ala Ala Thr
Ala Ser Lys Thr Gly Leu Lys Trp Phe Lys Ile Trp 115 120 125 Glu Asp
Thr Phe Asn Pro Ser Thr Lys Thr Trp Gly Val Asp Asn Leu 130 135 140
Ile Asn Asn Asn Gly Trp Val Tyr Phe Asn Leu Pro Gln Cys Ile Ala 145
150 155 160 Asp Gly Asn Tyr Leu Leu Arg Val Glu Val Leu Ala Leu His
Ser Ala 165 170 175 Tyr Ser Gln Gly Gln Ala Gln Phe Tyr Gln Ser Cys
Ala Gln Ile Asn 180 185 190 Val Ser Gly Gly Gly Ser Phe Thr Pro Ala
Ser Thr Val Ser Phe Pro 195 200 205 Gly Ala Tyr Ser Ala Ser Asp Pro
Gly Ile Leu Ile Asn Ile Tyr Gly 210 215 220 Ala Thr Gly Gln Pro Asp
Asn Asn Gly Gln Pro Tyr Thr Ala Pro Gly 225 230 235 240 Pro Ala Pro
Ile Ser Cys 245 27227PRTMyceliophthora thermophila 27Ile Phe Gln
Lys Val Ser Val Asn Gly Ala Asp Gln Gly Ser Leu Thr 1 5 10 15 Gly
Leu Arg Ala Pro Asn Asn Asn Asn Pro Val Gln Asn Val Asn Ser 20 25
30 Gln Asp Met Ile Cys Gly Gln Ser Gly Ser Thr Ser Asn Thr Ile Ile
35 40 45 Glu Val Lys Ala Gly Asp Arg Ile Gly Ala Trp Tyr Gln His
Val Ile 50 55 60 Gly Gly Ala Gln Phe Pro Asn Asp Pro Asp Asn Pro
Ile Ala Lys Ser 65 70 75 80 His Lys Gly Pro Val Met Ala Tyr Leu Ala
Lys Val Asp Asn Ala Ala 85 90 95 Thr Ala Ser Lys Thr Gly Leu Lys
Trp Phe Lys Ile Trp Glu Asp Thr 100 105 110 Phe Asn Pro Ser Thr Lys
Thr Trp Gly Val Asp Asn Leu Ile Asn Asn 115 120 125 Asn Gly Trp Val
Tyr Phe Asn Leu Pro Gln Cys Ile Ala Asp Gly Asn 130 135 140 Tyr Leu
Leu Arg Val Glu Val Leu Ala Leu His Ser Ala Tyr Ser Gln 145 150 155
160 Gly Gln Ala Gln Phe Tyr Gln Ser Cys Ala Gln Ile Asn Val Ser Gly
165 170 175 Gly Gly Ser Phe Thr Pro Ala Ser Thr Val Ser Phe Pro Gly
Ala Tyr 180 185 190 Ser Ala Ser Asp Pro Gly Ile Leu Ile Asn Ile Tyr
Gly Ala Thr Gly 195 200 205 Gln Pro Asp Asn Asn Gly Gln Pro Tyr Thr
Ala Pro Gly Pro Ala Pro 210 215 220 Ile Ser Cys 225
28762DNAMyceliophthora thermophila 28atggccctcc agctcttggc
gagcttggcc ctcctctcag tgccggccct tgcccacggt 60ggcttggcca actacaccgt
cggtgatact tggtacagag gctacgaccc aaacctgccg 120ccggagacgc
agctcaacca gacctggatg atccagcggc aatgggccac catcgacccc
180gtcttcaccg tgtcggagcc gtacctggcc tgcaacaacc cgggcgcgcc
gccgccctcg 240tacatcccca tccgcgccgg tgacaagatc acggccgtgt
actggtactg gctgcacgcc 300atcgggccca tgagcgtctg gctcgcgcgg
tgcggcgaca cgcccgcggc cgactgccgc 360gacgtcgacg tcaaccgggt
cggctggttc aagatctggg agggcggcct gctggagggt 420cccaacctgg
ccgaggggct ctggtaccaa aaggacttcc agcgctggga cggctccccg
480tccctctggc ccgtcacgat ccccaagggg ctcaagagcg ggacctacat
catccggcac 540gagatcctgt cgcttcacgt cgccctcaag ccccagtttt
acccggagtg tgcgcatctg 600aatattactg ggggcggaga cttgctgcca
cccgaagaga ctctggtgcg gtttccgggg 660gtttacaaag aggacgatcc
ctctatcttc atcgatgtct actcggagga gaacgcgaac 720cggacagatt
atacggttcc gggagggcca atctgggaag gg 76229254PRTMyceliophthora
thermophila 29Met Ala Leu Gln Leu Leu Ala Ser Leu Ala Leu Leu Ser
Val Pro Ala 1 5 10 15 Leu Ala His Gly Gly Leu Ala Asn Tyr Thr Val
Gly Asp Thr Trp Tyr 20 25 30 Arg Gly Tyr Asp Pro Asn Leu Pro Pro
Glu Thr Gln Leu Asn Gln Thr 35 40 45 Trp Met Ile Gln Arg Gln Trp
Ala Thr Ile Asp Pro Val Phe Thr Val 50 55 60 Ser Glu Pro Tyr Leu
Ala Cys Asn Asn Pro Gly Ala Pro Pro Pro Ser 65 70 75 80 Tyr Ile Pro
Ile Arg Ala Gly Asp Lys Ile Thr Ala Val Tyr Trp Tyr 85 90 95 Trp
Leu His Ala Ile Gly Pro Met Ser Val Trp Leu Ala Arg Cys Gly 100 105
110 Asp Thr Pro Ala Ala Asp Cys Arg Asp Val Asp Val Asn Arg Val Gly
115 120 125 Trp Phe Lys Ile Trp Glu Gly Gly Leu Leu Glu Gly Pro Asn
Leu Ala 130 135 140 Glu Gly Leu Trp Tyr Gln Lys Asp Phe Gln Arg Trp
Asp Gly Ser Pro 145 150 155 160 Ser Leu Trp Pro Val Thr Ile Pro Lys
Gly Leu Lys Ser Gly Thr Tyr 165 170 175 Ile Ile Arg His Glu Ile Leu
Ser Leu His Val Ala Leu Lys Pro Gln 180 185 190 Phe Tyr Pro Glu Cys
Ala His Leu Asn Ile Thr Gly Gly Gly Asp Leu 195 200 205 Leu Pro Pro
Glu Glu Thr Leu Val Arg Phe Pro Gly Val Tyr Lys Glu 210 215 220 Asp
Asp Pro Ser Ile Phe Ile Asp Val Tyr Ser Glu Glu Asn Ala Asn 225 230
235 240 Arg Thr Asp Tyr Thr Val Pro Gly Gly Pro Ile Trp Glu Gly 245
250 30231PRTMyceliophthora thermophila 30Asn Tyr Thr Val Gly Asp
Thr Trp Tyr Arg Gly Tyr Asp Pro Asn Leu 1 5 10 15 Pro Pro Glu Thr
Gln Leu Asn Gln Thr Trp Met Ile Gln Arg Gln Trp 20 25 30 Ala Thr
Ile Asp Pro Val Phe Thr Val Ser Glu Pro Tyr Leu Ala Cys 35 40 45
Asn Asn Pro Gly Ala Pro Pro Pro Ser Tyr Ile Pro Ile Arg Ala Gly 50
55 60 Asp Lys Ile Thr Ala Val Tyr Trp Tyr Trp Leu His Ala Ile Gly
Pro 65 70 75 80 Met Ser Val Trp Leu Ala Arg Cys Gly Asp Thr Pro Ala
Ala Asp Cys 85 90 95 Arg Asp Val Asp Val Asn Arg Val Gly Trp Phe
Lys Ile Trp Glu Gly 100 105 110 Gly Leu Leu Glu Gly Pro Asn Leu Ala
Glu Gly Leu Trp Tyr Gln Lys 115 120 125 Asp Phe Gln Arg Trp Asp Gly
Ser Pro Ser Leu Trp Pro Val Thr Ile 130
135 140 Pro Lys Gly Leu Lys Ser Gly Thr Tyr Ile Ile Arg His Glu Ile
Leu 145 150 155 160 Ser Leu His Val Ala Leu Lys Pro Gln Phe Tyr Pro
Glu Cys Ala His 165 170 175 Leu Asn Ile Thr Gly Gly Gly Asp Leu Leu
Pro Pro Glu Glu Thr Leu 180 185 190 Val Arg Phe Pro Gly Val Tyr Lys
Glu Asp Asp Pro Ser Ile Phe Ile 195 200 205 Asp Val Tyr Ser Glu Glu
Asn Ala Asn Arg Thr Asp Tyr Thr Val Pro 210 215 220 Gly Gly Pro Ile
Trp Glu Gly 225 230 31705DNAMyceliophthora thermophila 31atgaaggccc
tctctctcct tgcggctgcc ggggcagtct ctgcgcatac catcttcgtc 60cagctcgaag
cagacggcac gaggtacccg gtttcgtacg ggatccggga cccaacctac
120gacggcccca tcaccgacgt cacatccaac gacgttgctt gcaacggcgg
tccgaacccg 180acgaccccct ccagcgacgt catcaccgtc accgcgggca
ccaccgtcaa ggccatctgg 240aggcacaccc tccaatccgg cccggacgat
gtcatggacg ccagccacaa gggcccgacc 300ctggcctaca tcaagaaggt
cggcgatgcc accaaggact cgggcgtcgg cggtggctgg 360ttcaagatcc
aggaggacgg ttacaacaac ggccagtggg gcaccagcac cgttatctcc
420aacggcggcg agcactacat tgacatcccg gcctgcatcc ccgagggtca
gtacctcctc 480cgcgccgaga tgatcgccct ccacgcggcc gggtcccccg
gcggcgctca gctctacatg 540gaatgtgccc agatcaacat cgtcggcggc
tccggctcgg tgcccagctc gacggtcagc 600ttccccggcg cgtatagccc
caacgacccg ggtctcctca tcaacatcta ttccatgtcg 660ccctcgagct
cgtacaccat cccgggcccg cccgttttca agtgc 70532235PRTMyceliophthora
thermophila 32Met Lys Ala Leu Ser Leu Leu Ala Ala Ala Gly Ala Val
Ser Ala His 1 5 10 15 Thr Ile Phe Val Gln Leu Glu Ala Asp Gly Thr
Arg Tyr Pro Val Ser 20 25 30 Tyr Gly Ile Arg Asp Pro Thr Tyr Asp
Gly Pro Ile Thr Asp Val Thr 35 40 45 Ser Asn Asp Val Ala Cys Asn
Gly Gly Pro Asn Pro Thr Thr Pro Ser 50 55 60 Ser Asp Val Ile Thr
Val Thr Ala Gly Thr Thr Val Lys Ala Ile Trp 65 70 75 80 Arg His Thr
Leu Gln Ser Gly Pro Asp Asp Val Met Asp Ala Ser His 85 90 95 Lys
Gly Pro Thr Leu Ala Tyr Ile Lys Lys Val Gly Asp Ala Thr Lys 100 105
110 Asp Ser Gly Val Gly Gly Gly Trp Phe Lys Ile Gln Glu Asp Gly Tyr
115 120 125 Asn Asn Gly Gln Trp Gly Thr Ser Thr Val Ile Ser Asn Gly
Gly Glu 130 135 140 His Tyr Ile Asp Ile Pro Ala Cys Ile Pro Glu Gly
Gln Tyr Leu Leu 145 150 155 160 Arg Ala Glu Met Ile Ala Leu His Ala
Ala Gly Ser Pro Gly Gly Ala 165 170 175 Gln Leu Tyr Met Glu Cys Ala
Gln Ile Asn Ile Val Gly Gly Ser Gly 180 185 190 Ser Val Pro Ser Ser
Thr Val Ser Phe Pro Gly Ala Tyr Ser Pro Asn 195 200 205 Asp Pro Gly
Leu Leu Ile Asn Ile Tyr Ser Met Ser Pro Ser Ser Ser 210 215 220 Tyr
Thr Ile Pro Gly Pro Pro Val Phe Lys Cys 225 230 235
33220PRTMyceliophthora thermophila 33His Thr Ile Phe Val Gln Leu
Glu Ala Asp Gly Thr Arg Tyr Pro Val 1 5 10 15 Ser Tyr Gly Ile Arg
Asp Pro Thr Tyr Asp Gly Pro Ile Thr Asp Val 20 25 30 Thr Ser Asn
Asp Val Ala Cys Asn Gly Gly Pro Asn Pro Thr Thr Pro 35 40 45 Ser
Ser Asp Val Ile Thr Val Thr Ala Gly Thr Thr Val Lys Ala Ile 50 55
60 Trp Arg His Thr Leu Gln Ser Gly Pro Asp Asp Val Met Asp Ala Ser
65 70 75 80 His Lys Gly Pro Thr Leu Ala Tyr Ile Lys Lys Val Gly Asp
Ala Thr 85 90 95 Lys Asp Ser Gly Val Gly Gly Gly Trp Phe Lys Ile
Gln Glu Asp Gly 100 105 110 Tyr Asn Asn Gly Gln Trp Gly Thr Ser Thr
Val Ile Ser Asn Gly Gly 115 120 125 Glu His Tyr Ile Asp Ile Pro Ala
Cys Ile Pro Glu Gly Gln Tyr Leu 130 135 140 Leu Arg Ala Glu Met Ile
Ala Leu His Ala Ala Gly Ser Pro Gly Gly 145 150 155 160 Ala Gln Leu
Tyr Met Glu Cys Ala Gln Ile Asn Ile Val Gly Gly Ser 165 170 175 Gly
Ser Val Pro Ser Ser Thr Val Ser Phe Pro Gly Ala Tyr Ser Pro 180 185
190 Asn Asp Pro Gly Leu Leu Ile Asn Ile Tyr Ser Met Ser Pro Ser Ser
195 200 205 Ser Tyr Thr Ile Pro Gly Pro Pro Val Phe Lys Cys 210 215
220 34915DNAMyceliophthora thermophila 34atgaagtcgt ctaccccggc
cttgttcgcc gctgggctcc ttgctcagca tgctgcggcc 60cactccatct tccagcaggc
gagcagcggc tcgaccgact ttgatacgct gtgcacccgg 120atgccgccca
acaatagccc cgtcactagt gtgaccagcg gcgacatgac ctgcaaagtc
180ggcggcacca agggggtgtc cggcttctgc gaggtgaacg ccggcgacga
gttcacggtt 240gagatgcacg cgcagcccgg cgaccgctcg tgcgccaacg
aggccatcgg cgggaaccac 300ttcggcccgg tcctcatcta catgagcaag
gtcgacgacg cctccaccgc cgacgggtcc 360ggcgactggt tcaaggtgga
cgagttcggc tacgacgcaa gcaccaagac ctggggcacc 420gacaagctca
acgagaactg cggcaagcgc accttcaaca tccccagcca catccccgcg
480ggcgactatc tcgtccgggc cgaggctatc gcgctacaca ctgccaacca
gccaggcggc 540gcgcagttct acatgagctg ctatcaagtc aggatttccg
gcggcgaagg gggccagctg 600cctgccggag tcaagatccc gggcgcgtac
agtgccaacg accccggcat ccttgtcgac 660atctggggta acgatttcaa
cgaccctcca ggacactcgg cccgtcacgc catcatcatc 720atcagcagca
gcagcaacaa cagcggcgcc aagatgacca agaagatcca ggagcccacc
780atcacatcgg tcacggacct ccccaccgac gaggccaagt ggatcgcgct
ccaaaagatc 840tcgtacgtgg accagacggg cacggcgcgg acatacgagc
cggcgtcgcg caagacgcgg 900tcgccaagag tctag 91535304PRTMyceliophthora
thermophila 35Met Lys Ser Ser Thr Pro Ala Leu Phe Ala Ala Gly Leu
Leu Ala Gln 1 5 10 15 His Ala Ala Ala His Ser Ile Phe Gln Gln Ala
Ser Ser Gly Ser Thr 20 25 30 Asp Phe Asp Thr Leu Cys Thr Arg Met
Pro Pro Asn Asn Ser Pro Val 35 40 45 Thr Ser Val Thr Ser Gly Asp
Met Thr Cys Lys Val Gly Gly Thr Lys 50 55 60 Gly Val Ser Gly Phe
Cys Glu Val Asn Ala Gly Asp Glu Phe Thr Val 65 70 75 80 Glu Met His
Ala Gln Pro Gly Asp Arg Ser Cys Ala Asn Glu Ala Ile 85 90 95 Gly
Gly Asn His Phe Gly Pro Val Leu Ile Tyr Met Ser Lys Val Asp 100 105
110 Asp Ala Ser Thr Ala Asp Gly Ser Gly Asp Trp Phe Lys Val Asp Glu
115 120 125 Phe Gly Tyr Asp Ala Ser Thr Lys Thr Trp Gly Thr Asp Lys
Leu Asn 130 135 140 Glu Asn Cys Gly Lys Arg Thr Phe Asn Ile Pro Ser
His Ile Pro Ala 145 150 155 160 Gly Asp Tyr Leu Val Arg Ala Glu Ala
Ile Ala Leu His Thr Ala Asn 165 170 175 Gln Pro Gly Gly Ala Gln Phe
Tyr Met Ser Cys Tyr Gln Val Arg Ile 180 185 190 Ser Gly Gly Glu Gly
Gly Gln Leu Pro Ala Gly Val Lys Ile Pro Gly 195 200 205 Ala Tyr Ser
Ala Asn Asp Pro Gly Ile Leu Val Asp Ile Trp Gly Asn 210 215 220 Asp
Phe Asn Asp Pro Pro Gly His Ser Ala Arg His Ala Ile Ile Ile 225 230
235 240 Ile Ser Ser Ser Ser Asn Asn Ser Gly Ala Lys Met Thr Lys Lys
Ile 245 250 255 Gln Glu Pro Thr Ile Thr Ser Val Thr Asp Leu Pro Thr
Asp Glu Ala 260 265 270 Lys Trp Ile Ala Leu Gln Lys Ile Ser Tyr Val
Asp Gln Thr Gly Thr 275 280 285 Ala Arg Thr Tyr Glu Pro Ala Ser Arg
Lys Thr Arg Ser Pro Arg Val 290 295 300 36284PRTMyceliophthora
thermophila 36His Ser Ile Phe Gln Gln Ala Ser Ser Gly Ser Thr Asp
Phe Asp Thr 1 5 10 15 Leu Cys Thr Arg Met Pro Pro Asn Asn Ser Pro
Val Thr Ser Val Thr 20 25 30 Ser Gly Asp Met Thr Cys Lys Val Gly
Gly Thr Lys Gly Val Ser Gly 35 40 45 Phe Cys Glu Val Asn Ala Gly
Asp Glu Phe Thr Val Glu Met His Ala 50 55 60 Gln Pro Gly Asp Arg
Ser Cys Ala Asn Glu Ala Ile Gly Gly Asn His 65 70 75 80 Phe Gly Pro
Val Leu Ile Tyr Met Ser Lys Val Asp Asp Ala Ser Thr 85 90 95 Ala
Asp Gly Ser Gly Asp Trp Phe Lys Val Asp Glu Phe Gly Tyr Asp 100 105
110 Ala Ser Thr Lys Thr Trp Gly Thr Asp Lys Leu Asn Glu Asn Cys Gly
115 120 125 Lys Arg Thr Phe Asn Ile Pro Ser His Ile Pro Ala Gly Asp
Tyr Leu 130 135 140 Val Arg Ala Glu Ala Ile Ala Leu His Thr Ala Asn
Gln Pro Gly Gly 145 150 155 160 Ala Gln Phe Tyr Met Ser Cys Tyr Gln
Val Arg Ile Ser Gly Gly Glu 165 170 175 Gly Gly Gln Leu Pro Ala Gly
Val Lys Ile Pro Gly Ala Tyr Ser Ala 180 185 190 Asn Asp Pro Gly Ile
Leu Val Asp Ile Trp Gly Asn Asp Phe Asn Asp 195 200 205 Pro Pro Gly
His Ser Ala Arg His Ala Ile Ile Ile Ile Ser Ser Ser 210 215 220 Ser
Asn Asn Ser Gly Ala Lys Met Thr Lys Lys Ile Gln Glu Pro Thr 225 230
235 240 Ile Thr Ser Val Thr Asp Leu Pro Thr Asp Glu Ala Lys Trp Ile
Ala 245 250 255 Leu Gln Lys Ile Ser Tyr Val Asp Gln Thr Gly Thr Ala
Arg Thr Tyr 260 265 270 Glu Pro Ala Ser Arg Lys Thr Arg Ser Pro Arg
Val 275 280 37726DNAMyceliophthora thermophila 37atgaagtcgt
ctaccccggc cttgttcgcc gctgggctcc ttgctcagca tgctgcggcc 60cactccatct
tccagcaggc gagcagcggc tcgaccgact ttgatacgct gtgcacccgg
120atgccgccca acaatagccc cgtcactagt gtgaccagcg gcgacatgac
ctgcaacgtc 180ggcggcacca agggggtgtc gggcttctgc gaggtgaacg
ccggcgacga gttcacggtt 240gagatgcacg cgcagcccgg cgaccgctcg
tgcgccaacg aggccatcgg cgggaaccac 300ttcggcccgg tcctcatcta
catgagcaag gtcgacgacg cctccactgc cgacgggtcc 360ggcgactggt
tcaaggtgga cgagttcggc tacgacgcaa gcaccaagac ctggggcacc
420gacaagctca acgagaactg cggcaagcgc accttcaaca tccccagcca
catccccgcg 480ggcgactatc tcgtccgggc cgaggctatc gcgctacaca
ctgccaacca gccaggcggc 540gcgcagttct acatgagctg ctatcaagtc
aggatttccg gcggcgaagg gggccagctg 600cctgccggag tcaagatccc
gggcgcgtac agtgccaacg accccggcat ccttgtcgac 660atctggggta
acgatttcaa cgagtacgtt attccgggcc ccccggtcat cgacagcagc 720tacttc
72638242PRTMyceliophthora thermophila 38Met Lys Ser Ser Thr Pro Ala
Leu Phe Ala Ala Gly Leu Leu Ala Gln 1 5 10 15 His Ala Ala Ala His
Ser Ile Phe Gln Gln Ala Ser Ser Gly Ser Thr 20 25 30 Asp Phe Asp
Thr Leu Cys Thr Arg Met Pro Pro Asn Asn Ser Pro Val 35 40 45 Thr
Ser Val Thr Ser Gly Asp Met Thr Cys Asn Val Gly Gly Thr Lys 50 55
60 Gly Val Ser Gly Phe Cys Glu Val Asn Ala Gly Asp Glu Phe Thr Val
65 70 75 80 Glu Met His Ala Gln Pro Gly Asp Arg Ser Cys Ala Asn Glu
Ala Ile 85 90 95 Gly Gly Asn His Phe Gly Pro Val Leu Ile Tyr Met
Ser Lys Val Asp 100 105 110 Asp Ala Ser Thr Ala Asp Gly Ser Gly Asp
Trp Phe Lys Val Asp Glu 115 120 125 Phe Gly Tyr Asp Ala Ser Thr Lys
Thr Trp Gly Thr Asp Lys Leu Asn 130 135 140 Glu Asn Cys Gly Lys Arg
Thr Phe Asn Ile Pro Ser His Ile Pro Ala 145 150 155 160 Gly Asp Tyr
Leu Val Arg Ala Glu Ala Ile Ala Leu His Thr Ala Asn 165 170 175 Gln
Pro Gly Gly Ala Gln Phe Tyr Met Ser Cys Tyr Gln Val Arg Ile 180 185
190 Ser Gly Gly Glu Gly Gly Gln Leu Pro Ala Gly Val Lys Ile Pro Gly
195 200 205 Ala Tyr Ser Ala Asn Asp Pro Gly Ile Leu Val Asp Ile Trp
Gly Asn 210 215 220 Asp Phe Asn Glu Tyr Val Ile Pro Gly Pro Pro Val
Ile Asp Ser Ser 225 230 235 240 Tyr Phe 39222PRTMyceliophthora
thermophila 39His Ser Ile Phe Gln Gln Ala Ser Ser Gly Ser Thr Asp
Phe Asp Thr 1 5 10 15 Leu Cys Thr Arg Met Pro Pro Asn Asn Ser Pro
Val Thr Ser Val Thr 20 25 30 Ser Gly Asp Met Thr Cys Asn Val Gly
Gly Thr Lys Gly Val Ser Gly 35 40 45 Phe Cys Glu Val Asn Ala Gly
Asp Glu Phe Thr Val Glu Met His Ala 50 55 60 Gln Pro Gly Asp Arg
Ser Cys Ala Asn Glu Ala Ile Gly Gly Asn His 65 70 75 80 Phe Gly Pro
Val Leu Ile Tyr Met Ser Lys Val Asp Asp Ala Ser Thr 85 90 95 Ala
Asp Gly Ser Gly Asp Trp Phe Lys Val Asp Glu Phe Gly Tyr Asp 100 105
110 Ala Ser Thr Lys Thr Trp Gly Thr Asp Lys Leu Asn Glu Asn Cys Gly
115 120 125 Lys Arg Thr Phe Asn Ile Pro Ser His Ile Pro Ala Gly Asp
Tyr Leu 130 135 140 Val Arg Ala Glu Ala Ile Ala Leu His Thr Ala Asn
Gln Pro Gly Gly 145 150 155 160 Ala Gln Phe Tyr Met Ser Cys Tyr Gln
Val Arg Ile Ser Gly Gly Glu 165 170 175 Gly Gly Gln Leu Pro Ala Gly
Val Lys Ile Pro Gly Ala Tyr Ser Ala 180 185 190 Asn Asp Pro Gly Ile
Leu Val Asp Ile Trp Gly Asn Asp Phe Asn Glu 195 200 205 Tyr Val Ile
Pro Gly Pro Pro Val Ile Asp Ser Ser Tyr Phe 210 215 220
40969DNAMyceliophthora thermophila 40atgaagtcct tcaccctcac
cactctggcc gccctggctg gcaacgccgc cgctcacgcg 60accttccagg ccctctgggt
cgacggcgtc gactacggcg cgcagtgtgc ccgtctgccc 120gcgtccaact
cgccggtcac cgacgtgacc tccaacgcga tccgctgcaa cgccaacccc
180tcgcccgctc ggggcaagtg cccggtcaag gccggctcga ccgttacggt
cgagatgcat 240cagcaacccg gtgaccgctc gtgcagcagc gaggcgatcg
gcggggcgca ctacggcccc 300gtgatggtgt acatgtccaa ggtgtcggac
gcggcgtcgg cggacgggtc gtcgggctgg 360ttcaaggtgt tcgaggacgg
ctgggccaag aacccgtccg gcgggtcggg cgacgacgac 420tactggggca
ccaaggacct gaactcgtgc tgcgggaaga tgaacgtcaa gatccccgcc
480gacctgccct cgggcgacta cctgctccgg gccgaggccc tcgcgctgca
cacggccggc 540agcgcgggcg gcgcccagtt ctacatgacc tgctaccagc
tcaccgtgac cggctccggc 600agcgccagcc cgcccaccgt ctccttcccg
ggcgcctaca aggccaccga cccgggcatc 660ctcgtcaaca tccacgcccc
gctgtccggc tacaccgtgc ccggcccggc cgtctactcg 720ggcggctcca
ccaagaaggc cggcagcgcc tgcaccggct gcgagtccac ttgcgccgtc
780ggctccggcc ccaccgccac cgtctcccag tcgcccggtt ccaccgccac
ctcggccccc 840ggcggcggcg gcggctgcac cgtccagaag taccagcagt
gcggcggcca gggctacacc 900ggctgcacca actgcgcgtc cggctccacc
tgcagcgcgg tctcgccgcc ctactactcg 960cagtgcgtc
96941323PRTMyceliophthora thermophila 41Met Lys Ser Phe Thr Leu Thr
Thr Leu Ala Ala Leu Ala Gly Asn Ala 1 5 10 15 Ala Ala His Ala Thr
Phe Gln Ala Leu Trp Val Asp Gly Val Asp Tyr 20 25 30 Gly Ala Gln
Cys Ala Arg Leu Pro Ala Ser Asn Ser Pro Val Thr Asp 35 40 45 Val
Thr Ser Asn Ala Ile Arg Cys Asn Ala Asn Pro Ser Pro Ala Arg 50 55
60 Gly Lys Cys Pro Val Lys Ala Gly Ser Thr Val Thr Val Glu Met His
65 70 75 80 Gln Gln Pro Gly Asp Arg Ser Cys Ser Ser Glu Ala Ile Gly
Gly Ala 85 90 95 His Tyr Gly Pro Val Met Val Tyr Met Ser Lys Val
Ser Asp Ala Ala 100 105 110 Ser Ala Asp Gly Ser Ser Gly Trp Phe
Lys Val Phe Glu Asp Gly Trp 115 120 125 Ala Lys Asn Pro Ser Gly Gly
Ser Gly Asp Asp Asp Tyr Trp Gly Thr 130 135 140 Lys Asp Leu Asn Ser
Cys Cys Gly Lys Met Asn Val Lys Ile Pro Ala 145 150 155 160 Asp Leu
Pro Ser Gly Asp Tyr Leu Leu Arg Ala Glu Ala Leu Ala Leu 165 170 175
His Thr Ala Gly Ser Ala Gly Gly Ala Gln Phe Tyr Met Thr Cys Tyr 180
185 190 Gln Leu Thr Val Thr Gly Ser Gly Ser Ala Ser Pro Pro Thr Val
Ser 195 200 205 Phe Pro Gly Ala Tyr Lys Ala Thr Asp Pro Gly Ile Leu
Val Asn Ile 210 215 220 His Ala Pro Leu Ser Gly Tyr Thr Val Pro Gly
Pro Ala Val Tyr Ser 225 230 235 240 Gly Gly Ser Thr Lys Lys Ala Gly
Ser Ala Cys Thr Gly Cys Glu Ser 245 250 255 Thr Cys Ala Val Gly Ser
Gly Pro Thr Ala Thr Val Ser Gln Ser Pro 260 265 270 Gly Ser Thr Ala
Thr Ser Ala Pro Gly Gly Gly Gly Gly Cys Thr Val 275 280 285 Gln Lys
Tyr Gln Gln Cys Gly Gly Gln Gly Tyr Thr Gly Cys Thr Asn 290 295 300
Cys Ala Ser Gly Ser Thr Cys Ser Ala Val Ser Pro Pro Tyr Tyr Ser 305
310 315 320 Gln Cys Val 42305PRTMyceliophthora thermophila 42His
Ala Thr Phe Gln Ala Leu Trp Val Asp Gly Val Asp Tyr Gly Ala 1 5 10
15 Gln Cys Ala Arg Leu Pro Ala Ser Asn Ser Pro Val Thr Asp Val Thr
20 25 30 Ser Asn Ala Ile Arg Cys Asn Ala Asn Pro Ser Pro Ala Arg
Gly Lys 35 40 45 Cys Pro Val Lys Ala Gly Ser Thr Val Thr Val Glu
Met His Gln Gln 50 55 60 Pro Gly Asp Arg Ser Cys Ser Ser Glu Ala
Ile Gly Gly Ala His Tyr 65 70 75 80 Gly Pro Val Met Val Tyr Met Ser
Lys Val Ser Asp Ala Ala Ser Ala 85 90 95 Asp Gly Ser Ser Gly Trp
Phe Lys Val Phe Glu Asp Gly Trp Ala Lys 100 105 110 Asn Pro Ser Gly
Gly Ser Gly Asp Asp Asp Tyr Trp Gly Thr Lys Asp 115 120 125 Leu Asn
Ser Cys Cys Gly Lys Met Asn Val Lys Ile Pro Ala Asp Leu 130 135 140
Pro Ser Gly Asp Tyr Leu Leu Arg Ala Glu Ala Leu Ala Leu His Thr 145
150 155 160 Ala Gly Ser Ala Gly Gly Ala Gln Phe Tyr Met Thr Cys Tyr
Gln Leu 165 170 175 Thr Val Thr Gly Ser Gly Ser Ala Ser Pro Pro Thr
Val Ser Phe Pro 180 185 190 Gly Ala Tyr Lys Ala Thr Asp Pro Gly Ile
Leu Val Asn Ile His Ala 195 200 205 Pro Leu Ser Gly Tyr Thr Val Pro
Gly Pro Ala Val Tyr Ser Gly Gly 210 215 220 Ser Thr Lys Lys Ala Gly
Ser Ala Cys Thr Gly Cys Glu Ser Thr Cys 225 230 235 240 Ala Val Gly
Ser Gly Pro Thr Ala Thr Val Ser Gln Ser Pro Gly Ser 245 250 255 Thr
Ala Thr Ser Ala Pro Gly Gly Gly Gly Gly Cys Thr Val Gln Lys 260 265
270 Tyr Gln Gln Cys Gly Gly Gln Gly Tyr Thr Gly Cys Thr Asn Cys Ala
275 280 285 Ser Gly Ser Thr Cys Ser Ala Val Ser Pro Pro Tyr Tyr Ser
Gln Cys 290 295 300 Val 305 43870DNAMyceliophthora thermophila
43atgaagggac tcctcggcgc cgccgccctc tcgctggccg tcagcgatgt ctcggcccac
60tacatctttc agcagctgac gacgggcggc gtcaagcacg ctgtgtacca gtacatccgc
120aagaacacca actataactc gcccgtgacc gatctgacgt ccaacgacct
ccgctgcaat 180gtgggtgcta ccggtgcggg caccgatacc gtcacggtgc
gcgccggcga ttcgttcacc 240ttcacgaccg atacgcccgt ttaccaccag
ggcccgacct cgatctacat gtccaaggcc 300cccggcagcg cgtccgacta
cgacggcagc ggcggctggt tcaagatcaa ggactgggct 360gactacaccg
ccacgattcc ggaatgtatt ccccccggcg actacctgct tcgcatccag
420caactcggca tccacaaccc ttggcccgcg ggcatccccc agttctacat
ctcttgtgcc 480cagatcaccg tgactggtgg cggcagtgcc aaccccggcc
cgaccgtctc catcccaggc 540gccttcaagg agaccgaccc gggctacact
gtcaacatct acaacaactt ccacaactac 600accgtccctg gcccagccgt
cttcacctgc aacggtagcg gcggcaacaa cggcggcggc 660tccaacccag
tcaccaccac caccaccacc accaccaggc cgtccaccag caccgcccag
720tcccagccgt cgtcgagccc gaccagcccc tccagctgca ccgtcgcgaa
gtggggccag 780tgcggaggac agggttacag cggctgcacc gtgtgcgcgg
ccgggtcgac ctgccagaag 840accaacgact actacagcca gtgcttgtag
87044289PRTMyceliophthora thermophila 44Met Lys Gly Leu Leu Gly Ala
Ala Ala Leu Ser Leu Ala Val Ser Asp 1 5 10 15 Val Ser Ala His Tyr
Ile Phe Gln Gln Leu Thr Thr Gly Gly Val Lys 20 25 30 His Ala Val
Tyr Gln Tyr Ile Arg Lys Asn Thr Asn Tyr Asn Ser Pro 35 40 45 Val
Thr Asp Leu Thr Ser Asn Asp Leu Arg Cys Asn Val Gly Ala Thr 50 55
60 Gly Ala Gly Thr Asp Thr Val Thr Val Arg Ala Gly Asp Ser Phe Thr
65 70 75 80 Phe Thr Thr Asp Thr Pro Val Tyr His Gln Gly Pro Thr Ser
Ile Tyr 85 90 95 Met Ser Lys Ala Pro Gly Ser Ala Ser Asp Tyr Asp
Gly Ser Gly Gly 100 105 110 Trp Phe Lys Ile Lys Asp Trp Ala Asp Tyr
Thr Ala Thr Ile Pro Glu 115 120 125 Cys Ile Pro Pro Gly Asp Tyr Leu
Leu Arg Ile Gln Gln Leu Gly Ile 130 135 140 His Asn Pro Trp Pro Ala
Gly Ile Pro Gln Phe Tyr Ile Ser Cys Ala 145 150 155 160 Gln Ile Thr
Val Thr Gly Gly Gly Ser Ala Asn Pro Gly Pro Thr Val 165 170 175 Ser
Ile Pro Gly Ala Phe Lys Glu Thr Asp Pro Gly Tyr Thr Val Asn 180 185
190 Ile Tyr Asn Asn Phe His Asn Tyr Thr Val Pro Gly Pro Ala Val Phe
195 200 205 Thr Cys Asn Gly Ser Gly Gly Asn Asn Gly Gly Gly Ser Asn
Pro Val 210 215 220 Thr Thr Thr Thr Thr Thr Thr Thr Arg Pro Ser Thr
Ser Thr Ala Gln 225 230 235 240 Ser Gln Pro Ser Ser Ser Pro Thr Ser
Pro Ser Ser Cys Thr Val Ala 245 250 255 Lys Trp Gly Gln Cys Gly Gly
Gln Gly Tyr Ser Gly Cys Thr Val Cys 260 265 270 Ala Ala Gly Ser Thr
Cys Gln Lys Thr Asn Asp Tyr Tyr Ser Gln Cys 275 280 285 Leu
45270PRTMyceliophthora thermophila 45His Tyr Ile Phe Gln Gln Leu
Thr Thr Gly Gly Val Lys His Ala Val 1 5 10 15 Tyr Gln Tyr Ile Arg
Lys Asn Thr Asn Tyr Asn Ser Pro Val Thr Asp 20 25 30 Leu Thr Ser
Asn Asp Leu Arg Cys Asn Val Gly Ala Thr Gly Ala Gly 35 40 45 Thr
Asp Thr Val Thr Val Arg Ala Gly Asp Ser Phe Thr Phe Thr Thr 50 55
60 Asp Thr Pro Val Tyr His Gln Gly Pro Thr Ser Ile Tyr Met Ser Lys
65 70 75 80 Ala Pro Gly Ser Ala Ser Asp Tyr Asp Gly Ser Gly Gly Trp
Phe Lys 85 90 95 Ile Lys Asp Trp Ala Asp Tyr Thr Ala Thr Ile Pro
Glu Cys Ile Pro 100 105 110 Pro Gly Asp Tyr Leu Leu Arg Ile Gln Gln
Leu Gly Ile His Asn Pro 115 120 125 Trp Pro Ala Gly Ile Pro Gln Phe
Tyr Ile Ser Cys Ala Gln Ile Thr 130 135 140 Val Thr Gly Gly Gly Ser
Ala Asn Pro Gly Pro Thr Val Ser Ile Pro 145 150 155 160 Gly Ala Phe
Lys Glu Thr Asp Pro Gly Tyr Thr Val Asn Ile Tyr Asn 165 170 175 Asn
Phe His Asn Tyr Thr Val Pro Gly Pro Ala Val Phe Thr Cys Asn 180 185
190 Gly Ser Gly Gly Asn Asn Gly Gly Gly Ser Asn Pro Val Thr Thr Thr
195 200 205 Thr Thr Thr Thr Thr Arg Pro Ser Thr Ser Thr Ala Gln Ser
Gln Pro 210 215 220 Ser Ser Ser Pro Thr Ser Pro Ser Ser Cys Thr Val
Ala Lys Trp Gly 225 230 235 240 Gln Cys Gly Gly Gln Gly Tyr Ser Gly
Cys Thr Val Cys Ala Ala Gly 245 250 255 Ser Thr Cys Gln Lys Thr Asn
Asp Tyr Tyr Ser Gln Cys Leu 260 265 270 46834DNAMyceliophthora
thermophila 46ctgacgacgg gcggcgtcaa gcacgctgtg taccagtaca
tccgcaagaa caccaactat 60aactcgcccg tgaccgatct gacgtccaac gacctccgct
gcaatgtggg tgctaccggt 120gcgggcaccg ataccgtcac ggtgcgcgcc
ggcgattcgt tcaccttcac gaccgatacg 180cccgtttacc accagggccc
gacctcgatc tacatgtcca aggcccccgg cagcgcgtcc 240gactacgacg
gcagcggcgg ctggttcaag atcaaggact ggggtgccga ctttagcagc
300ggccaggcca cctggacctt ggcgtctgac tacaccgcca cgattccgga
atgtattccc 360cccggcgact acctgcttcg catccagcaa ctcggcatcc
acaacccttg gcccgcgggc 420atcccccagt tctacatctc ttgtgcccag
atcaccgtga ctggtggcgg cagtgccaac 480cccggcccga ccgtctccat
cccaggcgcc ttcaaggaga ccgacccggg ctacactgtc 540aacatctaca
acaacttcca caactacacc gtccctggcc cagccgtctt cacctgcaac
600ggtagcggcg gcaacaacgg cggcggctcc aacccagtca ccaccaccac
caccaccacc 660accaggccgt ccaccagcac cgcccagtcc cagccgtcgt
cgagcccgac cagcccctcc 720agctgcaccg tcgcgaagtg gggccagtgc
ggaggacagg gttacagcgg ctgcaccgtg 780tgcgcggccg ggtcgacctg
ccagaagacc aacgactact acagccagtg cttg 83447303PRTMyceliophthora
thermophila 47Met Lys Gly Leu Leu Gly Ala Ala Ala Leu Ser Leu Ala
Val Ser Asp 1 5 10 15 Val Ser Ala His Tyr Ile Phe Gln Gln Leu Thr
Thr Gly Gly Val Lys 20 25 30 His Ala Val Tyr Gln Tyr Ile Arg Lys
Asn Thr Asn Tyr Asn Ser Pro 35 40 45 Val Thr Asp Leu Thr Ser Asn
Asp Leu Arg Cys Asn Val Gly Ala Thr 50 55 60 Gly Ala Gly Thr Asp
Thr Val Thr Val Arg Ala Gly Asp Ser Phe Thr 65 70 75 80 Phe Thr Thr
Asp Thr Pro Val Tyr His Gln Gly Pro Thr Ser Ile Tyr 85 90 95 Met
Ser Lys Ala Pro Gly Ser Ala Ser Asp Tyr Asp Gly Ser Gly Gly 100 105
110 Trp Phe Lys Ile Lys Asp Trp Gly Ala Asp Phe Ser Ser Gly Gln Ala
115 120 125 Thr Trp Thr Leu Ala Ser Asp Tyr Thr Ala Thr Ile Pro Glu
Cys Ile 130 135 140 Pro Pro Gly Asp Tyr Leu Leu Arg Ile Gln Gln Leu
Gly Ile His Asn 145 150 155 160 Pro Trp Pro Ala Gly Ile Pro Gln Phe
Tyr Ile Ser Cys Ala Gln Ile 165 170 175 Thr Val Thr Gly Gly Gly Ser
Ala Asn Pro Gly Pro Thr Val Ser Ile 180 185 190 Pro Gly Ala Phe Lys
Glu Thr Asp Pro Gly Tyr Thr Val Asn Ile Tyr 195 200 205 Asn Asn Phe
His Asn Tyr Thr Val Pro Gly Pro Ala Val Phe Thr Cys 210 215 220 Asn
Gly Ser Gly Gly Asn Asn Gly Gly Gly Ser Asn Pro Val Thr Thr 225 230
235 240 Thr Thr Thr Thr Thr Thr Arg Pro Ser Thr Ser Thr Ala Gln Ser
Gln 245 250 255 Pro Ser Ser Ser Pro Thr Ser Pro Ser Ser Cys Thr Val
Ala Lys Trp 260 265 270 Gly Gln Cys Gly Gly Gln Gly Tyr Ser Gly Cys
Thr Val Cys Ala Ala 275 280 285 Gly Ser Thr Cys Gln Lys Thr Asn Asp
Tyr Tyr Ser Gln Cys Leu 290 295 300 48284PRTMyceliophthora
thermophila 48His Tyr Ile Phe Gln Gln Leu Thr Thr Gly Gly Val Lys
His Ala Val 1 5 10 15 Tyr Gln Tyr Ile Arg Lys Asn Thr Asn Tyr Asn
Ser Pro Val Thr Asp 20 25 30 Leu Thr Ser Asn Asp Leu Arg Cys Asn
Val Gly Ala Thr Gly Ala Gly 35 40 45 Thr Asp Thr Val Thr Val Arg
Ala Gly Asp Ser Phe Thr Phe Thr Thr 50 55 60 Asp Thr Pro Val Tyr
His Gln Gly Pro Thr Ser Ile Tyr Met Ser Lys 65 70 75 80 Ala Pro Gly
Ser Ala Ser Asp Tyr Asp Gly Ser Gly Gly Trp Phe Lys 85 90 95 Ile
Lys Asp Trp Gly Ala Asp Phe Ser Ser Gly Gln Ala Thr Trp Thr 100 105
110 Leu Ala Ser Asp Tyr Thr Ala Thr Ile Pro Glu Cys Ile Pro Pro Gly
115 120 125 Asp Tyr Leu Leu Arg Ile Gln Gln Leu Gly Ile His Asn Pro
Trp Pro 130 135 140 Ala Gly Ile Pro Gln Phe Tyr Ile Ser Cys Ala Gln
Ile Thr Val Thr 145 150 155 160 Gly Gly Gly Ser Ala Asn Pro Gly Pro
Thr Val Ser Ile Pro Gly Ala 165 170 175 Phe Lys Glu Thr Asp Pro Gly
Tyr Thr Val Asn Ile Tyr Asn Asn Phe 180 185 190 His Asn Tyr Thr Val
Pro Gly Pro Ala Val Phe Thr Cys Asn Gly Ser 195 200 205 Gly Gly Asn
Asn Gly Gly Gly Ser Asn Pro Val Thr Thr Thr Thr Thr 210 215 220 Thr
Thr Thr Arg Pro Ser Thr Ser Thr Ala Gln Ser Gln Pro Ser Ser 225 230
235 240 Ser Pro Thr Ser Pro Ser Ser Cys Thr Val Ala Lys Trp Gly Gln
Cys 245 250 255 Gly Gly Gln Gly Tyr Ser Gly Cys Thr Val Cys Ala Ala
Gly Ser Thr 260 265 270 Cys Gln Lys Thr Asn Asp Tyr Tyr Ser Gln Cys
Leu 275 280 491038DNAMyceliophthora thermophila 49atgtcttcct
tcacctccaa gggtctcctt tccgccctca tgggcgcggc aacggttgcc 60gcccacggtc
acgtcaccaa catcgtcatc aacggcgtct cataccagaa cttcgaccca
120ttcacgcacc cttatatgca gaaccctccg acggttgtcg gctggaccgc
gagcaacacg 180gacaacggct tcgtcggccc cgagtccttc tctagcccgg
acatcatctg ccacaagtcc 240gccaccaacg ctggcggcca tgccgtcgtc
gcggccggcg ataaggtctt catccagtgg 300gacacctggc ccgagtcgca
ccacggtccg gtcatcgact atctcgccga ctgcggcgac 360gcgggctgcg
agaaggtcga caagaccacg ctcaagttct tcaagatcag cgagtccggc
420ctgctcgacg gcactaacgc ccccggcaag tgggcgtccg acacgctgat
cgccaacaac 480aactcgtggc tggtccagat cccgcccaac atcgccccgg
gcaactacgt cctgcgccac 540gagatcatcg ccctgcacag cgccggccag
cagaacggcg cccagaacta ccctcagtgc 600ttcaacctgc aggtcaccgg
ctccggcact cagaagccct ccggcgtcct cggcaccgag 660ctctacaagg
ccaccgacgc cggcatcctg gccaacatct acacctcgcc cgtcacctac
720cagatccccg gcccggccat catctcgggc gcctccgccg tccagcagac
cacctcggcc 780atcaccgcct ctgctagcgc catcaccggc tccgctaccg
ccgcgcccac ggctgccacc 840accaccgccg ccgccgccgc caccactacc
accaccgctg gctccggtgc taccgccacg 900ccctcgaccg gcggctctcc
ttcttccgcc cagcctgctc ctaccaccgc tgccgctacc 960tccagccctg
ctcgcccgac ccgctgcgct ggtctgaaga agcgccgtcg ccacgcccgt
1020gacgtcaagg ttgccctc 103850346PRTMyceliophthora thermophila
50Met Ser Ser Phe Thr Ser Lys Gly Leu Leu Ser Ala Leu Met Gly Ala 1
5 10 15 Ala Thr Val Ala Ala His Gly His Val Thr Asn Ile Val Ile Asn
Gly 20 25 30 Val Ser Tyr Gln Asn Phe Asp Pro Phe Thr His Pro Tyr
Met Gln Asn 35 40 45 Pro Pro Thr Val Val Gly Trp Thr Ala Ser Asn
Thr Asp Asn Gly Phe 50 55 60 Val Gly Pro Glu Ser Phe Ser Ser Pro
Asp Ile Ile Cys His Lys Ser 65 70 75 80 Ala Thr Asn Ala Gly Gly His
Ala Val Val Ala Ala Gly Asp Lys Val 85 90 95 Phe Ile Gln Trp Asp
Thr Trp Pro Glu Ser His His Gly Pro Val Ile 100 105 110 Asp Tyr Leu
Ala Asp Cys Gly Asp Ala Gly Cys Glu Lys Val Asp Lys 115 120 125 Thr
Thr Leu Lys Phe Phe Lys Ile Ser Glu Ser Gly Leu Leu Asp Gly 130 135
140 Thr Asn Ala Pro Gly Lys Trp Ala Ser Asp Thr Leu Ile Ala Asn Asn
145 150 155 160 Asn Ser Trp Leu Val Gln Ile Pro Pro Asn Ile Ala Pro
Gly Asn Tyr 165
170 175 Val Leu Arg His Glu Ile Ile Ala Leu His Ser Ala Gly Gln Gln
Asn 180 185 190 Gly Ala Gln Asn Tyr Pro Gln Cys Phe Asn Leu Gln Val
Thr Gly Ser 195 200 205 Gly Thr Gln Lys Pro Ser Gly Val Leu Gly Thr
Glu Leu Tyr Lys Ala 210 215 220 Thr Asp Ala Gly Ile Leu Ala Asn Ile
Tyr Thr Ser Pro Val Thr Tyr 225 230 235 240 Gln Ile Pro Gly Pro Ala
Ile Ile Ser Gly Ala Ser Ala Val Gln Gln 245 250 255 Thr Thr Ser Ala
Ile Thr Ala Ser Ala Ser Ala Ile Thr Gly Ser Ala 260 265 270 Thr Ala
Ala Pro Thr Ala Ala Thr Thr Thr Ala Ala Ala Ala Ala Thr 275 280 285
Thr Thr Thr Thr Ala Gly Ser Gly Ala Thr Ala Thr Pro Ser Thr Gly 290
295 300 Gly Ser Pro Ser Ser Ala Gln Pro Ala Pro Thr Thr Ala Ala Ala
Thr 305 310 315 320 Ser Ser Pro Ala Arg Pro Thr Arg Cys Ala Gly Leu
Lys Lys Arg Arg 325 330 335 Arg His Ala Arg Asp Val Lys Val Ala Leu
340 345 51326PRTMyceliophthora thermophila 51Ala His Gly His Val
Thr Asn Ile Val Ile Asn Gly Val Ser Tyr Gln 1 5 10 15 Asn Phe Asp
Pro Phe Thr His Pro Tyr Met Gln Asn Pro Pro Thr Val 20 25 30 Val
Gly Trp Thr Ala Ser Asn Thr Asp Asn Gly Phe Val Gly Pro Glu 35 40
45 Ser Phe Ser Ser Pro Asp Ile Ile Cys His Lys Ser Ala Thr Asn Ala
