U.S. patent application number 13/489205 was filed with the patent office on 2013-01-03 for synthetic biology tools.
This patent application is currently assigned to The Regents of the University of California. Invention is credited to Chunbo Lou, Tae Seok Moon, Virgil Rhodius, Brynne Stanton, Alvin Tamsir, Karsten Temme, Chirs Voigt.
Application Number | 20130005590 13/489205 |
Document ID | / |
Family ID | 47296395 |
Filed Date | 2013-01-03 |
United States Patent
Application |
20130005590 |
Kind Code |
A1 |
Lou; Chunbo ; et
al. |
January 3, 2013 |
SYNTHETIC BIOLOGY TOOLS
Abstract
Methods for design of genetic circuits are provided.
Inventors: |
Lou; Chunbo; (San Francisco,
CA) ; Moon; Tae Seok; (San Francisco, CA) ;
Rhodius; Virgil; (El Sobrante, CA) ; Stanton;
Brynne; (San Francisco, CA) ; Tamsir; Alvin;
(San Francisco, CA) ; Temme; Karsten; (San
Francisco, CA) ; Voigt; Chirs; (San Francisco,
CA) |
Assignee: |
The Regents of the University of
California
Oakland
CA
|
Family ID: |
47296395 |
Appl. No.: |
13/489205 |
Filed: |
June 5, 2012 |
Related U.S. Patent Documents
|
|
|
|
|
|
Application
Number |
Filing Date |
Patent Number |
|
|
61493733 |
Jun 6, 2011 |
|
|
|
Current U.S.
Class: |
506/8 ;
435/252.33; 435/254.2; 435/325; 435/348; 435/349; 435/419;
506/23 |
Current CPC
Class: |
C12N 15/79 20130101;
G16B 30/00 20190201; C12N 15/70 20130101; G16B 20/00 20190201; C12N
15/635 20130101; G16B 35/00 20190201; C12N 15/63 20130101; G16C
20/60 20190201 |
Class at
Publication: |
506/8 ; 506/23;
435/252.33; 435/254.2; 435/325; 435/349; 435/419; 435/348 |
International
Class: |
C40B 30/02 20060101
C40B030/02; C12N 5/10 20060101 C12N005/10; C12N 1/19 20060101
C12N001/19; C40B 50/00 20060101 C40B050/00; C12N 1/21 20060101
C12N001/21 |
Goverment Interests
STATEMENT AS TO RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED
RESEARCH AND DEVELOPMENT
[0002] This invention was made with government support under grant
no. EEC-0540879 awarded by the National Science Foundation. The
government has certain rights in the invention.
Claims
1. A method of designing a genetic circuit containing one or more
orthogonal sequence-specific DNA binding polypeptides, the method
comprising providing a set of sequence-specific DNA binding
polypeptides; optimising expression of the polypeptides in a
heterologous host cell; identifying target DNA sequences to which
the polypeptides bind; generating synthetic transcriptional
regulatory elements comprising at least one identified target DNA
sequence, wherein the regulatory elements are responsive to a
sequence-specific DNA binding polypeptide from the set of
sequence-specific DNA binding polypeptides; designing cognate
sequence-specific DNA binding polypeptide-target DNA sequence pairs
to generate a set of orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence pairs; designing a genetic circuit
containing one or more orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence pairs from the set of orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
pairs, thereby designing a genetic circuit containing one or more
orthogonal sequence-specific DNA binding polypeptides.
2. The method of claim 1, wherein the sequence-specific DNA binding
polypeptides are selected from the group consisting of
transcription factors, transcriptional activators, RNA polymerases,
and transcriptional repressors.
3. The method of claim 2, wherein transcriptional repressors are
substantially identical to the Tetracycline repressor
(Tet.sup.R).
4. The method of claim 1, wherein the host cell is a prokaryotic
cell.
5. The method of claim 1, wherein the host cell is a eukaryotic
cell.
6. The method of claim 1, further comprising testing the circuit
for unintended interactions within the circuit and/or between the
circuit and the host cell genome.
7. The method of claim 1, wherein the providing comprises
algorithm-guided identification of sequence-specific DNA binding
polypeptides from one or more sequence database.