50 55 60 Gly Gly His Ala Val Val Ala Ala Gly Asp Lys Val Phe Ile
Gln Trp 65 70 75 80 Asp Thr Trp Pro Glu Ser His His Gly Pro Val Ile
Asp Tyr Leu Ala 85 90 95 Asp Cys Gly Asp Ala Gly Cys Glu Lys Val
Asp Lys Thr Thr Leu Lys 100 105 110 Phe Phe Lys Ile Ser Glu Ser Gly
Leu Leu Asp Gly Thr Asn Ala Pro 115 120 125 Gly Lys Trp Ala Ser Asp
Thr Leu Ile Ala Asn Asn Asn Ser Trp Leu 130 135 140 Val Gln Ile Pro
Pro Asn Ile Ala Pro Gly Asn Tyr Val Leu Arg His 145 150 155 160 Glu
Ile Ile Ala Leu His Ser Ala Gly Gln Gln Asn Gly Ala Gln Asn 165 170
175 Tyr Pro Gln Cys Phe Asn Leu Gln Val Thr Gly Ser Gly Thr Gln Lys
180 185 190 Pro Ser Gly Val Leu Gly Thr Glu Leu Tyr Lys Ala Thr Asp
Ala Gly 195 200 205 Ile Leu Ala Asn Ile Tyr Thr Ser Pro Val Thr Tyr
Gln Ile Pro Gly 210 215 220 Pro Ala Ile Ile Ser Gly Ala Ser Ala Val
Gln Gln Thr Thr Ser Ala 225 230 235 240 Ile Thr Ala Ser Ala Ser Ala
Ile Thr Gly Ser Ala Thr Ala Ala Pro 245 250 255 Thr Ala Ala Thr Thr
Thr Ala Ala Ala Ala Ala Thr Thr Thr Thr Thr 260 265 270 Ala Gly Ser
Gly Ala Thr Ala Thr Pro Ser Thr Gly Gly Ser Pro Ser 275 280 285 Ser
Ala Gln Pro Ala Pro Thr Thr Ala Ala Ala Thr Ser Ser Pro Ala 290 295
300 Arg Pro Thr Arg Cys Ala Gly Leu Lys Lys Arg Arg Arg His Ala Arg
305 310 315 320 Asp Val Lys Val Ala Leu 325 52714DNAMyceliophthora
thermophila 52atgaagacgc tcgccgccct cgtggtctcg gccgccctcg
tggccgcgca cggctatgtt 60gaccacgcca cgatcggtgg caaggattat cagttctacc
agccgtacca ggacccttac 120atgggcgaca acaagcccga tagggtttcc
cgctccatcc cgggcaacgg ccccgtggag 180gacgtcaact ccatcgacct
ccagtgccac gccggtgccg aaccggccaa gctccacgcc 240cccgccgccg
ccggctcgac cgtgacgctc tactggaccc tctggcccga ctcccacgtc
300ggccccgtca tcacctacat ggctcgctgc cccgacaccg gctgccagga
ctggtccccg 360ggaactaagc ccgtttggtt caagatcaag gaaggcggcc
gtgagggcac ctccaatacc 420ccgctcatga cggccccctc cgcctacacc
tacacgatcc cgtcctgcct caagagcggc 480tactacctcg tccgccacga
gatcatcgcc ctgcactcgg cctggcagta ccccggcgcc 540cagttctacc
cgggctgcca ccagctccag gtcaccggcg gcggctccac cgtgccctct
600accaacctgg tctccttccc cggcgcctac aaggggagcg accccggcat
cacctacgac 660gcttacaagg cgcaacctta caccatccct ggcccggccg
tgtttacctg ctga 71453237PRTMyceliophthora thermophila 53Met Lys Thr
Leu Ala Ala Leu Val Val Ser Ala Ala Leu Val Ala Ala 1 5 10 15 His
Gly Tyr Val Asp His Ala Thr Ile Gly Gly Lys Asp Tyr Gln Phe 20 25
30 Tyr Gln Pro Tyr Gln Asp Pro Tyr Met Gly Asp Asn Lys Pro Asp Arg
35 40 45 Val Ser Arg Ser Ile Pro Gly Asn Gly Pro Val Glu Asp Val
Asn Ser 50 55 60 Ile Asp Leu Gln Cys His Ala Gly Ala Glu Pro Ala
Lys Leu His Ala 65 70 75 80 Pro Ala Ala Ala Gly Ser Thr Val Thr Leu
Tyr Trp Thr Leu Trp Pro 85 90 95 Asp Ser His Val Gly Pro Val Ile
Thr Tyr Met Ala Arg Cys Pro Asp 100 105 110 Thr Gly Cys Gln Asp Trp
Ser Pro Gly Thr Lys Pro Val Trp Phe Lys 115 120 125 Ile Lys Glu Gly
Gly Arg Glu Gly Thr Ser Asn Thr Pro Leu Met Thr 130 135 140 Ala Pro
Ser Ala Tyr Thr Tyr Thr Ile Pro Ser Cys Leu Lys Ser Gly 145 150 155
160 Tyr Tyr Leu Val Arg His Glu Ile Ile Ala Leu His Ser Ala Trp Gln
165 170 175 Tyr Pro Gly Ala Gln Phe Tyr Pro Gly Cys His Gln Leu Gln
Val Thr 180 185 190 Gly Gly Gly Ser Thr Val Pro Ser Thr Asn Leu Val
Ser Phe Pro Gly 195 200 205 Ala Tyr Lys Gly Ser Asp Pro Gly Ile Thr
Tyr Asp Ala Tyr Lys Ala 210 215 220 Gln Pro Tyr Thr Ile Pro Gly Pro
Ala Val Phe Thr Cys 225 230 235 54219PRTMyceliophthora thermophila
54Tyr Val Asp His Ala Thr Ile Gly Gly Lys Asp Tyr Gln Phe Tyr Gln 1
5 10 15 Pro Tyr Gln Asp Pro Tyr Met Gly Asp Asn Lys Pro Asp Arg Val
Ser 20 25 30 Arg Ser Ile Pro Gly Asn Gly Pro Val Glu Asp Val Asn
Ser Ile Asp 35 40 45 Leu Gln Cys His Ala Gly Ala Glu Pro Ala Lys
Leu His Ala Pro Ala 50 55 60 Ala Ala Gly Ser Thr Val Thr Leu Tyr
Trp Thr Leu Trp Pro Asp Ser 65 70 75 80 His Val Gly Pro Val Ile Thr
Tyr Met Ala Arg Cys Pro Asp Thr Gly 85 90 95 Cys Gln Asp Trp Ser
Pro Gly Thr Lys Pro Val Trp Phe Lys Ile Lys 100 105 110 Glu Gly Gly
Arg Glu Gly Thr Ser Asn Thr Pro Leu Met Thr Ala Pro 115 120 125 Ser
Ala Tyr Thr Tyr Thr Ile Pro Ser Cys Leu Lys Ser Gly Tyr Tyr 130 135
140 Leu Val Arg His Glu Ile Ile Ala Leu His Ser Ala Trp Gln Tyr Pro
145 150 155 160 Gly Ala Gln Phe Tyr Pro Gly Cys His Gln Leu Gln Val
Thr Gly Gly 165 170 175 Gly Ser Thr Val Pro Ser Thr Asn Leu Val Ser
Phe Pro Gly Ala Tyr 180 185 190 Lys Gly Ser Asp Pro Gly Ile Thr Tyr
Asp Ala Tyr Lys Ala Gln Pro 195 200 205 Tyr Thr Ile Pro Gly Pro Ala
Val Phe Thr Cys 210 215 55723DNAMyceliophthora thermophila
55atgaagacgc tcgccgccct cgtggtctcg gccgccctcg tggccgcgca cggctatgtt
60gaccacgcca cgatcggtgg caaggattat cagttctacc agccgtacca ggacccttac
120atgggcgaca acaagcccga tagggtttcc cgctccatcc cgggcaacgg
ccccgtggag 180gacgtcaact ccatcgacct ccagtgccac gccggtgccg
aaccggccaa gctccacgcc 240cccgccgccg ccggctcgac cgtgacgctc
tactggaccc tctggcccga ctcccacgtc 300ggccccgtca tcacctacat
ggctcgctgc cccgacaccg gctgccagga ctggtccccg 360ggaactaagc
ccgtttggtt caagatcaag gaaggcggcc gtgagggcac ctccaatgtc
420tgggctgcta ccccgctcat gacggccccc tccgcctaca cctacacgat
cccgtcctgc 480ctcaagagcg gctactacct cgtccgccac gagatcatcg
ccctgcactc ggcctggcag 540taccccggcg cccagttcta cccgggctgc
caccagctcc aggtcaccgg cggcggctcc 600accgtgccct ctaccaacct
ggtctccttc cccggcgcct acaaggggag cgaccccggc 660atcacctacg
acgcttacaa ggcgcaacct tacaccatcc ctggcccggc cgtgtttacc 720tgc
72356241PRTMyceliophthora thermophila 56Met Lys Thr Leu Ala Ala Leu
Val Val Ser Ala Ala Leu Val Ala Ala 1 5 10 15 His Gly Tyr Val Asp
His Ala Thr Ile Gly Gly Lys Asp Tyr Gln Phe 20 25 30 Tyr Gln Pro
Tyr Gln Asp Pro Tyr Met Gly Asp Asn Lys Pro Asp Arg 35 40 45 Val
Ser Arg Ser Ile Pro Gly Asn Gly Pro Val Glu Asp Val Asn Ser 50 55
60 Ile Asp Leu Gln Cys His Ala Gly Ala Glu Pro Ala Lys Leu His Ala
65 70 75 80 Pro Ala Ala Ala Gly Ser Thr Val Thr Leu Tyr Trp Thr Leu
Trp Pro 85 90 95 Asp Ser His Val Gly Pro Val Ile Thr Tyr Met Ala
Arg Cys Pro Asp 100 105 110 Thr Gly Cys Gln Asp Trp Ser Pro Gly Thr
Lys Pro Val Trp Phe Lys 115 120 125 Ile Lys Glu Gly Gly Arg Glu Gly
Thr Ser Asn Val Trp Ala Ala Thr 130 135 140 Pro Leu Met Thr Ala Pro
Ser Ala Tyr Thr Tyr Thr Ile Pro Ser Cys 145 150 155 160 Leu Lys Ser
Gly Tyr Tyr Leu Val Arg His Glu Ile Ile Ala Leu His 165 170 175 Ser
Ala Trp Gln Tyr Pro Gly Ala Gln Phe Tyr Pro Gly Cys His Gln 180 185
190 Leu Gln Val Thr Gly Gly Gly Ser Thr Val Pro Ser Thr Asn Leu Val
195 200 205 Ser Phe Pro Gly Ala Tyr Lys Gly Ser Asp Pro Gly Ile Thr
Tyr Asp 210 215 220 Ala Tyr Lys Ala Gln Pro Tyr Thr Ile Pro Gly Pro
Ala Val Phe Thr 225 230 235 240 Cys 57223PRTMyceliophthora
thermophila 57Tyr Val Asp His Ala Thr Ile Gly Gly Lys Asp Tyr Gln
Phe Tyr Gln 1 5 10 15 Pro Tyr Gln Asp Pro Tyr Met Gly Asp Asn Lys
Pro Asp Arg Val Ser 20 25 30 Arg Ser Ile Pro Gly Asn Gly Pro Val
Glu Asp Val Asn Ser Ile Asp 35 40 45 Leu Gln Cys His Ala Gly Ala
Glu Pro Ala Lys Leu His Ala Pro Ala 50 55 60 Ala Ala Gly Ser Thr
Val Thr Leu Tyr Trp Thr Leu Trp Pro Asp Ser 65 70 75 80 His Val Gly
Pro Val Ile Thr Tyr Met Ala Arg Cys Pro Asp Thr Gly 85 90 95 Cys
Gln Asp Trp Ser Pro Gly Thr Lys Pro Val Trp Phe Lys Ile Lys 100 105
110 Glu Gly Gly Arg Glu Gly Thr Ser Asn Val Trp Ala Ala Thr Pro Leu
115 120 125 Met Thr Ala Pro Ser Ala Tyr Thr Tyr Thr Ile Pro Ser Cys
Leu Lys 130 135 140 Ser Gly Tyr Tyr Leu Val Arg His Glu Ile Ile Ala
Leu His Ser Ala 145 150 155 160 Trp Gln Tyr Pro Gly Ala Gln Phe Tyr
Pro Gly Cys His Gln Leu Gln 165 170 175 Val Thr Gly Gly Gly Ser Thr
Val Pro Ser Thr Asn Leu Val Ser Phe 180 185 190 Pro Gly Ala Tyr Lys
Gly Ser Asp Pro Gly Ile Thr Tyr Asp Ala Tyr 195 200 205 Lys Ala Gln
Pro Tyr Thr Ile Pro Gly Pro Ala Val Phe Thr Cys 210 215 220
58675DNAMyceliophthora thermophila 58atgagatact tcctccagct
cgctgcggcc gcggcctttg ccgtgaacag cgcggcgggt 60cactacatct tccagcagtt
cgcgacgggc gggtccaagt acccgccctg gaagtacatc 120cggcgcaaca
ccaacccgga ctggctgcag aacgggccgg tgacggacct gtcgtcgacc
180gacctgcgct gcaacgtggg cgggcaggtc agcaacggga ccgagaccat
caccttgaac 240gccggcgacg agttcagctt catcctcgac acgcccgtct
accatgccgg ccccacctcg 300ctctacatgt ccaaggcgcc cggagctgtg
gccgactacg acggcggcgg ggcctggttc 360aagatctacg actggggtcc
gtcggggacg agctggacgt tgagtggcac gtacactcag 420agaattccca
agtgcatccc tgacggcgag tacctcctcc gcatccagca gatcgggctc
480cacaaccccg gcgccgcgcc acagttctac atcagctgcg ctcaagtcaa
ggtcgtcgat 540ggcggcagca ccaatccgac cccgaccgcc cagattccgg
gagccttcca cagcaacgac 600cctggcttga ctgtcaatat ctacaacgac
cctctcacca actacgtcgt cccgggacct 660agagtttcgc actgg
67559225PRTMyceliophthora thermophila 59Met Arg Tyr Phe Leu Gln Leu
Ala Ala Ala Ala Ala Phe Ala Val Asn 1 5 10 15 Ser Ala Ala Gly His
Tyr Ile Phe Gln Gln Phe Ala Thr Gly Gly Ser 20 25 30 Lys Tyr Pro
Pro Trp Lys Tyr Ile Arg Arg Asn Thr Asn Pro Asp Trp 35 40 45 Leu
Gln Asn Gly Pro Val Thr Asp Leu Ser Ser Thr Asp Leu Arg Cys 50 55
60 Asn Val Gly Gly Gln Val Ser Asn Gly Thr Glu Thr Ile Thr Leu Asn
65 70 75 80 Ala Gly Asp Glu Phe Ser Phe Ile Leu Asp Thr Pro Val Tyr
His Ala 85 90 95 Gly Pro Thr Ser Leu Tyr Met Ser Lys Ala Pro Gly
Ala Val Ala Asp 100 105 110 Tyr Asp Gly Gly Gly Ala Trp Phe Lys Ile
Tyr Asp Trp Gly Pro Ser 115 120 125 Gly Thr Ser Trp Thr Leu Ser Gly
Thr Tyr Thr Gln Arg Ile Pro Lys 130 135 140 Cys Ile Pro Asp Gly Glu
Tyr Leu Leu Arg Ile Gln Gln Ile Gly Leu 145 150 155 160 His Asn Pro
Gly Ala Ala Pro Gln Phe Tyr Ile Ser Cys Ala Gln Val 165 170 175 Lys
Val Val Asp Gly Gly Ser Thr Asn Pro Thr Pro Thr Ala Gln Ile 180 185
190 Pro Gly Ala Phe His Ser Asn Asp Pro Gly Leu Thr Val Asn Ile Tyr
195 200 205 Asn Asp Pro Leu Thr Asn Tyr Val Val Pro Gly Pro Arg Val
Ser His 210 215 220 Trp 225 60205PRTMyceliophthora thermophila
60His Tyr Ile Phe Gln Gln Phe Ala Thr Gly Gly Ser Lys Tyr Pro Pro 1
5 10 15 Trp Lys Tyr Ile Arg Arg Asn Thr Asn Pro Asp Trp Leu Gln Asn
Gly 20 25 30 Pro Val Thr Asp Leu Ser Ser Thr Asp Leu Arg Cys Asn
Val Gly Gly 35 40 45 Gln Val Ser Asn Gly Thr Glu Thr Ile Thr Leu
Asn Ala Gly Asp Glu 50 55 60 Phe Ser Phe Ile Leu Asp Thr Pro Val
Tyr His Ala Gly Pro Thr Ser 65 70 75 80 Leu Tyr Met Ser Lys Ala Pro
Gly Ala Val Ala Asp Tyr Asp Gly Gly 85 90 95 Gly Ala Trp Phe Lys
Ile Tyr Asp Trp Gly Pro Ser Gly Thr Ser Trp 100 105 110 Thr Leu Ser
Gly Thr Tyr Thr Gln Arg Ile Pro Lys Cys Ile Pro Asp 115 120 125 Gly
Glu Tyr Leu Leu Arg Ile Gln Gln Ile Gly Leu His Asn Pro Gly 130 135
140 Ala Ala Pro Gln Phe Tyr Ile Ser Cys Ala Gln Val Lys Val Val Asp
145 150 155 160 Gly Gly Ser Thr Asn Pro Thr Pro Thr Ala Gln Ile Pro
Gly Ala Phe 165 170 175 His Ser Asn Asp Pro Gly Leu Thr Val Asn Ile
Tyr Asn Asp Pro Leu 180 185 190 Thr Asn Tyr Val Val Pro Gly Pro Arg
Val Ser His Trp 195 200 205 611332DNAMyceliophthora thermophila
61atgcacccct cccttctttt cacgcttggg ctggcgagcg tgcttgtccc cctctcgtct
60gcacacacta ccttcacgac cctcttcgtc aacgatgtca accaaggtga tggtacctgc
120attcgcatgg cgaagaaggg caatgtcgcc acccatcctc tcgcaggcgg
tctcgactcc 180gaagacatgg cctgtggtcg ggatggtcaa gaacccgtgg
catttacgtg tccggcccca 240gctggtgcca agttgactct cgagtttcgc
atgtgggccg atgcttcgca gtccggatcg 300atcgatccat cccaccttgg
cgtcatggcc atctacctca agaaggtttc cgacatgaaa 360tctgacgcgg
ccgctggccc gggctggttc aagatttggg accaaggcta cgacttggcg
420gccaagaagt gggccaccga gaagctcatc gacaacaacg gcctcctgag
cgtcaacctt 480ccaaccggct taccaaccgg ctactacctc gcccgccagg
agatcatcac gctccaaaac 540gttaccaatg acaggccaga gccccagttc
tacgtcggct gcgcacagct ctacgtcgag 600ggcacctcgg actcacccat
cccctcggac aagacggtct ccattcccgg ccacatcagc 660gacccggccg
acccgggcct gaccttcaac gtctacacgg gcgacgcatc cacctacaag
720ccgcccggcc ccgaggttta cttccccacc accaccacca ccacctcctc
ctcctcctcc 780ggaagcagcg acaacaaggg agccaggcgc cagcaaaccc
ccgacgacaa gcaggccgac 840ggcctcgttc cagccgactg cctcgtcaag
aacgcgaact ggtgcgccgc tgccctgccg 900ccgtacaccg acgaggccgg
ctgctgggcc gccgccgagg actgcaacaa gcagctggac 960gcgtgctaca
ccagcgcacc cccctcgggc agcaaggggt gcaaggtctg ggaggagcag
1020gtgtgcaccg tcgtctcgca gaagtgcgag gccggggatt tcaaggggcc
cccgcagctc 1080gggaaggagc tcggcgaggg gatcgatgag cctattccgg
ggggaaagct gcccccggcg 1140gtcaacgcgg gagagaacgg gaatcatggc
ggaggtggtg gtgatgatgg tgatgatgat 1200aatgatgagg ccggggctgg
ggcagcgtcg actccgactt ttgctgctcc tggtgcggcc 1260aagactcccc
aaccaaactc cgagagggcc cggcgccgtg aggcgcattg gcggcgactg
1320gaatctgctg ag 133262444PRTMyceliophthora thermophila 62Met His
Pro Ser Leu Leu Phe Thr Leu Gly Leu Ala Ser Val Leu Val 1 5 10 15
Pro Leu Ser Ser Ala His Thr Thr Phe Thr Thr Leu Phe Val Asn Asp 20
25 30 Val Asn Gln Gly Asp Gly Thr Cys Ile Arg Met Ala Lys Lys Gly
Asn 35 40 45 Val Ala Thr His Pro Leu Ala Gly Gly Leu Asp Ser Glu
Asp Met Ala 50 55 60 Cys Gly Arg Asp Gly Gln Glu Pro Val Ala Phe
Thr Cys Pro Ala Pro 65 70 75 80 Ala Gly Ala Lys Leu Thr Leu Glu Phe
Arg Met Trp Ala Asp Ala Ser 85 90 95 Gln Ser Gly Ser Ile Asp Pro
Ser His Leu Gly Val Met Ala Ile Tyr 100 105 110 Leu Lys Lys Val Ser
Asp Met Lys Ser Asp Ala Ala Ala Gly Pro Gly 115 120 125 Trp Phe Lys
Ile Trp Asp Gln Gly Tyr Asp Leu Ala Ala Lys Lys Trp 130 135 140 Ala
Thr Glu Lys Leu Ile Asp Asn Asn Gly Leu Leu Ser Val Asn Leu 145 150
155 160 Pro Thr Gly Leu Pro Thr Gly Tyr Tyr Leu Ala Arg Gln Glu Ile
Ile 165 170 175 Thr Leu Gln Asn Val Thr Asn Asp Arg Pro Glu Pro Gln
Phe Tyr Val 180 185 190 Gly Cys Ala Gln Leu Tyr Val Glu Gly Thr Ser
Asp Ser Pro Ile Pro 195 200 205 Ser Asp Lys Thr Val Ser Ile Pro Gly
His Ile Ser Asp Pro Ala Asp 210 215 220 Pro Gly Leu Thr Phe Asn Val
Tyr Thr Gly Asp Ala Ser Thr Tyr Lys 225 230 235 240 Pro Pro Gly Pro
Glu Val Tyr Phe Pro Thr Thr Thr Thr Thr Thr Ser 245 250 255 Ser Ser
Ser Ser Gly Ser Ser Asp Asn Lys Gly Ala Arg Arg Gln Gln 260 265 270
Thr Pro Asp Asp Lys Gln Ala Asp Gly Leu Val Pro Ala Asp Cys Leu 275
280 285 Val Lys Asn Ala Asn Trp Cys Ala Ala Ala Leu Pro Pro Tyr Thr
Asp 290 295 300 Glu Ala Gly Cys Trp Ala Ala Ala Glu Asp Cys Asn Lys
Gln Leu Asp 305 310 315 320 Ala Cys Tyr Thr Ser Ala Pro Pro Ser Gly
Ser Lys Gly Cys Lys Val 325 330 335 Trp Glu Glu Gln Val Cys Thr Val
Val Ser Gln Lys Cys Glu Ala Gly 340 345 350 Asp Phe Lys Gly Pro Pro
Gln Leu Gly Lys Glu Leu Gly Glu Gly Ile 355 360 365 Asp Glu Pro Ile
Pro Gly Gly Lys Leu Pro Pro Ala Val Asn Ala Gly 370 375 380 Glu Asn
Gly Asn His Gly Gly Gly Gly Gly Asp Asp Gly Asp Asp Asp 385 390 395
400 Asn Asp Glu Ala Gly Ala Gly Ala Ala Ser Thr Pro Thr Phe Ala Ala
405 410 415 Pro Gly Ala Ala Lys Thr Pro Gln Pro Asn Ser Glu Arg Ala
Arg Arg 420 425 430 Arg Glu Ala His Trp Arg Arg Leu Glu Ser Ala Glu
435 440 63423PRTMyceliophthora thermophila 63His Thr Thr Phe Thr
Thr Leu Phe Val Asn Asp Val Asn Gln Gly Asp 1 5 10 15 Gly Thr Cys
Ile Arg Met Ala Lys Lys Gly Asn Val Ala Thr His Pro 20 25 30 Leu
Ala Gly Gly Leu Asp Ser Glu Asp Met Ala Cys Gly Arg Asp Gly 35 40
45 Gln Glu Pro Val Ala Phe Thr Cys Pro Ala Pro Ala Gly Ala Lys Leu
50 55 60 Thr Leu Glu Phe Arg Met Trp Ala Asp Ala Ser Gln Ser Gly
Ser Ile 65 70 75 80 Asp Pro Ser His Leu Gly Val Met Ala Ile Tyr Leu
Lys Lys Val Ser 85 90 95 Asp Met Lys Ser Asp Ala Ala Ala Gly Pro
Gly Trp Phe Lys Ile Trp 100 105 110 Asp Gln Gly Tyr Asp Leu Ala Ala
Lys Lys Trp Ala Thr Glu Lys Leu 115 120 125 Ile Asp Asn Asn Gly Leu
Leu Ser Val Asn Leu Pro Thr Gly Leu Pro 130 135 140 Thr Gly Tyr Tyr
Leu Ala Arg Gln Glu Ile Ile Thr Leu Gln Asn Val 145 150 155 160 Thr
Asn Asp Arg Pro Glu Pro Gln Phe Tyr Val Gly Cys Ala Gln Leu 165 170
175 Tyr Val Glu Gly Thr Ser Asp Ser Pro Ile Pro Ser Asp Lys Thr Val
180 185 190 Ser Ile Pro Gly His Ile Ser Asp Pro Ala Asp Pro Gly Leu
Thr Phe 195 200 205 Asn Val Tyr Thr Gly Asp Ala Ser Thr Tyr Lys Pro
Pro Gly Pro Glu 210 215 220 Val Tyr Phe Pro Thr Thr Thr Thr Thr Thr
Ser Ser Ser Ser Ser Gly 225 230 235 240 Ser Ser Asp Asn Lys Gly Ala
Arg Arg Gln Gln Thr Pro Asp Asp Lys 245 250 255 Gln Ala Asp Gly Leu
Val Pro Ala Asp Cys Leu Val Lys Asn Ala Asn 260 265 270 Trp Cys Ala
Ala Ala Leu Pro Pro Tyr Thr Asp Glu Ala Gly Cys Trp 275 280 285 Ala
Ala Ala Glu Asp Cys Asn Lys Gln Leu Asp Ala Cys Tyr Thr Ser 290 295
300 Ala Pro Pro Ser Gly Ser Lys Gly Cys Lys Val Trp Glu Glu Gln Val
305 310 315 320 Cys Thr Val Val Ser Gln Lys Cys Glu Ala Gly Asp Phe
Lys Gly Pro 325 330 335 Pro Gln Leu Gly Lys Glu Leu Gly Glu Gly Ile
Asp Glu Pro Ile Pro 340 345 350 Gly Gly Lys Leu Pro Pro Ala Val Asn
Ala Gly Glu Asn Gly Asn His 355 360 365 Gly Gly Gly Gly Gly Asp Asp
Gly Asp Asp Asp Asn Asp Glu Ala Gly 370 375 380 Ala Gly Ala Ala Ser
Thr Pro Thr Phe Ala Ala Pro Gly Ala Ala Lys 385 390 395 400 Thr Pro
Gln Pro Asn Ser Glu Arg Ala Arg Arg Arg Glu Ala His Trp 405 410 415
Arg Arg Leu Glu Ser Ala Glu 420 64834DNAMyceliophthora thermophila
64atgttttctc tcaagttctt tatcttggcc ggtgggcttg ctgtcctcac cgaggctcac
60ataagactag tgtcgcccgc cccttttacc aaccctgacc agggccccag cccactccta
120gaggctggca gcgactatcc ctgccacaac ggcaatgggg gcggttatca
gggaacgcca 180acccagatgg caaagggttc taagcagcag ctagccttcc
aggggtctgc cgttcatggg 240ggtggctcct gccaagtgtc catcacctac
gacgaaaacc cgaccgctca gagctccttc 300aaggtcattc actcgattca
aggtggctgc cccgccaggg ccgagacgat cccggattgc 360agcgcacaaa
atatcaacgc ctgcaatata aagcccgata atgcccagat ggacaccccg
420gataagtatg agttcacgat cccggaggat ctccccagtg gcaaggccac
cctcgcctgg 480acatggatca acactatcgg caaccgcgag ttttatatgg
catgcgcccc ggttgagatc 540accggcgacg gcggtagcga gtcggctctg
gctgcgctgc ccgacatggt cattgccaac 600atcccgtcca tcggaggaac
ctgcgcgacc gaggagggga agtactacga atatcccaac 660cccggtaagt
cggtcgaaac catcccgggc tggaccgatt tggttcccct gcaaggcgaa
720tgcggtgctg cctccggtgt ctcgggctcc ggcggaaacg ccagcagtgc
tacccctgcc 780gcaggggccg ccccgactcc tgctgtccgc ggccgccgtc
ccacctggaa cgcc 83465278PRTMyceliophthora thermophila 65Met Phe Ser
Leu Lys Phe Phe Ile Leu Ala Gly Gly Leu Ala Val Leu 1 5 10 15 Thr
Glu Ala His Ile Arg Leu Val Ser Pro Ala Pro Phe Thr Asn Pro 20 25
30 Asp Gln Gly Pro Ser Pro Leu Leu Glu Ala Gly Ser Asp Tyr Pro Cys
35 40 45 His Asn Gly Asn Gly Gly Gly Tyr Gln Gly Thr Pro Thr Gln
Met Ala 50 55 60 Lys Gly Ser Lys Gln Gln Leu Ala Phe Gln Gly Ser
Ala Val His Gly 65 70 75 80 Gly Gly Ser Cys Gln Val Ser Ile Thr Tyr
Asp Glu Asn Pro Thr Ala 85 90 95 Gln Ser Ser Phe Lys Val Ile His
Ser Ile Gln Gly Gly Cys Pro Ala 100 105 110 Arg Ala Glu Thr Ile Pro
Asp Cys Ser Ala Gln Asn Ile Asn Ala Cys 115 120 125 Asn Ile Lys Pro
Asp Asn Ala Gln Met Asp Thr Pro Asp Lys Tyr Glu 130 135 140 Phe Thr
Ile Pro Glu Asp Leu Pro Ser Gly Lys Ala Thr Leu Ala Trp 145 150 155
160 Thr Trp Ile Asn Thr Ile Gly Asn Arg Glu Phe Tyr Met Ala Cys Ala
165 170 175 Pro Val Glu Ile Thr Gly Asp Gly Gly Ser Glu Ser Ala Leu
Ala Ala 180 185 190 Leu Pro Asp Met Val Ile Ala Asn Ile Pro Ser Ile
Gly Gly Thr Cys 195 200 205 Ala Thr Glu Glu Gly Lys Tyr Tyr Glu Tyr
Pro Asn Pro Gly Lys Ser 210 215 220 Val Glu Thr Ile Pro Gly Trp Thr
Asp Leu Val Pro Leu Gln Gly Glu 225 230 235 240 Cys Gly Ala Ala Ser
Gly Val Ser Gly Ser Gly Gly Asn Ala Ser Ser 245 250 255 Ala Thr Pro
Ala Ala Gly Ala Ala Pro Thr Pro Ala Val Arg Gly Arg 260 265 270 Arg
Pro Thr Trp Asn Ala 275 66259PRTMyceliophthora thermophila 66His
Ile Arg Leu Val Ser Pro Ala Pro Phe Thr Asn Pro Asp Gln Gly 1 5 10
15 Pro Ser Pro Leu Leu Glu Ala Gly Ser Asp Tyr Pro Cys His Asn Gly
20 25 30 Asn Gly Gly Gly Tyr Gln Gly Thr Pro Thr Gln Met Ala Lys
Gly Ser 35 40 45 Lys Gln Gln Leu Ala Phe Gln Gly Ser Ala Val His
Gly Gly Gly Ser 50 55 60 Cys Gln Val Ser Ile Thr Tyr Asp Glu Asn
Pro Thr Ala Gln Ser Ser 65 70 75 80 Phe Lys Val Ile His Ser Ile Gln
Gly Gly Cys Pro Ala Arg Ala Glu 85 90 95 Thr Ile Pro Asp Cys Ser
Ala Gln Asn Ile Asn Ala Cys Asn Ile Lys 100 105 110 Pro Asp Asn Ala
Gln Met Asp Thr Pro Asp Lys Tyr Glu Phe Thr Ile 115 120 125 Pro Glu
Asp Leu Pro Ser Gly Lys Ala Thr Leu Ala Trp Thr Trp Ile 130 135 140
Asn Thr Ile Gly Asn Arg Glu Phe Tyr Met Ala Cys Ala Pro Val Glu 145
150 155 160 Ile Thr Gly Asp Gly Gly Ser Glu Ser Ala Leu Ala Ala Leu
Pro Asp 165 170 175 Met Val Ile Ala Asn Ile Pro Ser Ile Gly Gly Thr
Cys Ala Thr Glu 180 185 190 Glu Gly Lys Tyr Tyr Glu Tyr Pro Asn Pro
Gly Lys Ser Val Glu Thr 195 200 205 Ile Pro Gly Trp Thr Asp Leu Val
Pro Leu Gln Gly Glu Cys Gly Ala 210 215 220 Ala Ser Gly Val Ser Gly
Ser Gly Gly Asn Ala Ser Ser Ala Thr Pro 225 230 235 240 Ala Ala Gly
Ala Ala Pro Thr Pro Ala Val Arg Gly Arg Arg Pro Thr 245 250 255 Trp
Asn Ala 67672DNAMyceliophthora thermophila 67atgaagctcg ccacgctcct
cgccgccctc accctcgggg tggccgacca gctcagcgtc 60gggtccagaa agtttggcgt
gtacgagcac attcgcaaga acacgaacta caactcgccc 120gttaccgacc
tgtcggacac caacctgcgc tgcaacgtcg gcgggggctc gggcaccagc
180accaccgtgc tcgacgtcaa ggccggagac tcgttcacct tcttcagcga
cgttgccgtc 240taccaccagg ggcccatctc gctgtgcgtg gaccggacca
gtgcagagag catggatgga 300cgggaaccgg acatgcgctg ccgaactggc
tcacaagctg gctacctggc ggtgactgac 360tacgacgggt ccggtgactg
tttcaagatc tatgactggg gaccgacgtt caacgggggc 420caggcgtcgt
ggccgacgag gaattcgtac gagtacagca tcctcaagtg catcagggac
480ggcgaatacc tactgcggat tcagtccctg gccatccata acccaggtgc
ccttccgcag 540ttctacatca gctgcgccca ggtgaatgtg acgggcggag
gcaccgtcac cccgagatca 600aggcgaccga tcctgatcta tttcaacttc
cactcgtata tcgtccctgg gccggcagtg 660ttcaagtgct ag
67268223PRTMyceliophthora thermophila 68Met Lys Leu Ala Thr Leu Leu
Ala Ala Leu Thr Leu Gly Val Ala Asp 1 5 10 15 Gln Leu Ser Val Gly
Ser Arg Lys Phe Gly Val Tyr Glu His Ile Arg 20 25 30 Lys Asn Thr
Asn Tyr Asn Ser Pro Val Thr Asp Leu Ser Asp Thr Asn 35 40 45 Leu
Arg Cys Asn Val Gly Gly Gly Ser Gly Thr Ser Thr Thr Val Leu 50 55
60 Asp Val Lys Ala Gly Asp Ser Phe Thr Phe Phe Ser Asp Val Ala Val
65 70 75 80 Tyr His Gln Gly Pro Ile Ser Leu Cys Val Asp Arg Thr Ser
Ala Glu 85 90 95 Ser Met Asp Gly Arg Glu Pro Asp Met Arg Cys Arg
Thr Gly Ser Gln 100 105 110 Ala Gly Tyr Leu Ala Val Thr Asp Tyr Asp
Gly Ser Gly Asp Cys Phe 115 120 125 Lys Ile Tyr Asp Trp Gly Pro Thr
Phe Asn Gly Gly Gln Ala Ser Trp 130 135 140 Pro Thr Arg Asn Ser Tyr
Glu Tyr Ser Ile Leu Lys Cys Ile Arg Asp 145 150 155 160 Gly Glu Tyr
Leu Leu Arg Ile Gln Ser Leu Ala Ile His Asn Pro Gly 165 170 175 Ala
Leu Pro Gln Phe Tyr Ile Ser Cys Ala Gln Val Asn Val Thr Gly 180 185
190 Gly Gly Thr Val Thr Pro Arg Ser Arg Arg Pro Ile Leu Ile Tyr Phe
195 200 205 Asn Phe His Ser Tyr Ile Val Pro Gly Pro Ala Val Phe Lys
Cys 210 215 220 69208PRTMyceliophthora thermophila 69Asp Gln Leu
Ser Val Gly Ser Arg Lys Phe Gly Val Tyr Glu His Ile 1 5 10 15 Arg
Lys Asn Thr Asn Tyr Asn Ser Pro Val Thr Asp Leu Ser Asp Thr 20 25
30 Asn Leu Arg Cys Asn Val Gly Gly Gly Ser Gly Thr Ser Thr Thr Val
35 40 45 Leu Asp Val Lys Ala Gly Asp Ser Phe Thr Phe Phe Ser Asp
Val Ala 50 55 60 Val Tyr His Gln Gly Pro Ile Ser Leu Cys Val Asp
Arg Thr Ser Ala 65 70 75 80 Glu Ser Met Asp Gly Arg Glu Pro Asp Met
Arg Cys Arg Thr Gly Ser 85 90 95 Gln Ala Gly Tyr Leu Ala Val Thr
Asp Tyr Asp Gly Ser Gly Asp Cys 100 105 110 Phe Lys Ile Tyr Asp Trp
Gly Pro Thr Phe Asn Gly Gly Gln Ala Ser 115 120 125 Trp Pro Thr Arg
Asn Ser Tyr Glu Tyr Ser Ile Leu Lys Cys Ile Arg 130 135 140 Asp Gly
Glu Tyr Leu Leu Arg Ile Gln Ser Leu Ala Ile His Asn Pro 145 150 155
160 Gly Ala Leu Pro Gln Phe Tyr Ile Ser Cys Ala Gln Val Asn Val Thr
165 170 175 Gly Gly Gly Thr Val Thr Pro Arg Ser Arg Arg Pro Ile Leu
Ile Tyr 180 185 190 Phe Asn Phe His Ser Tyr Ile Val Pro Gly Pro Ala
Val Phe Lys Cys 195 200 205 70642DNAMyceliophthora thermophila
70atgaagctcg ccacgctcct cgccgccctc accctcgggc tcagcgtcgg gtccagaaag
60tttggcgtgt acgagcacat tcgcaagaac acgaactaca actcgcccgt taccgacctg
120tcggacacca acctgcgctg caacgtcggc gggggctcgg gcaccagcac
caccgtgctc 180gacgtcaagg
ccggagactc gttcaccttc ttcagcgacg ttgccgtcta ccaccagggg
240cccatctcgc tgtgcgtgga ccggaccagt gcagagagca tggatggacg
ggaaccggac 300atgcgctgcc gaactggctc acaagctggc tacctggcgg
tgactgtgat gactgtgact 360gactacgacg ggtccggtga ctgtttcaag
atctatgact ggggaccgac gttcaacggg 420ggccaggcgt cgtggccgac
gaggaattcg tacgagtaca gcatcctcaa gtgcatcagg 480gacggcgaat
acctactgcg gattcagtcc ctggccatcc ataacccagg tgcccttccg
540cagttctaca tcagctgcgc ccaggtgaat gtgacgggcg gaggcaccat
ctatttcaac 600ttccactcgt atatcgtccc tgggccggca gtgttcaagt gc
64271214PRTMyceliophthora thermophila 71Met Lys Leu Ala Thr Leu Leu
Ala Ala Leu Thr Leu Gly Leu Ser Val 1 5 10 15 Gly Ser Arg Lys Phe
Gly Val Tyr Glu His Ile Arg Lys Asn Thr Asn 20 25 30 Tyr Asn Ser
Pro Val Thr Asp Leu Ser Asp Thr Asn Leu Arg Cys Asn 35 40 45 Val
Gly Gly Gly Ser Gly Thr Ser Thr Thr Val Leu Asp Val Lys Ala 50 55
60 Gly Asp Ser Phe Thr Phe Phe Ser Asp Val Ala Val Tyr His Gln Gly
65 70 75 80 Pro Ile Ser Leu Cys Val Asp Arg Thr Ser Ala Glu Ser Met
Asp Gly 85 90 95 Arg Glu Pro Asp Met Arg Cys Arg Thr Gly Ser Gln
Ala Gly Tyr Leu 100 105 110 Ala Val Thr Val Met Thr Val Thr Asp Tyr
Asp Gly Ser Gly Asp Cys 115 120 125 Phe Lys Ile Tyr Asp Trp Gly Pro
Thr Phe Asn Gly Gly Gln Ala Ser 130 135 140 Trp Pro Thr Arg Asn Ser
Tyr Glu Tyr Ser Ile Leu Lys Cys Ile Arg 145 150 155 160 Asp Gly Glu
Tyr Leu Leu Arg Ile Gln Ser Leu Ala Ile His Asn Pro 165 170 175 Gly
Ala Leu Pro Gln Phe Tyr Ile Ser Cys Ala Gln Val Asn Val Thr 180 185
190 Gly Gly Gly Thr Ile Tyr Phe Asn Phe His Ser Tyr Ile Val Pro Gly
195 200 205 Pro Ala Val Phe Lys Cys 210 72196PRTMyceliophthora
thermophila 72Arg Lys Phe Gly Val Tyr Glu His Ile Arg Lys Asn Thr
Asn Tyr Asn 1 5 10 15 Ser Pro Val Thr Asp Leu Ser Asp Thr Asn Leu
Arg Cys Asn Val Gly 20 25 30 Gly Gly Ser Gly Thr Ser Thr Thr Val
Leu Asp Val Lys Ala Gly Asp 35 40 45 Ser Phe Thr Phe Phe Ser Asp
Val Ala Val Tyr His Gln Gly Pro Ile 50 55 60 Ser Leu Cys Val Asp
Arg Thr Ser Ala Glu Ser Met Asp Gly Arg Glu 65 70 75 80 Pro Asp Met
Arg Cys Arg Thr Gly Ser Gln Ala Gly Tyr Leu Ala Val 85 90 95 Thr
Val Met Thr Val Thr Asp Tyr Asp Gly Ser Gly Asp Cys Phe Lys 100 105
110 Ile Tyr Asp Trp Gly Pro Thr Phe Asn Gly Gly Gln Ala Ser Trp Pro
115 120 125 Thr Arg Asn Ser Tyr Glu Tyr Ser Ile Leu Lys Cys Ile Arg
Asp Gly 130 135 140 Glu Tyr Leu Leu Arg Ile Gln Ser Leu Ala Ile His
Asn Pro Gly Ala 145 150 155 160 Leu Pro Gln Phe Tyr Ile Ser Cys Ala
Gln Val Asn Val Thr Gly Gly 165 170 175 Gly Thr Ile Tyr Phe Asn Phe
His Ser Tyr Ile Val Pro Gly Pro Ala 180 185 190 Val Phe Lys Cys 195
73579DNAMyceliophthora thermophila 73atgaccaaga atgcgcagag
caagcagggc gttgagaacc caacaagcgg cgacatccgc 60tgctacacct cgcagacggc
ggccaacgtc gtgaccgtgc cggccggctc gaccattcac 120tacatctcga
cccagcagat caaccacccc ggcccgactc agtactacct ggccaaggta
180ccccccggct cgtcggccaa gacctttgac gggtccggcg ccgtctggtt
caagatctcg 240accacgatgc ctaccgtgga cagcaacaag cagatgttct
ggccagggca gaacacttat 300gagacctcaa acaccaccat tcccgccaac
accccggacg gcgagtacct ccttcgcgtc 360aagcagatcg ccctccacat
ggcgtctcag cccaacaagg tccagttcta cctcgcctgc 420acccagatca
agatcaccgg tggtcgcaac ggcaccccca gcccgctggt cgcgctgccc
480ggagcctaca agagcaccga ccccggcatc ctggtcgaca tctactccat
gaagcccgaa 540tcgtaccagc ctcccgggcc gcccgtctgg cgcggctaa
57974192PRTMyceliophthora thermophila 74Met Thr Lys Asn Ala Gln Ser
Lys Gln Gly Val Glu Asn Pro Thr Ser 1 5 10 15 Gly Asp Ile Arg Cys
Tyr Thr Ser Gln Thr Ala Ala Asn Val Val Thr 20 25 30 Val Pro Ala
Gly Ser Thr Ile His Tyr Ile Ser Thr Gln Gln Ile Asn 35 40 45 His
Pro Gly Pro Thr Gln Tyr Tyr Leu Ala Lys Val Pro Pro Gly Ser 50 55
60 Ser Ala Lys Thr Phe Asp Gly Ser Gly Ala Val Trp Phe Lys Ile Ser
65 70 75 80 Thr Thr Met Pro Thr Val Asp Ser Asn Lys Gln Met Phe Trp
Pro Gly 85 90 95 Gln Asn Thr Tyr Glu Thr Ser Asn Thr Thr Ile Pro
Ala Asn Thr Pro 100 105 110 Asp Gly Glu Tyr Leu Leu Arg Val Lys Gln
Ile Ala Leu His Met Ala 115 120 125 Ser Gln Pro Asn Lys Val Gln Phe
Tyr Leu Ala Cys Thr Gln Ile Lys 130 135 140 Ile Thr Gly Gly Arg Asn
Gly Thr Pro Ser Pro Leu Val Ala Leu Pro 145 150 155 160 Gly Ala Tyr
Lys Ser Thr Asp Pro Gly Ile Leu Val Asp Ile Tyr Ser 165 170 175 Met
Lys Pro Glu Ser Tyr Gln Pro Pro Gly Pro Pro Val Trp Arg Gly 180 185
190 75672DNAMyceliophthora thermophila 75atgaggcttc tcgcaagctt
gttgctcgca gctacggctg ttcaagctca ctttgttaac 60ggacagcccg aagagagtga
ctggtcagcc acgcgcatga ccaagaatgc gcagagcaag 120cagggcgttg
agaacccaac aagcggcgac atccgctgct acacctcgca gacggcggcc
180aacgtcgtga ccgtgccggc cggctcgacc attcactaca tctcgaccca
gcagatcaac 240caccccggcc cgactcagta ctacctggcc aaggtacccc
ccggctcgtc ggccaagacc 300tttgacgggt ccggcgccgt ctggttcaag
atctcgacca cgatgcctac cgtggacagc 360aacaagcaga tgttctggcc
agggcagaac acttatgaga cctcaaacac caccattccc 420gccaacaccc
cggacggcga gtacctcctt cgcgtcaagc agatcgccct ccacatggcg
480tctcagccca acaaggtcca gttctacctc gcctgcaccc agatcaagat
caccggtggt 540cgcaacggca cccccagccc gctggtcgcg ctgcccggag
cctacaagag caccgacccc 600ggcatcctgg tcgacatcta ctccatgaag
cccgaatcgt accagcctcc cgggccgccc 660gtctggcgcg gc
67276224PRTMyceliophthora thermophila 76Met Arg Leu Leu Ala Ser Leu
Leu Leu Ala Ala Thr Ala Val Gln Ala 1 5 10 15 His Phe Val Asn Gly
Gln Pro Glu Glu Ser Asp Trp Ser Ala Thr Arg 20 25 30 Met Thr Lys
Asn Ala Gln Ser Lys Gln Gly Val Glu Asn Pro Thr Ser 35 40 45 Gly
Asp Ile Arg Cys Tyr Thr Ser Gln Thr Ala Ala Asn Val Val Thr 50 55
60 Val Pro Ala Gly Ser Thr Ile His Tyr Ile Ser Thr Gln Gln Ile Asn
65 70 75 80 His Pro Gly Pro Thr Gln Tyr Tyr Leu Ala Lys Val Pro Pro
Gly Ser 85 90 95 Ser Ala Lys Thr Phe Asp Gly Ser Gly Ala Val Trp
Phe Lys Ile Ser 100 105 110 Thr Thr Met Pro Thr Val Asp Ser Asn Lys
Gln Met Phe Trp Pro Gly 115 120 125 Gln Asn Thr Tyr Glu Thr Ser Asn
Thr Thr Ile Pro Ala Asn Thr Pro 130 135 140 Asp Gly Glu Tyr Leu Leu
Arg Val Lys Gln Ile Ala Leu His Met Ala 145 150 155 160 Ser Gln Pro
Asn Lys Val Gln Phe Tyr Leu Ala Cys Thr Gln Ile Lys 165 170 175 Ile
Thr Gly Gly Arg Asn Gly Thr Pro Ser Pro Leu Val Ala Leu Pro 180 185
190 Gly Ala Tyr Lys Ser Thr Asp Pro Gly Ile Leu Val Asp Ile Tyr Ser
195 200 205 Met Lys Pro Glu Ser Tyr Gln Pro Pro Gly Pro Pro Val Trp
Arg Gly 210 215 220 77208PRTMyceliophthora thermophila 77His Phe
Val Asn Gly Gln Pro Glu Glu Ser Asp Trp Ser Ala Thr Arg 1 5 10 15
Met Thr Lys Asn Ala Gln Ser Lys Gln Gly Val Glu Asn Pro Thr Ser 20
25 30 Gly Asp Ile Arg Cys Tyr Thr Ser Gln Thr Ala Ala Asn Val Val
Thr 35 40 45 Val Pro Ala Gly Ser Thr Ile His Tyr Ile Ser Thr Gln
Gln Ile Asn 50 55 60 His Pro Gly Pro Thr Gln Tyr Tyr Leu Ala Lys
Val Pro Pro Gly Ser 65 70 75 80 Ser Ala Lys Thr Phe Asp Gly Ser Gly
Ala Val Trp Phe Lys Ile Ser 85 90 95 Thr Thr Met Pro Thr Val Asp
Ser Asn Lys Gln Met Phe Trp Pro Gly 100 105 110 Gln Asn Thr Tyr Glu
Thr Ser Asn Thr Thr Ile Pro Ala Asn Thr Pro 115 120 125 Asp Gly Glu
Tyr Leu Leu Arg Val Lys Gln Ile Ala Leu His Met Ala 130 135 140 Ser
Gln Pro Asn Lys Val Gln Phe Tyr Leu Ala Cys Thr Gln Ile Lys 145 150
155 160 Ile Thr Gly Gly Arg Asn Gly Thr Pro Ser Pro Leu Val Ala Leu
Pro 165 170 175 Gly Ala Tyr Lys Ser Thr Asp Pro Gly Ile Leu Val Asp
Ile Tyr Ser 180 185 190 Met Lys Pro Glu Ser Tyr Gln Pro Pro Gly Pro
Pro Val Trp Arg Gly 195 200 205 78849DNAMyceliophthora thermophila
78atgaagccct ttagcctcgt cgccctggcg actgccgtga gcggccatgc catcttccag
60cgggtgtcgg tcaacgggca ggaccagggc cagctcaagg gggtgcgggc gccgtcgagc
120aactccccga tccagaacgt caacgatgcc aacatggcct gcaacgccaa
cattgtgtac 180cacgacaaca ccatcatcaa ggtgcccgcg ggagcccgcg
tcggcgcgtg gtggcagcac 240gtcatcggcg ggccgcaggg cgccaacgac
ccggacaacc cgatcgccgc ctcccacaag 300ggccccatcc aggtctacct
ggccaaggtg gacaacgcgg cgacggcgtc gccgtcgggc 360ctcaagtggt
tcaaggtggc cgagcgcggc ctgaacaacg gcgtgtgggc ctacctgatg
420cgcgtcgagc tgctcgccct gcacagcgcc tcgagccccg gcggcgccca
gttctacatg 480ggctgtgcac agatcgaagt cactggctcc ggcaccaact
cgggctccga ctttgtctcg 540ttccccggcg cctactcggc caacgacccg
ggcatcttgc tgagcatcta cgacagctcg 600ggcaagccca acaatggcgg
gcgctcgtac ccgatccccg gcccgcgccc catctcctgc 660tccggcagcg
gcggcggcgg caacaacggc ggcgacggcg gcgacgacaa caacggtggt
720ggcaacaaca acggcggcgg cagcgtcccc ctgtacgggc agtgcggcgg
catcggctac 780acgggcccga ccacctgtgc ccagggaact tgcaaggtgt
cgaacgaata ctacagccag 840tgcctcccc 84979283PRTMyceliophthora
thermophila 79Met Lys Pro Phe Ser Leu Val Ala Leu Ala Thr Ala Val
Ser Gly His 1 5 10 15 Ala Ile Phe Gln Arg Val Ser Val Asn Gly Gln
Asp Gln Gly Gln Leu 20 25 30 Lys Gly Val Arg Ala Pro Ser Ser Asn
Ser Pro Ile Gln Asn Val Asn 35 40 45 Asp Ala Asn Met Ala Cys Asn
Ala Asn Ile Val Tyr His Asp Asn Thr 50 55 60 Ile Ile Lys Val Pro
Ala Gly Ala Arg Val Gly Ala Trp Trp Gln His 65 70 75 80 Val Ile Gly
Gly Pro Gln Gly Ala Asn Asp Pro Asp Asn Pro Ile Ala 85 90 95 Ala
Ser His Lys Gly Pro Ile Gln Val Tyr Leu Ala Lys Val Asp Asn 100 105
110 Ala Ala Thr Ala Ser Pro Ser Gly Leu Lys Trp Phe Lys Val Ala Glu
115 120 125 Arg Gly Leu Asn Asn Gly Val Trp Ala Tyr Leu Met Arg Val
Glu Leu 130 135 140 Leu Ala Leu His Ser Ala Ser Ser Pro Gly Gly Ala
Gln Phe Tyr Met 145 150 155 160 Gly Cys Ala Gln Ile Glu Val Thr Gly
Ser Gly Thr Asn Ser Gly Ser 165 170 175 Asp Phe Val Ser Phe Pro Gly
Ala Tyr Ser Ala Asn Asp Pro Gly Ile 180 185 190 Leu Leu Ser Ile Tyr
Asp Ser Ser Gly Lys Pro Asn Asn Gly Gly Arg 195 200 205 Ser Tyr Pro
Ile Pro Gly Pro Arg Pro Ile Ser Cys Ser Gly Ser Gly 210 215 220 Gly
Gly Gly Asn Asn Gly Gly Asp Gly Gly Asp Asp Asn Asn Gly Gly 225 230
235 240 Gly Asn Asn Asn Gly Gly Gly Ser Val Pro Leu Tyr Gly Gln Cys
Gly 245 250 255 Gly Ile Gly Tyr Thr Gly Pro Thr Thr Cys Ala Gln Gly
Thr Cys Lys 260 265 270 Val Ser Asn Glu Tyr Tyr Ser Gln Cys Leu Pro
275 280 80268PRTMyceliophthora thermophila 80His Ala Ile Phe Gln
Arg Val Ser Val Asn Gly Gln Asp Gln Gly Gln 1 5 10 15 Leu Lys Gly
Val Arg Ala Pro Ser Ser Asn Ser Pro Ile Gln Asn Val 20 25 30 Asn
Asp Ala Asn Met Ala Cys Asn Ala Asn Ile Val Tyr His Asp Asn 35 40
45 Thr Ile Ile Lys Val Pro Ala Gly Ala Arg Val Gly Ala Trp Trp Gln
50 55 60 His Val Ile Gly Gly Pro Gln Gly Ala Asn Asp Pro Asp Asn
Pro Ile 65 70 75 80 Ala Ala Ser His Lys Gly Pro Ile Gln Val Tyr Leu
Ala Lys Val Asp 85 90 95 Asn Ala Ala Thr Ala Ser Pro Ser Gly Leu
Lys Trp Phe Lys Val Ala 100 105 110 Glu Arg Gly Leu Asn Asn Gly Val
Trp Ala Tyr Leu Met Arg Val Glu 115 120 125 Leu Leu Ala Leu His Ser
Ala Ser Ser Pro Gly Gly Ala Gln Phe Tyr 130 135 140 Met Gly Cys Ala
Gln Ile Glu Val Thr Gly Ser Gly Thr Asn Ser Gly 145 150 155 160 Ser
Asp Phe Val Ser Phe Pro Gly Ala Tyr Ser Ala Asn Asp Pro Gly 165 170
175 Ile Leu Leu Ser Ile Tyr Asp Ser Ser Gly Lys Pro Asn Asn Gly Gly
180 185 190 Arg Ser Tyr Pro Ile Pro Gly Pro Arg Pro Ile Ser Cys Ser
Gly Ser 195 200 205 Gly Gly Gly Gly Asn Asn Gly Gly Asp Gly Gly Asp
Asp Asn Asn Gly 210 215 220 Gly Gly Asn Asn Asn Gly Gly Gly Ser Val
Pro Leu Tyr Gly Gln Cys 225 230 235 240 Gly Gly Ile Gly Tyr Thr Gly
Pro Thr Thr Cys Ala Gln Gly Thr Cys 245 250 255 Lys Val Ser Asn Glu
Tyr Tyr Ser Gln Cys Leu Pro 260 265 81639DNAMyceliophthora
thermophila 81atgaagctca cctcgtccct cgctgtcctg gccgctgccg
gcgcccaggc tcactatacc 60ttccctaggg ccggcactgg tggttcgctc tctggcgagt
gggaggtggt ccgcatgacc 120gagaaccatt actcgcacgg cccggtcacc
gatgtcacca gccccgagat gacctgctat 180cagtccggcg tgcagggtgc
gccccagacc gtccaggtca aggcgggctc ccaattcacc 240ttcagcgtgg
atccctccat cggccacccc ggccctctcc agttctacat ggctaaggtg
300ccgtcgggcc agacggccgc cacctttgac ggcacgggag ccgtgtggtt
caagatctac 360caagacggcc cgaacggcct cggcaccgac agcattacct
ggcccagcgc cggcaaaacc 420gaggtctcgg tcaccatccc cagctgcatc
gaggatggcg agtacctgct ccgggtcgag 480cacacccccc tccctacagc
gccagcagcg caaaaccgag ctcgctcgtc accatcccca 540gctgcataca
aggccaccga cccgggcatc ctcttccagc tctactggcc catcccgacc
600gagtacatca accccggccc ggcccccgtc tcttgctaa
63982212PRTMyceliophthora thermophila 82Met Lys Leu Thr Ser Ser Leu
Ala Val Leu Ala Ala Ala Gly Ala Gln 1 5 10 15 Ala His Tyr Thr Phe
Pro Arg Ala Gly Thr Gly Gly Ser Leu Ser Gly 20 25 30 Glu Trp Glu
Val Val Arg Met Thr Glu Asn His Tyr Ser His Gly Pro 35 40 45 Val
Thr Asp Val Thr Ser Pro Glu Met Thr Cys Tyr Gln Ser Gly Val 50 55
60 Gln Gly Ala Pro Gln Thr Val Gln Val Lys Ala Gly Ser Gln Phe Thr
65 70 75 80 Phe Ser Val Asp Pro Ser Ile Gly His Pro Gly Pro Leu Gln
Phe Tyr 85 90 95 Met Ala Lys Val Pro Ser Gly Gln Thr Ala Ala Thr
Phe Asp Gly Thr 100 105 110 Gly Ala Val Trp Phe Lys Ile Tyr Gln Asp
Gly Pro Asn Gly Leu Gly 115 120 125 Thr Asp Ser Ile Thr Trp Pro Ser
Ala Gly Lys Thr Glu Val Ser Val 130 135 140
Thr Ile Pro Ser Cys Ile Glu Asp Gly Glu Tyr Leu Leu Arg Val Glu 145
150 155 160 His Thr Pro Leu Pro Thr Ala Pro Ala Ala Gln Asn Arg Ala
Arg Ser 165 170 175 Ser Pro Ser Pro Ala Ala Tyr Lys Ala Thr Asp Pro
Gly Ile Leu Phe 180 185 190 Gln Leu Tyr Trp Pro Ile Pro Thr Glu Tyr
Ile Asn Pro Gly Pro Ala 195 200 205 Pro Val Ser Cys 210
83195PRTMyceliophthora thermophila 83His Tyr Thr Phe Pro Arg Ala
Gly Thr Gly Gly Ser Leu Ser Gly Glu 1 5 10 15 Trp Glu Val Val Arg
Met Thr Glu Asn His Tyr Ser His Gly Pro Val 20 25 30 Thr Asp Val
Thr Ser Pro Glu Met Thr Cys Tyr Gln Ser Gly Val Gln 35 40 45 Gly
Ala Pro Gln Thr Val Gln Val Lys Ala Gly Ser Gln Phe Thr Phe 50 55
60 Ser Val Asp Pro Ser Ile Gly His Pro Gly Pro Leu Gln Phe Tyr Met
65 70 75 80 Ala Lys Val Pro Ser Gly Gln Thr Ala Ala Thr Phe Asp Gly
Thr Gly 85 90 95 Ala Val Trp Phe Lys Ile Tyr Gln Asp Gly Pro Asn
Gly Leu Gly Thr 100 105 110 Asp Ser Ile Thr Trp Pro Ser Ala Gly Lys
Thr Glu Val Ser Val Thr 115 120 125 Ile Pro Ser Cys Ile Glu Asp Gly
Glu Tyr Leu Leu Arg Val Glu His 130 135 140 Thr Pro Leu Pro Thr Ala
Pro Ala Ala Gln Asn Arg Ala Arg Ser Ser 145 150 155 160 Pro Ser Pro
Ala Ala Tyr Lys Ala Thr Asp Pro Gly Ile Leu Phe Gln 165 170 175 Leu
Tyr Trp Pro Ile Pro Thr Glu Tyr Ile Asn Pro Gly Pro Ala Pro 180 185
190 Val Ser Cys 195 84695DNAMyceliophthora thermophila 84atgaagctca
cctcgtccct cgctgtcctg gccgctgccg gcgcccaggc tcactatacc 60ttccctaggg
ccggcactgg tggttcgctc tctggcgagt gggaggtggt ccgcatgacc
120gagaccatta ctcgcacggc ccggtcaccg atgtcaccag ccccgagatg
acctgctatc 180agtccggcgt gcagggtgcg ccccagaccg tccaggtcaa
ggcgggctcc caattcacct 240tcagcgtgga tccctccatc ggccaccccg
gccctctcca gttctacatg gctaaggtgc 300cgtcgggcca gacggccgcc
acctttgacg gcacgggagc cgtgtggttc aagatctacc 360aagacggccc
gaacggcctc ggcaccgaca gcattacctg gcccagcgcc ggcaaaaccg
420aggtctcggt caccatcccc agctgcatcg aggatggcga gtacctgctc
cgggtcgagc 480acatcgcgct ccacagcgcc agcagcgtgg gcggcgccca
gttctacatc gcctgcgccc 540agctctccgt caccggcggc tccggcaccc
tcaacacggg ctcgctcgtc tccctgcccg 600gcgcctacaa ggccaccgac
ccgggcatcc tcttccagct ctactggccc atcccgaccg 660agtacatcaa
ccccggcccg gcccccgtct cttgc 69585232PRTMyceliophthora thermophila
85Met Lys Leu Thr Ser Ser Leu Ala Val Leu Ala Ala Ala Gly Ala Gln 1
5 10 15 Ala His Tyr Thr Phe Pro Arg Ala Gly Thr Gly Gly Ser Leu Ser
Gly 20 25 30 Glu Trp Glu Val Val Arg Met Thr Glu Asn His Tyr Ser
His Gly Pro 35 40 45 Val Thr Asp Val Thr Ser Pro Glu Met Thr Cys
Tyr Gln Ser Gly Val 50 55 60 Gln Gly Ala Pro Gln Thr Val Gln Val
Lys Ala Gly Ser Gln Phe Thr 65 70 75 80 Phe Ser Val Asp Pro Ser Ile
Gly His Pro Gly Pro Leu Gln Phe Tyr 85 90 95 Met Ala Lys Val Pro
Ser Gly Gln Thr Ala Ala Thr Phe Asp Gly Thr 100 105 110 Gly Ala Val
Trp Phe Lys Ile Tyr Gln Asp Gly Pro Asn Gly Leu Gly 115 120 125 Thr
Asp Ser Ile Thr Trp Pro Ser Ala Gly Lys Thr Glu Val Ser Val 130 135
140 Thr Ile Pro Ser Cys Ile Glu Asp Gly Glu Tyr Leu Leu Arg Val Glu
145 150 155 160 His Ile Ala Leu His Ser Ala Ser Ser Val Gly Gly Ala
Gln Phe Tyr 165 170 175 Ile Ala Cys Ala Gln Leu Ser Val Thr Gly Gly
Ser Gly Thr Leu Asn 180 185 190 Thr Gly Ser Leu Val Ser Leu Pro Gly
Ala Tyr Lys Ala Thr Asp Pro 195 200 205 Gly Ile Leu Phe Gln Leu Tyr
Trp Pro Ile Pro Thr Glu Tyr Ile Asn 210 215 220 Pro Gly Pro Ala Pro
Val Ser Cys 225 230 86215PRTMyceliophthora thermophila 86His Tyr
Thr Phe Pro Arg Ala Gly Thr Gly Gly Ser Leu Ser Gly Glu 1 5 10 15
Trp Glu Val Val Arg Met Thr Glu Asn His Tyr Ser His Gly Pro Val 20
25 30 Thr Asp Val Thr Ser Pro Glu Met Thr Cys Tyr Gln Ser Gly Val
Gln 35 40 45 Gly Ala Pro Gln Thr Val Gln Val Lys Ala Gly Ser Gln
Phe Thr Phe 50 55 60 Ser Val Asp Pro Ser Ile Gly His Pro Gly Pro
Leu Gln Phe Tyr Met 65 70 75 80 Ala Lys Val Pro Ser Gly Gln Thr Ala
Ala Thr Phe Asp Gly Thr Gly 85 90 95 Ala Val Trp Phe Lys Ile Tyr
Gln Asp Gly Pro Asn Gly Leu Gly Thr 100 105 110 Asp Ser Ile Thr Trp
Pro Ser Ala Gly Lys Thr Glu Val Ser Val Thr 115 120 125 Ile Pro Ser
Cys Ile Glu Asp Gly Glu Tyr Leu Leu Arg Val Glu His 130 135 140 Ile
Ala Leu His Ser Ala Ser Ser Val Gly Gly Ala Gln Phe Tyr Ile 145 150
155 160 Ala Cys Ala Gln Leu Ser Val Thr Gly Gly Ser Gly Thr Leu Asn
Thr 165 170 175 Gly Ser Leu Val Ser Leu Pro Gly Ala Tyr Lys Ala Thr
Asp Pro Gly 180 185 190 Ile Leu Phe Gln Leu Tyr Trp Pro Ile Pro Thr
Glu Tyr Ile Asn Pro 195 200 205 Gly Pro Ala Pro Val Ser Cys 210 215
87447DNAMyceliophthora thermophila 87atgccgccac cacgactgag
caccctcctt cccctcctag ccttaatagc ccccaccgcc 60ctggggcact cccacctcgg
gtacatcatc atcaacggcg aggtatacca aggattcgac 120ccgcggccgg
agcaggcgaa ctcgccgttg cgcgtgggct ggtcgacggg ggcaatcgac
180gacgggttcg tggcgccggc caactactcg tcgcccgaca tcatctgcca
catcgagggg 240gccagcccgc cggcgcacgc gcccgtccgg gcgggcgacc
gggtgcacgt gcaatggaac 300ggctggccgc tcggacacgt ggggccggtg
ctgtcgtacc tggcgccctg cggcgggctg 360gaggggtccg agagcgggtg
cgccggggtg gacaagcggc agctgcggtg gaccaaggtg 420gacgactcgc
tgccggcgat ggagctg 44788149PRTMyceliophthora thermophila 88Met Pro
Pro Pro Arg Leu Ser Thr Leu Leu Pro Leu Leu Ala Leu Ile 1 5 10 15
Ala Pro Thr Ala Leu Gly His Ser His Leu Gly Tyr Ile Ile Ile Asn 20
25 30 Gly Glu Val Tyr Gln Gly Phe Asp Pro Arg Pro Glu Gln Ala Asn
Ser 35 40 45 Pro Leu Arg Val Gly Trp Ser Thr Gly Ala Ile Asp Asp
Gly Phe Val 50 55 60 Ala Pro Ala Asn Tyr Ser Ser Pro Asp Ile Ile
Cys His Ile Glu Gly 65 70 75 80 Ala Ser Pro Pro Ala His Ala Pro Val
Arg Ala Gly Asp Arg Val His 85 90 95 Val Gln Trp Asn Gly Trp Pro
Leu Gly His Val Gly Pro Val Leu Ser 100 105 110 Tyr Leu Ala Pro Cys
Gly Gly Leu Glu Gly Ser Glu Ser Gly Cys Ala 115 120 125 Gly Val Asp
Lys Arg Gln Leu Arg Trp Thr Lys Val Asp Asp Ser Leu 130 135 140 Pro
Ala Met Glu Leu 145 89127PRTMyceliophthora thermophila 89His Ser
His Leu Gly Tyr Ile Ile Ile Asn Gly Glu Val Tyr Gln Gly 1 5 10 15
Phe Asp Pro Arg Pro Glu Gln Ala Asn Ser Pro Leu Arg Val Gly Trp 20
25 30 Ser Thr Gly Ala Ile Asp Asp Gly Phe Val Ala Pro Ala Asn Tyr
Ser 35 40 45 Ser Pro Asp Ile Ile Cys His Ile Glu Gly Ala Ser Pro
Pro Ala His 50 55 60 Ala Pro Val Arg Ala Gly Asp Arg Val His Val
Gln Trp Asn Gly Trp 65 70 75 80 Pro Leu Gly His Val Gly Pro Val Leu
Ser Tyr Leu Ala Pro Cys Gly 85 90 95 Gly Leu Glu Gly Ser Glu Ser
Gly Cys Ala Gly Val Asp Lys Arg Gln 100 105 110 Leu Arg Trp Thr Lys
Val Asp Asp Ser Leu Pro Ala Met Glu Leu 115 120 125
901176DNAMyceliophthora thermophila 90atgccgccac cacgactgag
caccctcctt cccctcctag ccttaatagc ccccaccgcc 60ctggggcact cccacctcgg
gtacatcatc atcaacggcg aggtatacca aggattcgac 120ccgcggccgg
agcaggcgaa ctcgccgttg cgcgtgggct ggtcgacggg ggcaatcgac
180gacgggttcg tggcgccggc caactactcg tcgcccgaca tcatctgcca
catcgagggg 240gccagcccgc cggcgcacgc gcccgtccgg gcgggcgacc
gggtgcacgt gcaatggaaa 300cggctggccg ctcggacacg tggggccggt
gctgtcgtac ctggcgccct gcggcgggct 360ggaggggtcc gagagcgggt
ggacgactcg ctgccggcga tggagctggt cggggccgcg 420gggggcgcgg
ggggcgagga cgacggcagc ggcagcgacg gcagcggcag cggcggcagc
480ggacgcgtcg gcgtgcccgg gcagcgctgg gccaccgacg tgttgatcgc
ggccaacaac 540agctggcagg tcgagatccc gcgcgggctg cgggacgggc
cgtacgtgct gcgccacgag 600atcgtcgcgc tgcactacgc ggccgagccc
ggcggcgcgc agaactaccc gctctgcgtc 660aacctgtggg tcgagggcgg
cgacggcagc atggagctgg accacttcga cgccacccag 720ttctaccggc
ccgacgaccc gggcatcctg ctcaacgtga cggccggcct gcgctcatac
780gccgtgccgg gcccgacgct ggccgcgggg gcgacgccgg tgccgtacgc
gcagcagaac 840atcagctcgg cgagggcgga tggaaccccc gtgattgtca
ccaggagcac ggagacggtg 900cccttcaccg cggcacccac gccagccgag
acggcagaag ccaaaggggg gaggtatgat 960gaccaaaccc gaactaaaga
cctaaatgaa cgcttctttt atagtagccg gccagaacag 1020aagaggctga
cagcgacctc aagaagggaa ctagttgatc atcgtacccg gtacctctcc
1080gtagctgtct gcgcagattt cggcgctcat aaggcagcag aaaccaacca
cgaagctttg 1140agaggcggca ataagcacca tggcggtgtt tcagag
117691392PRTMyceliophthora thermophila 91Met Pro Pro Pro Arg Leu
Ser Thr Leu Leu Pro Leu Leu Ala Leu Ile 1 5 10 15 Ala Pro Thr Ala
Leu Gly His Ser His Leu Gly Tyr Ile Ile Ile Asn 20 25 30 Gly Glu
Val Tyr Gln Gly Phe Asp Pro Arg Pro Glu Gln Ala Asn Ser 35 40 45
Pro Leu Arg Val Gly Trp Ser Thr Gly Ala Ile Asp Asp Gly Phe Val 50
55 60 Ala Pro Ala Asn Tyr Ser Ser Pro Asp Ile Ile Cys His Ile Glu
Gly 65 70 75 80 Ala Ser Pro Pro Ala His Ala Pro Val Arg Ala Gly Asp
Arg Val His 85 90 95 Val Gln Trp Lys Arg Leu Ala Ala Arg Thr Arg
Gly Ala Gly Ala Val 100 105 110 Val Pro Gly Ala Leu Arg Arg Ala Gly
Gly Val Arg Glu Arg Val Asp 115 120 125 Asp Ser Leu Pro Ala Met Glu
Leu Val Gly Ala Ala Gly Gly Ala Gly 130 135 140 Gly Glu Asp Asp Gly
Ser Gly Ser Asp Gly Ser Gly Ser Gly Gly Ser 145 150 155 160 Gly Arg
Val Gly Val Pro Gly Gln Arg Trp Ala Thr Asp Val Leu Ile 165 170 175
Ala Ala Asn Asn Ser Trp Gln Val Glu Ile Pro Arg Gly Leu Arg Asp 180
185 190 Gly Pro Tyr Val Leu Arg His Glu Ile Val Ala Leu His Tyr Ala
Ala 195 200 205 Glu Pro Gly Gly Ala Gln Asn Tyr Pro Leu Cys Val Asn
Leu Trp Val 210 215 220 Glu Gly Gly Asp Gly Ser Met Glu Leu Asp His
Phe Asp Ala Thr Gln 225 230 235 240 Phe Tyr Arg Pro Asp Asp Pro Gly
Ile Leu Leu Asn Val Thr Ala Gly 245 250 255 Leu Arg Ser Tyr Ala Val
Pro Gly Pro Thr Leu Ala Ala Gly Ala Thr 260 265 270 Pro Val Pro Tyr
Ala Gln Gln Asn Ile Ser Ser Ala Arg Ala Asp Gly 275 280 285 Thr Pro
Val Ile Val Thr Arg Ser Thr Glu Thr Val Pro Phe Thr Ala 290 295 300
Ala Pro Thr Pro Ala Glu Thr Ala Glu Ala Lys Gly Gly Arg Tyr Asp 305
310 315 320 Asp Gln Thr Arg Thr Lys Asp Leu Asn Glu Arg Phe Phe Tyr
Ser Ser 325 330 335 Arg Pro Glu Gln Lys Arg Leu Thr Ala Thr Ser Arg
Arg Glu Leu Val 340 345 350 Asp His Arg Thr Arg Tyr Leu Ser Val Ala
Val Cys Ala Asp Phe Gly 355 360 365 Ala His Lys Ala Ala Glu Thr Asn
His Glu Ala Leu Arg Gly Gly Asn 370 375 380 Lys His His Gly Gly Val
Ser Glu 385 390 92370PRTMyceliophthora thermophila 92His Ser His
Leu Gly Tyr Ile Ile Ile Asn Gly Glu Val Tyr Gln Gly 1 5 10 15 Phe
Asp Pro Arg Pro Glu Gln Ala Asn Ser Pro Leu Arg Val Gly Trp 20 25
30 Ser Thr Gly Ala Ile Asp Asp Gly Phe Val Ala Pro Ala Asn Tyr Ser
35 40 45 Ser Pro Asp Ile Ile Cys His Ile Glu Gly Ala Ser Pro Pro
Ala His 50 55 60 Ala Pro Val Arg Ala Gly Asp Arg Val His Val Gln
Trp Lys Arg Leu 65 70 75 80 Ala Ala Arg Thr Arg Gly Ala Gly Ala Val
Val Pro Gly Ala Leu Arg 85 90 95 Arg Ala Gly Gly Val Arg Glu Arg
Val Asp Asp Ser Leu Pro Ala Met 100 105 110 Glu Leu Val Gly Ala Ala
Gly Gly Ala Gly Gly Glu Asp Asp Gly Ser 115 120 125 Gly Ser Asp Gly
Ser Gly Ser Gly Gly Ser Gly Arg Val Gly Val Pro 130 135 140 Gly Gln
Arg Trp Ala Thr Asp Val Leu Ile Ala Ala Asn Asn Ser Trp 145 150 155
160 Gln Val Glu Ile Pro Arg Gly Leu Arg Asp Gly Pro Tyr Val Leu Arg
165 170 175 His Glu Ile Val Ala Leu His Tyr Ala Ala Glu Pro Gly Gly
Ala Gln 180 185 190 Asn Tyr Pro Leu Cys Val Asn Leu Trp Val Glu Gly
Gly Asp Gly Ser 195 200 205 Met Glu Leu Asp His Phe Asp Ala Thr Gln
Phe Tyr Arg Pro Asp Asp 210 215 220 Pro Gly Ile Leu Leu Asn Val Thr
Ala Gly Leu Arg Ser Tyr Ala Val 225 230 235 240 Pro Gly Pro Thr Leu
Ala Ala Gly Ala Thr Pro Val Pro Tyr Ala Gln 245 250 255 Gln Asn Ile
Ser Ser Ala Arg Ala Asp Gly Thr Pro Val Ile Val Thr 260 265 270 Arg
Ser Thr Glu Thr Val Pro Phe Thr Ala Ala Pro Thr Pro Ala Glu 275 280
285 Thr Ala Glu Ala Lys Gly Gly Arg Tyr Asp Asp Gln Thr Arg Thr Lys
290 295 300 Asp Leu Asn Glu Arg Phe Phe Tyr Ser Ser Arg Pro Glu Gln
Lys Arg 305 310 315 320 Leu Thr Ala Thr Ser Arg Arg Glu Leu Val Asp
His Arg Thr Arg Tyr 325 330 335 Leu Ser Val Ala Val Cys Ala Asp Phe
Gly Ala His Lys Ala Ala Glu 340 345 350 Thr Asn His Glu Ala Leu Arg
Gly Gly Asn Lys His His Gly Gly Val 355 360 365 Ser Glu 370
93453DNAMyceliophthora thermophila 93atgaggtcga cattggccgg
tgccctggca gccatcgctg ctcagaaagt agccggccac 60gccacgtttc agcagctctg
gcacggctcc tcctgtgtcc gccttccggc tagcaactca 120cccgtcacca
atgtgggaag cagagacttc gtctgcaacg ctggcacccg ccccgtcagt
180ggcaagtgcc ccgtgaaggc tggcggcacc gtcaccatcg agatgcacca
gcaacccggc 240gaccgcagct gcaacaacga agccatcgga ggggcgcatt
ggggccccgt ccaggtgtac 300ctgaccaagg ttcaggacgc cgcgacggcc
gacggctcga cgggctggtt caagatcttc 360tccgactcgt ggtccaagaa
gcccgggggc aacttgggcg acgacgacaa ctggggcacg 420cgcgacctga
acgcctgctg cgggaagatg gac 45394151PRTMyceliophthora thermophila
94Met Arg Ser Thr Leu Ala Gly Ala Leu Ala Ala Ile Ala Ala Gln Lys 1
5 10 15 Val Ala Gly His Ala Thr Phe Gln Gln Leu Trp His Gly Ser Ser
Cys 20 25 30 Val Arg Leu Pro Ala Ser Asn Ser Pro Val Thr Asn Val
Gly Ser Arg 35 40 45 Asp Phe Val Cys Asn Ala Gly Thr Arg Pro Val
Ser Gly Lys
Cys Pro 50 55 60 Val Lys Ala Gly Gly Thr Val Thr Ile Glu Met His
Gln Gln Pro Gly 65 70 75 80 Asp Arg Ser Cys Asn Asn Glu Ala Ile Gly
Gly Ala His Trp Gly Pro 85 90 95 Val Gln Val Tyr Leu Thr Lys Val
Gln Asp Ala Ala Thr Ala Asp Gly 100 105 110 Ser Thr Gly Trp Phe Lys
Ile Phe Ser Asp Ser Trp Ser Lys Lys Pro 115 120 125 Gly Gly Asn Leu
Gly Asp Asp Asp Asn Trp Gly Thr Arg Asp Leu Asn 130 135 140 Ala Cys
Cys Gly Lys Met Asp 145 150 95132PRTMyceliophthora thermophila
95His Ala Thr Phe Gln Gln Leu Trp His Gly Ser Ser Cys Val Arg Leu 1
5 10 15 Pro Ala Ser Asn Ser Pro Val Thr Asn Val Gly Ser Arg Asp Phe
Val 20 25 30 Cys Asn Ala Gly Thr Arg Pro Val Ser Gly Lys Cys Pro
Val Lys Ala 35 40 45 Gly Gly Thr Val Thr Ile Glu Met His Gln Gln
Pro Gly Asp Arg Ser 50 55 60 Cys Asn Asn Glu Ala Ile Gly Gly Ala
His Trp Gly Pro Val Gln Val 65 70 75 80 Tyr Leu Thr Lys Val Gln Asp
Ala Ala Thr Ala Asp Gly Ser Thr Gly 85 90 95 Trp Phe Lys Ile Phe
Ser Asp Ser Trp Ser Lys Lys Pro Gly Gly Asn 100 105 110 Leu Gly Asp
Asp Asp Asn Trp Gly Thr Arg Asp Leu Asn Ala Cys Cys 115 120 125 Gly
Lys Met Asp 130 96837DNAMyceliophthora thermophila 96atgaggtcga
cattggccgg tgccctggca gccatcgctg ctcagaaagt agccggccac 60gccacgtttc
agcagctctg gcacggctcc tcctgtgtcc gccttccggc tagcaactca
120cccgtcacca atgtgggaag cagagacttc gtctgcaacg ctggcacccg
ccccgtcagt 180ggcaagtgcc ccgtgaaggc tggcggcacc gtcaccatcg
agatgcacca gcaacccggc 240gaccgcagct gcaacaacga agccatcgga
ggggcgcatt ggggccccgt ccaggtgtac 300ctgaccaagg ttcaggacgc
cgcgacggcc gacggctcga cgggctggtt caagatcttc 360tccgactcgt
ggtccaagaa gcccgggggc aactcgggcg acgacgacaa ctggggcacg
420cgcgacctga acgcctgctg cgggaagatg gacgtggcca tcccggccga
catcgcgtcg 480ggcgactacc tgctgcgggc cgaggcgctg gccctgcaca
cggccggaca ggccggcggc 540gcccagttct acatgagctg ctaccagatg
acggtcgagg gcggctccgg gaccgccaac 600ccgcccaccg tcaagttccc
gggcgcctac agcgccaacg acccgggcat cctcgtcaac 660atccacgccc
ccctttccag ctacaccgcg cccggcccgg ccgtctacgc gggcggcacc
720atccgcgagg ccggctccgc ctgcaccggc tgcgcgcaga cctgcaaggt
cgggtcgtcc 780ccgagcgccg ttgcccccgg cagcggcgcg ggcaacggcg
gcgggttcca accccga 83797279PRTMyceliophthora thermophila 97Met Arg
Ser Thr Leu Ala Gly Ala Leu Ala Ala Ile Ala Ala Gln Lys 1 5 10 15
Val Ala Gly His Ala Thr Phe Gln Gln Leu Trp His Gly Ser Ser Cys 20
25 30 Val Arg Leu Pro Ala Ser Asn Ser Pro Val Thr Asn Val Gly Ser
Arg 35 40 45 Asp Phe Val Cys Asn Ala Gly Thr Arg Pro Val Ser Gly
Lys Cys Pro 50 55 60 Val Lys Ala Gly Gly Thr Val Thr Ile Glu Met
His Gln Gln Pro Gly 65 70 75 80 Asp Arg Ser Cys Asn Asn Glu Ala Ile
Gly Gly Ala His Trp Gly Pro 85 90 95 Val Gln Val Tyr Leu Thr Lys
Val Gln Asp Ala Ala Thr Ala Asp Gly 100 105 110 Ser Thr Gly Trp Phe
Lys Ile Phe Ser Asp Ser Trp Ser Lys Lys Pro 115 120 125 Gly Gly Asn
Ser Gly Asp Asp Asp Asn Trp Gly Thr Arg Asp Leu Asn 130 135 140 Ala
Cys Cys Gly Lys Met Asp Val Ala Ile Pro Ala Asp Ile Ala Ser 145 150
155 160 Gly Asp Tyr Leu Leu Arg Ala Glu Ala Leu Ala Leu His Thr Ala
Gly 165 170 175 Gln Ala Gly Gly Ala Gln Phe Tyr Met Ser Cys Tyr Gln
Met Thr Val 180 185 190 Glu Gly Gly Ser Gly Thr Ala Asn Pro Pro Thr
Val Lys Phe Pro Gly 195 200 205 Ala Tyr Ser Ala Asn Asp Pro Gly Ile
Leu Val Asn Ile His Ala Pro 210 215 220 Leu Ser Ser Tyr Thr Ala Pro
Gly Pro Ala Val Tyr Ala Gly Gly Thr 225 230 235 240 Ile Arg Glu Ala
Gly Ser Ala Cys Thr Gly Cys Ala Gln Thr Cys Lys 245 250 255 Val Gly
Ser Ser Pro Ser Ala Val Ala Pro Gly Ser Gly Ala Gly Asn 260 265 270
Gly Gly Gly Phe Gln Pro Arg 275 98260PRTMyceliophthora thermophila
98His Ala Thr Phe Gln Gln Leu Trp His Gly Ser Ser Cys Val Arg Leu 1
5 10 15 Pro Ala Ser Asn Ser Pro Val Thr Asn Val Gly Ser Arg Asp Phe
Val 20 25 30 Cys Asn Ala Gly Thr Arg Pro Val Ser Gly Lys Cys Pro
Val Lys Ala 35 40 45 Gly Gly Thr Val Thr Ile Glu Met His Gln Gln
Pro Gly Asp Arg Ser 50 55 60 Cys Asn Asn Glu Ala Ile Gly Gly Ala
His Trp Gly Pro Val Gln Val 65 70 75 80 Tyr Leu Thr Lys Val Gln Asp
Ala Ala Thr Ala Asp Gly Ser Thr Gly 85 90 95 Trp Phe Lys Ile Phe
Ser Asp Ser Trp Ser Lys Lys Pro Gly Gly Asn 100 105 110 Ser Gly Asp
Asp Asp Asn Trp Gly Thr Arg Asp Leu Asn Ala Cys Cys 115 120 125 Gly
Lys Met Asp Val Ala Ile Pro Ala Asp Ile Ala Ser Gly Asp Tyr 130 135
140 Leu Leu Arg Ala Glu Ala Leu Ala Leu His Thr Ala Gly Gln Ala Gly
145 150 155 160 Gly Ala Gln Phe Tyr Met Ser Cys Tyr Gln Met Thr Val
Glu Gly Gly 165 170 175 Ser Gly Thr Ala Asn Pro Pro Thr Val Lys Phe
Pro Gly Ala Tyr Ser 180 185 190 Ala Asn Asp Pro Gly Ile Leu Val Asn
Ile His Ala Pro Leu Ser Ser 195 200 205 Tyr Thr Ala Pro Gly Pro Ala
Val Tyr Ala Gly Gly Thr Ile Arg Glu 210 215 220 Ala Gly Ser Ala Cys
Thr Gly Cys Ala Gln Thr Cys Lys Val Gly Ser 225 230 235 240 Ser Pro
Ser Ala Val Ala Pro Gly Ser Gly Ala Gly Asn Gly Gly Gly 245 250 255
Phe Gln Pro Arg 260 99735DNAMyceliophthora thermophila 99atgctcctcc
tcaccctagc cacactcgtc accctcctgg cgcgccacgt ctcggctcac 60gcccggctgt
tccgcgtctc tgtcgacggg aaagaccagg gcgacgggct gaacaagtac
120atccgctcgc cggcgaccaa cgaccccgtg cgcgacctct cgagcgccgc
catcgtgtgc 180aacacccagg ggtccaaggc cgccccggac ttcgtcaggg
ccgcggccgg cgacaagctg 240accttcctct gggcgcacga caacccggac
gacccggtcg actacgtcct cgacccgtcc 300cacaagggcg ccatcctgac
ctacgtcgcc gcctacccct ccggggaccc gaccggcccc 360atctggagca
agcttgccga ggaaggattc accggcgggc agtgggcgac catcaagatg
420atcgacaacg gcggcaaggt cgacgtgacg ctgcccgagg cccttgcgcc
gggaaagtac 480ctgatccgcc aggagctgct ggccctgcac cgggccgact
ttgcctgcga cgacccggcc 540caccccaacc gcggcgccga gtcgtacccc
aactgcgtcc aggtggaggt gtcgggcagc 600ggcgacaaga agccggacca
gaactttgac ttcaacaagg gctatacctg cgataacaaa 660ggactccact
ttaagatcta catcggtcag gacagccagt atgtggcccc ggggccgcgg
720ccttggaatg ggagc 735100245PRTMyceliophthora thermophila 100Met
Leu Leu Leu Thr Leu Ala Thr Leu Val Thr Leu Leu Ala Arg His 1 5 10
15 Val Ser Ala His Ala Arg Leu Phe Arg Val Ser Val Asp Gly Lys Asp
20 25 30 Gln Gly Asp Gly Leu Asn Lys Tyr Ile Arg Ser Pro Ala Thr
Asn Asp 35 40 45 Pro Val Arg Asp Leu Ser Ser Ala Ala Ile Val Cys
Asn Thr Gln Gly 50 55 60 Ser Lys Ala Ala Pro Asp Phe Val Arg Ala
Ala Ala Gly Asp Lys Leu 65 70 75 80 Thr Phe Leu Trp Ala His Asp Asn
Pro Asp Asp Pro Val Asp Tyr Val 85 90 95 Leu Asp Pro Ser His Lys
Gly Ala Ile Leu Thr Tyr Val Ala Ala Tyr 100 105 110 Pro Ser Gly Asp
Pro Thr Gly Pro Ile Trp Ser Lys Leu Ala Glu Glu 115 120 125 Gly Phe
Thr Gly Gly Gln Trp Ala Thr Ile Lys Met Ile Asp Asn Gly 130 135 140
Gly Lys Val Asp Val Thr Leu Pro Glu Ala Leu Ala Pro Gly Lys Tyr 145
150 155 160 Leu Ile Arg Gln Glu Leu Leu Ala Leu His Arg Ala Asp Phe
Ala Cys 165 170 175 Asp Asp Pro Ala His Pro Asn Arg Gly Ala Glu Ser
Tyr Pro Asn Cys 180 185 190 Val Gln Val Glu Val Ser Gly Ser Gly Asp
Lys Lys Pro Asp Gln Asn 195 200 205 Phe Asp Phe Asn Lys Gly Tyr Thr
Cys Asp Asn Lys Gly Leu His Phe 210 215 220 Lys Ile Tyr Ile Gly Gln
Asp Ser Gln Tyr Val Ala Pro Gly Pro Arg 225 230 235 240 Pro Trp Asn
Gly Ser 245 101226PRTMyceliophthora thermophila 101His Ala Arg Leu
Phe Arg Val Ser Val Asp Gly Lys Asp Gln Gly Asp 1 5 10 15 Gly Leu
Asn Lys Tyr Ile Arg Ser Pro Ala Thr Asn Asp Pro Val Arg 20 25 30
Asp Leu Ser Ser Ala Ala Ile Val Cys Asn Thr Gln Gly Ser Lys Ala 35
40 45 Ala Pro Asp Phe Val Arg Ala Ala Ala Gly Asp Lys Leu Thr Phe
Leu 50 55 60 Trp Ala His Asp Asn Pro Asp Asp Pro Val Asp Tyr Val
Leu Asp Pro 65 70 75 80 Ser His Lys Gly Ala Ile Leu Thr Tyr Val Ala
Ala Tyr Pro Ser Gly 85 90 95 Asp Pro Thr Gly Pro Ile Trp Ser Lys
Leu Ala Glu Glu Gly Phe Thr 100 105 110 Gly Gly Gln Trp Ala Thr Ile
Lys Met Ile Asp Asn Gly Gly Lys Val 115 120 125 Asp Val Thr Leu Pro
Glu Ala Leu Ala Pro Gly Lys Tyr Leu Ile Arg 130 135 140 Gln Glu Leu
Leu Ala Leu His Arg Ala Asp Phe Ala Cys Asp Asp Pro 145 150 155 160
Ala His Pro Asn Arg Gly Ala Glu Ser Tyr Pro Asn Cys Val Gln Val 165
170 175 Glu Val Ser Gly Ser Gly Asp Lys Lys Pro Asp Gln Asn Phe Asp
Phe 180 185 190 Asn Lys Gly Tyr Thr Cys Asp Asn Lys Gly Leu His Phe
Lys Ile Tyr 195 200 205 Ile Gly Gln Asp Ser Gln Tyr Val Ala Pro Gly
Pro Arg Pro Trp Asn 210 215 220 Gly Ser 225 102600DNAMyceliophthora
thermophila 102atgttcactt cgctttgcat cacagatcat tggaggactc
ttagcagcca ctctgggcca 60gtcatgaact atctcgccca ttgcaccaat gacgactgca
agtctttcaa gggcgacagc 120ggcaacgtct gggtcaagat cgagcagctc
gcgtacaacc cgtcagccaa ccccccctgg 180gcgtctgacc tcctccgtga
gcacggtgcc aagtggaagg tgacgatccc gcccagtctt 240gtccccggcg
aatatctgct gcggcacgag atcctggggt tgcacgtcgc aggaaccgtg
300atgggcgccc agttctaccc cggctgcacc cagatcaggg tcaccgaagg
cgggagcacg 360cagctgccct cgggtattgc gctcccaggc gcttacggcc
cacaagacga gggtatcttg 420gtcgacttgt ggagggttaa ccagggccag
gtcaactaca cggcgcctgg aggacccgtt 480tggagcgaag cgtgggacac
cgagtttggc gggtccaaca cgaccgagtg cgccaccatg 540ctcgacgacc
tgctcgacta catggcggcc aacgacgagt ggatcggctg gacggcctag
600103199PRTMyceliophthora thermophila 103Met Phe Thr Ser Leu Cys
Ile Thr Asp His Trp Arg Thr Leu Ser Ser 1 5 10 15 His Ser Gly Pro
Val Met Asn Tyr Leu Ala His Cys Thr Asn Asp Asp 20 25 30 Cys Lys
Ser Phe Lys Gly Asp Ser Gly Asn Val Trp Val Lys Ile Glu 35 40 45
Gln Leu Ala Tyr Asn Pro Ser Ala Asn Pro Pro Trp Ala Ser Asp Leu 50
55 60 Leu Arg Glu His Gly Ala Lys Trp Lys Val Thr Ile Pro Pro Ser
Leu 65 70 75 80 Val Pro Gly Glu Tyr Leu Leu Arg His Glu Ile Leu Gly
Leu His Val 85 90 95 Ala Gly Thr Val Met Gly Ala Gln Phe Tyr Pro
Gly Cys Thr Gln Ile 100 105 110 Arg Val Thr Glu Gly Gly Ser Thr Gln
Leu Pro Ser Gly Ile Ala Leu 115 120 125 Pro Gly Ala Tyr Gly Pro Gln
Asp Glu Gly Ile Leu Val Asp Leu Trp 130 135 140 Arg Val Asn Gln Gly
Gln Val Asn Tyr Thr Ala Pro Gly Gly Pro Val 145 150 155 160 Trp Ser
Glu Ala Trp Asp Thr Glu Phe Gly Gly Ser Asn Thr Thr Glu 165 170 175
Cys Ala Thr Met Leu Asp Asp Leu Leu Asp Tyr Met Ala Ala Asn Asp 180
185 190 Glu Trp Ile Gly Trp Thr Ala 195 104693DNAMyceliophthora
thermophila 104atgaactatc tcgcccattg caccaatgac gactgcaagt
ctttcaaggg cgacagcggc 60aacgtctggg tcaagatcga gcagctcgcg tacaacccgt
cagccaaccc cccctgggcg 120tctgacctcc tccgtgagca cggtgccaag
tggaaggtga cgatcccgcc cagtcttgtc 180cccggcgaat atctgctgcg
gcacgagatc ctggggttgc acgtcgcagg aaccgtgatg 240ggcgcccagt
tctaccccgg ctgcacccag atcagggtca ccgaaggcgg gagcacgcag
300ctgccctcgg gtattgcgct cccaggcgct tacggcccac aagacgaggg
tatcttggtc 360gacttgtgga gggttaacca gggccaggtc aactacacgg
cgcctggagg acccgtttgg 420agcgaagcgt gggacaccga gtttggcggg
tccaacacga ccgagtgcgc caccatgctc 480gacgacctgc tcgactacat
ggcggccaac gacgacccat gctgcaccga ccagaaccag 540ttcgggagtc
tcgagccggg gagcaaggcg gccggcggct cgccgagcct gtacgatacc
600gtcttggtcc ccgttctcca gaagaaagtg ccgacaaagc tgcagtggag
cggaccggcg 660agcgtcaacg gggatgagtt gacagagagg ccc
693105231PRTMyceliophthora thermophila 105Met Asn Tyr Leu Ala His
Cys Thr Asn Asp Asp Cys Lys Ser Phe Lys 1 5 10 15 Gly Asp Ser Gly
Asn Val Trp Val Lys Ile Glu Gln Leu Ala Tyr Asn 20 25 30 Pro Ser
Ala Asn Pro Pro Trp Ala Ser Asp Leu Leu Arg Glu His Gly 35 40 45
Ala Lys Trp Lys Val Thr Ile Pro Pro Ser Leu Val Pro Gly Glu Tyr 50
55 60 Leu Leu Arg His Glu Ile Leu Gly Leu His Val Ala Gly Thr Val
Met 65 70 75 80 Gly Ala Gln Phe Tyr Pro Gly Cys Thr Gln Ile Arg Val
Thr Glu Gly 85 90 95 Gly Ser Thr Gln Leu Pro Ser Gly Ile Ala Leu
Pro Gly Ala Tyr Gly 100 105 110 Pro Gln Asp Glu Gly Ile Leu Val Asp
Leu Trp Arg Val Asn Gln Gly 115 120 125 Gln Val Asn Tyr Thr Ala Pro
Gly Gly Pro Val Trp Ser Glu Ala Trp 130 135 140 Asp Thr Glu Phe Gly
Gly Ser Asn Thr Thr Glu Cys Ala Thr Met Leu 145 150 155 160 Asp Asp
Leu Leu Asp Tyr Met Ala Ala Asn Asp Asp Pro Cys Cys Thr 165 170 175
Asp Gln Asn Gln Phe Gly Ser Leu Glu Pro Gly Ser Lys Ala Ala Gly 180
185 190 Gly Ser Pro Ser Leu Tyr Asp Thr Val Leu Val Pro Val Leu Gln
Lys 195 200 205 Lys Val Pro Thr Lys Leu Gln Trp Ser Gly Pro Ala Ser
Val Asn Gly 210 215 220 Asp Glu Leu Thr Glu Arg Pro 225 230
106681DNAMyceliophthora thermophila 106atgaagctga gcgctgccat
cgccgtgctc gcggccgccc ttgccgaggg gcactatacc 60ttccccagca tcgccaacac
ggccgactgg caatatgtgc gcatcacgac caacttccag 120agcaacggcc
ccgtgacgga cgtcaactcg gaccagatcc ggtgctacga gcgcaacccg
180ggcaccggcg cccccggcat ctacaacgtc acggccggca caaccatcaa
ctacaacgcc 240aagtcgtcca tctcccaccc gggacccatg gccttctaca
ttgccaaggt tcccgccggc 300cagtcggccg ccacctggga cggtaagggc
gccgtctggt ccaagatcca ccaggagatg 360ccgcactttg gcaccagcct
cacctgggac tccaacggcc gcacctccat gcccgtcacc 420atcccccgct
gtctgcagga cggcgagtat ctgctgcgtg cagagcacat tgccctccac
480agcgccggca gccccggcgg cgcccagttc tacatttctt gtgcccagct
ctcagtcacc 540ggcggcagcg ggacctggaa ccccaggaac aaggtgtcgt
tccccggcgc ctacaaggcc 600actgacccgg gcatcctgat caacatctac
taccccgtcc cgactagcta cactcccgct 660ggtccccccg tcgacacctg c
681107227PRTMyceliophthora thermophila 107Met Lys Leu Ser Ala Ala
Ile Ala
Val Leu Ala Ala Ala Leu Ala Glu 1 5 10 15 Gly His Tyr Thr Phe Pro
Ser Ile Ala Asn Thr Ala Asp Trp Gln Tyr 20 25 30 Val Arg Ile Thr
Thr Asn Phe Gln Ser Asn Gly Pro Val Thr Asp Val 35 40 45 Asn Ser
Asp Gln Ile Arg Cys Tyr Glu Arg Asn Pro Gly Thr Gly Ala 50 55 60
Pro Gly Ile Tyr Asn Val Thr Ala Gly Thr Thr Ile Asn Tyr Asn Ala 65
70 75 80 Lys Ser Ser Ile Ser His Pro Gly Pro Met Ala Phe Tyr Ile
Ala Lys 85 90 95 Val Pro Ala Gly Gln Ser Ala Ala Thr Trp Asp Gly
Lys Gly Ala Val 100 105 110 Trp Ser Lys Ile His Gln Glu Met Pro His
Phe Gly Thr Ser Leu Thr 115 120 125 Trp Asp Ser Asn Gly Arg Thr Ser