8. The method of claim 7, wherein the algorithm identifies amino
acid sequence similarity with a known sequence-specific DNA binding
polypeptide.
9. The method of claim 8, wherein a phylogenetic tree is used to
maximize the diversity between sequence-specific DNA binding
polypeptides in a library.
10. The method of claim 7, wherein the algorithm identifies
sequence-specific DNA binding polypeptide based on a phylogenetic
tree.
11. The method of claim 7, wherein the algorithm identifies
sequence-specific DNA binding polypeptide based on their predicted
ability to bind to different target DNA sequences.
12. The method of claim 11, where the predicted ability is based on
a bioinformatic algorithm that predicts the target DNA sequence by
assuming that the sequence-specific DNA binding polypeptide is
autoregulated.
13. The method of claim 1, wherein the optimizing comprises codon
optimization of a gene encoding the polypeptide.
14. The method of claim 1, wherein the optimizing comprises
selecting random codons different from the native codons such that
the coding sequence for the sequence-specific DNA binding
polypeptide is different from the native coding sequence.
15. The method of claim 1, wherein the optimizing comprises using
an algorithm to eliminate transcriptionally functional sequences in
a gene encoding the polypeptide.
16. The method of claim 15, wherein the functional sequences are
ribosome binding sites, regulatory elements, or terminators.
17. The method of claim 15, wherein the functional sequences are
target DNA sequences for other sequence-specific DNA binding
polypeptides in the orthogonal set.
18. The method of claim 1, wherein the target DNA sequences are
determined by an in vitro method.
19. The method of claim 18, wherein the in vitro method comprises
contacting a set of sequence-specific DNA-binding polypeptides to
an array of polynucleotides, thereby determining polynucleotide
sequences bound by the DNA-binding polypeptides.
20. The method of claim 19, wherein the array of polynucleotides is
a microarray.
21. The method of claim 19, wherein the polynucleotides to form a
hairpin.
22. The method of claim 21, wherein the hairpin comprises a target
DNA sequence.
23. The method of claim 21, wherein the hairpin comprises a 30 bp
inverted repeat.
24. The method of claim 23, wherein the inverted sequence has a T
at position 14, A at position 13, A at position 7, T at position
-7, T at position -13, and A at position -14.
25. The method of claim 23, wherein the hairpin sequences are
designed to have no more than a particular GC content.
26. The method of claim 25, where the GC content of the hairpin is
equal or less than 35%.
27. The method of claim 18, wherein the in vitro method is based on
high-throughput sequencing to quantify RNA transcripts.
28. The method of claim 1, wherein the target DNA sequences are
determined by an in vivo method.
29. The method of claim 28, wherein the in vivo method comprises
expression of the sequence-specific DNA binding polypeptide.
30. The method of claim 28, wherein the in vivo method comprises
constructing a synthetic regulatory element library, wherein
regulatory elements in the library comprise one or more of the
identified target DNA sequence(s).
31. The method of claim 30, wherein the synthetic regulatory
element library comprises mutations in the target DNA sequence
binding region.
32. The method of claim 31, wherein the target DNA sequence binding
region is between -10 and -35 regions of the regulatory
element.
33. The method of claim 31, wherein the target DNA sequence is a
-10 region or a -35 region.
34. The method of claim 31, wherein the target DNA sequence is in a
eukaryotic regulatory element.
35. The method of claim 34, wherein the target DNA sequence in the
eukaryotic regulatory element is identified in a yeast two-hybrid
assay.
36. The method of claim 1, the position of the target DNA sequence
recruits RNA polymerase.
37. The method of claim 1, wherein the position of the target DNA
sequence in the regulatory element is selected from: at the -10 or
-35 region of the regulatory element, in the UP-region of the
regulatory element, upstream of the -35 site, between the -10 and
-35 sites. between the -10 and transcriptional start site,
overlapping the transcriptional start site, and overlapping an
activator binding site.
38. The method of claim 1, wherein the sequence-specific
DNA-binding polypeptide comprises a modification that results in
recruitment of RNA polymerase to DNA bound by the sequence-specific
DNA-binding polypeptide.
39. The method of claim 38, wherein the modification is the
addition of the C-terminal VP 16 sequence.