Met Pro Val Thr Ile Pro Arg Cys 130 135 140 Leu Gln Asp Gly Glu Tyr
Leu Leu Arg Ala Glu His Ile Ala Leu His 145 150 155 160 Ser Ala Gly
Ser Pro Gly Gly Ala Gln Phe Tyr Ile Ser Cys Ala Gln 165 170 175 Leu
Ser Val Thr Gly Gly Ser Gly Thr Trp Asn Pro Arg Asn Lys Val 180 185
190 Ser Phe Pro Gly Ala Tyr Lys Ala Thr Asp Pro Gly Ile Leu Ile Asn
195 200 205 Ile Tyr Tyr Pro Val Pro Thr Ser Tyr Thr Pro Ala Gly Pro
Pro Val 210 215 220 Asp Thr Cys 225 108210PRTMyceliophthora
thermophila 108His Tyr Thr Phe Pro Ser Ile Ala Asn Thr Ala Asp Trp
Gln Tyr Val 1 5 10 15 Arg Ile Thr Thr Asn Phe Gln Ser Asn Gly Pro
Val Thr Asp Val Asn 20 25 30 Ser Asp Gln Ile Arg Cys Tyr Glu Arg
Asn Pro Gly Thr Gly Ala Pro 35 40 45 Gly Ile Tyr Asn Val Thr Ala
Gly Thr Thr Ile Asn Tyr Asn Ala Lys 50 55 60 Ser Ser Ile Ser His
Pro Gly Pro Met Ala Phe Tyr Ile Ala Lys Val 65 70 75 80 Pro Ala Gly
Gln Ser Ala Ala Thr Trp Asp Gly Lys Gly Ala Val Trp 85 90 95 Ser
Lys Ile His Gln Glu Met Pro His Phe Gly Thr Ser Leu Thr Trp 100 105
110 Asp Ser Asn Gly Arg Thr Ser Met Pro Val Thr Ile Pro Arg Cys Leu
115 120 125 Gln Asp Gly Glu Tyr Leu Leu Arg Ala Glu His Ile Ala Leu
His Ser 130 135 140 Ala Gly Ser Pro Gly Gly Ala Gln Phe Tyr Ile Ser
Cys Ala Gln Leu 145 150 155 160 Ser Val Thr Gly Gly Ser Gly Thr Trp
Asn Pro Arg Asn Lys Val Ser 165 170 175 Phe Pro Gly Ala Tyr Lys Ala
Thr Asp Pro Gly Ile Leu Ile Asn Ile 180 185 190 Tyr Tyr Pro Val Pro
Thr Ser Tyr Thr Pro Ala Gly Pro Pro Val Asp 195 200 205 Thr Cys 210
109765DNAMyceliophthora thermophila 109atgtaccgca cgctcggttc
cattgccctg ctcgcggggg gcgctgccgc ccacggcgcc 60gtgaccagct acaacattgc
gggcaaggac taccctggat actcgggctt cgcccctacc 120ggccaggatg
tcatccagtg gcaatggccc gactataacc ccgtgctgtc cgccagcgac
180cccaagctcc gctgcaacgg cggcaccggg gcggcgctgt atgccgaggc
ggcccccggc 240gacaccatca cggccacctg ggcccagtgg acgcactccc
agggcccgat cctggtgtgg 300atgtacaagt gccccggcga cttcagctcc
tgcgacggct ccggcgcggg ttggttcaag 360atcgacgagg ccggcttcca
cggcgacggc acgaccgtct tcctcgacac cgagaccccc 420tcgggctggg
acattgccaa gctggtcggc ggcaacaagt cgtggagcag caagatccct
480gacggcctcg ccccgggcaa ttacctggtc cgccacgagc tcatcgccct
gcaccaggcc 540aacaacccgc aattctaccc cgagtgcgcc cagatcaagg
tcaccggctc tggcaccgcc 600gagcccgccg cctcctacaa ggccgccatc
cccggctact gccagcagag cgaccccaac 660atttcgttca acatcaacga
ccactccctc ccgcaggagt acaagatccc cggtcccccg 720gtcttcaagg
gcaccgcctc cgccaaggct cgcgctttcc aggcc 765110255PRTMyceliophthora
thermophila 110Met Tyr Arg Thr Leu Gly Ser Ile Ala Leu Leu Ala Gly
Gly Ala Ala 1 5 10 15 Ala His Gly Ala Val Thr Ser Tyr Asn Ile Ala
Gly Lys Asp Tyr Pro 20 25 30 Gly Tyr Ser Gly Phe Ala Pro Thr Gly
Gln Asp Val Ile Gln Trp Gln 35 40 45 Trp Pro Asp Tyr Asn Pro Val
Leu Ser Ala Ser Asp Pro Lys Leu Arg 50 55 60 Cys Asn Gly Gly Thr
Gly Ala Ala Leu Tyr Ala Glu Ala Ala Pro Gly 65 70 75 80 Asp Thr Ile
Thr Ala Thr Trp Ala Gln Trp Thr His Ser Gln Gly Pro 85 90 95 Ile
Leu Val Trp Met Tyr Lys Cys Pro Gly Asp Phe Ser Ser Cys Asp 100 105
110 Gly Ser Gly Ala Gly Trp Phe Lys Ile Asp Glu Ala Gly Phe His Gly
115 120 125 Asp Gly Thr Thr Val Phe Leu Asp Thr Glu Thr Pro Ser Gly
Trp Asp 130 135 140 Ile Ala Lys Leu Val Gly Gly Asn Lys Ser Trp Ser
Ser Lys Ile Pro 145 150 155 160 Asp Gly Leu Ala Pro Gly Asn Tyr Leu
Val Arg His Glu Leu Ile Ala 165 170 175 Leu His Gln Ala Asn Asn Pro
Gln Phe Tyr Pro Glu Cys Ala Gln Ile 180 185 190 Lys Val Thr Gly Ser
Gly Thr Ala Glu Pro Ala Ala Ser Tyr Lys Ala 195 200 205 Ala Ile Pro
Gly Tyr Cys Gln Gln Ser Asp Pro Asn Ile Ser Phe Asn 210 215 220 Ile
Asn Asp His Ser Leu Pro Gln Glu Tyr Lys Ile Pro Gly Pro Pro 225 230
235 240 Val Phe Lys Gly Thr Ala Ser Ala Lys Ala Arg Ala Phe Gln Ala
245 250 255 111236PRTMyceliophthora thermophila 111Ala Val Thr Ser
Tyr Asn Ile Ala Gly Lys Asp Tyr Pro Gly Tyr Ser 1 5 10 15 Gly Phe
Ala Pro Thr Gly Gln Asp Val Ile Gln Trp Gln Trp Pro Asp 20 25 30
Tyr Asn Pro Val Leu Ser Ala Ser Asp Pro Lys Leu Arg Cys Asn Gly 35
40 45 Gly Thr Gly Ala Ala Leu Tyr Ala Glu Ala Ala Pro Gly Asp Thr
Ile 50 55 60 Thr Ala Thr Trp Ala Gln Trp Thr His Ser Gln Gly Pro
Ile Leu Val 65 70 75 80 Trp Met Tyr Lys Cys Pro Gly Asp Phe Ser Ser
Cys Asp Gly Ser Gly 85 90 95 Ala Gly Trp Phe Lys Ile Asp Glu Ala
Gly Phe His Gly Asp Gly Thr 100 105 110 Thr Val Phe Leu Asp Thr Glu
Thr Pro Ser Gly Trp Asp Ile Ala Lys 115 120 125 Leu Val Gly Gly Asn
Lys Ser Trp Ser Ser Lys Ile Pro Asp Gly Leu 130 135 140 Ala Pro Gly
Asn Tyr Leu Val Arg His Glu Leu Ile Ala Leu His Gln 145 150 155 160
Ala Asn Asn Pro Gln Phe Tyr Pro Glu Cys Ala Gln Ile Lys Val Thr 165
170 175 Gly Ser Gly Thr Ala Glu Pro Ala Ala Ser Tyr Lys Ala Ala Ile
Pro 180 185 190 Gly Tyr Cys Gln Gln Ser Asp Pro Asn Ile Ser Phe Asn
Ile Asn Asp 195 200 205 His Ser Leu Pro Gln Glu Tyr Lys Ile Pro Gly
Pro Pro Val Phe Lys 210 215 220 Gly Thr Ala Ser Ala Lys Ala Arg Ala
Phe Gln Ala 225 230 235 112675DNAMyceliophthora thermophila
112atgctgacaa caaccttcgc cctcctgacg gccgctctcg gcgtcagcgc
ccattatacc 60ctccccaggg tcgggaccgg ttccgactgg cagcacgtgc ggcgggctga
caactggcaa 120aacaacggct tcgtcggcga cgtcaactcg gagcagatca
ggtgcttcca ggcgacccct 180gccggcgccc aagacgtcta cactgttcag
gcgggatcga ccgtgaccta ccacgccaac 240cccagtatct accaccccgg
ccccatgcag ttctacctgg cccgcgttcc ggacggacag 300gacgtcaagt
cgtggaccgg cgagggtgcc gtgtggttca aggtgtacga ggagcagcct
360caatttggcg cccagctgac ctggcctagc aacggcaaga gctcgttcga
ggttcctatc 420cccagctgca ttcgggcggg caactacctc ctccgcgctg
agcacatcgc cctgcacgtt 480gcccaaagcc agggcggcgc ccagttctac
atctcgtgcg cccagctcca ggtcactggt 540ggcggcagca ccgagccttc
tcagaaggtt tccttcccgg gtgcctacaa gtccaccgac 600cccggcattc
ttatcaacat caactacccc gtccctacct cgtaccagaa tccgggtccg
660gctgtcttcc gttgc 675113225PRTMyceliophthora thermophila 113Met
Leu Thr Thr Thr Phe Ala Leu Leu Thr Ala Ala Leu Gly Val Ser 1 5 10
15 Ala His Tyr Thr Leu Pro Arg Val Gly Thr Gly Ser Asp Trp Gln His
20 25 30 Val Arg Arg Ala Asp Asn Trp Gln Asn Asn Gly Phe Val Gly
Asp Val 35 40 45 Asn Ser Glu Gln Ile Arg Cys Phe Gln Ala Thr Pro
Ala Gly Ala Gln 50 55 60 Asp Val Tyr Thr Val Gln Ala Gly Ser Thr
Val Thr Tyr His Ala Asn 65 70 75 80 Pro Ser Ile Tyr His Pro Gly Pro
Met Gln Phe Tyr Leu Ala Arg Val 85 90 95 Pro Asp Gly Gln Asp Val
Lys Ser Trp Thr Gly Glu Gly Ala Val Trp 100 105 110 Phe Lys Val Tyr
Glu Glu Gln Pro Gln Phe Gly Ala Gln Leu Thr Trp 115 120 125 Pro Ser
Asn Gly Lys Ser Ser Phe Glu Val Pro Ile Pro Ser Cys Ile 130 135 140
Arg Ala Gly Asn Tyr Leu Leu Arg Ala Glu His Ile Ala Leu His Val 145
150 155 160 Ala Gln Ser Gln Gly Gly Ala Gln Phe Tyr Ile Ser Cys Ala
Gln Leu 165 170 175 Gln Val Thr Gly Gly Gly Ser Thr Glu Pro Ser Gln
Lys Val Ser Phe 180 185 190 Pro Gly Ala Tyr Lys Ser Thr Asp Pro Gly
Ile Leu Ile Asn Ile Asn 195 200 205 Tyr Pro Val Pro Thr Ser Tyr Gln
Asn Pro Gly Pro Ala Val Phe Arg 210 215 220 Cys 225
114208PRTMyceliophthora thermophila 114His Tyr Thr Leu Pro Arg Val
Gly Thr Gly Ser Asp Trp Gln His Val 1 5 10 15 Arg Arg Ala Asp Asn
Trp Gln Asn Asn Gly Phe Val Gly Asp Val Asn 20 25 30 Ser Glu Gln
Ile Arg Cys Phe Gln Ala Thr Pro Ala Gly Ala Gln Asp 35 40 45 Val
Tyr Thr Val Gln Ala Gly Ser Thr Val Thr Tyr His Ala Asn Pro 50 55
60 Ser Ile Tyr His Pro Gly Pro Met Gln Phe Tyr Leu Ala Arg Val Pro
65 70 75 80 Asp Gly Gln Asp Val Lys Ser Trp Thr Gly Glu Gly Ala Val
Trp Phe 85 90 95 Lys Val Tyr Glu Glu Gln Pro Gln Phe Gly Ala Gln
Leu Thr Trp Pro 100 105 110 Ser Asn Gly Lys Ser Ser Phe Glu Val Pro
Ile Pro Ser Cys Ile Arg 115 120 125 Ala Gly Asn Tyr Leu Leu Arg Ala
Glu His Ile Ala Leu His Val Ala 130 135 140 Gln Ser Gln Gly Gly Ala
Gln Phe Tyr Ile Ser Cys Ala Gln Leu Gln 145 150 155 160 Val Thr Gly
Gly Gly Ser Thr Glu Pro Ser Gln Lys Val Ser Phe Pro 165 170 175 Gly
Ala Tyr Lys Ser Thr Asp Pro Gly Ile Leu Ile Asn Ile Asn Tyr 180 185
190 Pro Val Pro Thr Ser Tyr Gln Asn Pro Gly Pro Ala Val Phe Arg Cys
195 200 205 115711DNAMyceliophthora thermophila 115atgaaggttc
tcgcgcccct gattctggcc ggtgccgcca gcgcccacac catcttctca 60tccctcgagg
tgggcggcgt caaccagggc atcgggcagg gtgtccgcgt gccgtcgtac
120aacggtccga tcgaggacgt gacgtccaac tcgatcgcct gcaacgggcc
ccccaacccg 180acgacgccga ccaacaaggt catcacggtc cgggccggcg
agacggtgac ggccgtctgg 240cggtacatgc tgagcaccac cggctcggcc
cccaacgaca tcatggacag cagccacaag 300ggcccgacca tggcctacct
caagaaggtc gacaacgcca ccaccgactc gggcgtcggc 360ggcggctggt
tcaagatcca ggaggacggc cttaccaacg gcgtctgggg caccgagcgc
420gtcatcaacg gccagggccg ccacaacatc aagatccccg agtgcatcgc
ccccggccag 480tacctcctcc gcgccgagat gcttgccctg cacggagctt
ccaactaccc cggcgctcag 540ttctacatgg agtgcgccca gctcaatatc
gtcggcggca ccggcagcaa gacgccgtcc 600accgtcagct tcccgggcgc
ttacaagggt accgaccccg gagtcaagat caacatctac 660tggccccccg
tcaccagcta ccagattccc ggccccggcg tgttcacctg c
711116237PRTMyceliophthora thermophila 116Met Lys Val Leu Ala Pro
Leu Ile Leu Ala Gly Ala Ala Ser Ala His 1 5 10 15 Thr Ile Phe Ser
Ser Leu Glu Val Gly Gly Val Asn Gln Gly Ile Gly 20 25 30 Gln Gly
Val Arg Val Pro Ser Tyr Asn Gly Pro Ile Glu Asp Val Thr 35 40 45
Ser Asn Ser Ile Ala Cys Asn Gly Pro Pro Asn Pro Thr Thr Pro Thr 50
55 60 Asn Lys Val Ile Thr Val Arg Ala Gly Glu Thr Val Thr Ala Val
Trp 65 70 75 80 Arg Tyr Met Leu Ser Thr Thr Gly Ser Ala Pro Asn Asp
Ile Met Asp 85 90 95 Ser Ser His Lys Gly Pro Thr Met Ala Tyr Leu
Lys Lys Val Asp Asn 100 105 110 Ala Thr Thr Asp Ser Gly Val Gly Gly
Gly Trp Phe Lys Ile Gln Glu 115 120 125 Asp Gly Leu Thr Asn Gly Val
Trp Gly Thr Glu Arg Val Ile Asn Gly 130 135 140 Gln Gly Arg His Asn
Ile Lys Ile Pro Glu Cys Ile Ala Pro Gly Gln 145 150 155 160 Tyr Leu
Leu Arg Ala Glu Met Leu Ala Leu His Gly Ala Ser Asn Tyr 165 170 175
Pro Gly Ala Gln Phe Tyr Met Glu Cys Ala Gln Leu Asn Ile Val Gly 180
185 190 Gly Thr Gly Ser Lys Thr Pro Ser Thr Val Ser Phe Pro Gly Ala
Tyr 195 200 205 Lys Gly Thr Asp Pro Gly Val Lys Ile Asn Ile Tyr Trp
Pro Pro Val 210 215 220 Thr Ser Tyr Gln Ile Pro Gly Pro Gly Val Phe
Thr Cys 225 230 235 117222PRTMyceliophthora thermophila 117His Thr
Ile Phe Ser Ser Leu Glu Val Gly Gly Val Asn Gln Gly Ile 1 5 10 15
Gly Gln Gly Val Arg Val Pro Ser Tyr Asn Gly Pro Ile Glu Asp Val 20
25 30 Thr Ser Asn Ser Ile Ala Cys Asn Gly Pro Pro Asn Pro Thr Thr
Pro 35 40 45 Thr Asn Lys Val Ile Thr Val Arg Ala Gly Glu Thr Val
Thr Ala Val 50 55 60 Trp Arg Tyr Met Leu Ser Thr Thr Gly Ser Ala
Pro Asn Asp Ile Met 65 70 75 80 Asp Ser Ser His Lys Gly Pro Thr Met
Ala Tyr Leu Lys Lys Val Asp 85 90 95 Asn Ala Thr Thr Asp Ser Gly
Val Gly Gly Gly Trp Phe Lys Ile Gln 100 105 110 Glu Asp Gly Leu Thr
Asn Gly Val Trp Gly Thr Glu Arg Val Ile Asn 115 120 125 Gly Gln Gly
Arg His Asn Ile Lys Ile Pro Glu Cys Ile Ala Pro Gly 130 135 140 Gln
Tyr Leu Leu Arg Ala Glu Met Leu Ala Leu His Gly Ala Ser Asn 145 150
155 160 Tyr Pro Gly Ala Gln Phe Tyr Met Glu Cys Ala Gln Leu Asn Ile
Val 165 170 175 Gly Gly Thr Gly Ser Lys Thr Pro Ser Thr Val Ser Phe
Pro Gly Ala 180 185 190 Tyr Lys Gly Thr Asp Pro Gly Val Lys Ile Asn
Ile Tyr Trp Pro Pro 195 200 205 Val Thr Ser Tyr Gln Ile Pro Gly Pro
Gly Val Phe Thr Cys 210 215 220 118225DNAMyceliophthora thermophila
118atgatcgaca acctccctga tgactcccta caacccgcct gcctccgccc
gggccactac 60ctcgtccgcc acgagatcat cgcgctgcac tcggcctggg ccgagggcga
ggcccagttc 120taccccttcc ccctttttcc tttttttccc tcccttcttt
tgtccggtaa ctacacgatt 180cccggtcccg cgatctggaa gtgcccagag
gcacagcaga acgag 22511975PRTMyceliophthora thermophila 119Met Ile
Asp Asn Leu Pro Asp Asp Ser Leu Gln Pro Ala Cys Leu Arg 1 5 10 15
Pro Gly His Tyr Leu Val Arg His Glu Ile Ile Ala Leu His Ser Ala 20
25 30 Trp Ala Glu Gly Glu Ala Gln Phe Tyr Pro Phe Pro Leu Phe Pro
Phe 35
40 45 Phe Pro Ser Leu Leu Leu Ser Gly Asn Tyr Thr Ile Pro Gly Pro
Ala 50 55 60 Ile Trp Lys Cys Pro Glu Ala Gln Gln Asn Glu 65 70 75
12057PRTMyceliophthora thermophila 120His Tyr Leu Val Arg His Glu
Ile Ile Ala Leu His Ser Ala Trp Ala 1 5 10 15 Glu Gly Glu Ala Gln
Phe Tyr Pro Phe Pro Leu Phe Pro Phe Phe Pro 20 25 30 Ser Leu Leu
Leu Ser Gly Asn Tyr Thr Ile Pro Gly Pro Ala Ile Trp 35 40 45 Lys
Cys Pro Glu Ala Gln Gln Asn Glu 50 55 1211395DNAMyceliophthora
thermophila 121atggggcaga agactctcca ggggctggtg gcggcggcgg
cactggcagc ctcggtggcg 60aacgcgcagc aaccgggcac cttcacgccc gaggtgcatc
cgacgctgcc gacgtggaag 120tgcacgacga gcggcgggtg cgtccagcag
gacacgtcgg tggtgctcga ctggaactac 180cgctggttcc acaccgagga
cggtagcaag tcgtgcatca cctctagcgg cgtcgaccgg 240accctgtgcc
cggacgaggc gacgtgcgcc aagaactgct tcgtcgaggg cgtcaactac
300acgagcagcg gggtcgagac gtccggcagc tccctcaccc tccgccagtt
cttcaagggc 360tccgacggcg ccatcaacag cgtctccccg cgcgtctacc
tgctcggggg agacggcaac 420tatgtcgtgc tcaagctcct cggccaggag
ctgagcttcg acgtggacgt atcgtcgctc 480ccgtgcggcg agaacgcggc
cctgtacctg tccgagatgg acgcgacggg aggacggaac 540gagtacaaca
cgggcggggc cgagtacggg tcgggctact gtgacgccca gtgccccgtg
600cagaactgga acaacgggac gctcaacacg ggccgggtgg gctcgtgctg
caacgagatg 660gacatcctcg aggccaactc caaggccgag gccttcacgc
cgcacccctg catcggcaac 720tcgtgcgaca agagcgggtg cggcttcaac
gcgtacgcgc gcggttacca caactactgg 780gcccccggcg gcacgctcga
cacgtcccgg cctttcacca tgatcacccg cttcgtcacc 840gacgacggca
ccacctcggg caagctcgcc cgcatcgagc gcgtctacgt ccaggacggc
900aagaaggtgc ccagcgcggc gcccgggggg gacgtcatca cggccgacgg
gtgcacctcc 960gcgcagccct acggcggcct ttccggcatg ggcgacgccc
tcggccgcgg catggtcctg 1020gccctgagca tctggaacga cgcgtccggg
tacatgaact ggctcgacgc cggcagcaac 1080ggcccctgca gcgacaccga
gggtaacccg tccaacatcc tggccaacca cccggacgcc 1140cacgtcgtgc
tctccaacat ccgctggggc gacatcggct ccaccgtcga caccggcgat
1200ggcgacaaca acggcggcgg ccccaacccg tcatccacca ccaccgctac
cgctaccacc 1260acctcctccg gcccggccga gcctacccag acccactacg
gccagtgtgg agggaaagga 1320tggacgggcc ctacccgctg cgagacgccc
tacacctgca agtaccagaa cgactggtac 1380tcgcagtgcc tgtag
1395122464PRTMyceliophthora thermophila 122Met Gly Gln Lys Thr Leu
Gln Gly Leu Val Ala Ala Ala Ala Leu Ala 1 5 10 15 Ala Ser Val Ala
Asn Ala Gln Gln Pro Gly Thr Phe Thr Pro Glu Val 20 25 30 His Pro
Thr Leu Pro Thr Trp Lys Cys Thr Thr Ser Gly Gly Cys Val 35 40 45
Gln Gln Asp Thr Ser Val Val Leu Asp Trp Asn Tyr Arg Trp Phe His 50
55 60 Thr Glu Asp Gly Ser Lys Ser Cys Ile Thr Ser Ser Gly Val Asp
Arg 65 70 75 80 Thr Leu Cys Pro Asp Glu Ala Thr Cys Ala Lys Asn Cys
Phe Val Glu 85 90 95 Gly Val Asn Tyr Thr Ser Ser Gly Val Glu Thr
Ser Gly Ser Ser Leu 100 105 110 Thr Leu Arg Gln Phe Phe Lys Gly Ser
Asp Gly Ala Ile Asn Ser Val 115 120 125 Ser Pro Arg Val Tyr Leu Leu
Gly Gly Asp Gly Asn Tyr Val Val Leu 130 135 140 Lys Leu Leu Gly Gln
Glu Leu Ser Phe Asp Val Asp Val Ser Ser Leu 145 150 155 160 Pro Cys
Gly Glu Asn Ala Ala Leu Tyr Leu Ser Glu Met Asp Ala Thr 165 170 175
Gly Gly Arg Asn Glu Tyr Asn Thr Gly Gly Ala Glu Tyr Gly Ser Gly 180
185 190 Tyr Cys Asp Ala Gln Cys Pro Val Gln Asn Trp Asn Asn Gly Thr
Leu 195 200 205 Asn Thr Gly Arg Val Gly Ser Cys Cys Asn Glu Met Asp
Ile Leu Glu 210 215 220 Ala Asn Ser Lys Ala Glu Ala Phe Thr Pro His
Pro Cys Ile Gly Asn 225 230 235 240 Ser Cys Asp Lys Ser Gly Cys Gly
Phe Asn Ala Tyr Ala Arg Gly Tyr 245 250 255 His Asn Tyr Trp Ala Pro
Gly Gly Thr Leu Asp Thr Ser Arg Pro Phe 260 265 270 Thr Met Ile Thr
Arg Phe Val Thr Asp Asp Gly Thr Thr Ser Gly Lys 275 280 285 Leu Ala
Arg Ile Glu Arg Val Tyr Val Gln Asp Gly Lys Lys Val Pro 290 295 300
Ser Ala Ala Pro Gly Gly Asp Val Ile Thr Ala Asp Gly Cys Thr Ser 305
310 315 320 Ala Gln Pro Tyr Gly Gly Leu Ser Gly Met Gly Asp Ala Leu
Gly Arg 325 330 335 Gly Met Val Leu Ala Leu Ser Ile Trp Asn Asp Ala
Ser Gly Tyr Met 340 345 350 Asn Trp Leu Asp Ala Gly Ser Asn Gly Pro
Cys Ser Asp Thr Glu Gly 355 360 365 Asn Pro Ser Asn Ile Leu Ala Asn
His Pro Asp Ala His Val Val Leu 370 375 380 Ser Asn Ile Arg Trp Gly
Asp Ile Gly Ser Thr Val Asp Thr Gly Asp 385 390 395 400 Gly Asp Asn
Asn Gly Gly Gly Pro Asn Pro Ser Ser Thr Thr Thr Ala 405 410 415 Thr
Ala Thr Thr Thr Ser Ser Gly Pro Ala Glu Pro Thr Gln Thr His 420 425
430 Tyr Gly Gln Cys Gly Gly Lys Gly Trp Thr Gly Pro Thr Arg Cys Glu
435 440 445 Thr Pro Tyr Thr Cys Lys Tyr Gln Asn Asp Trp Tyr Ser Gln
Cys Leu 450 455 460 123442PRTMyceliophthora thermophila 123Gln Gln
Pro Gly Thr Phe Thr Pro Glu Val His Pro Thr Leu Pro Thr 1 5 10 15
Trp Lys Cys Thr Thr Ser Gly Gly Cys Val Gln Gln Asp Thr Ser Val 20
25 30 Val Leu Asp Trp Asn Tyr Arg Trp Phe His Thr Glu Asp Gly Ser
Lys 35 40 45 Ser Cys Ile Thr Ser Ser Gly Val Asp Arg Thr Leu Cys
Pro Asp Glu 50 55 60 Ala Thr Cys Ala Lys Asn Cys Phe Val Glu Gly
Val Asn Tyr Thr Ser 65 70 75 80 Ser Gly Val Glu Thr Ser Gly Ser Ser
Leu Thr Leu Arg Gln Phe Phe 85 90 95 Lys Gly Ser Asp Gly Ala Ile
Asn Ser Val Ser Pro Arg Val Tyr Leu 100 105 110 Leu Gly Gly Asp Gly
Asn Tyr Val Val Leu Lys Leu Leu Gly Gln Glu 115 120 125 Leu Ser Phe
Asp Val Asp Val Ser Ser Leu Pro Cys Gly Glu Asn Ala 130 135 140 Ala
Leu Tyr Leu Ser Glu Met Asp Ala Thr Gly Gly Arg Asn Glu Tyr 145 150
155 160 Asn Thr Gly Gly Ala Glu Tyr Gly Ser Gly Tyr Cys Asp Ala Gln
Cys 165 170 175 Pro Val Gln Asn Trp Asn Asn Gly Thr Leu Asn Thr Gly
Arg Val Gly 180 185 190 Ser Cys Cys Asn Glu Met Asp Ile Leu Glu Ala
Asn Ser Lys Ala Glu 195 200 205 Ala Phe Thr Pro His Pro Cys Ile Gly
Asn Ser Cys Asp Lys Ser Gly 210 215 220 Cys Gly Phe Asn Ala Tyr Ala
Arg Gly Tyr His Asn Tyr Trp Ala Pro 225 230 235 240 Gly Gly Thr Leu
Asp Thr Ser Arg Pro Phe Thr Met Ile Thr Arg Phe 245 250 255 Val Thr
Asp Asp Gly Thr Thr Ser Gly Lys Leu Ala Arg Ile Glu Arg 260 265 270
Val Tyr Val Gln Asp Gly Lys Lys Val Pro Ser Ala Ala Pro Gly Gly 275
280 285 Asp Val Ile Thr Ala Asp Gly Cys Thr Ser Ala Gln Pro Tyr Gly
Gly 290 295 300 Leu Ser Gly Met Gly Asp Ala Leu Gly Arg Gly Met Val
Leu Ala Leu 305 310 315 320 Ser Ile Trp Asn Asp Ala Ser Gly Tyr Met
Asn Trp Leu Asp Ala Gly 325 330 335 Ser Asn Gly Pro Cys Ser Asp Thr
Glu Gly Asn Pro Ser Asn Ile Leu 340 345 350 Ala Asn His Pro Asp Ala
His Val Val Leu Ser Asn Ile Arg Trp Gly 355 360 365 Asp Ile Gly Ser
Thr Val Asp Thr Gly Asp Gly Asp Asn Asn Gly Gly 370 375 380 Gly Pro
Asn Pro Ser Ser Thr Thr Thr Ala Thr Ala Thr Thr Thr Ser 385 390 395
400 Ser Gly Pro Ala Glu Pro Thr Gln Thr His Tyr Gly Gln Cys Gly Gly
405 410 415 Lys Gly Trp Thr Gly Pro Thr Arg Cys Glu Thr Pro Tyr Thr
Cys Lys 420 425 430 Tyr Gln Asn Asp Trp Tyr Ser Gln Cys Leu 435 440
1241170DNAMyceliophthora thermophila 124atgaagtcct ccatcctcgc
cagcgtcttc gccacgggcg ccgtggctca aagtggtccg 60tggcagcaat gtggtggcat
cggatggcaa ggatcgaccg actgtgtgtc gggttaccac 120tgcgtctacc
agaacgattg gtacagccag tgcgtgcctg gcgcggcgtc gacaacgctc
180cagacatcta ccacgtccag gcccaccgcc accagcaccg cccctccgtc
gtccaccacc 240tcgcctagca agggcaagct caagtggctc ggcagcaacg
agtcgggcgc cgagttcggg 300gagggcaact accccggcct ctggggcaag
cacttcatct tcccgtcgac ttcggcgatt 360cagacgctca tcaatgatgg
atacaacatc ttccggatcg acttctcgat ggagcgtctg 420gtgcccaacc
agttgacgtc gtccttcgac gagggctacc tccgcaacct gaccgaggtg
480gtcaacttcg tgacgaacgc gggcaagtac gccgtcctgg acccgcacaa
ctacggccgg 540tactacggca acgtcatcac ggacacgaac gcgttccgga
ccttctggac caacctggcc 600aagcagttcg cctccaactc gctcgtcatc
ttcgacacca acaacgagta caacacgatg 660gaccagaccc tggtgctcaa
cctcaaccag gccgccatcg acggcatccg ggccgccggc 720gcgacctcgc
agtacatctt cgtcgagggc aacgcgtgga gcggggcctg gagctggaac
780acgaccaaca ccaacatggc cgccctgacg gacccgcaga acaagatcgt
gtacgagatg 840caccagtacc tcgactcgga cagctcgggc acccacgccg
agtgcgtcag cagcaacatc 900ggcgcccagc gcgtcgtcgg agccacccag
tggctccgcg ccaacggcaa gctcggcgtc 960ctcggcgagt tcgccggcgg
cgccaacgcc gtctgccagc aggccgtcac cggcctcctc 1020gaccacctcc
aggacaacag cgacgtctgg ctgggtgccc tctggtgggc cgccggtccc
1080tggtggggcg actacatgta ctcgttcgag cctccttcgg gcaccggcta
tgtcaactac 1140aactcgatcc taaagaagta cttgccgtaa
1170125389PRTMyceliophthora thermophila 125Met Lys Ser Ser Ile Leu
Ala Ser Val Phe Ala Thr Gly Ala Val Ala 1 5 10 15 Gln Ser Gly Pro
Trp Gln Gln Cys Gly Gly Ile Gly Trp Gln Gly Ser 20 25 30 Thr Asp
Cys Val Ser Gly Tyr His Cys Val Tyr Gln Asn Asp Trp Tyr 35 40 45
Ser Gln Cys Val Pro Gly Ala Ala Ser Thr Thr Leu Gln Thr Ser Thr 50
55 60 Thr Ser Arg Pro Thr Ala Thr Ser Thr Ala Pro Pro Ser Ser Thr
Thr 65 70 75 80 Ser Pro Ser Lys Gly Lys Leu Lys Trp Leu Gly Ser Asn
Glu Ser Gly 85 90 95 Ala Glu Phe Gly Glu Gly Asn Tyr Pro Gly Leu
Trp Gly Lys His Phe 100 105 110 Ile Phe Pro Ser Thr Ser Ala Ile Gln
Thr Leu Ile Asn Asp Gly Tyr 115 120 125 Asn Ile Phe Arg Ile Asp Phe
Ser Met Glu Arg Leu Val Pro Asn Gln 130 135 140 Leu Thr Ser Ser Phe
Asp Glu Gly Tyr Leu Arg Asn Leu Thr Glu Val 145 150 155 160 Val Asn
Phe Val Thr Asn Ala Gly Lys Tyr Ala Val Leu Asp Pro His 165 170 175
Asn Tyr Gly Arg Tyr Tyr Gly Asn Val Ile Thr Asp Thr Asn Ala Phe 180
185 190 Arg Thr Phe Trp Thr Asn Leu Ala Lys Gln Phe Ala Ser Asn Ser
Leu 195 200 205 Val Ile Phe Asp Thr Asn Asn Glu Tyr Asn Thr Met Asp
Gln Thr Leu 210 215 220 Val Leu Asn Leu Asn Gln Ala Ala Ile Asp Gly
Ile Arg Ala Ala Gly 225 230 235 240 Ala Thr Ser Gln Tyr Ile Phe Val
Glu Gly Asn Ala Trp Ser Gly Ala 245 250 255 Trp Ser Trp Asn Thr Thr
Asn Thr Asn Met Ala Ala Leu Thr Asp Pro 260 265 270 Gln Asn Lys Ile
Val Tyr Glu Met His Gln Tyr Leu Asp Ser Asp Ser 275 280 285 Ser Gly
Thr His Ala Glu Cys Val Ser Ser Asn Ile Gly Ala Gln Arg 290 295 300
Val Val Gly Ala Thr Gln Trp Leu Arg Ala Asn Gly Lys Leu Gly Val 305
310 315 320 Leu Gly Glu Phe Ala Gly Gly Ala Asn Ala Val Cys Gln Gln
Ala Val 325 330 335 Thr Gly Leu Leu Asp His Leu Gln Asp Asn Ser Glu
Val Trp Leu Gly 340 345 350 Ala Leu Trp Trp Ala Ala Gly Pro Trp Trp
Gly Asp Tyr Met Tyr Ser 355 360 365 Phe Glu Pro Pro Ser Gly Thr Gly
Tyr Val Asn Tyr Asn Ser Ile Leu 370 375 380 Lys Lys Tyr Leu Pro 385
126373PRTMyceliophthora thermophila 126Gln Ser Gly Pro Trp Gln Gln
Cys Gly Gly Ile Gly Trp Gln Gly Ser 1 5 10 15 Thr Asp Cys Val Ser
Gly Tyr His Cys Val Tyr Gln Asn Asp Trp Tyr 20 25 30 Ser Gln Cys
Val Pro Gly Ala Ala Ser Thr Thr Leu Gln Thr Ser Thr 35 40 45 Thr
Ser Arg Pro Thr Ala Thr Ser Thr Ala Pro Pro Ser Ser Thr Thr 50 55
60 Ser Pro Ser Lys Gly Lys Leu Lys Trp Leu Gly Ser Asn Glu Ser Gly
65 70 75 80 Ala Glu Phe Gly Glu Gly Asn Tyr Pro Gly Leu Trp Gly Lys
His Phe 85 90 95 Ile Phe Pro Ser Thr Ser Ala Ile Gln Thr Leu Ile
Asn Asp Gly Tyr 100 105 110 Asn Ile Phe Arg Ile Asp Phe Ser Met Glu
Arg Leu Val Pro Asn Gln 115 120 125 Leu Thr Ser Ser Phe Asp Glu Gly
Tyr Leu Arg Asn Leu Thr Glu Val 130 135 140 Val Asn Phe Val Thr Asn
Ala Gly Lys Tyr Ala Val Leu Asp Pro His 145 150 155 160 Asn Tyr Gly
Arg Tyr Tyr Gly Asn Val Ile Thr Asp Thr Asn Ala Phe 165 170 175 Arg
Thr Phe Trp Thr Asn Leu Ala Lys Gln Phe Ala Ser Asn Ser Leu 180 185
190 Val Ile Phe Asp Thr Asn Asn Glu Tyr Asn Thr Met Asp Gln Thr Leu
195 200 205 Val Leu Asn Leu Asn Gln Ala Ala Ile Asp Gly Ile Arg Ala
Ala Gly 210 215 220 Ala Thr Ser Gln Tyr Ile Phe Val Glu Gly Asn Ala
Trp Ser Gly Ala 225 230 235 240 Trp Ser Trp Asn Thr Thr Asn Thr Asn
Met Ala Ala Leu Thr Asp Pro 245 250 255 Gln Asn Lys Ile Val Tyr Glu
Met His Gln Tyr Leu Asp Ser Asp Ser 260 265 270 Ser Gly Thr His Ala
Glu Cys Val Ser Ser Asn Ile Gly Ala Gln Arg 275 280 285 Val Val Gly
Ala Thr Gln Trp Leu Arg Ala Asn Gly Lys Leu Gly Val 290 295 300 Leu
Gly Glu Phe Ala Gly Gly Ala Asn Ala Val Cys Gln Gln Ala Val 305 310
315 320 Thr Gly Leu Leu Asp His Leu Gln Asp Asn Ser Glu Val Trp Leu
Gly 325 330 335 Ala Leu Trp Trp Ala Ala Gly Pro Trp Trp Gly Asp Tyr
Met Tyr Ser 340 345 350 Phe Glu Pro Pro Ser Gly Thr Gly Tyr Val Asn
Tyr Asn Ser Ile Leu 355 360 365 Lys Lys Tyr Leu Pro 370
1272613DNAMyceliophthora thermophila 127atgaaggctg ctgcgctttc
ctgcctcttc ggcagtaccc ttgccgttgc aggcgccatt 60gaatcgagaa aggttcacca
gaagcccctc gcgagatctg aaccttttta cccgtcgcca 120tggatgaatc
ccaacgccga cggctgggcg gaggcctatg cccaggccaa gtcctttgtc
180tcccaaatga ctctgctaga gaaggtcaac ttgaccacgg gagtcggctg
gggggctgag 240cagtgcgtcg gccaagtggg cgcgatccct cgccttggac
ttcgcagtct gtgcatgcat 300gactcccctc tcggcatccg aggagccgac
tacaactcag cgttcccctc tggccagacc 360gttgctgcta cctgggatcg
cggtctgatg taccgtcgcg gctacgcaat gggccaggag 420gccaaaggca
agggcatcaa tgtccttctc ggaccagtcg ccggccccct tggccgcatg
480cccgagggcg gtcgtaactg ggaaggcttc gctccggatc ccgtccttac
cggcatcggc 540atgtccgaga cgatcaaggg cattcaggat gctggcgtca
tcgcttgtgc gaagcacttt 600attggaaacg agcaggagca cttcagacag
gtgccagaag cccagggata cggttacaac
660atcagcgaaa ccctctcctc caacattgac gacaagacca tgcacgagct
ctacctttgg 720ccgtttgccg atgccgtccg ggccggcgtc ggctctgtca
tgtgctcgta ccagcaggtc 780aacaactcgt acgcctgcca gaactcgaag
ctgctgaacg acctcctcaa gaacgagctt 840gggtttcagg gcttcgtcat
gagcgactgg caggcacagc acactggcgc agcaagcgcc 900gtggctggtc
tcgatatgtc catgccgggc gacacccagt tcaacactgg cgtcagtttc
960tggggcgcca atctcaccct cgccgtcctc aacggcacag tccctgccta
ccgtctcgac 1020gacatggcca tgcgcatcat ggccgccctc ttcaaggtca
ccaagaccac cgacctggaa 1080ccgatcaact tctccttctg gaccgacgac
acttatggcc cgatccactg ggccgccaag 1140cagggctacc aggagattaa
ttcccacgtt gacgtccgcg ccgaccacgg caacctcatc 1200cgggagattg
ccgccaaggg tacggtgctg ctgaagaata ccggctctct acccctgaac
1260aagccaaagt tcgtggccgt catcggcgag gatgctgggt cgagccccaa
cgggcccaac 1320ggctgcagcg accgcggctg taacgaaggc acgctcgcca
tgggctgggg atccggcaca 1380gccaactatc cgtacctcgt ttcccccgac
gccgcgctcc aggcccgggc catccaggac 1440ggcacgaggt acgagagcgt
cctgtccaac tacgccgagg aaaagacaaa ggctctggtc 1500tcgcaggcca
atgcaaccgc catcgtcttc gtcaatgccg actcaggcga gggctacatc
1560aacgtggacg gtaacgaggg cgaccgtaag aacctgactc tctggaacaa
cggtgatact 1620ctggtcaaga acgtctcgag ctggtgcagc aacaccatcg
tcgtcatcca ctcggtcggc 1680ccggtcctcc tgaccgattg gtacgacaac
cccaacatca cggccattct ctgggctggt 1740cttccgggcc aggagtcggg
caactccatc accgacgtgc tttacggcaa ggtcaacccc 1800gccgcccgct
cgcccttcac ttggggcaag acccgcgaaa gctatggcgc ggacgtcctg
1860tacaagccga ataatggcaa tggtgcgccc caacaggact tcaccgaggg
cgtcttcatc 1920gactaccgct acttcgacaa ggttgacgat gactcggtca
tctacgagtt cggccacggc 1980ctgagctaca ccaccttcga gtacagcaac
atccgcgtcg tcaagtccaa cgtcagcgag 2040taccggccca cgacgggcac
cacggcccag gccccgacgt ttggcaactt ctccaccgac 2100ctcgaggact
atctcttccc caaggacgag ttcccctaca tctaccagta catctacccg
2160tacctcaaca cgaccgaccc ccggagggcc tcggccgatc cccactacgg
ccagaccgcc 2220gaggagttcc tcccgcccca cgccaccgat gacgaccccc
agccgctcct ccggtcctcg 2280ggcggaaact cccccggcgg caaccgccag
ctgtacgaca ttgtctacac aatcacggcc 2340gacatcacga atacgggctc
cgttgtaggc gaggaggtac cgcagctcta cgtctcgctg 2400ggcggtcccg
aggatcccaa ggtgcagctg cgcgactttg acaggatgcg gatcgaaccc
2460ggcgagacga ggcagttcac cggccgcctg acgcgcagag atctgagcaa
ctgggacgtc 2520acggtgcagg actgggtcat cagcaggtat cccaagacgg
catatgttgg gaggagcagc 2580cggaagttgg atctcaagat tgagcttcct tga
2613128870PRTMyceliophthora thermophila 128Met Lys Ala Ala Ala Leu
Ser Cys Leu Phe Gly Ser Thr Leu Ala Val 1 5 10 15 Ala Gly Ala Ile
Glu Ser Arg Lys Val His Gln Lys Pro Leu Ala Arg 20 25 30 Ser Glu
Pro Phe Tyr Pro Ser Pro Trp Met Asn Pro Asn Ala Asp Gly 35 40 45
Trp Ala Glu Ala Tyr Ala Gln Ala Lys Ser Phe Val Ser Gln Met Thr 50
55 60 Leu Leu Glu Lys Val Asn Leu Thr Thr Gly Val Gly Trp Gly Ala
Glu 65 70 75 80 Gln Cys Val Gly Gln Val Gly Ala Ile Pro Arg Leu Gly
Leu Arg Ser 85 90 95 Leu Cys Met His Asp Ser Pro Leu Gly Ile Arg
Gly Ala Asp Tyr Asn 100 105 110 Ser Ala Phe Pro Ser Gly Gln Thr Val
Ala Ala Thr Trp Asp Arg Gly 115 120 125 Leu Met Tyr Arg Arg Gly Tyr
Ala Met Gly Gln Glu Ala Lys Gly Lys 130 135 140 Gly Ile Asn Val Leu
Leu Gly Pro Val Ala Gly Pro Leu Gly Arg Met 145 150 155 160 Pro Glu
Gly Gly Arg Asn Trp Glu Gly Phe Ala Pro Asp Pro Val Leu 165 170 175
Thr Gly Ile Gly Met Ser Glu Thr Ile Lys Gly Ile Gln Asp Ala Gly 180
185 190 Val Ile Ala Cys Ala Lys His Phe Ile Gly Asn Glu Gln Glu His
Phe 195 200 205 Arg Gln Val Pro Glu Ala Gln Gly Tyr Gly Tyr Asn Ile
Ser Glu Thr 210 215 220 Leu Ser Ser Asn Ile Asp Asp Lys Thr Met His
Glu Leu Tyr Leu Trp 225 230 235 240 Pro Phe Ala Asp Ala Val Arg Ala
Gly Val Gly Ser Val Met Cys Ser 245 250 255 Tyr Gln Gln Val Asn Asn
Ser Tyr Ala Cys Gln Asn Ser Lys Leu Leu 260 265 270 Asn Asp Leu Leu
Lys Asn Glu Leu Gly Phe Gln Gly Phe Val Met Ser 275 280 285 Asp Trp
Gln Ala Gln His Thr Gly Ala Ala Ser Ala Val Ala Gly Leu 290 295 300
Asp Met Ser Met Pro Gly Asp Thr Gln Phe Asn Thr Gly Val Ser Phe 305
310 315 320 Trp Gly Ala Asn Leu Thr Leu Ala Val Leu Asn Gly Thr Val
Pro Ala 325 330 335 Tyr Arg Leu Asp Asp Met Ala Met Arg Ile Met Ala
Ala Leu Phe Lys 340 345 350 Val Thr Lys Thr Thr Asp Leu Glu Pro Ile
Asn Phe Ser Phe Trp Thr 355 360 365 Asp Asp Thr Tyr Gly Pro Ile His
Trp Ala Ala Lys Gln Gly Tyr Gln 370 375 380 Glu Ile Asn Ser His Val
Asp Val Arg Ala Asp His Gly Asn Leu Ile 385 390 395 400 Arg Glu Ile
Ala Ala Lys Gly Thr Val Leu Leu Lys Asn Thr Gly Ser 405 410 415 Leu
Pro Leu Asn Lys Pro Lys Phe Val Ala Val Ile Gly Glu Asp Ala 420 425
430 Gly Ser Ser Pro Asn Gly Pro Asn Gly Cys Ser Asp Arg Gly Cys Asn
435 440 445 Glu Gly Thr Leu Ala Met Gly Trp Gly Ser Gly Thr Ala Asn
Tyr Pro 450 455 460 Tyr Leu Val Ser Pro Asp Ala Ala Leu Gln Ala Arg
Ala Ile Gln Asp 465 470 475 480 Gly Thr Arg Tyr Glu Ser Val Leu Ser
Asn Tyr Ala Glu Glu Lys Thr 485 490 495 Lys Ala Leu Val Ser Gln Ala
Asn Ala Thr Ala Ile Val Phe Val Asn 500 505 510 Ala Asp Ser Gly Glu
Gly Tyr Ile Asn Val Asp Gly Asn Glu Gly Asp 515 520 525 Arg Lys Asn
Leu Thr Leu Trp Asn Asn Gly Asp Thr Leu Val Lys Asn 530 535 540 Val
Ser Ser Trp Cys Ser Asn Thr Ile Val Val Ile His Ser Val Gly 545 550
555 560 Pro Val Leu Leu Thr Asp Trp Tyr Asp Asn Pro Asn Ile Thr Ala
Ile 565 570 575 Leu Trp Ala Gly Leu Pro Gly Gln Glu Ser Gly Asn Ser
Ile Thr Asp 580 585 590 Val Leu Tyr Gly Lys Val Asn Pro Ala Ala Arg
Ser Pro Phe Thr Trp 595 600 605 Gly Lys Thr Arg Glu Ser Tyr Gly Ala
Asp Val Leu Tyr Lys Pro Asn 610 615 620 Asn Gly Asn Gly Ala Pro Gln
Gln Asp Phe Thr Glu Gly Val Phe Ile 625 630 635 640 Asp Tyr Arg Tyr
Phe Asp Lys Val Asp Asp Asp Ser Val Ile Tyr Glu 645 650 655 Phe Gly
His Gly Leu Ser Tyr Thr Thr Phe Glu Tyr Ser Asn Ile Arg 660 665 670
Val Val Lys Ser Asn Val Ser Glu Tyr Arg Pro Thr Thr Gly Thr Thr 675
680 685 Ala Gln Ala Pro Thr Phe Gly Asn Phe Ser Thr Asp Leu Glu Asp
Tyr 690 695 700 Leu Phe Pro Lys Asp Glu Phe Pro Tyr Ile Tyr Gln Tyr
Ile Tyr Pro 705 710 715 720 Tyr Leu Asn Thr Thr Asp Pro Arg Arg Ala
Ser Ala Asp Pro His Tyr 725 730 735 Gly Gln Thr Ala Glu Glu Phe Leu
Pro Pro His Ala Thr Asp Asp Asp 740 745 750 Pro Gln Pro Leu Leu Arg
Ser Ser Gly Gly Asn Ser Pro Gly Gly Asn 755 760 765 Arg Gln Leu Tyr
Asp Ile Val Tyr Thr Ile Thr Ala Asp Ile Thr Asn 770 775 780 Thr Gly
Ser Val Val Gly Glu Glu Val Pro Gln Leu Tyr Val Ser Leu 785 790 795
800 Gly Gly Pro Glu Asp Pro Lys Val Gln Leu Arg Asp Phe Asp Arg Met
805 810 815 Arg Ile Glu Pro Gly Glu Thr Arg Gln Phe Thr Gly Arg Leu
Thr Arg 820 825 830 Arg Asp Leu Ser Asn Trp Asp Val Thr Val Gln Asp
Trp Val Ile Ser 835 840 845 Arg Tyr Pro Lys Thr Ala Tyr Val Gly Arg
Ser Ser Arg Lys Leu Asp 850 855 860 Leu Lys Ile Glu Leu Pro 865 870
129851PRTMyceliophthora thermophila 129Ile Glu Ser Arg Lys Val His
Gln Lys Pro Leu Ala Arg Ser Glu Pro 1 5 10 15 Phe Tyr Pro Ser Pro
Trp Met Asn Pro Asn Ala Asp Gly Trp Ala Glu 20 25 30 Ala Tyr Ala
Gln Ala Lys Ser Phe Val Ser Gln Met Thr Leu Leu Glu 35 40 45 Lys
Val Asn Leu Thr Thr Gly Val Gly Trp Gly Ala Glu Gln Cys Val 50 55
60 Gly Gln Val Gly Ala Ile Pro Arg Leu Gly Leu Arg Ser Leu Cys Met
65 70 75 80 His Asp Ser Pro Leu Gly Ile Arg Gly Ala Asp Tyr Asn Ser
Ala Phe 85 90 95 Pro Ser Gly Gln Thr Val Ala Ala Thr Trp Asp Arg
Gly Leu Met Tyr 100 105 110 Arg Arg Gly Tyr Ala Met Gly Gln Glu Ala
Lys Gly Lys Gly Ile Asn 115 120 125 Val Leu Leu Gly Pro Val Ala Gly
Pro Leu Gly Arg Met Pro Glu Gly 130 135 140 Gly Arg Asn Trp Glu Gly
Phe Ala Pro Asp Pro Val Leu Thr Gly Ile 145 150 155 160 Gly Met Ser
Glu Thr Ile Lys Gly Ile Gln Asp Ala Gly Val Ile Ala 165 170 175 Cys
Ala Lys His Phe Ile Gly Asn Glu Gln Glu His Phe Arg Gln Val 180 185
190 Pro Glu Ala Gln Gly Tyr Gly Tyr Asn Ile Ser Glu Thr Leu Ser Ser
195 200 205 Asn Ile Asp Asp Lys Thr Met His Glu Leu Tyr Leu Trp Pro
Phe Ala 210 215 220 Asp Ala Val Arg Ala Gly Val Gly Ser Val Met Cys
Ser Tyr Gln Gln 225 230 235 240 Val Asn Asn Ser Tyr Ala Cys Gln Asn
Ser Lys Leu Leu Asn Asp Leu 245 250 255 Leu Lys Asn Glu Leu Gly Phe
Gln Gly Phe Val Met Ser Asp Trp Gln 260 265 270 Ala Gln His Thr Gly
Ala Ala Ser Ala Val Ala Gly Leu Asp Met Ser 275 280 285 Met Pro Gly
Asp Thr Gln Phe Asn Thr Gly Val Ser Phe Trp Gly Ala 290 295 300 Asn
Leu Thr Leu Ala Val Leu Asn Gly Thr Val Pro Ala Tyr Arg Leu 305 310
315 320 Asp Asp Met Ala Met Arg Ile Met Ala Ala Leu Phe Lys Val Thr
Lys 325 330 335 Thr Thr Asp Leu Glu Pro Ile Asn Phe Ser Phe Trp Thr
Asp Asp Thr 340 345 350 Tyr Gly Pro Ile His Trp Ala Ala Lys Gln Gly
Tyr Gln Glu Ile Asn 355 360 365 Ser His Val Asp Val Arg Ala Asp His
Gly Asn Leu Ile Arg Glu Ile 370 375 380 Ala Ala Lys Gly Thr Val Leu
Leu Lys Asn Thr Gly Ser Leu Pro Leu 385 390 395 400 Asn Lys Pro Lys
Phe Val Ala Val Ile Gly Glu Asp Ala Gly Ser Ser 405 410 415 Pro Asn
Gly Pro Asn Gly Cys Ser Asp Arg Gly Cys Asn Glu Gly Thr 420 425 430
Leu Ala Met Gly Trp Gly Ser Gly Thr Ala Asn Tyr Pro Tyr Leu Val 435
440 445 Ser Pro Asp Ala Ala Leu Gln Ala Arg Ala Ile Gln Asp Gly Thr
Arg 450 455 460 Tyr Glu Ser Val Leu Ser Asn Tyr Ala Glu Glu Lys Thr
Lys Ala Leu 465 470 475 480 Val Ser Gln Ala Asn Ala Thr Ala Ile Val
Phe Val Asn Ala Asp Ser 485 490 495 Gly Glu Gly Tyr Ile Asn Val Asp
Gly Asn Glu Gly Asp Arg Lys Asn 500 505 510 Leu Thr Leu Trp Asn Asn
Gly Asp Thr Leu Val Lys Asn Val Ser Ser 515 520 525 Trp Cys Ser Asn
Thr Ile Val Val Ile His Ser Val Gly Pro Val Leu 530 535 540 Leu Thr
Asp Trp Tyr Asp Asn Pro Asn Ile Thr Ala Ile Leu Trp Ala 545 550 555
560 Gly Leu Pro Gly Gln Glu Ser Gly Asn Ser Ile Thr Asp Val Leu Tyr
565 570 575 Gly Lys Val Asn Pro Ala Ala Arg Ser Pro Phe Thr Trp Gly
Lys Thr 580 585 590 Arg Glu Ser Tyr Gly Ala Asp Val Leu Tyr Lys Pro
Asn Asn Gly Asn 595 600 605 Gly Ala Pro Gln Gln Asp Phe Thr Glu Gly
Val Phe Ile Asp Tyr Arg 610 615 620 Tyr Phe Asp Lys Val Asp Asp Asp
Ser Val Ile Tyr Glu Phe Gly His 625 630 635 640 Gly Leu Ser Tyr Thr
Thr Phe Glu Tyr Ser Asn Ile Arg Val Val Lys 645 650 655 Ser Asn Val
Ser Glu Tyr Arg Pro Thr Thr Gly Thr Thr Ala Gln Ala 660 665 670 Pro
Thr Phe Gly Asn Phe Ser Thr Asp Leu Glu Asp Tyr Leu Phe Pro 675 680
685 Lys Asp Glu Phe Pro Tyr Ile Tyr Gln Tyr Ile Tyr Pro Tyr Leu Asn
690 695 700 Thr Thr Asp Pro Arg Arg Ala Ser Ala Asp Pro His Tyr Gly
Gln Thr 705 710 715 720 Ala Glu Glu Phe Leu Pro Pro His Ala Thr Asp
Asp Asp Pro Gln Pro 725 730 735 Leu Leu Arg Ser Ser Gly Gly Asn Ser
Pro Gly Gly Asn Arg Gln Leu 740 745 750 Tyr Asp Ile Val Tyr Thr Ile
Thr Ala Asp Ile Thr Asn Thr Gly Ser 755 760 765 Val Val Gly Glu Glu
Val Pro Gln Leu Tyr Val Ser Leu Gly Gly Pro 770 775 780 Glu Asp Pro
Lys Val Gln Leu Arg Asp Phe Asp Arg Met Arg Ile Glu 785 790 795 800
Pro Gly Glu Thr Arg Gln Phe Thr Gly Arg Leu Thr Arg Arg Asp Leu 805
810 815 Ser Asn Trp Asp Val Thr Val Gln Asp Trp Val Ile Ser Arg Tyr
Pro 820 825 830 Lys Thr Ala Tyr Val Gly Arg Ser Ser Arg Lys Leu Asp
Leu Lys Ile 835 840 845 Glu Leu Pro 850 1302613DNAArtificial
SequenceSynthetic polynucleotide of BGL "Variant 883" 130atgaaggctg
ctgcgctttc ctgcctcttc ggcagtaccc ttgccgttgc aggcgccatt 60gaatcgagaa
aggttcacca gaagcccctc gcgagatctg aaccttttta cccgtcgcca
120tggatgaatc ccaacgccga cggctgggcg gaggcctatg cccaggccaa
gtcctttgtc 180tcccaaatga ctctgctaga gaaggtcaac ttgaccacgg
gagtcggctg gggggctgag 240cagtgcgtcg gccaagtggg cgcgatccct
cgccttggac ttcgcagtct gtgcatgcat 300gactcccctc tcggcatccg
aggagccgac tacaactcag cgttcccctc tggccagacc 360gttgctgcta
cctgggatcg cggtctgatg taccgtcgcg gctacgcaat gggccaggag
420gccaaaggca agggcatcaa tgtccttctc ggaccagtcg ccggccccct
tggccgcatg 480cccgagggcg gtcgtaactg ggaaggcttc gctccggatc
ccgtccttac cggcatcggc 540atgtccgaga cgatcaaggg cattcaggat
gctggcgtca tcgcttgtgc gaagcacttt 600attggaaacg agcaggagca
cttcagacag gtgccagaag cccagggata cggttacaac 660atcagcgaaa
ccctctcctc caacattgac gacaagacca tgcacgagct ctacctttgg
720ccgtttgccg atgccgtccg ggccggcgtc ggctctgtca tgtgctcgta
caaccaggtc 780aacaactcgt acgcctgcca gaactcgaag ctgctgaacg
acctcctcaa gaacgagctt 840gggtttcagg gcttcgtcat gagcgactgg
tgggcacagc acactggcgc agcaagcgcc 900gtggctggtc tcgatatgtc
catgccgggc gacaccatgt tcaacactgg cgtcagtttc 960tggggcgcca
atctcaccct cgccgtcctc aacggcacag tccctgccta ccgtctcgac
1020gacatggcca tgcgcatcat ggccgccctc ttcaaggtca ccaagaccac
cgacctggaa 1080ccgatcaact tctccttctg gacccgcgac acttatggcc
cgatccactg ggccgccaag 1140cagggctacc aggagattaa ttcccacgtt
gacgtccgcg ccgaccacgg caacctcatc 1200cggaacattg ccgccaaggg
tacggtgctg ctgaagaata ccggctctct acccctgaac 1260aagccaaagt
tcgtggccgt catcggcgag gatgctgggc cgagccccaa cgggcccaac
1320ggctgcagcg accgcggctg taacgaaggc acgctcgcca tgggctgggg
atccggcaca 1380gccaactatc cgtacctcgt ttcccccgac gccgcgctcc
agttgcgggc catccaggac 1440ggcacgaggt acgagagcgt cctgtccaac
tacgccgagg aaaatacaaa ggctctggtc 1500tcgcaggcca atgcaaccgc
catcgtcttc gtcaatgccg actcaggcga gggctacatc 1560aacgtggacg
gtaacgaggg cgaccgtaag aacctgactc tctggaacaa cggtgatact
1620ctggtcaaga acgtctcgag ctggtgcagc aacaccatcg tcgtcatcca
ctcggtcggc 1680ccggtcctcc
tgaccgattg gtacgacaac cccaacatca cggccattct ctgggctggt
1740cttccgggcc aggagtcggg caactccatc accgacgtgc tttacggcaa
ggtcaacccc 1800gccgcccgct cgcccttcac ttggggcaag acccgcgaaa
gctatggcgc ggacgtcctg 1860tacaagccga ataatggcaa ttgggcgccc
caacaggact tcaccgaggg cgtcttcatc 1920gactaccgct acttcgacaa
ggttgacgat gactcggtca tctacgagtt cggccacggc 1980ctgagctaca
ccaccttcga gtacagcaac atccgcgtcg tcaagtccaa cgtcagcgag
2040taccggccca cgacgggcac cacgattcag gccccgacgt ttggcaactt
ctccaccgac 2100ctcgaggact atctcttccc caaggacgag ttcccctaca
tcccgcagta catctacccg 2160tacctcaaca cgaccgaccc ccggagggcc
tcggccgatc cccactacgg ccagaccgcc 2220gaggagttcc tcccgcccca
cgccaccgat gacgaccccc agccgctcct ccggtcctcg 2280ggcggaaact
cccccggcgg caaccgccag ctgtacgaca ttgtctacac aatcacggcc
2340gacatcacga atacgggctc cgttgtaggc gaggaggtac cgcagctcta
cgtctcgctg 2400ggcggtcccg aggatcccaa ggtgcagctg cgcgactttg
acaggatgcg gatcgaaccc 2460ggcgagacga ggcagttcac cggccgcctg
acgcgcagag atctgagcaa ctgggacgtc 2520acggtgcagg actgggtcat
cagcaggtat cccaagacgg catatgttgg gaggagcagc 2580cggaagttgg
atctcaagat tgagcttcct tga 2613131870PRTArtificial SequenceSynthetic
polypeptide of BGL "Variant 883" 131Met Lys Ala Ala Ala Leu Ser Cys
Leu Phe Gly Ser Thr Leu Ala Val 1 5 10 15 Ala Gly Ala Ile Glu Ser
Arg Lys Val His Gln Lys Pro Leu Ala Arg 20 25 30 Ser Glu Pro Phe
Tyr Pro Ser Pro Trp Met Asn Pro Asn Ala Asp Gly 35 40 45 Trp Ala
Glu Ala Tyr Ala Gln Ala Lys Ser Phe Val Ser Gln Met Thr 50 55 60
Leu Leu Glu Lys Val Asn Leu Thr Thr Gly Val Gly Trp Gly Ala Glu 65
70 75 80 Gln Cys Val Gly Gln Val Gly Ala Ile Pro Arg Leu Gly Leu
Arg Ser 85 90 95 Leu Cys Met His Asp Ser Pro Leu Gly Ile Arg Gly
Ala Asp Tyr Asn 100 105 110 Ser Ala Phe Pro Ser Gly Gln Thr Val Ala
Ala Thr Trp Asp Arg Gly 115 120 125 Leu Met Tyr Arg Arg Gly Tyr Ala
Met Gly Gln Glu Ala Lys Gly Lys 130 135 140 Gly Ile Asn Val Leu Leu
Gly Pro Val Ala Gly Pro Leu Gly Arg Met 145 150 155 160 Pro Glu Gly
Gly Arg Asn Trp Glu Gly Phe Ala Pro Asp Pro Val Leu 165 170 175 Thr
Gly Ile Gly Met Ser Glu Thr Ile Lys Gly Ile Gln Asp Ala Gly 180 185
190 Val Ile Ala Cys Ala Lys His Phe Ile Gly Asn Glu Gln Glu His Phe
195 200 205 Arg Gln Val Pro Glu Ala Gln Gly Tyr Gly Tyr Asn Ile Ser
Glu Thr 210 215 220 Leu Ser Ser Asn Ile Asp Asp Lys Thr Met His Glu
Leu Tyr Leu Trp 225 230 235 240 Pro Phe Ala Asp Ala Val Arg Ala Gly
Val Gly Ser Val Met Cys Ser 245 250 255 Tyr Asn Gln Val Asn Asn Ser
Tyr Ala Cys Gln Asn Ser Lys Leu Leu 260 265 270 Asn Asp Leu Leu Lys
Asn Glu Leu Gly Phe Gln Gly Phe Val Met Ser 275 280 285 Asp Trp Trp
Ala Gln His Thr Gly Ala Ala Ser Ala Val Ala Gly Leu 290 295 300 Asp
Met Ser Met Pro Gly Asp Thr Met Phe Asn Thr Gly Val Ser Phe 305 310
315 320 Trp Gly Ala Asn Leu Thr Leu Ala Val Leu Asn Gly Thr Val Pro
Ala 325 330 335 Tyr Arg Leu Asp Asp Met Ala Met Arg Ile Met Ala Ala
Leu Phe Lys 340 345 350 Val Thr Lys Thr Thr Asp Leu Glu Pro Ile Asn
Phe Ser Phe Trp Thr 355 360 365 Arg Asp Thr Tyr Gly Pro Ile His Trp
Ala Ala Lys Gln Gly Tyr Gln 370 375 380 Glu Ile Asn Ser His Val Asp
Val Arg Ala Asp His Gly Asn Leu Ile 385 390 395 400 Arg Asn Ile Ala
Ala Lys Gly Thr Val Leu Leu Lys Asn Thr Gly Ser 405 410 415 Leu Pro
Leu Asn Lys Pro Lys Phe Val Ala Val Ile Gly Glu Asp Ala 420 425 430
Gly Pro Ser Pro Asn Gly Pro Asn Gly Cys Ser Asp Arg Gly Cys Asn 435
440 445 Glu Gly Thr Leu Ala Met Gly Trp Gly Ser Gly Thr Ala Asn Tyr
Pro 450 455 460 Tyr Leu Val Ser Pro Asp Ala Ala Leu Gln Leu Arg Ala
Ile Gln Asp 465 470 475 480 Gly Thr Arg Tyr Glu Ser Val Leu Ser Asn
Tyr Ala Glu Glu Asn Thr 485 490 495 Lys Ala Leu Val Ser Gln Ala Asn
Ala Thr Ala Ile Val Phe Val Asn 500 505 510 Ala Asp Ser Gly Glu Gly
Tyr Ile Asn Val Asp Gly Asn Glu Gly Asp 515 520 525 Arg Lys Asn Leu
Thr Leu Trp Asn Asn Gly Asp Thr Leu Val Lys Asn 530 535 540 Val Ser
Ser Trp Cys Ser Asn Thr Ile Val Val Ile His Ser Val Gly 545 550 555
560 Pro Val Leu Leu Thr Asp Trp Tyr Asp Asn Pro Asn Ile Thr Ala Ile
565 570 575 Leu Trp Ala Gly Leu Pro Gly Gln Glu Ser Gly Asn Ser Ile
Thr Asp 580 585 590 Val Leu Tyr Gly Lys Val Asn Pro Ala Ala Arg Ser
Pro Phe Thr Trp 595 600 605 Gly Lys Thr Arg Glu Ser Tyr Gly Ala Asp
Val Leu Tyr Lys Pro Asn 610 615 620 Asn Gly Asn Trp Ala Pro Gln Gln
Asp Phe Thr Glu Gly Val Phe Ile 625 630 635 640 Asp Tyr Arg Tyr Phe
Asp Lys Val Asp Asp Asp Ser Val Ile Tyr Glu 645 650 655 Phe Gly His
Gly Leu Ser Tyr Thr Thr Phe Glu Tyr Ser Asn Ile Arg 660 665 670 Val
Val Lys Ser Asn Val Ser Glu Tyr Arg Pro Thr Thr Gly Thr Thr 675 680
685 Ile Gln Ala Pro Thr Phe Gly Asn Phe Ser Thr Asp Leu Glu Asp Tyr
690 695 700 Leu Phe Pro Lys Asp Glu Phe Pro Tyr Ile Pro Gln Tyr Ile
Tyr Pro 705 710 715 720 Tyr Leu Asn Thr Thr Asp Pro Arg Arg Ala Ser
Ala Asp Pro His Tyr 725 730 735 Gly Gln Thr Ala Glu Glu Phe Leu Pro
Pro His Ala Thr Asp Asp Asp 740 745 750 Pro Gln Pro Leu Leu Arg Ser
Ser Gly Gly Asn Ser Pro Gly Gly Asn 755 760 765 Arg Gln Leu Tyr Asp
Ile Val Tyr Thr Ile Thr Ala Asp Ile Thr Asn 770 775 780 Thr Gly Ser
Val Val Gly Glu Glu Val Pro Gln Leu Tyr Val Ser Leu 785 790 795 800
Gly Gly Pro Glu Asp Pro Lys Val Gln Leu Arg Asp Phe Asp Arg Met 805
810 815 Arg Ile Glu Pro Gly Glu Thr Arg Gln Phe Thr Gly Arg Leu Thr
Arg 820 825 830 Arg Asp Leu Ser Asn Trp Asp Val Thr Val Gln Asp Trp
Val Ile Ser 835 840 845 Arg Tyr Pro Lys Thr Ala Tyr Val Gly Arg Ser
Ser Arg Lys Leu Asp 850 855 860 Leu Lys Ile Glu Leu Pro 865 870
132851PRTArtificial SequenceSynthetic polypeptide of BGL "Variant
883" 132Ile Glu Ser Arg Lys Val His Gln Lys Pro Leu Ala Arg Ser Glu
Pro 1 5 10 15 Phe Tyr Pro Ser Pro Trp Met Asn Pro Asn Ala Asp Gly
Trp Ala Glu 20 25 30 Ala Tyr Ala Gln Ala Lys Ser Phe Val Ser Gln
Met Thr Leu Leu Glu 35 40 45 Lys Val Asn Leu Thr Thr Gly Val Gly
Trp Gly Ala Glu Gln Cys Val 50 55 60 Gly Gln Val Gly Ala Ile Pro
Arg Leu Gly Leu Arg Ser Leu Cys Met 65 70 75 80 His Asp Ser Pro Leu
Gly Ile Arg Gly Ala Asp Tyr Asn Ser Ala Phe 85 90 95 Pro Ser Gly
Gln Thr Val Ala Ala Thr Trp Asp Arg Gly Leu Met Tyr 100 105 110 Arg
Arg Gly Tyr Ala Met Gly Gln Glu Ala Lys Gly Lys Gly Ile Asn 115 120
125 Val Leu Leu Gly Pro Val Ala Gly Pro Leu Gly Arg Met Pro Glu Gly
130 135 140 Gly Arg Asn Trp Glu Gly Phe Ala Pro Asp Pro Val Leu Thr
Gly Ile 145 150 155 160 Gly Met Ser Glu Thr Ile Lys Gly Ile Gln Asp
Ala Gly Val Ile Ala 165 170 175 Cys Ala Lys His Phe Ile Gly Asn Glu
Gln Glu His Phe Arg Gln Val 180 185 190 Pro Glu Ala Gln Gly Tyr Gly
Tyr Asn Ile Ser Glu Thr Leu Ser Ser 195 200 205 Asn Ile Asp Asp Lys
Thr Met His Glu Leu Tyr Leu Trp Pro Phe Ala 210 215 220 Asp Ala Val
Arg Ala Gly Val Gly Ser Val Met Cys Ser Tyr Asn Gln 225 230 235 240
Val Asn Asn Ser Tyr Ala Cys Gln Asn Ser Lys Leu Leu Asn Asp Leu 245
250 255 Leu Lys Asn Glu Leu Gly Phe Gln Gly Phe Val Met Ser Asp Trp
Trp 260 265 270 Ala Gln His Thr Gly Ala Ala Ser Ala Val Ala Gly Leu
Asp Met Ser 275 280 285 Met Pro Gly Asp Thr Met Phe Asn Thr Gly Val
Ser Phe Trp Gly Ala 290 295 300 Asn Leu Thr Leu Ala Val Leu Asn Gly
Thr Val Pro Ala Tyr Arg Leu 305 310 315 320 Asp Asp Met Ala Met Arg
Ile Met Ala Ala Leu Phe Lys Val Thr Lys 325 330 335 Thr Thr Asp Leu
Glu Pro Ile Asn Phe Ser Phe Trp Thr Arg Asp Thr 340 345 350 Tyr Gly
Pro Ile His Trp Ala Ala Lys Gln Gly Tyr Gln Glu Ile Asn 355 360 365
Ser His Val Asp Val Arg Ala Asp His Gly Asn Leu Ile Arg Asn Ile 370
375 380 Ala Ala Lys Gly Thr Val Leu Leu Lys Asn Thr Gly Ser Leu Pro
Leu 385 390 395 400 Asn Lys Pro Lys Phe Val Ala Val Ile Gly Glu Asp
Ala Gly Pro Ser 405 410 415 Pro Asn Gly Pro Asn Gly Cys Ser Asp Arg
Gly Cys Asn Glu Gly Thr 420 425 430 Leu Ala Met Gly Trp Gly Ser Gly
Thr Ala Asn Tyr Pro Tyr Leu Val 435 440 445 Ser Pro Asp Ala Ala Leu
Gln Leu Arg Ala Ile Gln Asp Gly Thr Arg 450 455 460 Tyr Glu Ser Val
Leu Ser Asn Tyr Ala Glu Glu Asn Thr Lys Ala Leu 465 470 475 480 Val
Ser Gln Ala Asn Ala Thr Ala Ile Val Phe Val Asn Ala Asp Ser 485 490
495 Gly Glu Gly Tyr Ile Asn Val Asp Gly Asn Glu Gly Asp Arg Lys Asn
500 505 510 Leu Thr Leu Trp Asn Asn Gly Asp Thr Leu Val Lys Asn Val
Ser Ser 515 520 525 Trp Cys Ser Asn Thr Ile Val Val Ile His Ser Val
Gly Pro Val Leu 530 535 540 Leu Thr Asp Trp Tyr Asp Asn Pro Asn Ile
Thr Ala Ile Leu Trp Ala 545 550 555 560 Gly Leu Pro Gly Gln Glu Ser
Gly Asn Ser Ile Thr Asp Val Leu Tyr 565 570 575 Gly Lys Val Asn Pro
Ala Ala Arg Ser Pro Phe Thr Trp Gly Lys Thr 580 585 590 Arg Glu Ser
Tyr Gly Ala Asp Val Leu Tyr Lys Pro Asn Asn Gly Asn 595 600 605 Trp
Ala Pro Gln Gln Asp Phe Thr Glu Gly Val Phe Ile Asp Tyr Arg 610 615
620 Tyr Phe Asp Lys Val Asp Asp Asp Ser Val Ile Tyr Glu Phe Gly His
625 630 635 640 Gly Leu Ser Tyr Thr Thr Phe Glu Tyr Ser Asn Ile Arg
Val Val Lys 645 650 655 Ser Asn Val Ser Glu Tyr Arg Pro Thr Thr Gly
Thr Thr Ile Gln Ala 660 665 670 Pro Thr Phe Gly Asn Phe Ser Thr Asp
Leu Glu Asp Tyr Leu Phe Pro 675 680 685 Lys Asp Glu Phe Pro Tyr Ile
Pro Gln Tyr Ile Tyr Pro Tyr Leu Asn 690 695 700 Thr Thr Asp Pro Arg
Arg Ala Ser Ala Asp Pro His Tyr Gly Gln Thr 705 710 715 720 Ala Glu
Glu Phe Leu Pro Pro His Ala Thr Asp Asp Asp Pro Gln Pro 725 730 735
Leu Leu Arg Ser Ser Gly Gly Asn Ser Pro Gly Gly Asn Arg Gln Leu 740
745 750 Tyr Asp Ile Val Tyr Thr Ile Thr Ala Asp Ile Thr Asn Thr Gly
Ser 755 760 765 Val Val Gly Glu Glu Val Pro Gln Leu Tyr Val Ser Leu
Gly Gly Pro 770 775 780 Glu Asp Pro Lys Val Gln Leu Arg Asp Phe Asp
Arg Met Arg Ile Glu 785 790 795 800 Pro Gly Glu Thr Arg Gln Phe Thr
Gly Arg Leu Thr Arg Arg Asp Leu 805 810 815 Ser Asn Trp Asp Val Thr
Val Gln Asp Trp Val Ile Ser Arg Tyr Pro 820 825 830 Lys Thr Ala Tyr
Val Gly Arg Ser Ser Arg Lys Leu Asp Leu Lys Ile 835 840 845 Glu Leu
Pro 850 1332613DNAArtificial SequenceSynthetic polynucleotide of
BGL "Variant 900" 133atgaaggctg ctgcgctttc ctgcctcttc ggcagtaccc
ttgccgttgc aggcgccatt 60gaatcgagaa aggttcacca gaagcccctc gcgagatctg
aaccttttta cccgtcgcca 120tggatgaatc ccaacgccat cggctgggcg
gaggcctatg cccaggccaa gtcctttgtc 180tcccaaatga ctctgctaga
gaaggtcaac ttgaccacgg gagtcggctg gggggaggag 240cagtgcgtcg
gcaacgtggg cgcgatccct cgccttggac ttcgcagtct gtgcatgcat
300gactcccctc tcggcgtgcg aggaaccgac tacaactcag cgttcccctc
tggccagacc 360gttgctgcta cctgggatcg cggtctgatg taccgtcgcg
gctacgcaat gggccaggag 420gccaaaggca agggcatcaa tgtccttctc
ggaccagtcg ccggccccct tggccgcatg 480cccgagggcg gtcgtaactg
ggaaggcttc gctccggatc ccgtccttac cggcatcggc 540atgtccgaga
cgatcaaggg cattcaggat gctggcgtca tcgcttgtgc gaagcacttt
600attggaaacg agcaggagca cttcagacag gtgccagaag cccagggata
cggttacaac 660atcagcgaaa ccctctcctc caacattgac gacaagacca
tgcacgagct ctacctttgg 720ccgtttgccg atgccgtccg ggccggcgtc
ggctctgtca tgtgctcgta caaccagggc 780aacaactcgt acgcctgcca
gaactcgaag ctgctgaacg acctcctcaa gaacgagctt 840gggtttcagg
gcttcgtcat gagcgactgg tgggcacagc acactggcgc agcaagcgcc
900gtggctggtc tcgatatgtc catgccgggc gacaccatgg tcaacactgg
cgtcagtttc 960tggggcgcca atctcaccct cgccgtcctc aacggcacag
tccctgccta ccgtctcgac 1020gacatgtgca tgcgcatcat ggccgccctc
ttcaaggtca ccaagaccac cgacctggaa 1080ccgatcaact tctccttctg
gacccgcgac acttatggcc cgatccactg ggccgccaag 1140cagggctacc
aggagattaa ttcccacgtt gacgtccgcg ccgaccacgg caacctcatc
1200cggaacattg ccgccaaggg tacggtgctg ctgaagaata ccggctctct
acccctgaac 1260aagccaaagt tcgtggccgt catcggcgag gatgctgggc
cgagccccaa cgggcccaac 1320ggctgcagcg accgcggctg taacgaaggc
acgctcgcca tgggctgggg atccggcaca 1380gccaactatc cgtacctcgt
ttcccccgac gccgcgctcc aggcgcgggc catccaggac 1440ggcacgaggt
acgagagcgt cctgtccaac tacgccgagg aaaatacaaa ggctctggtc
1500tcgcaggcca atgcaaccgc catcgtcttc gtcaatgccg actcaggcga
gggctacatc 1560aacgtggacg gtaacgaggg cgaccgtaag aacctgactc
tctggaacaa cggtgatact 1620ctggtcaaga acgtctcgag ctggtgcagc
aacaccatcg tcgtcatcca ctcggtcggc 1680ccggtcctcc tgaccgattg
gtacgacaac cccaacatca cggccattct ctgggctggt 1740cttccgggcc
aggagtcggg caactccatc accgacgtgc tttacggcaa ggtcaacccc
1800gccgcccgct cgcccttcac ttggggcaag acccgcgaaa gctatggcgc
ggacgtcctg 1860tacaagccga ataatggcaa ttgggcgccc caacaggact
tcaccgaggg cgtcttcatc 1920gactaccgct acttcgacaa ggttgacgat
gactcggtca tctacgagtt cggccacggc 1980ctgagctaca ccaccttcga
gtacagcaac atccgcgtcg tcaagtccaa cgtcagcgag 2040taccggccca
cgacgggcac cacgattcag gccccgacgt ttggcaactt ctccaccgac
2100ctcgaggact atctcttccc caaggacgag ttcccctaca tcccgcagta
catctacccg 2160tacctcaaca cgaccgaccc ccggagggcc tcgggcgatc
cccactacgg ccagaccgcc 2220gaggagttcc tcccgcccca cgccaccgat
gacgaccccc agccgctcct ccggtcctcg 2280ggcggaaact cccccggcgg
caaccgccag ctgtacgaca ttgtctacac aatcacggcc 2340gacatcacga
atacgggctc cgttgtaggc gaggaggtac cgcagctcta cgtctcgctg
2400ggcggtcccg aggatcccaa ggtgcagctg cgcgactttg acaggatgcg
gatcgaaccc 2460ggcgagacga ggcagttcac cggccgcctg acgcgcagag
atctgagcaa ctgggacgtc 2520acggtgcagg actgggtcat cagcaggtat
cccaagacgg catatgttgg gaggagcagc 2580cggaagttgg atctcaagat
tgagcttcct tga 2613134870PRTArtificial SequenceSynthetic
polypeptide of BGL "Variant 900" 134Met Lys Ala Ala Ala Leu Ser Cys
Leu Phe Gly Ser Thr Leu Ala Val 1 5 10 15 Ala Gly Ala Ile Glu Ser
Arg Lys Val His Gln Lys Pro Leu Ala Arg 20 25 30 Ser Glu Pro Phe
Tyr Pro Ser Pro Trp Met Asn Pro Asn Ala Ile Gly 35 40 45 Trp Ala
Glu Ala Tyr Ala Gln Ala Lys Ser Phe Val Ser Gln Met Thr 50 55 60
Leu Leu Glu Lys Val Asn Leu Thr Thr Gly Val Gly Trp Gly Glu Glu 65
70 75 80 Gln Cys Val Gly Asn Val Gly Ala Ile Pro Arg Leu Gly Leu
Arg Ser 85 90 95 Leu Cys Met His Asp Ser Pro Leu Gly Val Arg Gly
Thr Asp Tyr Asn 100 105 110 Ser Ala Phe Pro Ser Gly Gln Thr Val Ala
Ala Thr Trp Asp Arg Gly 115 120 125 Leu Met Tyr Arg Arg Gly Tyr Ala
Met Gly Gln Glu Ala Lys Gly Lys 130 135 140 Gly Ile Asn Val Leu Leu
Gly Pro Val Ala Gly Pro Leu Gly Arg Met 145 150 155 160 Pro Glu Gly
Gly Arg Asn Trp Glu Gly Phe Ala Pro Asp Pro Val Leu 165 170 175 Thr
Gly Ile Gly Met Ser Glu Thr Ile Lys Gly Ile Gln Asp Ala Gly 180 185
190 Val Ile Ala Cys Ala Lys His Phe Ile Gly Asn Glu Gln Glu His Phe
195 200 205 Arg Gln Val Pro Glu Ala Gln Gly Tyr Gly Tyr Asn Ile Ser
Glu Thr 210 215 220 Leu Ser Ser Asn Ile Asp Asp Lys Thr Met His Glu
Leu Tyr Leu Trp 225 230 235 240 Pro Phe Ala Asp Ala Val Arg Ala Gly
Val Gly Ser Val Met Cys Ser 245 250 255 Tyr Asn Gln Gly Asn Asn Ser
Tyr Ala Cys Gln Asn Ser Lys Leu Leu 260 265 270 Asn Asp Leu Leu Lys
Asn Glu Leu Gly Phe Gln Gly Phe Val Met Ser 275 280 285 Asp Trp Trp
Ala Gln His Thr Gly Ala Ala Ser Ala Val Ala Gly Leu 290 295 300 Asp
Met Ser Met Pro Gly Asp Thr Met Val Asn Thr Gly Val Ser Phe 305 310
315 320 Trp Gly Ala Asn Leu Thr Leu Ala Val Leu Asn Gly Thr Val Pro
Ala 325 330 335 Tyr Arg Leu Asp Asp Met Cys Met Arg Ile Met Ala Ala
Leu Phe Lys 340 345 350 Val Thr Lys Thr Thr Asp Leu Glu Pro Ile Asn
Phe Ser Phe Trp Thr 355 360 365 Arg Asp Thr Tyr Gly Pro Ile His Trp
Ala Ala Lys Gln Gly Tyr Gln 370 375 380 Glu Ile Asn Ser His Val Asp
Val Arg Ala Asp His Gly Asn Leu Ile 385 390 395 400 Arg Asn Ile Ala
Ala Lys Gly Thr Val Leu Leu Lys Asn Thr Gly Ser 405 410 415 Leu Pro
Leu Asn Lys Pro Lys Phe Val Ala Val Ile Gly Glu Asp Ala 420 425 430
Gly Pro Ser Pro Asn Gly Pro Asn Gly Cys Ser Asp Arg Gly Cys Asn 435
440 445 Glu Gly Thr Leu Ala Met Gly Trp Gly Ser Gly Thr Ala Asn Tyr
Pro 450 455 460 Tyr Leu Val Ser Pro Asp Ala Ala Leu Gln Ala Arg Ala
Ile Gln Asp 465 470 475 480 Gly Thr Arg Tyr Glu Ser Val Leu Ser Asn
Tyr Ala Glu Glu Asn Thr 485 490 495 Lys Ala Leu Val Ser Gln Ala Asn
Ala Thr Ala Ile Val Phe Val Asn 500 505 510 Ala Asp Ser Gly Glu Gly
Tyr Ile Asn Val Asp Gly Asn Glu Gly Asp 515 520 525 Arg Lys Asn Leu
Thr Leu Trp Asn Asn Gly Asp Thr Leu Val Lys Asn 530 535 540 Val Ser
Ser Trp Cys Ser Asn Thr Ile Val Val Ile His Ser Val Gly 545 550 555
560 Pro Val Leu Leu Thr Asp Trp Tyr Asp Asn Pro Asn Ile Thr Ala Ile
565 570 575 Leu Trp Ala Gly Leu Pro Gly Gln Glu Ser Gly Asn Ser Ile
Thr Asp 580 585 590 Val Leu Tyr Gly Lys Val Asn Pro Ala Ala Arg Ser
Pro Phe Thr Trp 595 600 605 Gly Lys Thr Arg Glu Ser Tyr Gly Ala Asp
Val Leu Tyr Lys Pro Asn 610 615 620 Asn Gly Asn Trp Ala Pro Gln Gln
Asp Phe Thr Glu Gly Val Phe Ile 625 630 635 640 Asp Tyr Arg Tyr Phe
Asp Lys Val Asp Asp Asp Ser Val Ile Tyr Glu 645 650 655 Phe Gly His
Gly Leu Ser Tyr Thr Thr Phe Glu Tyr Ser Asn Ile Arg 660 665 670 Val
Val Lys Ser Asn Val Ser Glu Tyr Arg Pro Thr Thr Gly Thr Thr 675 680
685 Ile Gln Ala Pro Thr Phe Gly Asn Phe Ser Thr Asp Leu Glu Asp Tyr
690 695 700 Leu Phe Pro Lys Asp Glu Phe Pro Tyr Ile Pro Gln Tyr Ile
Tyr Pro 705 710 715 720 Tyr Leu Asn Thr Thr Asp Pro Arg Arg Ala Ser
Gly Asp Pro His Tyr 725 730 735 Gly Gln Thr Ala Glu Glu Phe Leu Pro
Pro His Ala Thr Asp Asp Asp 740 745 750 Pro Gln Pro Leu Leu Arg Ser
Ser Gly Gly Asn Ser Pro Gly Gly Asn 755 760 765 Arg Gln Leu Tyr Asp
Ile Val Tyr Thr Ile Thr Ala Asp Ile Thr Asn 770 775 780 Thr Gly Ser
Val Val Gly Glu Glu Val Pro Gln Leu Tyr Val Ser Leu 785 790 795 800
Gly Gly Pro Glu Asp Pro Lys Val Gln Leu Arg Asp Phe Asp Arg Met 805
810 815 Arg Ile Glu Pro Gly Glu Thr Arg Gln Phe Thr Gly Arg Leu Thr
Arg 820 825 830 Arg Asp Leu Ser Asn Trp Asp Val Thr Val Gln Asp Trp
Val Ile Ser 835 840 845 Arg Tyr Pro Lys Thr Ala Tyr Val Gly Arg Ser
Ser Arg Lys Leu Asp 850 855 860 Leu Lys Ile Glu Leu Pro 865 870
135851PRTArtificial SequenceSynthetic polypeptide of BGL "Variant
900" 135Ile Glu Ser Arg Lys Val His Gln Lys Pro Leu Ala Arg Ser Glu
Pro 1 5 10 15 Phe Tyr Pro Ser Pro Trp Met Asn Pro Asn Ala Ile Gly
Trp Ala Glu 20 25 30 Ala Tyr Ala Gln Ala Lys Ser Phe Val Ser Gln
Met Thr Leu Leu Glu 35 40 45 Lys Val Asn Leu Thr Thr Gly Val Gly
Trp Gly Glu Glu Gln Cys Val 50 55 60 Gly Asn Val Gly Ala Ile Pro
Arg Leu Gly Leu Arg Ser Leu Cys Met 65 70 75 80 His Asp Ser Pro Leu
Gly Val Arg Gly Thr Asp Tyr Asn Ser Ala Phe 85 90 95 Pro Ser Gly
Gln Thr Val Ala Ala Thr Trp Asp Arg Gly Leu Met Tyr 100 105 110 Arg
Arg Gly Tyr Ala Met Gly Gln Glu Ala Lys Gly Lys Gly Ile Asn 115 120
125 Val Leu Leu Gly Pro Val Ala Gly Pro Leu Gly Arg Met Pro Glu Gly
130 135 140 Gly Arg Asn Trp Glu Gly Phe Ala Pro Asp Pro Val Leu Thr
Gly Ile 145 150 155 160 Gly Met Ser Glu Thr Ile Lys Gly Ile Gln Asp
Ala Gly Val Ile Ala 165 170 175 Cys Ala Lys His Phe Ile Gly Asn Glu
Gln Glu His Phe Arg Gln Val 180 185 190 Pro Glu Ala Gln Gly Tyr Gly
Tyr Asn Ile Ser Glu Thr Leu Ser Ser 195 200 205 Asn Ile Asp Asp Lys
Thr Met His Glu Leu Tyr Leu Trp Pro Phe Ala 210 215 220 Asp Ala Val
Arg Ala Gly Val Gly Ser Val Met Cys Ser Tyr Asn Gln 225 230 235 240
Gly Asn Asn Ser Tyr Ala Cys Gln Asn Ser Lys Leu Leu Asn Asp Leu 245
250 255 Leu Lys Asn Glu Leu Gly Phe Gln Gly Phe Val Met Ser Asp Trp
Trp 260 265 270 Ala Gln His Thr Gly Ala Ala Ser Ala Val Ala Gly Leu
Asp Met Ser 275 280 285 Met Pro Gly Asp Thr Met Val Asn Thr Gly Val
Ser Phe Trp Gly Ala 290 295 300 Asn Leu Thr Leu Ala Val Leu Asn Gly
Thr Val Pro Ala Tyr Arg Leu 305 310 315 320 Asp Asp Met Cys Met Arg
Ile Met Ala Ala Leu Phe Lys Val Thr Lys 325 330 335 Thr Thr Asp Leu
Glu Pro Ile Asn Phe Ser Phe Trp Thr Arg Asp Thr 340 345 350 Tyr Gly
Pro Ile His Trp Ala Ala Lys Gln Gly Tyr Gln Glu Ile Asn 355 360 365
Ser His Val Asp Val Arg Ala Asp His Gly Asn Leu Ile Arg Asn Ile 370
375 380 Ala Ala Lys Gly Thr Val Leu Leu Lys Asn Thr Gly Ser Leu Pro
Leu 385 390 395 400 Asn Lys Pro Lys Phe Val Ala Val Ile Gly Glu Asp
Ala Gly Pro Ser 405 410 415 Pro Asn Gly Pro Asn Gly Cys Ser Asp Arg
Gly Cys Asn Glu Gly Thr 420 425 430 Leu Ala Met Gly Trp Gly Ser Gly
Thr Ala Asn Tyr Pro Tyr Leu Val 435 440 445 Ser Pro Asp Ala Ala Leu
Gln Ala Arg Ala Ile Gln Asp Gly Thr Arg 450 455 460 Tyr Glu Ser Val
Leu Ser Asn Tyr Ala Glu Glu Asn Thr Lys Ala Leu 465 470 475 480 Val
Ser Gln Ala Asn Ala Thr Ala Ile Val Phe Val Asn Ala Asp Ser 485 490
495 Gly Glu Gly Tyr Ile Asn Val Asp Gly Asn Glu Gly Asp Arg Lys Asn
500 505 510 Leu Thr Leu Trp Asn Asn Gly Asp Thr Leu Val Lys Asn Val
Ser Ser 515 520 525 Trp Cys Ser Asn Thr Ile Val Val Ile His Ser Val
Gly Pro Val Leu 530 535 540 Leu Thr Asp Trp Tyr Asp Asn Pro Asn Ile
Thr Ala Ile Leu Trp Ala 545 550 555 560 Gly Leu Pro Gly Gln Glu Ser
Gly Asn Ser Ile Thr Asp Val Leu Tyr 565 570 575 Gly Lys Val Asn Pro
Ala Ala Arg Ser Pro Phe Thr Trp Gly Lys Thr 580 585 590 Arg Glu Ser
Tyr Gly Ala Asp Val Leu Tyr Lys Pro Asn Asn Gly Asn 595 600 605 Trp
Ala Pro Gln Gln Asp Phe Thr Glu Gly Val Phe Ile Asp Tyr Arg 610 615
620 Tyr Phe Asp Lys Val Asp Asp Asp Ser Val Ile Tyr Glu Phe Gly His
625 630 635 640 Gly Leu Ser Tyr Thr Thr Phe Glu Tyr Ser Asn Ile Arg
Val Val Lys 645 650 655 Ser Asn Val Ser Glu Tyr Arg Pro Thr Thr Gly
Thr Thr Ile Gln Ala 660 665 670 Pro Thr Phe Gly Asn Phe Ser Thr Asp
Leu Glu Asp Tyr Leu Phe Pro 675 680 685 Lys Asp Glu Phe Pro Tyr Ile
Pro Gln Tyr Ile Tyr Pro Tyr Leu Asn 690 695 700 Thr Thr Asp Pro Arg
Arg Ala Ser Gly Asp Pro His Tyr Gly Gln Thr 705 710 715 720 Ala Glu
Glu Phe Leu Pro Pro His Ala Thr Asp Asp Asp Pro Gln Pro 725 730 735
Leu Leu Arg Ser Ser Gly Gly Asn Ser Pro Gly Gly Asn Arg Gln Leu 740
745 750 Tyr Asp Ile Val Tyr Thr Ile Thr Ala Asp Ile Thr Asn Thr Gly
Ser 755 760 765 Val Val Gly Glu Glu Val Pro Gln Leu Tyr Val Ser Leu
Gly Gly Pro 770 775 780 Glu Asp Pro Lys Val Gln Leu Arg Asp Phe Asp
Arg Met Arg Ile Glu 785 790 795 800 Pro Gly Glu Thr Arg Gln Phe Thr
Gly Arg Leu Thr Arg Arg Asp Leu 805 810 815 Ser Asn Trp Asp Val Thr
Val Gln Asp Trp Val Ile Ser Arg Tyr Pro 820 825 830 Lys Thr Ala Tyr
Val Gly Arg Ser Ser Arg Lys Leu Asp Leu Lys Ile 835 840 845 Glu Leu
Pro 850 1361368DNATalaromyces emersonii 136atgcttcgac gggctcttct
tctatcctct tccgccatcc ttgctgtcaa ggcacagcag 60gccggcacgg cgacggcaga
gaaccacccg cccctgacat ggcaggaatg caccgcccct 120gggagctgca
ccacccagaa cggggcggtc gttcttgatg cgaactggcg ttgggtgcac
180gatgtgaacg gatacaccaa ctgctacacg ggcaatacct gggaccccac
gtactgccct 240gacgacgaaa cctgcgccca gaactgtgcg ctggacggcg
cggattacga gggcacctac 300ggcgtgactt cgtcgggcag ctccttgaaa
ctcaatttcg tcaccgggtc gaacgtcgga 360tcccgtctct acctgctgca
ggacgactcg acctatcaga tcttcaagct tctgaaccgc 420gagttcagct
ttgacgtcga tgtctccaat cttccgtgcg gattgaacgg cgctctgtac
480tttgtcgcca tggacgccga cggcggcgtg tccaagtacc cgaacaacaa
ggctggtgcc 540aagtacggaa ccgggtattg cgactcccaa tgcccacggg
acctcaagtt catcgacggc 600gaggccaacg tcgagggctg gcagccgtct
tcgaacaacg ccaacaccgg aattggcgac 660cacggctcct gctgtgcgga
gatggatgtc tgggaagcaa acagcatctc caatgcggtc 720actccgcacc
cgtgcgacac gccaggccag acgatgtgct ctggagatga ctgcggtggc
780acatactcta acgatcgcta cgcgggaacc tgcgatcctg acggctgtga
cttcaaccct 840taccgcatgg gcaacacttc tttctacggg cctggcaaga
tcatcgatac caccaagccc 900ttcactgtcg tgacgcagtt cctcactgat
gatggtacgg atactggaac tctcagcgag 960atcaagcgct tctacatcca
gaacagcaac gtcattccgc agcccaactc ggacatcagt 1020ggcgtgaccg
gcaactcgat cacgacggag ttctgcactg ctcagaagca ggcctttggc
1080gacacggacg acttctctca gcacggtggc ctggccaaga tgggagcggc
catgcagcag 1140ggtatggtcc tggtgatgag tttgtgggac gactacgccg
cgcagatgct gtggttggat 1200tccgactacc cgacggatgc ggaccccacg
acccctggta ttgcccgtgg aacgtgtccg 1260acggactcgg gcgtcccatc
ggatgtcgag tcgcagagcc ccaactccta cgtgacctac 1320tcgaacatta
agtttggtcc gatcaactcg accttcaccg cttcgtga 1368137455PRTTalaromyces
emersonii 137Met Leu Arg Arg Ala Leu Leu Leu Ser Ser Ser Ala Ile
Leu Ala Val 1 5 10 15 Lys Ala Gln Gln Ala Gly Thr Ala Thr Ala Glu
Asn His Pro Pro Leu 20 25 30 Thr Trp Gln Glu Cys Thr Ala Pro Gly
Ser Cys Thr Thr Gln Asn Gly 35 40 45 Ala Val Val Leu Asp Ala Asn
Trp Arg Trp Val His Asp Val Asn Gly 50 55 60 Tyr Thr Asn Cys Tyr
Thr Gly Asn Thr Trp Asp Pro Thr Tyr Cys Pro 65 70 75 80 Asp Asp Glu
Thr Cys Ala Gln Asn Cys Ala Leu Asp Gly Ala Asp Tyr 85 90 95 Glu
Gly Thr Tyr Gly Val Thr Ser Ser Gly Ser Ser Leu Lys Leu Asn 100 105
110 Phe Val Thr Gly Ser Asn Val Gly Ser Arg Leu Tyr Leu Leu Gln Asp
115 120 125 Asp Ser Thr Tyr Gln Ile Phe Lys Leu Leu Asn Arg Glu Phe
Ser Phe 130 135 140 Asp Val Asp Val Ser Asn Leu Pro Cys Gly Leu Asn
Gly Ala Leu Tyr 145 150 155 160 Phe Val Ala Met Asp Ala Asp Gly Gly
Val Ser Lys Tyr Pro Asn Asn 165 170 175 Lys Ala Gly Ala Lys Tyr Gly
Thr Gly Tyr Cys Asp Ser Gln Cys Pro 180 185 190 Arg Asp Leu Lys Phe
Ile Asp Gly Glu Ala Asn Val Glu Gly Trp Gln 195 200 205 Pro Ser Ser
Asn Asn Ala Asn Thr Gly Ile Gly Asp His Gly Ser Cys 210 215 220 Cys
Ala Glu Met Asp Val Trp Glu Ala Asn Ser Ile Ser Asn Ala Val 225 230
235 240 Thr Pro His Pro Cys Asp Thr Pro Gly Gln Thr Met Cys Ser Gly
Asp 245 250 255 Asp Cys Gly Gly Thr Tyr Ser Asn Asp Arg Tyr Ala Gly
Thr Cys Asp 260 265 270 Pro Asp Gly Cys Asp Phe Asn Pro Tyr Arg Met
Gly Asn Thr Ser Phe 275 280 285 Tyr Gly Pro Gly Lys Ile Ile Asp Thr
Thr Lys Pro Phe Thr Val Val 290 295 300 Thr Gln Phe Leu Thr Asp Asp