40. The method of claim 1, wherein the orthogonal set is determined
by identifying a set of sequence-specific DNA-binding polypeptides
that do not bind to each other's target DNA sequences.
41. The method of claim 40, wherein the designing cognate
sequence-specific DNA binding polypeptide-target DNA sequence pairs
comprises maximizing the size of the set of orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
pairs.
42. The method of claim 40, wherein the identifying comprises using
a bioinformatic model built using empirical DNA binding data.
43. The method of claim 42, wherein the bioinformatic model
maximizes the diversity between target DNA sequences in the set of
orthogonal-sequence-specific DNA binding polypeptide-target
sequence pairs.
44. The method of claim 42, wherein a graph partitioning algorithm
is used to identify the maximum orthogonal set.
45. The method of claim 44, wherein edges of the set are weighted
by sequence entropy calculated by the set of DNA binding sequences
to which two target DNA sequences bind.
46. The method of claim 2, wherein the repressors are TetR
homologues, zinc finger proteins, or Tal effectors.
47. The method of claim 46, wherein the TetR homolgues are AcrR,
AmtR, ArpA, BM3R1, BarA, Bell, EthR, FarA, HapR, HIyIIR, IcaR,
LmrA, LuxT, McbR, MphR, MtrR, MtrR, Ph1F, PsrA, QacR, ScbR, SmcR,
SmeT, TetR, TtgR, Ty1P, UidR, VarR.
48. The method of claim 2, wherein the transcriptional activators
are sigma factors.
49. The method of claim 1, wherein the genetic circuit is
determined using a logic minimisation algorithm.
50. The method of claim 49, wherein the logic minimisation
algorithm is ESPRESSO.
51. The method of claim 1, wherein the genetic circuit is
determined using a hardware descriptive language.
52. The method of claim 51, wherein the hardware descriptive
language is VHDL or Verilog.
53. The method of claim 1, wherein the genetic circuit is a
combination of logic gates.
54. The method of claim 53, wherein the logic gates are selected
from the group consisting of AND, NAND, NOR, OR, NOT, XOR, EQUALS,
AND, IMPLIES, and ANDN gates.
55. The method of claim 54, wherein the NOR gates comprise a
transcriptional repressors and a transcriptional repressor target
DNA sequence.
56. The method of claim 54, wherein the AND gates comprises a sigma
factor and a sigma factor target DNA sequence.
57. The method of claim 56, wherein the sigma factor is a chimeric
sigma factor comprising a first and second domain wherein the first
and second domains are from two different sigma factors, wherein
the first domain binds to a -10 region of a regulatory element and
the second domain binds to a -35 region of a regulatory
element.
58. The method of claim 2, wherein the RNA polymerase is
substantially identical to T7 RNA polymerase (RNAP).
59. The method of claim 2, wherein the set of orthogonal pairs
comprises at least two or more different RNA polymerases
substantially identical to T7 RNA polymerase (RNAP).
60. The method of claim 58, wherein the T7 RNAP has been modified
from its native form to reduce toxicity to a heterologous
organism.
61. The method of claim 60, wherein the modification includes one
or more of addition of an N-terminal Lon protease tag, a GTG start
codon, and/or an R632S mutation.
62. The method of claim 2, further comprising mutating T7 RNAP to
generate an orthogonal set of polypeptides substantially identical
to T7 RNAP that bind to different DNA sequences.
63. The method of claim 60 or 62, wherein the polypeptides comprise
a loop corresponding to the loop between 745 and 761 of T7 RNAP,
wherein the loop is mutated to the sequence of a homologous phage
polymerase.
64. The method of claim 58, wherein the polymerase is from T3, K1F,
or N4.
65. The method of claim 58, wherein a cognate target DNA sequence
is created by mutating at least one nucleotide of a T7 RNAP
dependent promoter between nucleotides -13 and -18
66. The method of claim 58, wherein a cognate target DNA sequence
comprises a DNA binding sequence for T3, K1F, or N4 phage
polymerase.
67. The method of claim 58, wherein strength of the cognate target
DNA sequence has been modified by mutating the nucleotides between
-4 and -8.