Gly Thr Asp Thr Gly Thr Leu Ser Glu 305 310 315 320 Ile Lys Arg Phe
Tyr Ile Gln Asn Ser Asn Val Ile Pro Gln Pro Asn 325 330 335 Ser Asp
Ile Ser Gly Val Thr Gly Asn Ser Ile Thr Thr Glu Phe Cys 340 345
350 Thr Ala Gln Lys Gln Ala Phe Gly Asp Thr Asp Asp Phe Ser Gln His
355 360 365 Gly Gly Leu Ala Lys Met Gly Ala Ala Met Gln Gln Gly Met
Val Leu 370 375 380 Val Met Ser Leu Trp Asp Asp Tyr Ala Ala Gln Met
Leu Trp Leu Asp 385 390 395 400 Ser Asp Tyr Pro Thr Asp Ala Asp Pro
Thr Thr Pro Gly Ile Ala Arg 405 410 415 Gly Thr Cys Pro Thr Asp Ser
Gly Val Pro Ser Asp Val Glu Ser Gln 420 425 430 Ser Pro Asn Ser Tyr
Val Thr Tyr Ser Asn Ile Lys Phe Gly Pro Ile 435 440 445 Asn Ser Thr
Phe Thr Ala Ser 450 455 138437PRTTalaromyces emersonii 138Gln Gln
Ala Gly Thr Ala Thr Ala Glu Asn His Pro Pro Leu Thr Trp 1 5 10 15
Gln Glu Cys Thr Ala Pro Gly Ser Cys Thr Thr Gln Asn Gly Ala Val 20
25 30 Val Leu Asp Ala Asn Trp Arg Trp Val His Asp Val Asn Gly Tyr
Thr 35 40 45 Asn Cys Tyr Thr Gly Asn Thr Trp Asp Pro Thr Tyr Cys
Pro Asp Asp 50 55 60 Glu Thr Cys Ala Gln Asn Cys Ala Leu Asp Gly
Ala Asp Tyr Glu Gly 65 70 75 80 Thr Tyr Gly Val Thr Ser Ser Gly Ser
Ser Leu Lys Leu Asn Phe Val 85 90 95 Thr Gly Ser Asn Val Gly Ser
Arg Leu Tyr Leu Leu Gln Asp Asp Ser 100 105 110 Thr Tyr Gln Ile Phe
Lys Leu Leu Asn Arg Glu Phe Ser Phe Asp Val 115 120 125 Asp Val Ser
Asn Leu Pro Cys Gly Leu Asn Gly Ala Leu Tyr Phe Val 130 135 140 Ala
Met Asp Ala Asp Gly Gly Val Ser Lys Tyr Pro Asn Asn Lys Ala 145 150
155 160 Gly Ala Lys Tyr Gly Thr Gly Tyr Cys Asp Ser Gln Cys Pro Arg
Asp 165 170 175 Leu Lys Phe Ile Asp Gly Glu Ala Asn Val Glu Gly Trp
Gln Pro Ser 180 185 190 Ser Asn Asn Ala Asn Thr Gly Ile Gly Asp His
Gly Ser Cys Cys Ala 195 200 205 Glu Met Asp Val Trp Glu Ala Asn Ser
Ile Ser Asn Ala Val Thr Pro 210 215 220 His Pro Cys Asp Thr Pro Gly
Gln Thr Met Cys Ser Gly Asp Asp Cys 225 230 235 240 Gly Gly Thr Tyr
Ser Asn Asp Arg Tyr Ala Gly Thr Cys Asp Pro Asp 245 250 255 Gly Cys
Asp Phe Asn Pro Tyr Arg Met Gly Asn Thr Ser Phe Tyr Gly 260 265 270
Pro Gly Lys Ile Ile Asp Thr Thr Lys Pro Phe Thr Val Val Thr Gln 275
280 285 Phe Leu Thr Asp Asp Gly Thr Asp Thr Gly Thr Leu Ser Glu Ile
Lys 290 295 300 Arg Phe Tyr Ile Gln Asn Ser Asn Val Ile Pro Gln Pro
Asn Ser Asp 305 310 315 320 Ile Ser Gly Val Thr Gly Asn Ser Ile Thr
Thr Glu Phe Cys Thr Ala 325 330 335 Gln Lys Gln Ala Phe Gly Asp Thr
Asp Asp Phe Ser Gln His Gly Gly 340 345 350 Leu Ala Lys Met Gly Ala
Ala Met Gln Gln Gly Met Val Leu Val Met 355 360 365 Ser Leu Trp Asp
Asp Tyr Ala Ala Gln Met Leu Trp Leu Asp Ser Asp 370 375 380 Tyr Pro
Thr Asp Ala Asp Pro Thr Thr Pro Gly Ile Ala Arg Gly Thr 385 390 395
400 Cys Pro Thr Asp Ser Gly Val Pro Ser Asp Val Glu Ser Gln Ser Pro
405 410 415 Asn Ser Tyr Val Thr Tyr Ser Asn Ile Lys Phe Gly Pro Ile
Asn Ser 420 425 430 Thr Phe Thr Ala Ser 435
1391581DNAMyceliophthora thermophila 139atgtacgcca agttcgcgac
cctcgccgcc cttgtggctg gcgccgctgc tcagaacgcc 60tgcactctga ccgctgagaa
ccacccctcg ctgacgtggt ccaagtgcac gtctggcggc 120agctgcacca
gcgtccaggg ttccatcacc atcgacgcca actggcggtg gactcaccgg
180accgatagcg ccaccaactg ctacgagggc aacaagtggg atacttcgta
ctgcagcgat 240ggtccttctt gcgcctccaa gtgctgcatc gacggcgctg
actactcgag cacctatggc 300atcaccacga gcggtaactc cctgaacctc
aagttcgtca ccaagggcca gtactcgacc 360aacatcggct cgcgtaccta
cctgatggag agcgacacca agtaccagat gttccagctc 420ctcggcaacg
agttcacctt cgatgtcgac gtctccaacc tcggctgcgg cctcaatggc
480gccctctact tcgtgtccat ggatgccgat ggtggcatgt ccaagtactc
gggcaacaag 540gcaggtgcca agtacggtac cggctactgt gattctcagt
gcccccgcga cctcaagttc 600atcaacggcg aggccaacgt agagaactgg
cagagctcga ccaacgatgc caacgccggc 660acgggcaagt acggcagctg
ctgctccgag atggacgtct gggaggccaa caacatggcc 720gccgccttca
ctccccaccc ttgcaccgtg atcggccagt cgcgctgcga gggcgactcg
780tgcggcggta cctacagcac cgaccgctat gccggcatct gcgaccccga
cggatgcgac 840ttcaactcgt accgccaggg caacaagacc ttctacggca
agggcatgac ggtcgacacg 900accaagaaga tcacggtcgt cacccagttc
ctcaagaact cggccggcga gctctccgag 960atcaagcggt tctacgtcca
gaacggcaag gtcatcccca actccgagtc caccatcccg 1020ggcgtcgagg
gcaactccat cacccaggac tggtgcgacc gccagaaggc cgccttcggc
1080gacgtgaccg acttccagga caagggcggc atggtccaga tgggcaaggc
cctcgcgggg 1140cccatggtcc tcgtcatgtc catctgggac gaccacgccg
tcaacatgct ctggctcgac 1200tccacctggc ccatcgacgg cgccggcaag
ccgggcgccg agcgcggtgc ctgccccacc 1260acctcgggcg tccccgctga
ggtcgaggcc gaggccccca actccaacgt catcttctcc 1320aacatccgct
tcggccccat cggctccacc gtctccggcc tgcccgacgg cggcagcggc
1380aaccccaacc cgcccgtcag ctcgtccacc ccggtcccct cctcgtccac
cacatcctcc 1440ggttcctccg gcccgactgg cggcacgggt gtcgctaagc
actatgagca atgcggagga 1500atcgggttca ctggccctac ccagtgcgag
agcccctaca cttgcaccaa gctgaatgac 1560tggtactcgc agtgcctgta a
1581140526PRTMyceliophthora thermophila 140Met Tyr Ala Lys Phe Ala
Thr Leu Ala Ala Leu Val Ala Gly Ala Ala 1 5 10 15 Ala Gln Asn Ala
Cys Thr Leu Thr Ala Glu Asn His Pro Ser Leu Thr 20 25 30 Tyr Ser
Lys Cys Thr Ser Gly Gly Ser Cys Thr Ser Val Gln Gly Ser 35 40 45
Ile Thr Ile Asp Ala Asn Trp Arg Trp Thr His Arg Thr Asp Ser Ala 50
55 60 Thr Asn Cys Tyr Glu Gly Asn Lys Trp Asp Thr Ser Trp Cys Ser
Asp 65 70 75 80 Gly Pro Ser Cys Ala Ser Lys Cys Cys Ile Asp Gly Ala
Asp Tyr Ser 85 90 95 Ser Thr Tyr Gly Ile Thr Thr Ser Gly Asn Ser
Leu Asn Leu Lys Phe 100 105 110 Val Thr Lys Gly Gln Tyr Ser Thr Asn
Ile Gly Ser Arg Thr Tyr Leu 115 120 125 Met Glu Ser Asp Thr Lys Tyr
Gln Met Phe Gln Leu Leu Gly Asn Glu 130 135 140 Phe Thr Phe Asp Val
Asp Val Ser Asn Leu Gly Cys Gly Leu Asn Gly 145 150 155 160 Ala Leu
Tyr Phe Val Ser Met Asp Ala Asp Gly Gly Met Ser Lys Tyr 165 170 175
Ser Gly Asn Lys Ala Gly Ala Lys Tyr Gly Thr Gly Tyr Cys Asp Ser 180
185 190 Gln Cys Pro Arg Asp Leu Lys Phe Ile Asn Gly Glu Ala Asn Val
Glu 195 200 205 Asn Trp Gln Ser Ser Thr Asn Asp Ala Asn Ala Gly Thr
Gly Lys Tyr 210 215 220 Gly Ser Cys Cys Ser Glu Met Asp Val Trp Glu
Ala Asn Asn Met Ala 225 230 235 240 Ala Ala Phe Thr Pro His Pro Cys
Thr Val Ile Gly Gln Ser Arg Cys 245 250 255 Glu Gly Asp Ser Cys Gly
Gly Thr Tyr Ser Thr Asp Arg Tyr Ala Gly 260 265 270 Ile Cys Asp Pro
Asp Gly Cys Asp Phe Asn Ser Tyr Arg Gln Gly Asn 275 280 285 Lys Thr
Phe Tyr Gly Lys Gly Met Thr Val Asp Thr Thr Lys Lys Ile 290 295 300
Thr Val Val Thr Gln Phe Leu Lys Asn Ser Ala Gly Glu Leu Ser Glu 305
310 315 320 Ile Lys Arg Phe Tyr Val Gln Asn Gly Lys Val Ile Pro Asn
Ser Glu 325 330 335 Ser Thr Ile Pro Gly Val Glu Gly Asn Ser Ile Thr
Gln Asp Trp Cys 340 345 350 Asp Arg Gln Lys Ala Ala Phe Gly Asp Val
Thr Asp Phe Gln Asp Lys 355 360 365 Gly Gly Met Val Gln Met Gly Lys
Ala Leu Ala Gly Pro Met Val Leu 370 375 380 Val Met Ser Ile Trp Asp
Asp His Ala Val Asn Met Leu Trp Leu Asp 385 390 395 400 Ser Thr Trp
Pro Ile Asp Gly Ala Gly Lys Pro Gly Ala Glu Arg Gly 405 410 415 Ala
Cys Pro Thr Thr Ser Gly Val Pro Ala Glu Val Glu Ala Glu Ala 420 425
430 Pro Asn Ser Asn Val Ile Phe Ser Asn Ile Arg Phe Gly Pro Ile Gly
435 440 445 Ser Thr Val Ser Gly Leu Pro Asp Gly Gly Ser Gly Asn Pro
Asn Pro 450 455 460 Pro Val Ser Ser Ser Thr Pro Val Pro Ser Ser Ser
Thr Thr Ser Ser 465 470 475 480 Gly Ser Ser Gly Pro Thr Gly Gly Thr
Gly Val Ala Lys His Tyr Glu 485 490 495 Gln Cys Gly Gly Ile Gly Phe
Thr Gly Pro Thr Gln Cys Glu Ser Pro 500 505 510 Tyr Thr Cys Thr Lys
Leu Asn Asp Trp Tyr Ser Gln Cys Leu 515 520 525
141509PRTMyceliophthora thermophila 141Gln Asn Ala Cys Thr Leu Thr
Ala Glu Asn His Pro Ser Leu Thr Tyr 1 5 10 15 Ser Lys Cys Thr Ser
Gly Gly Ser Cys Thr Ser Val Gln Gly Ser Ile 20 25 30 Thr Ile Asp
Ala Asn Trp Arg Trp Thr His Arg Thr Asp Ser Ala Thr 35 40 45 Asn
Cys Tyr Glu Gly Asn Lys Trp Asp Thr Ser Trp Cys Ser Asp Gly 50 55
60 Pro Ser Cys Ala Ser Lys Cys Cys Ile Asp Gly Ala Asp Tyr Ser Ser
65 70 75 80 Thr Tyr Gly Ile Thr Thr Ser Gly Asn Ser Leu Asn Leu Lys
Phe Val 85 90 95 Thr Lys Gly Gln Tyr Ser Thr Asn Ile Gly Ser Arg
Thr Tyr Leu Met 100 105 110 Glu Ser Asp Thr Lys Tyr Gln Met Phe Gln
Leu Leu Gly Asn Glu Phe 115 120 125 Thr Phe Asp Val Asp Val Ser Asn
Leu Gly Cys Gly Leu Asn Gly Ala 130 135 140 Leu Tyr Phe Val Ser Met
Asp Ala Asp Gly Gly Met Ser Lys Tyr Ser 145 150 155 160 Gly Asn Lys
Ala Gly Ala Lys Tyr Gly Thr Gly Tyr Cys Asp Ser Gln 165 170 175 Cys
Pro Arg Asp Leu Lys Phe Ile Asn Gly Glu Ala Asn Val Glu Asn 180 185
190 Trp Gln Ser Ser Thr Asn Asp Ala Asn Ala Gly Thr Gly Lys Tyr Gly
195 200 205 Ser Cys Cys Ser Glu Met Asp Val Trp Glu Ala Asn Asn Met
Ala Ala 210 215 220 Ala Phe Thr Pro His Pro Cys Thr Val Ile Gly Gln
Ser Arg Cys Glu 225 230 235 240 Gly Asp Ser Cys Gly Gly Thr Tyr Ser
Thr Asp Arg Tyr Ala Gly Ile 245 250 255 Cys Asp Pro Asp Gly Cys Asp
Phe Asn Ser Tyr Arg Gln Gly Asn Lys 260 265 270 Thr Phe Tyr Gly Lys
Gly Met Thr Val Asp Thr Thr Lys Lys Ile Thr 275 280 285 Val Val Thr
Gln Phe Leu Lys Asn Ser Ala Gly Glu Leu Ser Glu Ile 290 295 300 Lys
Arg Phe Tyr Val Gln Asn Gly Lys Val Ile Pro Asn Ser Glu Ser 305 310
315 320 Thr Ile Pro Gly Val Glu Gly Asn Ser Ile Thr Gln Asp Trp Cys
Asp 325 330 335 Arg Gln Lys Ala Ala Phe Gly Asp Val Thr Asp Phe Gln
Asp Lys Gly 340 345 350 Gly Met Val Gln Met Gly Lys Ala Leu Ala Gly
Pro Met Val Leu Val 355 360 365 Met Ser Ile Trp Asp Asp His Ala Val
Asn Met Leu Trp Leu Asp Ser 370 375 380 Thr Trp Pro Ile Asp Gly Ala
Gly Lys Pro Gly Ala Glu Arg Gly Ala 385 390 395 400 Cys Pro Thr Thr
Ser Gly Val Pro Ala Glu Val Glu Ala Glu Ala Pro 405 410 415 Asn Ser
Asn Val Ile Phe Ser Asn Ile Arg Phe Gly Pro Ile Gly Ser 420 425 430
Thr Val Ser Gly Leu Pro Asp Gly Gly Ser Gly Asn Pro Asn Pro Pro 435
440 445 Val Ser Ser Ser Thr Pro Val Pro Ser Ser Ser Thr Thr Ser Ser
Gly 450 455 460 Ser Ser Gly Pro Thr Gly Gly Thr Gly Val Ala Lys His
Tyr Glu Gln 465 470 475 480 Cys Gly Gly Ile Gly Phe Thr Gly Pro Thr
Gln Cys Glu Ser Pro Tyr 485 490 495 Thr Cys Thr Lys Leu Asn Asp Trp
Tyr Ser Gln Cys Leu 500 505 1421581DNAArtificial SequenceSynthetic
polynucleotide of M. thermophila CBH1a "Variant 145" 142atgtacgcca
agttcgcgac cctcgccgcc cttgtggctg gcgccgctgc tcagaacgcc 60tgcactctga
ccgctgagaa ccacccctcg ctgacgtggt ccaagtgcac gtctggcggc
120agctgcacca gcgtccaggg ttccatcacc atcgacgcca actggcggtg
gactcaccgg 180accgatagcg ccaccaactg ctacgagggc aacaagtggg
atacttcgtg gtgcagcgat 240ggtccttctt gcgcctccaa gtgctgcatc
gacggcgctg actactcgag cacctatggc 300atcaccacga gcggtaactc
cctgaacctc aagttcgtca ccaagggcca gtactcgacc 360aacatcggct
cgcgtaccta cctgatggag agcgacacca agtaccagat gttccagctc
420ctcggcaacg agttcacctt cgatgtcgac gtctccaacc tcggctgcgg
cctcaatggc 480gccctctact tcgtgtccat ggatgccgat ggtggcatgt
ccaagtactc gggcaacaag 540gcaggtgcca agtacggtac cggctactgt
gattctcagt gcccccgcga cctcaagttc 600atcaacggcg aggccaacgt
agagaactgg cagagctcga ccaacgatgc caacgccggc 660acgggcaagt
acggcagctg ctgctccgag atggacgtct gggaggccaa caacatggcc
720gccgccttca ctccccaccc ttgcaccgtg atcggccagt cgcgctgcga
gggcgactcg 780tgcggcggta cctacagcac cgaccgctat gccggcatct
gcgaccccga cggatgcgac 840ttcaactcgt accgccaggg caacaagacc
ttctacggca agggcatgac ggtcgacacg 900accaagaaga tcacggtcgt
cacccagttc ctcaagaact cggccggcga gctctccgag 960atcaagcggt
tctacgtcca gaacggcaag gtcatcccca actccgagtc caccatcccg
1020ggcgtcgagg gcaactccat cacccaggac tggtgcgacc gccagaaggc
cgccttcggc 1080gacgtgaccg acttccagga caagggcggc atggtccaga
tgggcaaggc cctcgcgggg 1140cccatggtcc tcgtcatgtc catctgggac
gaccacgccg tcaacatgct ctggctcgac 1200tccacctggc ccatcgacgg
cgccggcaag ccgggcgccg agcgcggtgc ctgccccacc 1260acctcgggcg
tccccgctga ggtcgaggcc gaggccccca actccaacgt catcttctcc
1320aacatccgct tcggccccat cggctccacc gtctccggcc tgcccgacgg
cggcagcggc 1380aaccccaacc cgcccgtcag ctcgtccacc ccggtcccct
cctcgtccac cacatcctcc 1440ggttcctccg gcccgactgg cggcacgggt
gtcgctaagc actatgagca atgcggagga 1500atcgggttca ctggccctac
ccagtgcgag agcccctaca cttgcaccaa gctgaatgac 1560tggtactcgc
agtgcctgta a 1581143526PRTArtificial SequenceSynthetic polypeptide
of M. thermophila CBH1a "Variant 145" 143Met Tyr Ala Lys Phe Ala
Thr Leu Ala Ala Leu Val Ala Gly Ala Ala 1 5 10 15 Ala Gln Asn Ala
Cys Thr Leu Thr Ala Glu Asn His Pro Ser Leu Thr 20 25 30 Trp Ser
Lys Cys Thr Ser Gly Gly Ser Cys Thr Ser Val Gln Gly Ser 35 40 45
Ile Thr Ile Asp Ala Asn Trp Arg Trp Thr His Arg Thr Asp Ser Ala 50
55 60 Thr Asn Cys Tyr Glu Gly Asn Lys Trp Asp Thr Ser Trp Cys Ser
Asp 65 70 75 80 Gly Pro Ser Cys Ala Ser Lys Cys Cys Ile Asp Gly Ala
Asp Tyr Ser 85 90 95 Ser Thr Tyr Gly Ile Thr Thr Ser Gly Asn Ser
Leu Asn Leu Lys Phe 100 105 110 Val Thr Lys Gly Gln Tyr Ser Thr Asn
Ile Gly Ser Arg Thr Tyr Leu 115 120 125 Met Glu Ser Asp Thr Lys Tyr
Gln Met Phe Gln Leu Leu Gly Asn Glu 130 135 140 Phe Thr Phe Asp Val
Asp Val Ser Asn Leu Gly Cys Gly Leu Asn Gly 145 150 155 160 Ala Leu
Tyr Phe Val Ser Met Asp Ala Asp Gly Gly Met Ser Lys Tyr 165 170 175
Ser Gly Asn Lys Ala Gly Ala Lys Tyr Gly Thr Gly Tyr Cys Asp Ser
180
185 190 Gln Cys Pro Arg Asp Leu Lys Phe Ile Asn Gly Glu Ala Asn Val
Glu 195 200 205 Asn Trp Gln Ser Ser Thr Asn Asp Ala Asn Ala Gly Thr
Gly Lys Tyr 210 215 220 Gly Ser Cys Cys Ser Glu Met Asp Val Trp Glu
Ala Asn Asn Met Ala 225 230 235 240 Ala Ala Phe Thr Pro His Pro Cys
Thr Val Ile Gly Gln Ser Arg Cys 245 250 255 Glu Gly Asp Ser Cys Gly
Gly Thr Tyr Ser Thr Asp Arg Tyr Ala Gly 260 265 270 Ile Cys Asp Pro
Asp Gly Cys Asp Phe Asn Ser Tyr Arg Gln Gly Asn 275 280 285 Lys Thr
Phe Tyr Gly Lys Gly Met Thr Val Asp Thr Thr Lys Lys Ile 290 295 300
Thr Val Val Thr Gln Phe Leu Lys Asn Ser Ala Gly Glu Leu Ser Glu 305
310 315 320 Ile Lys Arg Phe Tyr Val Gln Asn Gly Lys Val Ile Pro Asn
Ser Glu 325 330 335 Ser Thr Ile Pro Gly Val Glu Gly Asn Ser Ile Thr
Gln Asp Trp Cys 340 345 350 Asp Arg Gln Lys Ala Ala Phe Gly Asp Val
Thr Asp Phe Gln Asp Lys 355 360 365 Gly Gly Met Val Gln Met Gly Lys
Ala Leu Ala Gly Pro Met Val Leu 370 375 380 Val Met Ser Ile Trp Asp
Asp His Ala Val Asn Met Leu Trp Leu Asp 385 390 395 400 Ser Thr Trp
Pro Ile Asp Gly Ala Gly Lys Pro Gly Ala Glu Arg Gly 405 410 415 Ala
Cys Pro Thr Thr Ser Gly Val Pro Ala Glu Val Glu Ala Glu Ala 420 425
430 Pro Asn Ser Asn Val Ile Phe Ser Asn Ile Arg Phe Gly Pro Ile Gly
435 440 445 Ser Thr Val Ser Gly Leu Pro Asp Gly Gly Ser Gly Asn Pro
Asn Pro 450 455 460 Pro Val Ser Ser Ser Thr Pro Val Pro Ser Ser Ser
Thr Thr Ser Ser 465 470 475 480 Gly Ser Ser Gly Pro Thr Gly Gly Thr
Gly Val Ala Lys His Tyr Glu 485 490 495 Gln Cys Gly Gly Ile Gly Phe
Thr Gly Pro Thr Gln Cys Glu Ser Pro 500 505 510 Tyr Thr Cys Thr Lys
Leu Asn Asp Trp Tyr Ser Gln Cys Leu 515 520 525 144509PRTArtificial
SequenceSynthetic polypeptide of M. thermophila CBH1a "Variant 145"
144Gln Asn Ala Cys Thr Leu Thr Ala Glu Asn His Pro Ser Leu Thr Trp
1 5 10 15 Ser Lys Cys Thr Ser Gly Gly Ser Cys Thr Ser Val Gln Gly
Ser Ile 20 25 30 Thr Ile Asp Ala Asn Trp Arg Trp Thr His Arg Thr
Asp Ser Ala Thr 35 40 45 Asn Cys Tyr Glu Gly Asn Lys Trp Asp Thr
Ser Trp Cys Ser Asp Gly 50 55 60 Pro Ser Cys Ala Ser Lys Cys Cys
Ile Asp Gly Ala Asp Tyr Ser Ser 65 70 75 80 Thr Tyr Gly Ile Thr Thr
Ser Gly Asn Ser Leu Asn Leu Lys Phe Val 85 90 95 Thr Lys Gly Gln
Tyr Ser Thr Asn Ile Gly Ser Arg Thr Tyr Leu Met 100 105 110 Glu Ser
Asp Thr Lys Tyr Gln Met Phe Gln Leu Leu Gly Asn Glu Phe 115 120 125
Thr Phe Asp Val Asp Val Ser Asn Leu Gly Cys Gly Leu Asn Gly Ala 130
135 140 Leu Tyr Phe Val Ser Met Asp Ala Asp Gly Gly Met Ser Lys Tyr
Ser 145 150 155 160 Gly Asn Lys Ala Gly Ala Lys Tyr Gly Thr Gly Tyr
Cys Asp Ser Gln 165 170 175 Cys Pro Arg Asp Leu Lys Phe Ile Asn Gly
Glu Ala Asn Val Glu Asn 180 185 190 Trp Gln Ser Ser Thr Asn Asp Ala
Asn Ala Gly Thr Gly Lys Tyr Gly 195 200 205 Ser Cys Cys Ser Glu Met
Asp Val Trp Glu Ala Asn Asn Met Ala Ala 210 215 220 Ala Phe Thr Pro
His Pro Cys Thr Val Ile Gly Gln Ser Arg Cys Glu 225 230 235 240 Gly
Asp Ser Cys Gly Gly Thr Tyr Ser Thr Asp Arg Tyr Ala Gly Ile 245 250
255 Cys Asp Pro Asp Gly Cys Asp Phe Asn Ser Tyr Arg Gln Gly Asn Lys
260 265 270 Thr Phe Tyr Gly Lys Gly Met Thr Val Asp Thr Thr Lys Lys
Ile Thr 275 280 285 Val Val Thr Gln Phe Leu Lys Asn Ser Ala Gly Glu
Leu Ser Glu Ile 290 295 300 Lys Arg Phe Tyr Val Gln Asn Gly Lys Val
Ile Pro Asn Ser Glu Ser 305 310 315 320 Thr Ile Pro Gly Val Glu Gly
Asn Ser Ile Thr Gln Asp Trp Cys Asp 325 330 335 Arg Gln Lys Ala Ala
Phe Gly Asp Val Thr Asp Phe Gln Asp Lys Gly 340 345 350 Gly Met Val
Gln Met Gly Lys Ala Leu Ala Gly Pro Met Val Leu Val 355 360 365 Met
Ser Ile Trp Asp Asp His Ala Val Asn Met Leu Trp Leu Asp Ser 370 375
380 Thr Trp Pro Ile Asp Gly Ala Gly Lys Pro Gly Ala Glu Arg Gly Ala
385 390 395 400 Cys Pro Thr Thr Ser Gly Val Pro Ala Glu Val Glu Ala
Glu Ala Pro 405 410 415 Asn Ser Asn Val Ile Phe Ser Asn Ile Arg Phe
Gly Pro Ile Gly Ser 420 425 430 Thr Val Ser Gly Leu Pro Asp Gly Gly
Ser Gly Asn Pro Asn Pro Pro 435 440 445 Val Ser Ser Ser Thr Pro Val
Pro Ser Ser Ser Thr Thr Ser Ser Gly 450 455 460 Ser Ser Gly Pro Thr
Gly Gly Thr Gly Val Ala Lys His Tyr Glu Gln 465 470 475 480 Cys Gly
Gly Ile Gly Phe Thr Gly Pro Thr Gln Cys Glu Ser Pro Tyr 485 490 495
Thr Cys Thr Lys Leu Asn Asp Trp Tyr Ser Gln Cys Leu 500 505
1451581DNAArtificial SequenceSynthetic polynucleotide of M.
thermophila CBH1a "Variant 983" 145atgtacgcca agttcgcgac cctcgccgcc
cttgtggctg gcgccgctgc tcagaacgcc 60tgcactctga acgctgagaa ccacccctcg
ctgacgtggt ccaagtgcac gtctggcggc 120agctgcacca gcgtccaggg
ttccatcacc atcgacgcca actggcggtg gactcaccgg 180accgatagcg
ccaccaactg ctacgagggc aacaagtggg atacttcgta ctgcagcgat
240ggtccttctt gcgcctccaa gtgctgcatc gacggcgctg actactcgag
cacctatggc 300atcaccacga gcggtaactc cctgaacctc aagttcgtca
ccaagggcca gtactcgacc 360aacatcggct cgcgtaccta cctgatggag
agcgacacca agtaccagat gttccagctc 420ctcggcaacg agttcacctt
cgatgtcgac gtctccaacc tcggctgcgg cctcaatggc 480gccctctact
tcgtgtccat ggatgccgat ggtggcatgt ccaagtactc gggcaacaag
540gcaggtgcca agtacggtac cggctactgt gattctcagt gcccccgcga
cctcaagttc 600atcaacggcg aggccaacgt agagaactgg cagagctcga
ccaacgatgc caacgccggc 660acgggcaagt acggcagctg ctgctccgag
atggacgtct gggaggccaa caacatggcc 720gccgccttca ctccccaccc
ttgcaccgtg atcggccagt cgcgctgcga gggcgactcg 780tgcggcggta
cctacagcac cgaccgctat gccggcatct gcgaccccga cggatgcgac
840ttcaactcgt accgccaggg caacaagacc ttctacggca agggcatgac
ggtcgacacg 900accaagaaga tcacggtcgt cacccagttc ctcaagaact
cggccggcga gctctccgag 960atcaagcggt tctacgtcca gaacggcaag
gtcatcccca actccgagtc caccatcccg 1020ggcgtcgagg gcaactccat
cacccaggag tactgcgacc gccagaaggc cgccttcggc 1080gacgtgaccg
acttccagga caagggcggc atggtccaga tgggcaaggc cctcgcgggg
1140cccatggtcc tcgtcatgtc catctgggac gaccacgccg acaacatgct
ctggctcgac 1200tccacctggc ccatcgacgg cgccggcaag ccgggcgccg
agcgcggtgc ctgccccacc 1260acctcgggcg tccccgctga ggtcgaggcc
gaggccccca actccaacgt catcttctcc 1320aacatccgct tcggccccat
cggctccacc gtctccggcc tgcccgacgg cggcagcggc 1380aaccccaacc
cgcccgtcag ctcgtccacc ccggtcccct cctcgtccac cacatcctcc
1440ggttcctccg gcccgactgg cggcacgggt gtcgctaagc actatgagca
atgcggagga 1500atcgggttca ctggccctac ccagtgcgag agcccctaca
cttgcaccaa gctgaatgac 1560tggtactcgc agtgcctgta a
1581146526PRTArtificial SequenceSynthetic polypeptide of M.
thermophila CBH1a "Variant 983" 146Met Tyr Ala Lys Phe Ala Thr Leu
Ala Ala Leu Val Ala Gly Ala Ala 1 5 10 15 Ala Gln Asn Ala Cys Thr
Leu Asn Ala Glu Asn His Pro Ser Leu Thr 20 25 30 Trp Ser Lys Cys
Thr Ser Gly Gly Ser Cys Thr Ser Val Gln Gly Ser 35 40 45 Ile Thr
Ile Asp Ala Asn Trp Arg Trp Thr His Arg Thr Asp Ser Ala 50 55 60
Thr Asn Cys Tyr Glu Gly Asn Lys Trp Asp Thr Ser Tyr Cys Ser Asp 65
70 75 80 Gly Pro Ser Cys Ala Ser Lys Cys Cys Ile Asp Gly Ala Asp
Tyr Ser 85 90 95 Ser Thr Tyr Gly Ile Thr Thr Ser Gly Asn Ser Leu
Asn Leu Lys Phe 100 105 110 Val Thr Lys Gly Gln Tyr Ser Thr Asn Ile
Gly Ser Arg Thr Tyr Leu 115 120 125 Met Glu Ser Asp Thr Lys Tyr Gln
Met Phe Gln Leu Leu Gly Asn Glu 130 135 140 Phe Thr Phe Asp Val Asp
Val Ser Asn Leu Gly Cys Gly Leu Asn Gly 145 150 155 160 Ala Leu Tyr
Phe Val Ser Met Asp Ala Asp Gly Gly Met Ser Lys Tyr 165 170 175 Ser
Gly Asn Lys Ala Gly Ala Lys Tyr Gly Thr Gly Tyr Cys Asp Ser 180 185
190 Gln Cys Pro Arg Asp Leu Lys Phe Ile Asn Gly Glu Ala Asn Val Glu
195 200 205 Asn Trp Gln Ser Ser Thr Asn Asp Ala Asn Ala Gly Thr Gly
Lys Tyr 210 215 220 Gly Ser Cys Cys Ser Glu Met Asp Val Trp Glu Ala
Asn Asn Met Ala 225 230 235 240 Ala Ala Phe Thr Pro His Pro Cys Thr
Val Ile Gly Gln Ser Arg Cys 245 250 255 Glu Gly Asp Ser Cys Gly Gly
Thr Tyr Ser Thr Asp Arg Tyr Ala Gly 260 265 270 Ile Cys Asp Pro Asp
Gly Cys Asp Phe Asn Ser Tyr Arg Gln Gly Asn 275 280 285 Lys Thr Phe
Tyr Gly Lys Gly Met Thr Val Asp Thr Thr Lys Lys Ile 290 295 300 Thr
Val Val Thr Gln Phe Leu Lys Asn Ser Ala Gly Glu Leu Ser Glu 305 310
315 320 Ile Lys Arg Phe Tyr Val Gln Asn Gly Lys Val Ile Pro Asn Ser
Glu 325 330 335 Ser Thr Ile Pro Gly Val Glu Gly Asn Ser Ile Thr Gln
Glu Tyr Cys 340 345 350 Asp Arg Gln Lys Ala Ala Phe Gly Asp Val Thr
Asp Phe Gln Asp Lys 355 360 365 Gly Gly Met Val Gln Met Gly Lys Ala
Leu Ala Gly Pro Met Val Leu 370 375 380 Val Met Ser Ile Trp Asp Asp
His Ala Asp Asn Met Leu Trp Leu Asp 385 390 395 400 Ser Thr Trp Pro
Ile Asp Gly Ala Gly Lys Pro Gly Ala Glu Arg Gly 405 410 415 Ala Cys
Pro Thr Thr Ser Gly Val Pro Ala Glu Val Glu Ala Glu Ala 420 425 430
Pro Asn Ser Asn Val Ile Phe Ser Asn Ile Arg Phe Gly Pro Ile Gly 435
440 445 Ser Thr Val Ser Gly Leu Pro Asp Gly Gly Ser Gly Asn Pro Asn
Pro 450 455 460 Pro Val Ser Ser Ser Thr Pro Val Pro Ser Ser Ser Thr
Thr Ser Ser 465 470 475 480 Gly Ser Ser Gly Pro Thr Gly Gly Thr Gly
Val Ala Lys His Tyr Glu 485 490 495 Gln Cys Gly Gly Ile Gly Phe Thr
Gly Pro Thr Gln Cys Glu Ser Pro 500 505 510 Tyr Thr Cys Thr Lys Leu
Asn Asp Trp Tyr Ser Gln Cys Leu 515 520 525 147509PRTArtificial
SequenceSynthetic polypeptide of M. thermophila CBH1a "Variant 983"
147Gln Asn Ala Cys Thr Leu Asn Ala Glu Asn His Pro Ser Leu Thr Trp
1 5 10 15 Ser Lys Cys Thr Ser Gly Gly Ser Cys Thr Ser Val Gln Gly
Ser Ile 20 25 30 Thr Ile Asp Ala Asn Trp Arg Trp Thr His Arg Thr
Asp Ser Ala Thr 35 40 45 Asn Cys Tyr Glu Gly Asn Lys Trp Asp Thr
Ser Tyr Cys Ser Asp Gly 50 55 60 Pro Ser Cys Ala Ser Lys Cys Cys
Ile Asp Gly Ala Asp Tyr Ser Ser 65 70 75 80 Thr Tyr Gly Ile Thr Thr
Ser Gly Asn Ser Leu Asn Leu Lys Phe Val 85 90 95 Thr Lys Gly Gln
Tyr Ser Thr Asn Ile Gly Ser Arg Thr Tyr Leu Met 100 105 110 Glu Ser
Asp Thr Lys Tyr Gln Met Phe Gln Leu Leu Gly Asn Glu Phe 115 120 125
Thr Phe Asp Val Asp Val Ser Asn Leu Gly Cys Gly Leu Asn Gly Ala 130
135 140 Leu Tyr Phe Val Ser Met Asp Ala Asp Gly Gly Met Ser Lys Tyr
Ser 145 150 155 160 Gly Asn Lys Ala Gly Ala Lys Tyr Gly Thr Gly Tyr
Cys Asp Ser Gln 165 170 175 Cys Pro Arg Asp Leu Lys Phe Ile Asn Gly
Glu Ala Asn Val Glu Asn 180 185 190 Trp Gln Ser Ser Thr Asn Asp Ala
Asn Ala Gly Thr Gly Lys Tyr Gly 195 200 205 Ser Cys Cys Ser Glu Met
Asp Val Trp Glu Ala Asn Asn Met Ala Ala 210 215 220 Ala Phe Thr Pro
His Pro Cys Thr Val Ile Gly Gln Ser Arg Cys Glu 225 230 235 240 Gly
Asp Ser Cys Gly Gly Thr Tyr Ser Thr Asp Arg Tyr Ala Gly Ile 245 250
255 Cys Asp Pro Asp Gly Cys Asp Phe Asn Ser Tyr Arg Gln Gly Asn Lys
260 265 270 Thr Phe Tyr Gly Lys Gly Met Thr Val Asp Thr Thr Lys Lys
Ile Thr 275 280 285 Val Val Thr Gln Phe Leu Lys Asn Ser Ala Gly Glu
Leu Ser Glu Ile 290 295 300 Lys Arg Phe Tyr Val Gln Asn Gly Lys Val
Ile Pro Asn Ser Glu Ser 305 310 315 320 Thr Ile Pro Gly Val Glu Gly
Asn Ser Ile Thr Gln Glu Tyr Cys Asp 325 330 335 Arg Gln Lys Ala Ala
Phe Gly Asp Val Thr Asp Phe Gln Asp Lys Gly 340 345 350 Gly Met Val
Gln Met Gly Lys Ala Leu Ala Gly Pro Met Val Leu Val 355 360 365 Met
Ser Ile Trp Asp Asp His Ala Asp Asn Met Leu Trp Leu Asp Ser 370 375
380 Thr Trp Pro Ile Asp Gly Ala Gly Lys Pro Gly Ala Glu Arg Gly Ala
385 390 395 400 Cys Pro Thr Thr Ser Gly Val Pro Ala Glu Val Glu Ala
Glu Ala Pro 405 410 415 Asn Ser Asn Val Ile Phe Ser Asn Ile Arg Phe
Gly Pro Ile Gly Ser 420 425 430 Thr Val Ser Gly Leu Pro Asp Gly Gly
Ser Gly Asn Pro Asn Pro Pro 435 440 445 Val Ser Ser Ser Thr Pro Val
Pro Ser Ser Ser Thr Thr Ser Ser Gly 450 455 460 Ser Ser Gly Pro Thr
Gly Gly Thr Gly Val Ala Lys His Tyr Glu Gln 465 470 475 480 Cys Gly
Gly Ile Gly Phe Thr Gly Pro Thr Gln Cys Glu Ser Pro Tyr 485 490 495
Thr Cys Thr Lys Leu Asn Asp Trp Tyr Ser Gln Cys Leu 500 505
1481449DNAMyceliophthora thermophila 148atggccaaga agcttttcat
caccgccgcg cttgcggctg ccgtgttggc ggcccccgtc 60attgaggagc gccagaactg
cggcgctgtg tggactcaat gcggcggtaa cgggtggcaa 120ggtcccacat
gctgcgcctc gggctcgacc tgcgttgcgc agaacgagtg gtactctcag
180tgcctgccca acagccaggt gacgagttcc accactccgt cgtcgacttc
cacctcgcag 240cgcagcacca gcacctccag cagcaccacc aggagcggca
gctcctcctc ctcctccacc 300acgcccccgc ccgtctccag ccccgtgacc
agcattcccg gcggtgcgac ctccacggcg 360agctactctg gcaacccctt
ctcgggcgtc cggctcttcg ccaacgacta ctacaggtcc 420gaggtccaca
atctcgccat tcctagcatg actggtactc tggcggccaa ggcttccgcc
480gtcgccgaag tccctagctt ccagtggctc gaccggaacg tcaccatcga
caccctgatg 540gtccagactc tgtcccaggt ccgggctctc aataaggccg
gtgccaatcc tccctatgct 600gcccaactcg tcgtctacga cctccccgac
cgtgactgtg ccgccgctgc gtccaacggc 660gagttttcga ttgcaaacgg
cggcgccgcc aactacagga gctacatcga cgctatccgc 720aagcacatca
ttgagtactc ggacatccgg atcatcctgg ttatcgagcc cgactcgatg
780gccaacatgg tgaccaacat gaacgtggcc
aagtgcagca acgccgcgtc gacgtaccac 840gagttgaccg tgtacgcgct
caagcagctg aacctgccca acgtcgccat gtatctcgac 900gccggccacg
ccggctggct cggctggccc gccaacatcc agcccgccgc cgagctgttt
960gccggcatct acaatgatgc cggcaagccg gctgccgtcc gcggcctggc
cactaacgtc 1020gccaactaca acgcctggag catcgcttcg gccccgtcgt
acacgtcgcc taaccctaac 1080tacgacgaga agcactacat cgaggccttc
agcccgctct tgaactcggc cggcttcccc 1140gcacgcttca ttgtcgacac
tggccgcaac ggcaaacaac ctaccggcca acaacagtgg 1200ggtgactggt
gcaatgtcaa gggcaccggc tttggcgtgc gcccgacggc caacacgggc
1260cacgagctgg tcgatgcctt tgtctgggtc aagcccggcg gcgagtccga
cggcacaagc 1320gacaccagcg ccgcccgcta cgactaccac tgcggcctgt
ccgatgccct gcagcctgcc 1380cccgaggctg gacagtggtt ccaggcctac
ttcgagcagc tgctcaccaa cgccaacccg 1440cccttctaa
1449149482PRTMyceliophthora thermophila 149Met Ala Lys Lys Leu Phe
Ile Thr Ala Ala Leu Ala Ala Ala Val Leu 1 5 10 15 Ala Ala Pro Val
Ile Glu Glu Arg Gln Asn Cys Gly Ala Val Trp Thr 20 25 30 Gln Cys
Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys Cys Ala Ser Gly 35 40 45
Ser Thr Cys Val Ala Gln Asn Glu Trp Tyr Ser Gln Cys Leu Pro Asn 50
55 60 Ser Gln Val Thr Ser Ser Thr Thr Pro Ser Ser Thr Ser Thr Ser
Gln 65 70 75 80 Arg Ser Thr Ser Thr Ser Ser Ser Thr Thr Arg Ser Gly
Ser Ser Ser 85 90 95 Ser Ser Ser Thr Thr Pro Pro Pro Val Ser Ser
Pro Val Thr Ser Ile 100 105 110 Pro Gly Gly Ala Thr Ser Thr Ala Ser
Tyr Ser Gly Asn Pro Phe Ser 115 120 125 Gly Val Arg Leu Phe Ala Asn
Asp Tyr Tyr Arg Ser Glu Val His Asn 130 135 140 Leu Ala Ile Pro Ser
Met Thr Gly Thr Leu Ala Ala Lys Ala Ser Ala 145 150 155 160 Val Ala
Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn Val Thr Ile 165 170 175
Asp Thr Leu Met Val Gln Thr Leu Ser Gln Val Arg Ala Leu Asn Lys 180
185 190 Ala Gly Ala Asn Pro Pro Tyr Ala Ala Gln Leu Val Val Tyr Asp
Leu 195 200 205 Pro Asp Arg Asp Cys Ala Ala Ala Ala Ser Asn Gly Glu
Phe Ser Ile 210 215 220 Ala Asn Gly Gly Ala Ala Asn Tyr Arg Ser Tyr
Ile Asp Ala Ile Arg 225 230 235 240 Lys His Ile Ile Glu Tyr Ser Asp
Ile Arg Ile Ile Leu Val Ile Glu 245 250 255 Pro Asp Ser Met Ala Asn
Met Val Thr Asn Met Asn Val Ala Lys Cys 260 265 270 Ser Asn Ala Ala
Ser Thr Tyr His Glu Leu Thr Val Tyr Ala Leu Lys 275 280 285 Gln Leu
Asn Leu Pro Asn Val Ala Met Tyr Leu Asp Ala Gly His Ala 290 295 300
Gly Trp Leu Gly Trp Pro Ala Asn Ile Gln Pro Ala Ala Glu Leu Phe 305
310 315 320 Ala Gly Ile Tyr Asn Asp Ala Gly Lys Pro Ala Ala Val Arg
Gly Leu 325 330 335 Ala Thr Asn Val Ala Asn Tyr Asn Ala Trp Ser Ile
Ala Ser Ala Pro 340 345 350 Ser Tyr Thr Ser Pro Asn Pro Asn Tyr Asp
Glu Lys His Tyr Ile Glu 355 360 365 Ala Phe Ser Pro Leu Leu Asn Ser
Ala Gly Phe Pro Ala Arg Phe Ile 370 375 380 Val Asp Thr Gly Arg Asn
Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp 385 390 395 400 Gly Asp Trp
Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg Pro Thr 405 410 415 Ala
Asn Thr Gly His Glu Leu Val Asp Ala Phe Val Trp Val Lys Pro 420 425
430 Gly Gly Glu Ser Asp Gly Thr Ser Asp Thr Ser Ala Ala Arg Tyr Asp
435 440 445 Tyr His Cys Gly Leu Ser Asp Ala Leu Gln Pro Ala Pro Glu
Ala Gly 450 455 460 Gln Trp Phe Gln Ala Tyr Phe Glu Gln Leu Leu Thr
Asn Ala Asn Pro 465 470 475 480 Pro Phe 150465PRTMyceliophthora
thermophila 150Ala Pro Val Ile Glu Glu Arg Gln Asn Cys Gly Ala Val
Trp Thr Gln 1 5 10 15 Cys Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys
Cys Ala Ser Gly Ser 20 25 30 Thr Cys Val Ala Gln Asn Glu Trp Tyr
Ser Gln Cys Leu Pro Asn Ser 35 40 45 Gln Val Thr Ser Ser Thr Thr
Pro Ser Ser Thr Ser Thr Ser Gln Arg 50 55 60 Ser Thr Ser Thr Ser
Ser Ser Thr Thr Arg Ser Gly Ser Ser Ser Ser 65 70 75 80 Ser Ser Thr
Thr Pro Pro Pro Val Ser Ser Pro Val Thr Ser Ile Pro 85 90 95 Gly
Gly Ala Thr Ser Thr Ala Ser Tyr Ser Gly Asn Pro Phe Ser Gly 100 105
110 Val Arg Leu Phe Ala Asn Asp Tyr Tyr Arg Ser Glu Val His Asn Leu
115 120 125 Ala Ile Pro Ser Met Thr Gly Thr Leu Ala Ala Lys Ala Ser
Ala Val 130 135 140 Ala Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn
Val Thr Ile Asp 145 150 155 160 Thr Leu Met Val Gln Thr Leu Ser Gln
Val Arg Ala Leu Asn Lys Ala 165 170 175 Gly Ala Asn Pro Pro Tyr Ala
Ala Gln Leu Val Val Tyr Asp Leu Pro 180 185 190 Asp Arg Asp Cys Ala
Ala Ala Ala Ser Asn Gly Glu Phe Ser Ile Ala 195 200 205 Asn Gly Gly
Ala Ala Asn Tyr Arg Ser Tyr Ile Asp Ala Ile Arg Lys 210 215 220 His
Ile Ile Glu Tyr Ser Asp Ile Arg Ile Ile Leu Val Ile Glu Pro 225 230
235 240 Asp Ser Met Ala Asn Met Val Thr Asn Met Asn Val Ala Lys Cys
Ser 245 250 255 Asn Ala Ala Ser Thr Tyr His Glu Leu Thr Val Tyr Ala
Leu Lys Gln 260 265 270 Leu Asn Leu Pro Asn Val Ala Met Tyr Leu Asp
Ala Gly His Ala Gly 275 280 285 Trp Leu Gly Trp Pro Ala Asn Ile Gln
Pro Ala Ala Glu Leu Phe Ala 290 295 300 Gly Ile Tyr Asn Asp Ala Gly
Lys Pro Ala Ala Val Arg Gly Leu Ala 305 310 315 320 Thr Asn Val Ala
Asn Tyr Asn Ala Trp Ser Ile Ala Ser Ala Pro Ser 325 330 335 Tyr Thr
Ser Pro Asn Pro Asn Tyr Asp Glu Lys His Tyr Ile Glu Ala 340 345 350
Phe Ser Pro Leu Leu Asn Ser Ala Gly Phe Pro Ala Arg Phe Ile Val 355
360 365 Asp Thr Gly Arg Asn Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp
Gly 370 375 380 Asp Trp Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg
Pro Thr Ala 385 390 395 400 Asn Thr Gly His Glu Leu Val Asp Ala Phe
Val Trp Val Lys Pro Gly 405 410 415 Gly Glu Ser Asp Gly Thr Ser Asp
Thr Ser Ala Ala Arg Tyr Asp Tyr 420 425 430 His Cys Gly Leu Ser Asp
Ala Leu Gln Pro Ala Pro Glu Ala Gly Gln 435 440 445 Trp Phe Gln Ala
Tyr Phe Glu Gln Leu Leu Thr Asn Ala Asn Pro Pro 450 455 460 Phe 465
1511449DNAArtificial SequenceSynthetic polynucleotide of M.
thermophila CBH2b "Variant 196" 151atggccaaga agcttttcat caccgccgcg
cttgcggctg ccgtgttggc ggcccccgtc 60attgaggagc gccagaactg cggcgctgtg
tggactcaat gcggcggtaa cgggtggcaa 120ggtcccacat gctgcgcctc
gggctcgacc tgcgttgcgc agaacgagtg gtactctcag 180tgcctgccca
acagccaggt gacgagttcc accactccgt cgtcgacttc cacctcgcag
240cgcagcacca gcacctccag cagcaccacc aggagcggca gctcctcctc
ctcctccacc 300acgcccaccc ccgtctccag ccccgtgacc agcattcccg
gcggtgcgac ctccacggcg 360agctactctg gcaacccctt ctcgggcgtc
cggctcttcg ccaacgacta ctacaggtcc 420gaggtccaca atctcgccat
tcctagcatg actggtactc tggcggccaa ggcttccgcc 480gtcgccgaag
tccctagctt ccagtggctc gaccggaacg tcaccatcga caccctgatg
540gtcccgactc tgtcccgcgt ccgggctctc aataaggccg gtgccaatcc
tccctatgct 600gcccaactcg tcgtctacga cctccccgac cgtgactgtg
ccgccgctgc gtccaacggc 660gagttttcga ttgcaaacgg cggcgccgcc
aactacagga gctacatcga cgctatccgc 720aagcacatca ttgagtactc
ggacatccgg atcatcctgg ttatcgagcc cgactcgatg 780gccaacatgg
tgaccaacat gaacgtggcc aagtgcagca acgccgcgtc gacgtaccac
840gagttgaccg tgtacgcgct caagcagctg aacctgccca acgtcgccat
gtatctcgac 900gccggccacg ccggctggct cggctggccc gccaacatcc
agcccgccgc cgagctgttt 960gccggcatct acaatgatgc cggcaagccg
gctgccgtcc gcggcctggc cactaacgtc 1020gccaactaca acgcctggag
catcgcttcg gccccgtcgt acacgtcgcc taaccctaac 1080tacgacgaga
agcactacat cgaggccttc agcccgctct tgaactcggc cggcttcccc
1140gcacgcttca ttgtcgacac tggccgcaac ggcaaacaac ctaccggcca
acaacagtgg 1200ggtgactggt gcaatgtcaa gggcaccggc tttggcgtgc
gcccgacggc caacacgggc 1260cacgagctgg tcgatgcctt tgtctgggtc
aagcccggcg gcgagtccga cggcacaagc 1320gacaccagcg ccgcccgcta
cgactaccac tgcggcctgt ccgatgccct gcagcctgcc 1380cccgaggctg
gacagtggtt ccaggcctac ttcgagcagc tgctcaccaa cgccaacccg
1440cccttctaa 1449152482PRTArtificial SequenceSynthetic polypeptide
of M. thermophila CBH2b "Variant 196" 152Met Ala Lys Lys Leu Phe
Ile Thr Ala Ala Leu Ala Ala Ala Val Leu 1 5 10 15 Ala Ala Pro Val
Ile Glu Glu Arg Gln Asn Cys Gly Ala Val Trp Thr 20 25 30 Gln Cys
Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys Cys Ala Ser Gly 35 40 45
Ser Thr Cys Val Ala Gln Asn Glu Trp Tyr Ser Gln Cys Leu Pro Asn 50
55 60 Ser Gln Val Thr Ser Ser Thr Thr Pro Ser Ser Thr Ser Thr Ser
Gln 65 70 75 80 Arg Ser Thr Ser Thr Ser Ser Ser Thr Thr Arg Ser Gly
Ser Ser Ser 85 90 95 Ser Ser Ser Thr Thr Pro Thr Pro Val Ser Ser
Pro Val Thr Ser Ile 100 105 110 Pro Gly Gly Ala Thr Ser Thr Ala Ser
Tyr Ser Gly Asn Pro Phe Ser 115 120 125 Gly Val Arg Leu Phe Ala Asn
Asp Tyr Tyr Arg Ser Glu Val His Asn 130 135 140 Leu Ala Ile Pro Ser
Met Thr Gly Thr Leu Ala Ala Lys Ala Ser Ala 145 150 155 160 Val Ala
Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn Val Thr Ile 165 170 175
Asp Thr Leu Met Val Pro Thr Leu Ser Arg Val Arg Ala Leu Asn Lys 180
185 190 Ala Gly Ala Asn Pro Pro Tyr Ala Ala Gln Leu Val Val Tyr Asp
Leu 195 200 205 Pro Asp Arg Asp Cys Ala Ala Ala Ala Ser Asn Gly Glu
Phe Ser Ile 210 215 220 Ala Asn Gly Gly Ala Ala Asn Tyr Arg Ser Tyr
Ile Asp Ala Ile Arg 225 230 235 240 Lys His Ile Ile Glu Tyr Ser Asp
Ile Arg Ile Ile Leu Val Ile Glu 245 250 255 Pro Asp Ser Met Ala Asn
Met Val Thr Asn Met Asn Val Ala Lys Cys 260 265 270 Ser Asn Ala Ala
Ser Thr Tyr His Glu Leu Thr Val Tyr Ala Leu Lys 275 280 285 Gln Leu
Asn Leu Pro Asn Val Ala Met Tyr Leu Asp Ala Gly His Ala 290 295 300
Gly Trp Leu Gly Trp Pro Ala Asn Ile Gln Pro Ala Ala Glu Leu Phe 305
310 315 320 Ala Gly Ile Tyr Asn Asp Ala Gly Lys Pro Ala Ala Val Arg
Gly Leu 325 330 335 Ala Thr Asn Val Ala Asn Tyr Asn Ala Trp Ser Ile
Ala Ser Ala Pro 340 345 350 Ser Tyr Thr Ser Pro Asn Pro Asn Tyr Asp
Glu Lys His Tyr Ile Glu 355 360 365 Ala Phe Ser Pro Leu Leu Asn Ser
Ala Gly Phe Pro Ala Arg Phe Ile 370 375 380 Val Asp Thr Gly Arg Asn
Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp 385 390 395 400 Gly Asp Trp
Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg Pro Thr 405 410 415 Ala
Asn Thr Gly His Glu Leu Val Asp Ala Phe Val Trp Val Lys Pro 420 425
430 Gly Gly Glu Ser Asp Gly Thr Ser Asp Thr Ser Ala Ala Arg Tyr Asp
435 440 445 Tyr His Cys Gly Leu Ser Asp Ala Leu Gln Pro Ala Pro Glu
Ala Gly 450 455 460 Gln Trp Phe Gln Ala Tyr Phe Glu Gln Leu Leu Thr
Asn Ala Asn Pro 465 470 475 480 Pro Phe 153465PRTArtificial
SequenceSynthetic polypeptide of M. thermophila CBH2b "Variant 196"
153Ala Pro Val Ile Glu Glu Arg Gln Asn Cys Gly Ala Val Trp Thr Gln
1 5 10 15 Cys Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys Cys Ala Ser
Gly Ser 20 25 30 Thr Cys Val Ala Gln Asn Glu Trp Tyr Ser Gln Cys
Leu Pro Asn Ser 35 40 45 Gln Val Thr Ser Ser Thr Thr Pro Ser Ser
Thr Ser Thr Ser Gln Arg 50 55 60 Ser Thr Ser Thr Ser Ser Ser Thr
Thr Arg Ser Gly Ser Ser Ser Ser 65 70 75 80 Ser Ser Thr Thr Pro Thr
Pro Val Ser Ser Pro Val Thr Ser Ile Pro 85 90 95 Gly Gly Ala Thr
Ser Thr Ala Ser Tyr Ser Gly Asn Pro Phe Ser Gly 100 105 110 Val Arg
Leu Phe Ala Asn Asp Tyr Tyr Arg Ser Glu Val His Asn Leu 115 120 125
Ala Ile Pro Ser Met Thr Gly Thr Leu Ala Ala Lys Ala Ser Ala Val 130
135 140 Ala Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn Val Thr Ile
Asp 145 150 155 160 Thr Leu Met Val Pro Thr Leu Ser Arg Val Arg Ala
Leu Asn Lys Ala 165 170 175 Gly Ala Asn Pro Pro Tyr Ala Ala Gln Leu
Val Val Tyr Asp Leu Pro 180 185 190 Asp Arg Asp Cys Ala Ala Ala Ala
Ser Asn Gly Glu Phe Ser Ile Ala 195 200 205 Asn Gly Gly Ala Ala Asn
Tyr Arg Ser Tyr Ile Asp Ala Ile Arg Lys 210 215 220 His Ile Ile Glu
Tyr Ser Asp Ile Arg Ile Ile Leu Val Ile Glu Pro 225 230 235 240 Asp
Ser Met Ala Asn Met Val Thr Asn Met Asn Val Ala Lys Cys Ser 245 250
255 Asn Ala Ala Ser Thr Tyr His Glu Leu Thr Val Tyr Ala Leu Lys Gln
260 265 270 Leu Asn Leu Pro Asn Val Ala Met Tyr Leu Asp Ala Gly His
Ala Gly 275 280 285 Trp Leu Gly Trp Pro Ala Asn Ile Gln Pro Ala Ala
Glu Leu Phe Ala 290 295 300 Gly Ile Tyr Asn Asp Ala Gly Lys Pro Ala
Ala Val Arg Gly Leu Ala 305 310 315 320 Thr Asn Val Ala Asn Tyr Asn
Ala Trp Ser Ile Ala Ser Ala Pro Ser 325 330 335 Tyr Thr Ser Pro Asn
Pro Asn Tyr Asp Glu Lys His Tyr Ile Glu Ala 340 345 350 Phe Ser Pro
Leu Leu Asn Ser Ala Gly Phe Pro Ala Arg Phe Ile Val 355 360 365 Asp
Thr Gly Arg Asn Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp Gly 370 375
380 Asp Trp Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg Pro Thr Ala
385 390 395 400 Asn Thr Gly His Glu Leu Val Asp Ala Phe Val Trp Val
Lys Pro Gly 405 410 415 Gly Glu Ser Asp Gly Thr Ser Asp Thr Ser Ala
Ala Arg Tyr Asp Tyr 420 425 430 His Cys Gly Leu Ser Asp Ala Leu Gln
Pro Ala Pro Glu Ala Gly Gln 435 440 445 Trp Phe Gln Ala Tyr Phe Glu
Gln Leu Leu Thr Asn Ala Asn Pro Pro 450 455 460 Phe 465
1541449DNAArtificial SequenceSynthetic polynucleotide of M.
thermophila CBH2b "Variant 287" 154atggccaaga agcttttcat caccgccgcg
cttgcggctg ccgtgttggc ggcccccgtc 60attgaggagc gccagaactg cggcgctgtg
tggactcaat gcggcggtaa cgggtggcaa
120ggtcccacat gctgcgcctc gggctcgacc tgcgttgcgc agaacgagtg
gtactctcag 180tgcctgccca acagccaggt gacgagttcc accactccgt
cgtcgacttc cacctcgcag 240cgcagcacca gcacctccag cagcaccacc
aggagcggca gctcctcctc ctcctccacc 300acgcccccgc ccgtctccag
ccccgtgacc agcattcccg gcggtgcgac ctccacggcg 360agctactctg
gcaacccctt ctcgggcgtc cggctcttcg ccaacgacta ctacaggtcc
420gaggtccaca atctcgccat tcctagcatg actggtactc tggcggccaa
ggcttccgcc 480gtcgccgaag tccctagctt ccagtggctc gaccggaacg
tcaccatcga caccctgatg 540gtcccgactc tgtcccgcgt ccgggctctc
aataaggccg gtgccaatcc tccctatgct 600gcccaactcg tcgtctacga
cctccccgac cgtgactgtg ccgccgctgc gtccaacggc 660gagttttcga
ttgcaaacgg cggcgccgcc aactacagga gctacatcga cgctatccgc
720aagcacatca aggagtactc ggacatccgg atcatcctgg ttatcgagcc
cgactcgatg 780gccaacatgg tgaccaacat gaacgtggcc aagtgcagca
acgccgcgtc gacgtaccac 840gagttgaccg tgtacgcgct caagcagctg
aacctgccca acgtcgccat gtatctcgac 900gccggccacg ccggctggct
cggctggccc gccaacatcc agcccgccgc cgagctgttt 960gccggcatct
acaatgatgc cggcaagccg gctgccgtcc gcggcctggc cactaacgtc
1020gccaactaca acgcctggag catcgcttcg gccccgtcgt acacgtcgcc
taaccctaac 1080tacgacgaga agcactacat cgaggccttc agcccgctct
tgaacgacgc cggcttcccc 1140gcacgcttca ttgtcgacac tggccgcaac
ggcaaacaac ctaccggcca acaacagtgg 1200ggtgactggt gcaatgtcaa
gggcaccggc tttggcgtgc gcccgacggc caacacgggc 1260cacgagctgg
tcgatgcctt tgtctgggtc aagcccggcg gcgagtccga cggcacaagc
1320gacaccagcg ccgcccgcta cgactaccac tgcggcctgt ccgatgccct
gcagcctgcc 1380cccgaggctg gacagtggtt ccaggcctac ttcgagcagc
tgctcaccaa cgccaacccg 1440cccttctaa 1449155482PRTArtificial
SequenceSynthetic polypeptide of M. thermophila CBH2b "Variant 287"
155Met Ala Lys Lys Leu Phe Ile Thr Ala Ala Leu Ala Ala Ala Val Leu
1 5 10 15 Ala Ala Pro Val Ile Glu Glu Arg Gln Asn Cys Gly Ala Val
Trp Thr 20 25 30 Gln Cys Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys
Cys Ala Ser Gly 35 40 45 Ser Thr Cys Val Ala Gln Asn Glu Trp Tyr
Ser Gln Cys Leu Pro Asn 50 55 60 Ser Gln Val Thr Ser Ser Thr Thr
Pro Ser Ser Thr Ser Thr Ser Gln 65 70 75 80 Arg Ser Thr Ser Thr Ser
Ser Ser Thr Thr Arg Ser Gly Ser Ser Ser 85 90 95 Ser Ser Ser Thr
Thr Pro Pro Pro Val Ser Ser Pro Val Thr Ser Ile 100 105 110 Pro Gly
Gly Ala Thr Ser Thr Ala Ser Tyr Ser Gly Asn Pro Phe Ser 115 120 125
Gly Val Arg Leu Phe Ala Asn Asp Tyr Tyr Arg Ser Glu Val His Asn 130
135 140 Leu Ala Ile Pro Ser Met Thr Gly Thr Leu Ala Ala Lys Ala Ser
Ala 145 150 155 160 Val Ala Glu Val Pro Ser Phe Gln Trp Leu Asp Arg
Asn Val Thr Ile 165 170 175 Asp Thr Leu Met Val Pro Thr Leu Ser Arg
Val Arg Ala Leu Asn Lys 180 185 190 Ala Gly Ala Asn Pro Pro Tyr Ala
Ala Gln Leu Val Val Tyr Asp Leu 195 200 205 Pro Asp Arg Asp Cys Ala
Ala Ala Ala Ser Asn Gly Glu Phe Ser Ile 210 215 220 Ala Asn Gly Gly
Ala Ala Asn Tyr Arg Ser Tyr Ile Asp Ala Ile Arg 225 230 235 240 Lys
His Ile Lys Glu Tyr Ser Asp Ile Arg Ile Ile Leu Val Ile Glu 245 250
255 Pro Asp Ser Met Ala Asn Met Val Thr Asn Met Asn Val Ala Lys Cys
260 265 270 Ser Asn Ala Ala Ser Thr Tyr His Glu Leu Thr Val Tyr Ala
Leu Lys 275 280 285 Gln Leu Asn Leu Pro Asn Val Ala Met Tyr Leu Asp
Ala Gly His Ala 290 295 300 Gly Trp Leu Gly Trp Pro Ala Asn Ile Gln
Pro Ala Ala Glu Leu Phe 305 310 315 320 Ala Gly Ile Tyr Asn Asp Ala
Gly Lys Pro Ala Ala Val Arg Gly Leu 325 330 335 Ala Thr Asn Val Ala
Asn Tyr Asn Ala Trp Ser Ile Ala Ser Ala Pro 340 345 350 Ser Tyr Thr
Ser Pro Asn Pro Asn Tyr Asp Glu Lys His Tyr Ile Glu 355 360 365 Ala
Phe Ser Pro Leu Leu Asn Asp Ala Gly Phe Pro Ala Arg Phe Ile 370 375
380 Val Asp Thr Gly Arg Asn Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp
385 390 395 400 Gly Asp Trp Cys Asn Val Lys Gly Thr Gly Phe Gly Val
Arg Pro Thr 405 410 415 Ala Asn Thr Gly His Glu Leu Val Asp Ala Phe
Val Trp Val Lys Pro 420 425 430 Gly Gly Glu Ser Asp Gly Thr Ser Asp
Thr Ser Ala Ala Arg Tyr Asp 435 440 445 Tyr His Cys Gly Leu Ser Asp
Ala Leu Gln Pro Ala Pro Glu Ala Gly 450 455 460 Gln Trp Phe Gln Ala
Tyr Phe Glu Gln Leu Leu Thr Asn Ala Asn Pro 465 470 475 480 Pro Phe
156465PRTArtificial SequenceSynthetic polypeptide of M. thermophila
CBH2b "Variant 287" 156Ala Pro Val Ile Glu Glu Arg Gln Asn Cys Gly
Ala Val Trp Thr Gln 1 5 10 15 Cys Gly Gly Asn Gly Trp Gln Gly Pro
Thr Cys Cys Ala Ser Gly Ser 20 25 30 Thr Cys Val Ala Gln Asn Glu
Trp Tyr Ser Gln Cys Leu Pro Asn Ser 35 40 45 Gln Val Thr Ser Ser
Thr Thr Pro Ser Ser Thr Ser Thr Ser Gln Arg 50 55 60 Ser Thr Ser
Thr Ser Ser Ser Thr Thr Arg Ser Gly Ser Ser Ser Ser 65 70 75 80 Ser
Ser Thr Thr Pro Pro Pro Val Ser Ser Pro Val Thr Ser Ile Pro 85 90
95 Gly Gly Ala Thr Ser Thr Ala Ser Tyr Ser Gly Asn Pro Phe Ser Gly
100 105 110 Val Arg Leu Phe Ala Asn Asp Tyr Tyr Arg Ser Glu Val His
Asn Leu 115 120 125 Ala Ile Pro Ser Met Thr Gly Thr Leu Ala Ala Lys
Ala Ser Ala Val 130 135 140 Ala Glu Val Pro Ser Phe Gln Trp Leu Asp
Arg Asn Val Thr Ile Asp 145 150 155 160 Thr Leu Met Val Pro Thr Leu
Ser Arg Val Arg Ala Leu Asn Lys Ala 165 170 175 Gly Ala Asn Pro Pro
Tyr Ala Ala Gln Leu Val Val Tyr Asp Leu Pro 180 185 190 Asp Arg Asp
Cys Ala Ala Ala Ala Ser Asn Gly Glu Phe Ser Ile Ala 195 200 205 Asn
Gly Gly Ala Ala Asn Tyr Arg Ser Tyr Ile Asp Ala Ile Arg Lys 210 215
220 His Ile Lys Glu Tyr Ser Asp Ile Arg Ile Ile Leu Val Ile Glu Pro
225 230 235 240 Asp Ser Met Ala Asn Met Val Thr Asn Met Asn Val Ala
Lys Cys Ser 245 250 255 Asn Ala Ala Ser Thr Tyr His Glu Leu Thr Val
Tyr Ala Leu Lys Gln 260 265 270 Leu Asn Leu Pro Asn Val Ala Met Tyr
Leu Asp Ala Gly His Ala Gly 275 280 285 Trp Leu Gly Trp Pro Ala Asn
Ile Gln Pro Ala Ala Glu Leu Phe Ala 290 295 300 Gly Ile Tyr Asn Asp
Ala Gly Lys Pro Ala Ala Val Arg Gly Leu Ala 305 310 315 320 Thr Asn
Val Ala Asn Tyr Asn Ala Trp Ser Ile Ala Ser Ala Pro Ser 325 330 335
Tyr Thr Ser Pro Asn Pro Asn Tyr Asp Glu Lys His Tyr Ile Glu Ala 340
345 350 Phe Ser Pro Leu Leu Asn Asp Ala Gly Phe Pro Ala Arg Phe Ile
Val 355 360 365 Asp Thr Gly Arg Asn Gly Lys Gln Pro Thr Gly Gln Gln
Gln Trp Gly 370 375 380 Asp Trp Cys Asn Val Lys Gly Thr Gly Phe Gly
Val Arg Pro Thr Ala 385 390 395 400 Asn Thr Gly His Glu Leu Val Asp
Ala Phe Val Trp Val Lys Pro Gly 405 410 415 Gly Glu Ser Asp Gly Thr
Ser Asp Thr Ser Ala Ala Arg Tyr Asp Tyr 420 425 430 His Cys Gly Leu
Ser Asp Ala Leu Gln Pro Ala Pro Glu Ala Gly Gln 435 440 445 Trp Phe
Gln Ala Tyr Phe Glu Gln Leu Leu Thr Asn Ala Asn Pro Pro 450 455 460
Phe 465 1571449DNAArtificial SequenceSynthetic polynucleotide of M.
thermophila CBH2b "Variant 962" 157atggccaaga agcttttcat caccgccgcg
cttgcggctg ccgtgttggc ggcccccgtc 60attgaggagc gccagaactg cggcgctgtg
tggactcaat gcggcggtaa cgggtggcaa 120ggtcccacat gctgcgcctc
gggctcgacc tgcgttgcgc agaacgagtg gtactctcag 180tgcctgccca
acagccaggt gacgagttcc accactccgt cgtcgacttc cacctcgcag
240cgcagcacca gcacctccag cagcaccacc aggagcggca gctcctcctc
ctcctccacc 300acgcccaccc ccgtctccag ccccgtgacc agcattcccg
gcggtgcgac ctccacggcg 360agctactctg gcaacccctt ctcgggcgtc
cggctcttcg ccaacgacta ctacaggtcc 420gaggtcatga atctcgccat
tcctagcatg actggtactc tggcggccaa ggcttccgcc 480gtcgccgaag
tccctagctt ccagtggctc gaccggaacg tcaccatcga caccctgatg
540gtcaccactc tgtcccaggt ccgggctctc aataaggccg gtgccaatcc
tccctatgct 600gcccaactcg tcgtctacga cctccccgac cgtgactgtg
ccgccgctgc gtccaacggc 660gagttttcga ttgcaaacgg cggcagcgcc
aactacagga gctacatcga cgctatccgc 720aagcacatca ttgagtactc
ggacatccgg atcatcctgg ttatcgagcc cgactcgatg 780gccaacatgg
tgaccaacat gaacgtggcc aagtgcagca acgccgcgtc gacgtaccac
840gagttgaccg tgtacgcgct caagcagctg aacctgccca acgtcgccat
gtatctcgac 900gccggccacg ccggctggct cggctggccc gccaacatcc
agcccgccgc cgagctgttt 960gccggcatct acaatgatgc cggcaagccg
gctgccgtcc gcggcctggc cactaacgtc 1020gccaactaca acgcctggag
catcgcttcg gccccgtcgt acacgcagcc taaccctaac 1080tacgacgaga
agcactacat cgaggccttc agcccgctct tgaactcggc cggcttcccc
1140gcacgcttca ttgtcgacac tggccgcaac ggcaaacaac ctaccggcca
acaacagtgg 1200ggtgactggt gcaatgtcaa gggcaccggc tttggcgtgc
gcccgacggc caacacgggc 1260cacgagctgg tcgatgcctt tgtctgggtc
aagcccggcg gcgagtccga cggcacaagc 1320gacaccagcg ccgcccgcta
cgactaccac tgcggcctgt ccgatgccct gcagcctgcc 1380cccgaggctg
gacagtggtt ccaggcctac ttcgagcagc tgctcaccaa cgccaacccg
1440cccttctaa 1449158482PRTArtificial SequenceSynthetic polypeptide
of M. thermophila CBH2b "Variant 962" 158Met Ala Lys Lys Leu Phe
Ile Thr Ala Ala Leu Ala Ala Ala Val Leu 1 5 10 15 Ala Ala Pro Val
Ile Glu Glu Arg Gln Asn Cys Gly Ala Val Trp Thr 20 25 30 Gln Cys
Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys Cys Ala Ser Gly 35 40 45
Ser Thr Cys Val Ala Gln Asn Glu Trp Tyr Ser Gln Cys Leu Pro Asn 50
55 60 Ser Gln Val Thr Ser Ser Thr Thr Pro Ser Ser Thr Ser Thr Ser
Gln 65 70 75 80 Arg Ser Thr Ser Thr Ser Ser Ser Thr Thr Arg Ser Gly
Ser Ser Ser 85 90 95 Ser Ser Ser Thr Thr Pro Thr Pro Val Ser Ser
Pro Val Thr Ser Ile 100 105 110 Pro Gly Gly Ala Thr Ser Thr Ala Ser
Tyr Ser Gly Asn Pro Phe Ser 115 120 125 Gly Val Arg Leu Phe Ala Asn
Asp Tyr Tyr Arg Ser Glu Val Met Asn 130 135 140 Leu Ala Ile Pro Ser
Met Thr Gly Thr Leu Ala Ala Lys Ala Ser Ala 145 150 155 160 Val Ala
Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn Val Thr Ile 165 170 175
Asp Thr Leu Met Val Thr Thr Leu Ser Gln Val Arg Ala Leu Asn Lys 180
185 190 Ala Gly Ala Asn Pro Pro Tyr Ala Ala Gln Leu Val Val Tyr Asp
Leu 195 200 205 Pro Asp Arg Asp Cys Ala Ala Ala Ala Ser Asn Gly Glu
Phe Ser Ile 210 215 220 Ala Asn Gly Gly Ser Ala Asn Tyr Arg Ser Tyr
Ile Asp Ala Ile Arg 225 230 235 240 Lys His Ile Ile Glu Tyr Ser Asp
Ile Arg Ile Ile Leu Val Ile Glu 245 250 255 Pro Asp Ser Met Ala Asn
Met Val Thr Asn Met Asn Val Ala Lys Cys 260 265 270 Ser Asn Ala Ala
Ser Thr Tyr His Glu Leu Thr Val Tyr Ala Leu Lys 275 280 285 Gln Leu
Asn Leu Pro Asn Val Ala Met Tyr Leu Asp Ala Gly His Ala 290 295 300
Gly Trp Leu Gly Trp Pro Ala Asn Ile Gln Pro Ala Ala Glu Leu Phe 305
310 315 320 Ala Gly Ile Tyr Asn Asp Ala Gly Lys Pro Ala Ala Val Arg
Gly Leu 325 330 335 Ala Thr Asn Val Ala Asn Tyr Asn Ala Trp Ser Ile
Ala Ser Ala Pro 340 345 350 Ser Tyr Thr Gln Pro Asn Pro Asn Tyr Asp
Glu Lys His Tyr Ile Glu 355 360 365 Ala Phe Ser Pro Leu Leu Asn Ser
Ala Gly Phe Pro Ala Arg Phe Ile 370 375 380 Val Asp Thr Gly Arg Asn
Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp 385 390 395 400 Gly Asp Trp
Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg Pro Thr 405 410 415 Ala
Asn Thr Gly His Glu Leu Val Asp Ala Phe Val Trp Val Lys Pro 420 425
430 Gly Gly Glu Ser Asp Gly Thr Ser Asp Thr Ser Ala Ala Arg Tyr Asp
435 440 445 Tyr His Cys Gly Leu Ser Asp Ala Leu Gln Pro Ala Pro Glu
Ala Gly 450 455 460 Gln Trp Phe Gln Ala Tyr Phe Glu Gln Leu Leu Thr
Asn Ala Asn Pro 465 470 475 480 Pro Phe 159464PRTArtificial
SequenceSynthetic polypeptide of M. thermophila CBH2b "Variant 962"
159Ala Pro Val Ile Glu Glu Arg Gln Asn Cys Gly Ala Val Trp Thr Gln
1 5 10 15 Cys Gly Gly Asn Gly Trp Gln Gly Pro Thr Cys Cys Ala Ser
Gly Ser 20 25 30 Thr Cys Val Ala Gln Asn Glu Trp Tyr Ser Gln Cys
Leu Pro Asn Ser 35 40 45 Gln Val Thr Ser Ser Thr Thr Pro Ser Ser
Thr Ser Thr Ser Gln Arg 50 55 60 Ser Thr Ser Thr Ser Ser Ser Thr
Thr Arg Ser Gly Ser Ser Ser Ser 65 70 75 80 Ser Ser Thr Thr Pro Thr
Pro Val Ser Ser Pro Val Thr Ser Ile Pro 85 90 95 Gly Gly Ala Thr
Ser Thr Ala Ser Tyr Ser Gly Asn Pro Phe Ser Gly 100 105 110 Val Arg
Leu Phe Ala Asn Asp Tyr Tyr Arg Ser Glu Val Met Asn Leu 115 120 125
Ala Ile Pro Ser Met Thr Gly Thr Leu Ala Ala Lys Ala Ser Ala Val 130
135 140 Ala Glu Val Pro Ser Phe Gln Trp Leu Asp Arg Asn Val Thr Ile
Asp 145 150 155 160 Thr Leu Met Val Thr Thr Leu Ser Gln Val Arg Ala
Leu Asn Lys Ala 165 170 175 Gly Ala Asn Pro Pro Tyr Ala Ala Gln Leu
Val Val Tyr Asp Leu Pro 180 185 190 Asp Arg Asp Cys Ala Ala Ala Ala
Ser Asn Gly Glu Phe Ser Ile Ala 195 200 205 Asn Gly Gly Ser Ala Asn
Tyr Arg Ser Tyr Ile Asp Ala Ile Arg Lys 210 215 220 His Ile Ile Glu
Tyr Ser Asp Ile Arg Ile Ile Leu Val Ile Glu Pro 225 230 235 240 Asp
Ser Met Ala Asn Met Val Thr Asn Met Asn Val Ala Lys Cys Ser 245 250
255 Asn Ala Ala Ser Thr Tyr His Glu Leu Thr Val Tyr Ala Leu Lys Gln
260 265 270 Leu Asn Leu Pro Asn Val Ala Met Tyr Leu Asp Ala Gly His
Ala Gly 275 280 285 Trp Leu Gly Trp Pro Ala Asn Ile Gln Pro Ala Ala
Glu Leu Phe Ala 290 295 300 Gly Ile Tyr Asn Asp Gly Lys Pro Ala Ala
Val Arg Gly Leu Ala Thr 305 310 315 320 Asn Val Ala Asn Tyr Asn Ala
Trp Ser Ile Ala Ser Ala Pro Ser Tyr 325 330 335 Thr Gln Pro Asn Pro
Asn Tyr Asp Glu Lys His Tyr Ile Glu Ala Phe 340 345 350 Ser Pro Leu
Leu Asn Ser Ala Gly Phe Pro Ala Arg Phe Ile Val Asp 355 360 365 Thr
Gly Arg Asn Gly Lys Gln Pro Thr Gly Gln Gln Gln Trp Gly Asp 370
375 380 Trp Cys Asn Val Lys Gly Thr Gly Phe Gly Val Arg Pro Thr Ala
Asn 385 390 395 400 Thr Gly His Glu Leu Val Asp Ala Phe Val Trp Val
Lys Pro Gly Gly 405 410 415 Glu Ser Asp Gly Thr Ser Asp Thr Ser Ala
Ala Arg Tyr Asp Tyr His 420 425 430 Cys Gly Leu Ser Asp Ala Leu Gln
Pro Ala Pro Glu Ala Gly Gln Trp 435 440 445 Phe Gln Ala Tyr Phe Glu
Gln Leu Leu Thr Asn Ala Asn Pro Pro Phe 450 455 460
1601239DNAMyceliophthora thermophila 160atgcactcca aagctttctt
ggcagcgctt cttgcgcctg ccgtctcagg gcaactgaac 60gacctcgccg tcagggctgg
actcaagtac tttggtactg ctcttagcga gagcgtcatc 120aacagtgata
ctcggtatgc tgccatcctc agcgacaaga gcatgttcgg ccagctcgtc
180cccgagaatg gcatgaagtg ggatgctact gagccgtccc gtggccagtt
caactacgcc 240tcgggcgaca tcacggccaa cacggccaag aagaatggcc
agggcatgcg ttgccacacc 300atggtctggt acagccagct cccgagctgg
gtctcctcgg gctcgtggac cagggactcg 360ctcacctcgg tcatcgagac
gcacatgaac aacgtcatgg gccactacaa gggccaatgc 420tacgcctggg
atgtcatcaa cgaggccatc aatgacgacg gcaactcctg gcgcgacaac
480gtctttctcc ggacctttgg gaccgactac ttcgccctgt ccttcaacct
agccaagaag 540gccgatcccg ataccaagct gtactacaac gactacaacc
tcgagtacaa ccaggccaag 600acggaccgcg ctgttgagct cgtcaagatg
gtccaggccg ccggcgcgcc catcgacggt 660gtcggcttcc agggccacct
cattgtcggc tcgaccccga cgcgctcgca gctggccacc 720gccctccagc
gcttcaccgc gctcggcctc gaggtcgcct acaccgagct cgacatccgc
780cactcgagcc tgccggcctc ttcgtcggcg ctcgcgaccc agggcaacga
cttcgccaac 840gtggtcggct cttgcctcga caccgccggc tgcgtcggcg
tcaccgtctg gggcttcacc 900gatgcgcact cgtggatccc gaacacgttc
cccggccagg gcgacgccct gatctacgac 960agcaactaca acaagaagcc
cgcgtggacc tcgatctcgt ccgtcctggc cgccaaggcc 1020accggcgccc
cgcccgcctc gtcctccacc accctcgtca ccatcaccac ccctccgccg
1080gcatccacca ccgcctcctc ctcctccagt gccacgccca cgagcgtccc
gacgcagacg 1140aggtggggac agtgcggcgg catcggatgg acggggccga
cccagtgcga gagcccatgg 1200acctgccaga agctgaacga ctggtactgg
cagtgcctg 1239161413PRTMyceliophthora thermophila 161Met His Ser
Lys Ala Phe Leu Ala Ala Leu Leu Ala Pro Ala Val Ser 1 5 10 15 Gly
Gln Leu Asn Asp Leu Ala Val Arg Ala Gly Leu Lys Tyr Phe Gly 20 25
30 Thr Ala Leu Ser Glu Ser Val Ile Asn Ser Asp Thr Arg Tyr Ala Ala
35 40 45 Ile Leu Ser Asp Lys Ser Met Phe Gly Gln Leu Val Pro Glu
Asn Gly 50 55 60 Met Lys Trp Asp Ala Thr Glu Pro Ser Arg Gly Gln
Phe Asn Tyr Ala 65 70 75 80 Ser Gly Asp Ile Thr Ala Asn Thr Ala Lys
Lys Asn Gly Gln Gly Met 85 90 95 Arg Cys His Thr Met Val Trp Tyr
Ser Gln Leu Pro Ser Trp Val Ser 100 105 110 Ser Gly Ser Trp Thr Arg
Asp Ser Leu Thr Ser Val Ile Glu Thr His 115 120 125 Met Asn Asn Val
Met Gly His Tyr Lys Gly Gln Cys Tyr Ala Trp Asp 130 135 140 Val Ile
Asn Glu Ala Ile Asn Asp Asp Gly Asn Ser Trp Arg Asp Asn 145 150 155
160 Val Phe Leu Arg Thr Phe Gly Thr Asp Tyr Phe Ala Leu Ser Phe Asn
165 170 175 Leu Ala Lys Lys Ala Asp Pro Asp Thr Lys Leu Tyr Tyr Asn
Asp Tyr 180 185 190 Asn Leu Glu Tyr Asn Gln Ala Lys Thr Asp Arg Ala
Val Glu Leu Val 195 200 205 Lys Met Val Gln Ala Ala Gly Ala Pro Ile
Asp Gly Val Gly Phe Gln 210 215 220 Gly His Leu Ile Val Gly Ser Thr
Pro Thr Arg Ser Gln Leu Ala Thr 225 230 235 240 Ala Leu Gln Arg Phe
Thr Ala Leu Gly Leu Glu Val Ala Tyr Thr Glu 245 250 255 Leu Asp Ile
Arg His Ser Ser Leu Pro Ala Ser Ser Ser Ala Leu Ala 260 265 270 Thr
Gln Gly Asn Asp Phe Ala Asn Val Val Gly Ser Cys Leu Asp Thr 275 280
285 Ala Gly Cys Val Gly Val Thr Val Trp Gly Phe Thr Asp Ala His Ser
290 295 300 Trp Ile Pro Asn Thr Phe Pro Gly Gln Gly Asp Ala Leu Ile
Tyr Asp 305 310 315 320 Ser Asn Tyr Asn Lys Lys Pro Ala Trp Thr Ser
Ile Ser Ser Val Leu 325 330 335 Ala Ala Lys Ala Thr Gly Ala Pro Pro
Ala Ser Ser Ser Thr Thr Leu 340 345 350 Val Thr Ile Thr Thr Pro Pro
Pro Ala Ser Thr Thr Ala Ser Ser Ser 355 360 365 Ser Ser Ala Thr Pro
Thr Ser Val Pro Thr Gln Thr Arg Trp Gly Gln 370 375 380 Cys Gly Gly
Ile Gly Trp Thr Gly Pro Thr Gln Cys Glu Ser Pro Trp 385 390 395 400
Thr Cys Gln Lys Leu Asn Asp Trp Tyr Trp Gln Cys Leu 405 410
162396PRTMyceliophthora thermophila 162Gln Leu Asn Asp Leu Ala Val
Arg Ala Gly Leu Lys Tyr Phe Gly Thr 1 5 10 15 Ala Leu Ser Glu Ser
Val Ile Asn Ser Asp Thr Arg Tyr Ala Ala Ile 20 25 30 Leu Ser Asp
Lys Ser Met Phe Gly Gln Leu Val Pro Glu Asn Gly Met 35 40 45 Lys
Trp Asp Ala Thr Glu Pro Ser Arg Gly Gln Phe Asn Tyr Ala Ser 50 55
60 Gly Asp Ile Thr Ala Asn Thr Ala Lys Lys Asn Gly Gln Gly Met Arg
65 70 75 80 Cys His Thr Met Val Trp Tyr Ser Gln Leu Pro Ser Trp Val
Ser Ser 85 90 95 Gly Ser Trp Thr Arg Asp Ser Leu Thr Ser Val Ile
Glu Thr His Met 100 105 110 Asn Asn Val Met Gly His Tyr Lys Gly Gln
Cys Tyr Ala Trp Asp Val 115 120 125 Ile Asn Glu Ala Ile Asn Asp Asp
Gly Asn Ser Trp Arg Asp Asn Val 130 135 140 Phe Leu Arg Thr Phe Gly
Thr Asp Tyr Phe Ala Leu Ser Phe Asn Leu 145 150 155 160 Ala Lys Lys
Ala Asp Pro Asp Thr Lys Leu Tyr Tyr Asn Asp Tyr Asn 165 170 175 Leu
Glu Tyr Asn Gln Ala Lys Thr Asp Arg Ala Val Glu Leu Val Lys 180 185
190 Met Val Gln Ala Ala Gly Ala Pro Ile Asp Gly Val Gly Phe Gln Gly
195 200 205 His Leu Ile Val Gly Ser Thr Pro Thr Arg Ser Gln Leu Ala
Thr Ala 210 215 220 Leu Gln Arg Phe Thr Ala Leu Gly Leu Glu Val Ala
Tyr Thr Glu Leu 225 230 235 240 Asp Ile Arg His Ser Ser Leu Pro Ala
Ser Ser Ser Ala Leu Ala Thr 245 250 255 Gln Gly Asn Asp Phe Ala Asn
Val Val Gly Ser Cys Leu Asp Thr Ala 260 265 270 Gly Cys Val Gly Val
Thr Val Trp Gly Phe Thr Asp Ala His Ser Trp 275 280 285 Ile Pro Asn
Thr Phe Pro Gly Gln Gly Asp Ala Leu Ile Tyr Asp Ser 290 295 300 Asn
Tyr Asn Lys Lys Pro Ala Trp Thr Ser Ile Ser Ser Val Leu Ala 305 310
315 320 Ala Lys Ala Thr Gly Ala Pro Pro Ala Ser Ser Ser Thr Thr Leu
Val 325 330 335 Thr Ile Thr Thr Pro Pro Pro Ala Ser Thr Thr Ala Ser
Ser Ser Ser 340 345 350 Ser Ala Thr Pro Thr Ser Val Pro Thr Gln Thr
Arg Trp Gly Gln Cys 355 360 365 Gly Gly Ile Gly Trp Thr Gly Pro Thr
Gln Cys Glu Ser Pro Trp Thr 370 375 380 Cys Gln Lys Leu Asn Asp Trp
Tyr Trp Gln Cys Leu 385 390 395 163654DNAMyceliophthora thermophila
163atggtctcgt tcactctcct cctcacggtc atcgccgctg cggtgacgac
ggccagccct 60ctcgaggtgg tcaagcgcgg catccagccg ggcacgggca cccacgaggg
gtacttctac 120tcgttctgga ccgacggccg tggctcggtc gacttcaacc
ccgggccccg cggctcgtac 180agcgtcacct ggaacaacgt caacaactgg
gttggcggca agggctggaa cccgggcccg 240ccgcgcaaga ttgcgtacaa
cggcacctgg aacaactaca acgtgaacag ctacctcgcc 300ctgtacggct
ggactcgcaa cccgctggtc gagtattaca tcgtggaggc atacggcacg
360tacaacccct cgtcgggcac ggcgcggctg ggcaccatcg aggacgacgg
cggcgtgtac 420gacatctaca agacgacgcg gtacaaccag ccgtccatcg
aggggacctc caccttcgac 480cagtactggt ccgtccgccg ccagaagcgc
gtcggcggca ctatcgacac gggcaagcac 540tttgacgagt ggaagcgcca
gggcaacctc cagctcggca cctggaacta catgatcatg 600gccaccgagg
gctaccagag ctctggttcg gccactatcg aggtccggga ggcc
654164218PRTMyceliophthora thermophila 164Met Val Ser Phe Thr Leu
Leu Leu Thr Val Ile Ala Ala Ala Val Thr 1 5 10 15 Thr Ala Ser Pro
Leu Glu Val Val Lys Arg Gly Ile Gln Pro Gly Thr 20 25 30 Gly Thr
His Glu Gly Tyr Phe Tyr Ser Phe Trp Thr Asp Gly Arg Gly 35 40 45
Ser Val Asp Phe Asn Pro Gly Pro Arg Gly Ser Tyr Ser Val Thr Trp 50
55 60 Asn Asn Val Asn Asn Trp Val Gly Gly Lys Gly Trp Asn Pro Gly
Pro 65 70 75 80 Pro Arg Lys Ile Ala Tyr Asn Gly Thr Trp Asn Asn Tyr
Asn Val Asn 85 90 95 Ser Tyr Leu Ala Leu Tyr Gly Trp Thr Arg Asn
Pro Leu Val Glu Tyr 100 105 110 Tyr Ile Val Glu Ala Tyr Gly Thr Tyr
Asn Pro Ser Ser Gly Thr Ala 115 120 125 Arg Leu Gly Thr Ile Glu Asp
Asp Gly Gly Val Tyr Asp Ile Tyr Lys 130 135 140 Thr Thr Arg Tyr Asn
Gln Pro Ser Ile Glu Gly Thr Ser Thr Phe Asp 145 150 155 160 Gln Tyr
Trp Ser Val Arg Arg Gln Lys Arg Val Gly Gly Thr Ile Asp 165 170 175
Thr Gly Lys His Phe Asp Glu Trp Lys Arg Gln Gly Asn Leu Gln Leu 180
185 190 Gly Thr Trp Asn Tyr Met Ile Met Ala Thr Glu Gly Tyr Gln Ser
Ser 195 200 205 Gly Ser Ala Thr Ile Glu Val Arg Glu Ala 210 215
165200PRTMyceliophthora thermophila 165Ser Pro Leu Glu Val Val Lys
Arg Gly Ile Gln Pro Gly Thr Gly Thr 1 5 10 15 His Glu Gly Tyr Phe
Tyr Ser Phe Trp Thr Asp Gly Arg Gly Ser Val 20 25 30 Asp Phe Asn
Pro Gly Pro Arg Gly Ser Tyr Ser Val Thr Trp Asn Asn 35 40 45 Val
Asn Asn Trp Val Gly Gly Lys Gly Trp Asn Pro Gly Pro Pro Arg 50 55
60 Lys Ile Ala Tyr Asn Gly Thr Trp Asn Asn Tyr Asn Val Asn Ser Tyr
65 70 75 80 Leu Ala Leu Tyr Gly Trp Thr Arg Asn Pro Leu Val Glu Tyr
Tyr Ile 85 90 95 Val Glu Ala Tyr Gly Thr Tyr Asn Pro Ser Ser Gly
Thr Ala Arg Leu 100 105 110 Gly Thr Ile Glu Asp Asp Gly Gly Val Tyr
Asp Ile Tyr Lys Thr Thr 115 120 125 Arg Tyr Asn Gln Pro Ser Ile Glu
Gly Thr Ser Thr Phe Asp Gln Tyr 130 135 140 Trp Ser Val Arg Arg Gln
Lys Arg Val Gly Gly Thr Ile Asp Thr Gly 145 150 155 160 Lys His Phe
Asp Glu Trp Lys Arg Gln Gly Asn Leu Gln Leu Gly Thr 165 170 175 Trp
Asn Tyr Met Ile Met Ala Thr Glu Gly Tyr Gln Ser Ser Gly Ser 180 185
190 Ala Thr Ile Glu Val Arg Glu Ala 195 200
1661155DNAMyceliophthora thermophila 166atgcgtactc ttacgttcgt
gctggcagcc gccccggtgg ctgtgcttgc ccaatctcct 60ctgtggggcc agtgcggcgg
tcaaggctgg acaggtccca cgacctgcgt ttctggcgca 120gtatgccaat
tcgtcaatga ctggtactcc caatgcgtgc ccggatcgag caaccctcct
180acgggcacca ccagcagcac cactggaagc accccggctc ctactggcgg
cggcggcagc 240ggaaccggcc tccacgacaa attcaaggcc aagggcaagc
tctacttcgg aaccgagatc 300gatcactacc atctcaacaa caatgccttg