68. The method of claim 58, comprising generating a library of
promoters with different strengths by recombining defined sequences
between -13 and -18 with defined sequences between -4 and -8 of a
DNA binding sequence for T7, T3, K1F, or N4 phage polymerase.
69. The method of claim 2, wherein the transcriptional activator
requires a second chaperone polypeptide to be bound to the
activator to generate transcriptional activity.
70. The method of claim 69, wherein the transcriptional activator
is substantially identical to InvF (from Salmonella typhimurium),
MxiE (from Shigella flexneri), or ExsA (from Pseudomonas
aeriginosa).
71. The method of claim 69 or 70, wherein the chaperone is
substantially similar to SicA (from Salmonella typhimuriwn), IpgC
(from Shigella flexneri), or ExsC (from Pseudomonas aeriginosa)
72. The method of claim 69, wherein the transcriptional activator
and chaperone are used to construct an AND gate.
73. The method of claim 72, wherein one promoter serves as an input
controls the expression of the activator and a second promoter that
serves as an input controls the expression of the chaperone.
74. A method of generating a library of orthogonal sigma factors,
the method comprising generating a library of polynucleotides
encoding chimeric sigma factors, wherein the chimeric sigma factors
comprise a domain from at least two different sigma factors,
wherein each of the domains bind to the -10 or -35 region of a
regulatory element; and expressing chimeric sigma factors from the
library of polynucleotides, thereby generating a library of
chimeric sigma factors.
75. A host cell comprising a heterologous genetic circuit
comprising at least two orthogonal sequence-specific DNA binding
polypeptides, wherein the genetic circuit is a combination of logic
gates.
76. The host cell of claim 75, wherein the logic gates are selected
from the group consisting of AND, NAND, NOR, OR NOT, XOR, EQUALS,
AND, IMPLIES, and ANDN gates.
77. The host cell of claim 76, wherein the NOR gates comprise a
transcriptional repressors and a transcriptional repressor target
DNA sequence.
78. The host cell of claim 76, wherein the AND gates comprises a
sigma factor and a sigma factor target DNA sequence.
79. The host cell of claim 78, wherein the sigma factor is a
chimeric sigma factor comprising a first and second domain wherein
the first and second domains are from two different sigma factors,
wherein the first domain binds to a -10 region of a regulatory
element and the second domain binds to a -35 region of a regulatory
element.
80. The host cell of claim 76, wherein the at least two
sequence-specific DNA binding polypeptides are selected from the
group consisting of transcription factors, transcriptional
activators, RNA polymerases, and transcriptional repressors.
81. The host cell of claim 76, wherein the at least two
sequence-specific DNA binding polypeptides are transcriptional
activators.
82. The host cell of claim 76, wherein the at least two
sequence-specific DNA binding polypeptides are RNA polymerases.
83. The host cell of claim 76, wherein the at least two
sequence-specific DNA binding polypeptides are transcriptional
repressors.
84. The host cell of claim 75, wherein the logic gates comprise a
regulatory element, wherein the regulatory element comprises a
target DNA sequence bound by one of the sequence-specific DNA
binding polypeptides and wherein the position of the target DNA
sequence in the regulatory element is selected from: at the -10 or
-35 region of the regulatory element, in the UP-region of the
regulatory element, upstream of the -35 site, between the -10 and
-35 sites. between the -10 and transcriptional start site,
overlapping the transcriptional start site, and overlapping an
activator binding site.
85. The host cell of claim 84, wherein the at least two
sequence-specific DNA binding polypeptides are selected from the
group consisting of transcription factors, transcriptional
activators, RNA polymerases, and transcriptional repressors.
86. The host cell of claim 75, wherein the host cell is a
prokaryotic host cell.
87. The host cell of claim 75, wherein the gates are combined by
having the output promoter of an upstream gate serve as the input
promoter of a downstream gate.
88. The host cell of claim 87, wherein a spacer sequence is
included after the promoter that serves as a connection point
between gates.
89. The host cell of claim 88, wherein the spacer is encoded at the
5'-UTR of the mRNA encoding a transcription factor before the
ribosome binding site.
90. The host cell of claim 88, wherein the spacer forms a stem
loop, is a native sequence from a metabolic pathway, or is from a
5'-UTR obtained from a phage.