accaacattg tcaagaaaga ctttggtcaa 360gtcactcacg agaacagctt
gaagtgggat gctactgagc cgagccgcaa tcaattcaac 420tttgccaacg
ccgacgcggt tgtcaacttt gcccaggcca acggcaagct catccgcggc
480cacaccctcc tctggcactc tcagctgccg cagtgggtgc agaacatcaa
cgaccgcaac 540accttgaccc aggtcatcga gaaccacgtc accacccttg
tcactcgcta caagggcaag 600atcctccact gggacgtcgt taacgagatc
tttgccgagg acggctcgct ccgcgacagc 660gtcttcagcc gcgtcctcgg
cgaggacttt gtcggcatcg ccttccgcgc cgcccgcgcc 720gccgatccca
acgccaagct ctacatcaac gactacaacc tcgacattgc caactacgcc
780aaggtgaccc ggggcatggt cgagaaggtc aacaagtgga tcgcccaggg
catcccgatc 840gacggcatcg gcacccagtg ccacctggcc gggcccggcg
ggtggaacac ggccgccggc 900gtccccgacg ccctcaaggc cctcgccgcg
gccaacgtca aggagatcgc catcaccgag 960ctcgacatcg ccggcgcctc
cgccaacgac tacctcaccg tcatgaacgc ctgcctccag 1020gtctccaagt
gcgtcggcat caccgtctgg ggcgtctctg acaaggacag ctggaggtcg
1080agcagcaacc cgctcctctt cgacagcaac taccagccaa aggcggcata
caatgctctg 1140attaatgcct tgtaa 1155167384PRTMyceliophthora
thermophila 167Met Arg Thr Leu Thr Phe Val Leu Ala Ala Ala Pro Val
Ala Val Leu 1 5 10 15 Ala Gln Ser Pro Leu Trp Gly Gln Cys Gly Gly
Gln Gly Trp Thr Gly 20 25 30 Pro Thr Thr Cys Val Ser Gly Ala Val
Cys Gln Phe Val Asn Asp Trp 35 40 45 Tyr Ser Gln Cys Val Pro Gly
Ser Ser Asn Pro Pro Thr Gly Thr Thr 50 55 60 Ser Ser Thr Thr Gly
Ser Thr Pro Ala Pro Thr Gly Gly Gly Gly Ser 65 70 75 80 Gly Thr Gly
Leu His Asp Lys Phe Lys Ala Lys Gly Lys Leu Tyr Phe 85 90 95 Gly
Thr Glu Ile Asp His Tyr His Leu Asn Asn Asn Ala Leu Thr Asn 100 105
110 Ile Val Lys Lys Asp Phe Gly Gln Val Thr His Glu Asn Ser Leu Lys
115 120 125 Trp Asp Ala Thr Glu Pro Ser Arg Asn Gln Phe Asn Phe Ala
Asn Ala 130 135 140 Asp Ala Val Val Asn Phe Ala Gln Ala Asn Gly Lys
Leu Ile Arg Gly 145 150 155 160 His Thr Leu Leu Trp His Ser Gln Leu
Pro Gln Trp Val Gln Asn Ile 165 170 175 Asn Asp Arg Asn Thr Leu Thr
Gln Val Ile Glu Asn His Val Thr Thr 180 185 190 Leu Val Thr Arg Tyr
Lys Gly Lys Ile Leu His Trp Asp Val Val Asn 195 200 205 Glu Ile Phe
Ala Glu Asp Gly Ser Leu Arg Asp Ser Val Phe Ser Arg 210 215 220 Val
Leu Gly Glu Asp Phe Val Gly Ile Ala Phe Arg Ala Ala Arg Ala 225 230
235 240 Ala Asp Pro Asn Ala Lys Leu Tyr Ile Asn Asp Tyr Asn Leu Asp
Ile 245 250 255 Ala Asn Tyr Ala Lys Val Thr Arg Gly Met Val Glu Lys
Val Asn Lys 260 265 270 Trp Ile Ala Gln Gly Ile Pro Ile Asp Gly Ile
Gly Thr Gln Cys His 275 280 285 Leu Ala Gly Pro Gly Gly Trp Asn Thr
Ala Ala Gly Val Pro Asp Ala 290 295 300 Leu Lys Ala Leu Ala Ala Ala
Asn Val Lys Glu Ile Ala Ile Thr Glu 305 310 315 320 Leu Asp Ile Ala
Gly Ala Ser Ala Asn Asp Tyr Leu Thr Val Met Asn 325 330 335 Ala Cys
Leu Gln Val Ser Lys Cys Val Gly Ile Thr Val Trp Gly Val 340 345 350
Ser Asp Lys Asp Ser Trp Arg Ser Ser Ser Asn Pro Leu Leu Phe Asp 355
360 365 Ser Asn Tyr Gln Pro Lys Ala Ala Tyr Asn Ala Leu Ile Asn Ala
Leu 370 375 380 168367PRTMyceliophthora thermophila 168Gln Ser Pro
Leu Trp Gly Gln Cys Gly Gly Gln Gly Trp Thr Gly Pro 1 5 10 15 Thr
Thr Cys Val Ser Gly Ala Val Cys Gln Phe Val Asn Asp Trp Tyr 20 25
30 Ser Gln Cys Val Pro Gly Ser Ser Asn Pro Pro Thr Gly Thr Thr Ser
35 40 45 Ser Thr Thr Gly Ser Thr Pro Ala Pro Thr Gly Gly Gly Gly
Ser Gly 50 55 60 Thr Gly Leu His Asp Lys Phe Lys Ala Lys Gly Lys
Leu Tyr Phe Gly 65 70
75 80 Thr Glu Ile Asp His Tyr His Leu Asn Asn Asn Ala Leu Thr Asn
Ile 85 90 95 Val Lys Lys Asp Phe Gly Gln Val Thr His Glu Asn Ser
Leu Lys Trp 100 105 110 Asp Ala Thr Glu Pro Ser Arg Asn Gln Phe Asn
Phe Ala Asn Ala Asp 115 120 125 Ala Val Val Asn Phe Ala Gln Ala Asn
Gly Lys Leu Ile Arg Gly His 130 135 140 Thr Leu Leu Trp His Ser Gln
Leu Pro Gln Trp Val Gln Asn Ile Asn 145 150 155 160 Asp Arg Asn Thr
Leu Thr Gln Val Ile Glu Asn His Val Thr Thr Leu 165 170 175 Val Thr
Arg Tyr Lys Gly Lys Ile Leu His Trp Asp Val Val Asn Glu 180 185 190
Ile Phe Ala Glu Asp Gly Ser Leu Arg Asp Ser Val Phe Ser Arg Val 195
200 205 Leu Gly Glu Asp Phe Val Gly Ile Ala Phe Arg Ala Ala Arg Ala
Ala 210 215 220 Asp Pro Asn Ala Lys Leu Tyr Ile Asn Asp Tyr Asn Leu
Asp Ile Ala 225 230 235 240 Asn Tyr Ala Lys Val Thr Arg Gly Met Val
Glu Lys Val Asn Lys Trp 245 250 255 Ile Ala Gln Gly Ile Pro Ile Asp
Gly Ile Gly Thr Gln Cys His Leu 260 265 270 Ala Gly Pro Gly Gly Trp
Asn Thr Ala Ala Gly Val Pro Asp Ala Leu 275 280 285 Lys Ala Leu Ala
Ala Ala Asn Val Lys Glu Ile Ala Ile Thr Glu Leu 290 295 300 Asp Ile
Ala Gly Ala Ser Ala Asn Asp Tyr Leu Thr Val Met Asn Ala 305 310 315
320 Cys Leu Gln Val Ser Lys Cys Val Gly Ile Thr Val Trp Gly Val Ser
325 330 335 Asp Lys Asp Ser Trp Arg Ser Ser Ser Asn Pro Leu Leu Phe
Asp Ser 340 345 350 Asn Tyr Gln Pro Lys Ala Ala Tyr Asn Ala Leu Ile
Asn Ala Leu 355 360 365 169687DNAMyceliophthora thermophila
169atggtctcgc tcaagtccct cctcctcgcc gcggcggcga cgttgacggc
ggtgacggcg 60cgcccgttcg actttgacga cggcaactcg accgaggcgc tggccaagcg
ccaggtcacg 120cccaacgcgc agggctacca ctcgggctac ttctactcgt
ggtggtccga cggcggcggc 180caggccacct tcaccctgct cgagggcagc
cactaccagg tcaactggag gaacacgggc 240aactttgtcg gtggcaaggg
ctggaacccg ggtaccggcc ggaccatcaa ctacggcggc 300tcgttcaacc
cgagcggcaa cggctacctg gccgtctacg gctggacgca caacccgctg
360atcgagtact acgtggtcga gtcgtacggg acctacaacc cgggcagcca
ggcccagtac 420aagggcagct tccagagcga cggcggcacc tacaacatct
acgtctcgac ccgctacaac 480gcgccctcga tcgagggcac ccgcaccttc
cagcagtact ggtccatccg cacctccaag 540cgcgtcggcg gctccgtcac
catgcagaac cacttcaacg cctgggccca gcacggcatg 600cccctcggct
cccacgacta ccagatcgtc gccaccgagg gctaccagag cagcggctcc
660tccgacatct acgtccagac tcactag 687170228PRTMyceliophthora
thermophila 170Met Val Ser Leu Lys Ser Leu Leu Leu Ala Ala Ala Ala
Thr Leu Thr 1 5 10 15 Ala Val Thr Ala Arg Pro Phe Asp Phe Asp Asp
Gly Asn Ser Thr Glu 20 25 30 Ala Leu Ala Lys Arg Gln Val Thr Pro
Asn Ala Gln Gly Tyr His Ser 35 40 45 Gly Tyr Phe Tyr Ser Trp Trp
Ser Asp Gly Gly Gly Gln Ala Thr Phe 50 55 60 Thr Leu Leu Glu Gly
Ser His Tyr Gln Val Asn Trp Arg Asn Thr Gly 65 70 75 80 Asn Phe Val
Gly Gly Lys Gly Trp Asn Pro Gly Thr Gly Arg Thr Ile 85 90 95 Asn
Tyr Gly Gly Ser Phe Asn Pro Ser Gly Asn Gly Tyr Leu Ala Val 100 105
110 Tyr Gly Trp Thr His Asn Pro Leu Ile Glu Tyr Tyr Val Val Glu Ser
115 120 125 Tyr Gly Thr Tyr Asn Pro Gly Ser Gln Ala Gln Tyr Lys Gly
Ser Phe 130 135 140 Gln Ser Asp Gly Gly Thr Tyr Asn Ile Tyr Val Ser
Thr Arg Tyr Asn 145 150 155 160 Ala Pro Ser Ile Glu Gly Thr Arg Thr
Phe Gln Gln Tyr Trp Ser Ile 165 170 175 Arg Thr Ser Lys Arg Val Gly
Gly Ser Val Thr Met Gln Asn His Phe 180 185 190 Asn Ala Trp Ala Gln
His Gly Met Pro Leu Gly Ser His Asp Tyr Gln 195 200 205 Ile Val Ala
Thr Glu Gly Tyr Gln Ser Ser Gly Ser Ser Asp Ile Tyr 210 215 220 Val
Gln Thr His 225 171208PRTMyceliophthora thermophila 171Arg Pro Phe
Asp Phe Asp Asp Gly Asn Ser Thr Glu Ala Leu Ala Lys 1 5 10 15 Arg
Gln Val Thr Pro Asn Ala Gln Gly Tyr His Ser Gly Tyr Phe Tyr 20 25
30 Ser Trp Trp Ser Asp Gly Gly Gly Gln Ala Thr Phe Thr Leu Leu Glu
35 40 45 Gly Ser His Tyr Gln Val Asn Trp Arg Asn Thr Gly Asn Phe
Val Gly 50 55 60 Gly Lys Gly Trp Asn Pro Gly Thr Gly Arg Thr Ile
Asn Tyr Gly Gly 65 70 75 80 Ser Phe Asn Pro Ser Gly Asn Gly Tyr Leu
Ala Val Tyr Gly Trp Thr 85 90 95 His Asn Pro Leu Ile Glu Tyr Tyr
Val Val Glu Ser Tyr Gly Thr Tyr 100 105 110 Asn Pro Gly Ser Gln Ala
Gln Tyr Lys Gly Ser Phe Gln Ser Asp Gly 115 120 125 Gly Thr Tyr Asn
Ile Tyr Val Ser Thr Arg Tyr Asn Ala Pro Ser Ile 130 135 140 Glu Gly
Thr Arg Thr Phe Gln Gln Tyr Trp Ser Ile Arg Thr Ser Lys 145 150 155
160 Arg Val Gly Gly Ser Val Thr Met Gln Asn His Phe Asn Ala Trp Ala
165 170 175 Gln His Gly Met Pro Leu Gly Ser His Asp Tyr Gln Ile Val
Ala Thr 180 185 190 Glu Gly Tyr Gln Ser Ser Gly Ser Ser Asp Ile Tyr
Val Gln Thr His 195 200 205 172681DNAMyceliophthora thermophila
172atggttaccc tcactcgcct ggcggtcgcc gcggcggcca tgatctccag
cactggcctg 60gctgccccga cgcccgaagc tggccccgac cttcccgact ttgagctcgg
ggtcaacaac 120ctcgcccgcc gcgcgctgga ctacaaccag aactacagga
ccagcggcaa cgtcaactac 180tcgcccaccg acaacggcta ctcggtcagc
ttctccaacg cgggagattt tgtcgtcggg 240aagggctgga ggacgggagc
caccagaaac atcaccttct cgggatcgac acagcatacc 300tcgggcaccg
tgctcgtctc cgtctacggc tggacccgga acccgctgat cgagtactac
360gtgcaggagt acacgtccaa cggggccggc tccgctcagg gcgagaagct
gggcacggtc 420gagagcgacg ggggcacgta cgagatctgg cggcaccagc
aggtcaacca gccgtcgatc 480gagggcacct cgaccttctg gcagtacatc
tcgaaccgcg tgtccggcca gcggcccaac 540ggcggcaccg tcaccctcgc
caaccacttc gccgcctggc agaagctcgg cctgaacctg 600ggccagcacg
actaccaggt cctggccacc gagggctggg gcaacgccgg cggcagctcc
660cagtacaccg tcagcggctg a 681173226PRTMyceliophthora thermophila
173Met Val Thr Leu Thr Arg Leu Ala Val Ala Ala Ala Ala Met Ile Ser
1 5 10 15 Ser Thr Gly Leu Ala Ala Pro Thr Pro Glu Ala Gly Pro Asp
Leu Pro 20 25 30 Asp Phe Glu Leu Gly Val Asn Asn Leu Ala Arg Arg
Ala Leu Asp Tyr 35 40 45 Asn Gln Asn Tyr Arg Thr Ser Gly Asn Val
Asn Tyr Ser Pro Thr Asp 50 55 60 Asn Gly Tyr Ser Val Ser Phe Ser
Asn Ala Gly Asp Phe Val Val Gly 65 70 75 80 Lys Gly Trp Arg Thr Gly
Ala Thr Arg Asn Ile Thr Phe Ser Gly Ser 85 90 95 Thr Gln His Thr
Ser Gly Thr Val Leu Val Ser Val Tyr Gly Trp Thr 100 105 110 Arg Asn
Pro Leu Ile Glu Tyr Tyr Val Gln Glu Tyr Thr Ser Asn Gly 115 120 125
Ala Gly Ser Ala Gln Gly Glu Lys Leu Gly Thr Val Glu Ser Asp Gly 130
135 140 Gly Thr Tyr Glu Ile Trp Arg His Gln Gln Val Asn Gln Pro Ser
Ile 145 150 155 160 Glu Gly Thr Ser Thr Phe Trp Gln Tyr Ile Ser Asn
Arg Val Ser Gly 165 170 175 Gln Arg Pro Asn Gly Gly Thr Val Thr Leu
Ala Asn His Phe Ala Ala 180 185 190 Trp Gln Lys Leu Gly Leu Asn Leu
Gly Gln His Asp Tyr Gln Val Leu 195 200 205 Ala Thr Glu Gly Trp Gly
Asn Ala Gly Gly Ser Ser Gln Tyr Thr Val 210 215 220 Ser Gly 225
174205PRTMyceliophthora thermophila 174Ala Pro Thr Pro Glu Ala Gly
Pro Asp Leu Pro Asp Phe Glu Leu Gly 1 5 10 15 Val Asn Asn Leu Ala
Arg Arg Ala Leu Asp Tyr Asn Gln Asn Tyr Arg 20 25 30 Thr Ser Gly
Asn Val Asn Tyr Ser Pro Thr Asp Asn Gly Tyr Ser Val 35 40 45 Ser
Phe Ser Asn Ala Gly Asp Phe Val Val Gly Lys Gly Trp Arg Thr 50 55
60 Gly Ala Thr Arg Asn Ile Thr Phe Ser Gly Ser Thr Gln His Thr Ser
65 70 75 80 Gly Thr Val Leu Val Ser Val Tyr Gly Trp Thr Arg Asn Pro
Leu Ile 85 90 95 Glu Tyr Tyr Val Gln Glu Tyr Thr Ser Asn Gly Ala
Gly Ser Ala Gln 100 105 110 Gly Glu Lys Leu Gly Thr Val Glu Ser Asp
Gly Gly Thr Tyr Glu Ile 115 120 125 Trp Arg His Gln Gln Val Asn Gln
Pro Ser Ile Glu Gly Thr Ser Thr 130 135 140 Phe Trp Gln Tyr Ile Ser
Asn Arg Val Ser Gly Gln Arg Pro Asn Gly 145 150 155 160 Gly Thr Val
Thr Leu Ala Asn His Phe Ala Ala Trp Gln Lys Leu Gly 165 170 175 Leu
Asn Leu Gly Gln His Asp Tyr Gln Val Leu Ala Thr Glu Gly Trp 180 185
190 Gly Asn Ala Gly Gly Ser Ser Gln Tyr Thr Val Ser Gly 195 200 205
1751833DNAMyceliophthora thermophila 175atgttcttcg cttctctgct
gctcggtctc ctggcgggcg tgtccgcttc accgggacac 60gggcggaatt ccaccttcta
caaccccatc ttccccggct tctaccccga tccgagctgc 120atctacgtgc
ccgagcgtga ccacaccttc ttctgtgcct cgtcgagctt caacgccttc
180ccgggcatcc cgattcatgc cagcaaggac ctgcagaact ggaagttgat
cggccatgtg 240ctgaatcgca aggaacagct tccccggctc gctgagacca
accggtcgac cagcggcatc 300tgggcaccca ccctccggtt ccatgacgac
accttctggt tggtcaccac actagtggac 360gacgaccggc cgcaggagga
cgcttccaga tgggacaata ttatcttcaa ggcaaagaat 420ccgtatgatc
cgaggtcctg gtccaaggcc gtccacttca acttcactgg ctacgacacg
480gagcctttct gggacgaaga tggaaaggtg tacatcaccg gcgcccatgc
ttggcatgtt 540ggcccataca tccagcaggc cgaagtcgat ctcgacacgg
gggccgtcgg cgagtggcgc 600atcatctgga acggaacggg cggcatggct
cctgaagggc cgcacatcta ccgcaaagat 660gggtggtact acttgctggc
tgctgaaggg gggaccggca tcgaccatat ggtgaccatg 720gcccggtcga
gaaaaatctc cagtccttac gagtccaacc caaacaaccc cgtgttgacc
780aacgccaaca cgaccagtta ctttcaaacc gtcgggcatt cagacctgtt
ccatgacaga 840catgggaact ggtgggcagt cgccctctcc acccgctccg
gtccagaata tcttcactac 900cccatgggcc gcgagaccgt catgacagcc
gtgagctggc cgaaggacga gtggccaacc 960ttcaccccca tatctggcaa
gatgagcggc tggccgatgc ctccttcgca gaaggacatt 1020cgcggagtcg
gcccctacgt caactccccc gacccggaac acctgacctt cccccgctcg
1080gcgcccctgc cggcccacct cacctactgg cgatacccga acccgtcctc
ctacacgccg 1140tccccgcccg ggcaccccaa caccctccgc ctgaccccgt
cccgcctgaa cctgaccgcc 1200ctcaacggca actacgcggg ggccgaccag
accttcgtct cgcgccggca gcagcacacc 1260ctcttcacct acagcgtcac
gctcgactac gcgccgcgga ccgccgggga ggaggccggc 1320gtgaccgcct
tcctgacgca gaaccaccac ctcgacctgg gcgtcgtcct gctccctcgc
1380ggctccgcca ccgcgccctc gctgccgggc ctgagtagta gtacaactac
tactagtagt 1440agtagtagtc gtccggacga ggaggaggag cgcgaggcgg
gcgaagagga agaagagggc 1500ggacaagact tgatgatccc gcatgtgcgg
ttcaggggcg agtcgtacgt gcccgtcccg 1560gcgcccgtcg tgtacccgat
accccgggcc tggagaggcg ggaagcttgt gttagagatc 1620cgggcttgta
attcgactca cttctcgttc cgtgtcgggc cggacgggag acggtctgag
1680cggacggtgg tcatggaggc ttcgaacgag gccgttagct ggggctttac
tggaacgctg 1740ctgggcatct atgcgaccag taatggtggc aacggaacca
cgccggcgta tttttcggat 1800tggaggtaca caccattgga gcagtttagg gat
1833176611PRTMyceliophthora thermophila 176Met Phe Phe Ala Ser Leu
Leu Leu Gly Leu Leu Ala Gly Val Ser Ala 1 5 10 15 Ser Pro Gly His
Gly Arg Asn Ser Thr Phe Tyr Asn Pro Ile Phe Pro 20 25 30 Gly Phe
Tyr Pro Asp Pro Ser Cys Ile Tyr Val Pro Glu Arg Asp His 35 40 45
Thr Phe Phe Cys Ala Ser Ser Ser Phe Asn Ala Phe Pro Gly Ile Pro 50
55 60 Ile His Ala Ser Lys Asp Leu Gln Asn Trp Lys Leu Ile Gly His
Val 65 70 75 80 Leu Asn Arg Lys Glu Gln Leu Pro Arg Leu Ala Glu Thr
Asn Arg Ser 85 90 95 Thr Ser Gly Ile Trp Ala Pro Thr Leu Arg Phe
His Asp Asp Thr Phe 100 105 110 Trp Leu Val Thr Thr Leu Val Asp Asp
Asp Arg Pro Gln Glu Asp Ala 115 120 125 Ser Arg Trp Asp Asn Ile Ile
Phe Lys Ala Lys Asn Pro Tyr Asp Pro 130 135 140 Arg Ser Trp Ser Lys
Ala Val His Phe Asn Phe Thr Gly Tyr Asp Thr 145 150 155 160 Glu Pro
Phe Trp Asp Glu Asp Gly Lys Val Tyr Ile Thr Gly Ala His 165 170 175
Ala Trp His Val Gly Pro Tyr Ile Gln Gln Ala Glu Val Asp Leu Asp 180
185 190 Thr Gly Ala Val Gly Glu Trp Arg Ile Ile Trp Asn Gly Thr Gly
Gly 195 200 205 Met Ala Pro Glu Gly Pro His Ile Tyr Arg Lys Asp Gly
Trp Tyr Tyr 210 215 220 Leu Leu Ala Ala Glu Gly Gly Thr Gly Ile Asp
His Met Val Thr Met 225 230 235 240 Ala Arg Ser Arg Lys Ile Ser Ser
Pro Tyr Glu Ser Asn Pro Asn Asn 245 250 255 Pro Val Leu Thr Asn Ala
Asn Thr Thr Ser Tyr Phe Gln Thr Val Gly 260 265 270 His Ser Asp Leu
Phe His Asp Arg His Gly Asn Trp Trp Ala Val Ala 275 280 285 Leu Ser
Thr Arg Ser Gly Pro Glu Tyr Leu His Tyr Pro Met Gly Arg 290 295 300
Glu Thr Val Met Thr Ala Val Ser Trp Pro Lys Asp Glu Trp Pro Thr 305
310 315 320 Phe Thr Pro Ile Ser Gly Lys Met Ser Gly Trp Pro Met Pro
Pro Ser 325 330 335 Gln Lys Asp Ile Arg Gly Val Gly Pro Tyr Val Asn
Ser Pro Asp Pro 340 345 350 Glu His Leu Thr Phe Pro Arg Ser Ala Pro
Leu Pro Ala His Leu Thr 355 360 365 Tyr Trp Arg Tyr Pro Asn Pro Ser
Ser Tyr Thr Pro Ser Pro Pro Gly 370 375 380 His Pro Asn Thr Leu Arg
Leu Thr Pro Ser Arg Leu Asn Leu Thr Ala 385 390 395 400 Leu Asn Gly
Asn Tyr Ala Gly Ala Asp Gln Thr Phe Val Ser Arg Arg 405 410 415 Gln
Gln His Thr Leu Phe Thr Tyr Ser Val Thr Leu Asp Tyr Ala Pro 420 425
430 Arg Thr Ala Gly Glu Glu Ala Gly Val Thr Ala Phe Leu Thr Gln Asn
435 440 445 His His Leu Asp Leu Gly Val Val Leu Leu Pro Arg Gly Ser
Ala Thr 450 455 460 Ala Pro Ser Leu Pro Gly Leu Ser Ser Ser Thr Thr
Thr Thr Ser Ser 465 470 475 480 Ser Ser Ser Arg Pro Asp Glu Glu Glu
Glu Arg Glu Ala Gly Glu Glu 485 490 495 Glu Glu Glu Gly Gly Gln Asp
Leu Met Ile Pro His Val Arg Phe Arg 500 505 510 Gly Glu Ser Tyr Val
Pro Val Pro Ala Pro Val Val Tyr Pro Ile Pro 515 520 525 Arg Ala Trp
Arg Gly Gly Lys Leu Val Leu Glu Ile Arg Ala Cys Asn 530 535 540 Ser
Thr His Phe Ser Phe Arg Val Gly Pro Asp Gly Arg Arg Ser Glu 545 550
555 560 Arg Thr Val Val Met Glu Ala Ser Asn Glu Ala Val Ser Trp Gly
Phe 565 570 575 Thr Gly Thr Leu Leu Gly Ile Tyr Ala Thr Ser Asn Gly
Gly Asn Gly 580 585 590 Thr Thr Pro Ala Tyr Phe Ser Asp Trp Arg Tyr
Thr Pro Leu Glu Gln 595 600
605 Phe Arg Asp 610 177595PRTMyceliophthora thermophila 177Ser Pro
Gly His Gly Arg Asn Ser Thr Phe Tyr Asn Pro Ile Phe Pro 1 5 10 15
Gly Phe Tyr Pro Asp Pro Ser Cys Ile Tyr Val Pro Glu Arg Asp His 20
25 30 Thr Phe Phe Cys Ala Ser Ser Ser Phe Asn Ala Phe Pro Gly Ile
Pro 35 40 45 Ile His Ala Ser Lys Asp Leu Gln Asn Trp Lys Leu Ile
Gly His Val 50 55 60 Leu Asn Arg Lys Glu Gln Leu Pro Arg Leu Ala
Glu Thr Asn Arg Ser 65 70 75 80 Thr Ser Gly Ile Trp Ala Pro Thr Leu
Arg Phe His Asp Asp Thr Phe 85 90 95 Trp Leu Val Thr Thr Leu Val
Asp Asp Asp Arg Pro Gln Glu Asp Ala 100 105 110 Ser Arg Trp Asp Asn
Ile Ile Phe Lys Ala Lys Asn Pro Tyr Asp Pro 115 120 125 Arg Ser Trp
Ser Lys Ala Val His Phe Asn Phe Thr Gly Tyr Asp Thr 130 135 140 Glu
Pro Phe Trp Asp Glu Asp Gly Lys Val Tyr Ile Thr Gly Ala His 145 150
155 160 Ala Trp His Val Gly Pro Tyr Ile Gln Gln Ala Glu Val Asp Leu
Asp 165 170 175 Thr Gly Ala Val Gly Glu Trp Arg Ile Ile Trp Asn Gly
Thr Gly Gly 180 185 190 Met Ala Pro Glu Gly Pro His Ile Tyr Arg Lys
Asp Gly Trp Tyr Tyr 195 200 205 Leu Leu Ala Ala Glu Gly Gly Thr Gly
Ile Asp His Met Val Thr Met 210 215 220 Ala Arg Ser Arg Lys Ile Ser
Ser Pro Tyr Glu Ser Asn Pro Asn Asn 225 230 235 240 Pro Val Leu Thr
Asn Ala Asn Thr Thr Ser Tyr Phe Gln Thr Val Gly 245 250 255 His Ser
Asp Leu Phe His Asp Arg His Gly Asn Trp Trp Ala Val Ala 260 265 270
Leu Ser Thr Arg Ser Gly Pro Glu Tyr Leu His Tyr Pro Met Gly Arg 275
280 285 Glu Thr Val Met Thr Ala Val Ser Trp Pro Lys Asp Glu Trp Pro
Thr 290 295 300 Phe Thr Pro Ile Ser Gly Lys Met Ser Gly Trp Pro Met
Pro Pro Ser 305 310 315 320 Gln Lys Asp Ile Arg Gly Val Gly Pro Tyr
Val Asn Ser Pro Asp Pro 325 330 335 Glu His Leu Thr Phe Pro Arg Ser
Ala Pro Leu Pro Ala His Leu Thr 340 345 350 Tyr Trp Arg Tyr Pro Asn
Pro Ser Ser Tyr Thr Pro Ser Pro Pro Gly 355 360 365 His Pro Asn Thr
Leu Arg Leu Thr Pro Ser Arg Leu Asn Leu Thr Ala 370 375 380 Leu Asn
Gly Asn Tyr Ala Gly Ala Asp Gln Thr Phe Val Ser Arg Arg 385 390 395
400 Gln Gln His Thr Leu Phe Thr Tyr Ser Val Thr Leu Asp Tyr Ala Pro
405 410 415 Arg Thr Ala Gly Glu Glu Ala Gly Val Thr Ala Phe Leu Thr
Gln Asn 420 425 430 His His Leu Asp Leu Gly Val Val Leu Leu Pro Arg
Gly Ser Ala Thr 435 440 445 Ala Pro Ser Leu Pro Gly Leu Ser Ser Ser
Thr Thr Thr Thr Ser Ser 450 455 460 Ser Ser Ser Arg Pro Asp Glu Glu
Glu Glu Arg Glu Ala Gly Glu Glu 465 470 475 480 Glu Glu Glu Gly Gly
Gln Asp Leu Met Ile Pro His Val Arg Phe Arg 485 490 495 Gly Glu Ser
Tyr Val Pro Val Pro Ala Pro Val Val Tyr Pro Ile Pro 500 505 510 Arg
Ala Trp Arg Gly Gly Lys Leu Val Leu Glu Ile Arg Ala Cys Asn 515 520
525 Ser Thr His Phe Ser Phe Arg Val Gly Pro Asp Gly Arg Arg Ser Glu
530 535 540 Arg Thr Val Val Met Glu Ala Ser Asn Glu Ala Val Ser Trp
Gly Phe 545 550 555 560 Thr Gly Thr Leu Leu Gly Ile Tyr Ala Thr Ser
Asn Gly Gly Asn Gly 565 570 575 Thr Thr Pro Ala Tyr Phe Ser Asp Trp
Arg Tyr Thr Pro Leu Glu Gln 580 585 590 Phe Arg Asp 595
178942DNAMyceliophthora thermophila 178atgaagctcc tgggcaaact
ctcggcggca ctcgccctcg cgggcagcag gctggctgcc 60gcgcacccgg tcttcgacga
gctgatgcgg ccgacggcgc cgctggtgcg cccgcgggcg 120gccctgcagc
aggtgaccaa ctttggcagc aacccgtcca acacgaagat gttcatctac
180gtgcccgaca agctggcccc caacccgccc atcatagtgg ccatccacta
ctgcaccggc 240accgcccagg cctactactc gggctcccct tacgcccgcc
tcgccgacca gaagggcttc 300atcgtcatct acccggagtc cccctacagc
ggcacctgtt gggacgtctc gtcgcgcgcc 360gccctgaccc acaacggcgg
cggcgacagc aactcgatcg ccaacatggt cacctacacc 420ctcgaaaagt
acaatggcga cgccagcaag gtctttgtca ccggctcctc gtccggcgcc
480atgatgacga acgtgatggc cgccgcgtac ccggaactgt tcgcggcagg
aatcgcctac 540tcgggcgtgc ccgccggctg cttctacagc cagtccggag
gcaccaacgc gtggaacagc 600tcgtgcgcca acgggcagat caactcgacg
ccccaggtgt gggccaagat ggtcttcgac 660atgtacccgg aatacgacgg
cccgcgcccc aagatgcaga tctaccacgg ctcggccgac 720ggcacgctca
gacccagcaa ctacaacgag accatcaagc agtggtgcgg cgtcttcggc
780ttcgactaca cccgccccga caccacccag gccaactccc cgcaggccgg
ctacaccacc 840tacacctggg gcgagcagca gctcgtcggc atctacgccc
agggcgtcgg acacacggtc 900cccatccgcg gcagcgacga catggccttc
tttggcctgt ga 942179313PRTMyceliophthora thermophila 179Met Lys Leu
Leu Gly Lys Leu Ser Ala Ala Leu Ala Leu Ala Gly Ser 1 5 10 15 Arg
Leu Ala Ala Ala His Pro Val Phe Asp Glu Leu Met Arg Pro Thr 20 25
30 Ala Pro Leu Val Arg Pro Arg Ala Ala Leu Gln Gln Val Thr Asn Phe
35 40 45 Gly Ser Asn Pro Ser Asn Thr Lys Met Phe Ile Tyr Val Pro
Asp Lys 50 55 60 Leu Ala Pro Asn Pro Pro Ile Ile Val Ala Ile His
Tyr Cys Thr Gly 65 70 75 80 Thr Ala Gln Ala Tyr Tyr Ser Gly Ser Pro
Tyr Ala Arg Leu Ala Asp 85 90 95 Gln Lys Gly Phe Ile Val Ile Tyr
Pro Glu Ser Pro Tyr Ser Gly Thr 100 105 110 Cys Trp Asp Val Ser Ser
Arg Ala Ala Leu Thr His Asn Gly Gly Gly 115 120 125 Asp Ser Asn Ser
Ile Ala Asn Met Val Thr Tyr Thr Leu Glu Lys Tyr 130 135 140 Asn Gly
Asp Ala Ser Lys Val Phe Val Thr Gly Ser Ser Ser Gly Ala 145 150 155
160 Met Met Thr Asn Val Met Ala Ala Ala Tyr Pro Glu Leu Phe Ala Ala
165 170 175 Gly Ile Ala Tyr Ser Gly Val Pro Ala Gly Cys Phe Tyr Ser
Gln Ser 180 185 190 Gly Gly Thr Asn Ala Trp Asn Ser Ser Cys Ala Asn
Gly Gln Ile Asn 195 200 205 Ser Thr Pro Gln Val Trp Ala Lys Met Val
Phe Asp Met Tyr Pro Glu 210 215 220 Tyr Asp Gly Pro Arg Pro Lys Met
Gln Ile Tyr His Gly Ser Ala Asp 225 230 235 240 Gly Thr Leu Arg Pro
Ser Asn Tyr Asn Glu Thr Ile Lys Gln Trp Cys 245 250 255 Gly Val Phe
Gly Phe Asp Tyr Thr Arg Pro Asp Thr Thr Gln Ala Asn 260 265 270 Ser
Pro Gln Ala Gly Tyr Thr Thr Tyr Thr Trp Gly Glu Gln Gln Leu 275 280
285 Val Gly Ile Tyr Ala Gln Gly Val Gly His Thr Val Pro Ile Arg Gly
290 295 300 Ser Asp Asp Met Ala Phe Phe Gly Leu 305 310
180292PRTMyceliophthora thermophila 180His Pro Val Phe Asp Glu Leu
Met Arg Pro Thr Ala Pro Leu Val Arg 1 5 10 15 Pro Arg Ala Ala Leu
Gln Gln Val Thr Asn Phe Gly Ser Asn Pro Ser 20 25 30 Asn Thr Lys
Met Phe Ile Tyr Val Pro Asp Lys Leu Ala Pro Asn Pro 35 40 45 Pro
Ile Ile Val Ala Ile His Tyr Cys Thr Gly Thr Ala Gln Ala Tyr 50 55
60 Tyr Ser Gly Ser Pro Tyr Ala Arg Leu Ala Asp Gln Lys Gly Phe Ile
65 70 75 80 Val Ile Tyr Pro Glu Ser Pro Tyr Ser Gly Thr Cys Trp Asp
Val Ser 85 90 95 Ser Arg Ala Ala Leu Thr His Asn Gly Gly Gly Asp
Ser Asn Ser Ile 100 105 110 Ala Asn Met Val Thr Tyr Thr Leu Glu Lys
Tyr Asn Gly Asp Ala Ser 115 120 125 Lys Val Phe Val Thr Gly Ser Ser
Ser Gly Ala Met Met Thr Asn Val 130 135 140 Met Ala Ala Ala Tyr Pro
Glu Leu Phe Ala Ala Gly Ile Ala Tyr Ser 145 150 155 160 Gly Val Pro
Ala Gly Cys Phe Tyr Ser Gln Ser Gly Gly Thr Asn Ala 165 170 175 Trp
Asn Ser Ser Cys Ala Asn Gly Gln Ile Asn Ser Thr Pro Gln Val 180 185
190 Trp Ala Lys Met Val Phe Asp Met Tyr Pro Glu Tyr Asp Gly Pro Arg
195 200 205 Pro Lys Met Gln Ile Tyr His Gly Ser Ala Asp Gly Thr Leu
Arg Pro 210 215 220 Ser Asn Tyr Asn Glu Thr Ile Lys Gln Trp Cys Gly
Val Phe Gly Phe 225 230 235 240 Asp Tyr Thr Arg Pro Asp Thr Thr Gln
Ala Asn Ser Pro Gln Ala Gly 245 250 255 Tyr Thr Thr Tyr Thr Trp Gly
Glu Gln Gln Leu Val Gly Ile Tyr Ala 260 265 270 Gln Gly Val Gly His
Thr Val Pro Ile Arg Gly Ser Asp Asp Met Ala 275 280 285 Phe Phe Gly
Leu 290 181840DNAMyceliophthora thermophila 181atgatctcgg
ttcctgctct cgctctggcc cttctggccg ccgtccaggt cgtcgagtct 60gcctcggctg
gctgtggcaa ggcgccccct tcctcgggca ccaagtcgat gacggtcaac
120ggcaagcagc gccagtacat tctccagctg cccaacaact acgacgccaa
caaggcccac 180agggtggtga tcgggtacca ctggcgcgac ggatccatga
acgacgtggc caacggcggc 240ttctacgatc tgcggtcccg ggcgggcgac
agcaccatct tcgttgcccc caacggcctc 300aatgccggat gggccaacgt
gggcggcgag gacatcacct ttacggacca gatcgtagac 360atgctcaaga
acgacctctg cgtggacgag acccagttct ttgctacggg ctggagctat
420ggcggtgcca tgagccatag cgtggcttgt tctcggccag acgtcttcaa
ggccgtcgcg 480gtcatcgccg gggcccagct gtccggctgc gccggcggca
cgacgcccgt ggcgtaccta 540ggcatccacg gagccgccga caacgtcctg
cccatcgacc tcggccgcca gctgcgcgac 600aagtggctgc agaccaacgg
ctgcaactac cagggcgccc aggaccccgc gccgggccag 660caggcccaca
tcaagaccac ctacagctgc tcccgcgcgc ccgtcacctg gatcggccac
720gggggcggcc acgtccccga ccccacgggc aacaacggcg tcaagtttgc
gccccaggag 780acctgggact tctttgatgc cgccgtcgga gcggccggcg
cgcagagccc gatgacataa 840182279PRTMyceliophthora thermophila 182Met
Ile Ser Val Pro Ala Leu Ala Leu Ala Leu Leu Ala Ala Val Gln 1 5 10
15 Val Val Glu Ser Ala Ser Ala Gly Cys Gly Lys Ala Pro Pro Ser Ser
20 25 30 Gly Thr Lys Ser Met Thr Val Asn Gly Lys Gln Arg Gln Tyr
Ile Leu 35 40 45 Gln Leu Pro Asn Asn Tyr Asp Ala Asn Lys Ala His
Arg Val Val Ile 50 55 60 Gly Tyr His Trp Arg Asp Gly Ser Met Asn
Asp Val Ala Asn Gly Gly 65 70 75 80 Phe Tyr Asp Leu Arg Ser Arg Ala
Gly Asp Ser Thr Ile Phe Val Ala 85 90 95 Pro Asn Gly Leu Asn Ala
Gly Trp Ala Asn Val Gly Gly Glu Asp Ile 100 105 110 Thr Phe Thr Asp
Gln Ile Val Asp Met Leu Lys Asn Asp Leu Cys Val 115 120 125 Asp Glu
Thr Gln Phe Phe Ala Thr Gly Trp Ser Tyr Gly Gly Ala Met 130 135 140
Ser His Ser Val Ala Cys Ser Arg Pro Asp Val Phe Lys Ala Val Ala 145
150 155 160 Val Ile Ala Gly Ala Gln Leu Ser Gly Cys Ala Gly Gly Thr
Thr Pro 165 170 175 Val Ala Tyr Leu Gly Ile His Gly Ala Ala Asp Asn
Val Leu Pro Ile 180 185 190 Asp Leu Gly Arg Gln Leu Arg Asp Lys Trp
Leu Gln Thr Asn Gly Cys 195 200 205 Asn Tyr Gln Gly Ala Gln Asp Pro
Ala Pro Gly Gln Gln Ala His Ile 210 215 220 Lys Thr Thr Tyr Ser Cys
Ser Arg Ala Pro Val Thr Trp Ile Gly His 225 230 235 240 Gly Gly Gly
His Val Pro Asp Pro Thr Gly Asn Asn Gly Val Lys Phe 245 250 255 Ala
Pro Gln Glu Thr Trp Asp Phe Phe Asp Ala Ala Val Gly Ala Ala 260 265
270 Gly Ala Gln Ser Pro Met Thr 275 183259PRTMyceliophthora
thermophila 183Ala Ser Ala Gly Cys Gly Lys Ala Pro Pro Ser Ser Gly
Thr Lys Ser 1 5 10 15 Met Thr Val Asn Gly Lys Gln Arg Gln Tyr Ile
Leu Gln Leu Pro Asn 20 25 30 Asn Tyr Asp Ala Asn Lys Ala His Arg
Val Val Ile Gly Tyr His Trp 35 40 45 Arg Asp Gly Ser Met Asn Asp
Val Ala Asn Gly Gly Phe Tyr Asp Leu 50 55 60 Arg Ser Arg Ala Gly
Asp Ser Thr Ile Phe Val Ala Pro Asn Gly Leu 65 70 75 80 Asn Ala Gly
Trp Ala Asn Val Gly Gly Glu Asp Ile Thr Phe Thr Asp 85 90 95 Gln
Ile Val Asp Met Leu Lys Asn Asp Leu Cys Val Asp Glu Thr Gln 100 105
110 Phe Phe Ala Thr Gly Trp Ser Tyr Gly Gly Ala Met Ser His Ser Val
115 120 125 Ala Cys Ser Arg Pro Asp Val Phe Lys Ala Val Ala Val Ile
Ala Gly 130 135 140 Ala Gln Leu Ser Gly Cys Ala Gly Gly Thr Thr Pro
Val Ala Tyr Leu 145 150 155 160 Gly Ile His Gly Ala Ala Asp Asn Val
Leu Pro Ile Asp Leu Gly Arg 165 170 175 Gln Leu Arg Asp Lys Trp Leu
Gln Thr Asn Gly Cys Asn Tyr Gln Gly 180 185 190 Ala Gln Asp Pro Ala
Pro Gly Gln Gln Ala His Ile Lys Thr Thr Tyr 195 200 205 Ser Cys Ser
Arg Ala Pro Val Thr Trp Ile Gly His Gly Gly Gly His 210 215 220 Val
Pro Asp Pro Thr Gly Asn Asn Gly Val Lys Phe Ala Pro Gln Glu 225 230
235 240 Thr Trp Asp Phe Phe Asp Ala Ala Val Gly Ala Ala Gly Ala Gln
Ser 245 250 255 Pro Met Thr 18439DNAArtificial SequenceSynthetic
polynucleotide primer cdxp001 184accgcggtgg cggccaggtt cgttcgtcgt
ctcatgtgt 3918539DNAArtificial SequenceSynthetic polynucleotide
primer cdxp002 185caatagacat cagcatccgg ccaacgaaga aggaaagta
3918624DNAArtificial SequenceSynthetic polynucleotide primer
cdxp003 186aagagtgcaa gagtgaaggc aggc 2418751DNAArtificial
SequenceSynthetic polynucleotide primer cdxp004 187ctagcacagt
cagacctcca cataccatcg tactcgcaac tgacgctcgt t 5118851DNAArtificial
SequenceSynthetic polynucleotide primer cdxp005 188gcagtcgcag
catttacatc aggctggtat gtggaggtct gactgtgcta g 5118924DNAArtificial
SequenceSynthetic polynucleotide primer cdxp006 189gcccgctgtc
attcaagaca ttgc 2419040DNAArtificial SequenceSynthetic
polynucleotide primer cdxp007 190gccaagcttg catgccatca ctgttgatga
cgctctcgct 4019124DNAArtificial SequenceSynthetic polynucleotide
primer cdxp008 191tgttggcgac ctcgtattgg gaat 2419224DNAArtificial
SequenceSynthetic polynucleotide primer cdxp009 192tctcggaggg
cgaagaatct cgtg 2419340DNAArtificial SequenceSynthetic
polynucleotide primer cdxp010 193aattcgagct cggtacttgt gcatttacgg
tgctgtgacg 4019449DNAArtificial SequenceSynthetic polynucleotide
primer cdx111006 194ccgtctctcc gcatgccaga aagattcctt cccttgctcc
ttcacactg 4919525DNAArtificial SequenceSynthetic polynucleotide
primer cdx111007 195cccctcccct acctatcttg tgtct
2519624DNAArtificial SequenceSynthetic polynucleotide primer
cdx111008 196ggataagagt gaacaacgac gagc 2419748DNAArtificial
SequenceSynthetic polynucleotide
primer cdx111009 197gtaacaccca atacgccggc cgaacaaaag ccattcttcc
tccgagac 4819824DNAArtificial SequenceSynthetic polynucleotide
primer cdx10177 198tgttggcgac ctcgtattgg gaat 2419924DNAArtificial
SequenceSynthetic polynucleotide primer cdx10176 199tctttctggc
atgcggagag acgg 2420024DNAArtificial SequenceSynthetic
polynucleotide primer cdx10178 200tctcggaggg cgaagaatct cgtg
2420124DNAArtificial SequenceSynthetic polynucleotide primer
cdx10179 201ttcggccggc gtattgggtg ttac 24
* * * * *