91. The host cell of claim 90, wherein the stem loop is a
ribozyme.
92. The host cell of claim 91, wherein the ribozyme is RiboJ.
93. A non-transitory computer readable storage medium encoded with
instructions, executable by a processor, for designing a host cell
comprising a heterologous genetic circuit comprising at least two
orthogonal sequence-specific DNA binding polypeptides, wherein the
genetic circuit is a combination of logic gates, the instructions
comprising: providing a set of sequence-specific DNA binding
polypeptides; optimizing expression of the polypeptides in a
heterologous host cell; identifying target DNA sequences to which
the polypeptides bind; generating synthetic transcriptional
regulatory elements comprising at least one identified target DNA
sequence, wherein the regulatory elements are responsive to a
sequence-specific DNA binding polypeptide from the set of
sequence-specific DNA binding polypeptides; designing cognate
sequence-specific DNA binding polypeptide-target DNA sequence pairs
to generate one or more orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence pairs; designing a genetic circuit
comprising a combination of logic gates, the logic gates comprising
the one or more orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence pairs.
94. A computer product comprising a computer readable medium
encoded with a plurality of instructions for controlling a
computing system to perform an operation for designing a host cell
comprising a heterologous genetic circuit comprising at least two
orthogonal sequence-specific DNA binding polypeptides, wherein the
genetic circuit is a combination of logic gates, the instructions
comprising instructions for the steps of any of the methods of
claim 1-57.
Description
CROSS-REFERENCE TO RELATED PATENT APPLICATIONS
[0001] This application claims benefit of priority to U.S.
Provisional Patent Application No. 61/493,733, filed on Jun. 6,
2011, which is incorporated by reference.
REFERENCE TO A "SEQUENCE LISTING," A TABLE, OR A COMPUTER PROGRAM
LISTING APPENDIX SUBMITTED AS AN ASCII TEXT FILE
[0003] The Sequence Listing written in file-2091-1.txt, created on
May 29, 2012, 12,288 bytes, machine format IBM-PC, MS-Windows
operating system, is hereby incorporated by reference in its
entirety for all purposes.
BACKGROUND OF THE INVENTION
[0004] Genetically programming cells require sensors to receive
information, circuits to process the inputs, and actuators to link
the circuit output to a cellular response (Andrianantoandro E, et
al., Mol Syst Biol 2 (2006); Chin J W Curr Opin Struct Biol 16:
551-556 (2006); Voigt C A Curr Opin Biotech 17: 548-557 (2006); Tan
C, Mol Biosyst 3: 343-353 (2007)). In this paradigm, sensing,
signal integration, and actuation are encoded by distinct `devices`
comprised of genes and regulatory elements (Knight T K, Sussman G J
Unconventional Models of Computation 257-272 (1997); Endy D Nature
438: 449-453 (2005)). These devices communicate with one another
through changes in gene expression and activity. For example, when
a sensor is stimulated, this may lead to the activation of a
promoter, which then acts as the input to a circuit.
BRIEF SUMMARY OF THE INVENTION
[0005] Embodiments of the present invention provide methods of
designing a genetic circuit containing one or more orthogonal
sequence-specific DNA binding polypeptides. In some embodiments,
the method comprises:
providing a set of sequence-specific DNA binding polypeptides;
optimizing expression of the polypeptides in a heterologous host
cell; identifying target DNA sequences to which the polypeptides
bind; generating synthetic transcriptional regulatory elements
comprising at least one identified target DNA sequence, wherein the
regulatory elements are responsive to a sequence-specific DNA
binding polypeptide from the set of sequence-specific DNA binding
polypeptides; designing cognate sequence-specific DNA binding
polypeptide-target DNA sequence pairs to generate a set of
orthogonal sequence-specific DNA binding polypeptide-target DNA
sequence pairs; and designing a genetic circuit containing one or
more orthogonal sequence-specific DNA binding polypeptide-target
DNA sequence pairs from the set of orthogonal sequence-specific DNA
binding polypeptide-target DNA sequence pairs, thereby designing a
genetic circuit containing one or more orthogonal sequence-specific
DNA binding polypeptides.
[0006] Embodiments of the present teachings provide methods to
identify, design and modify wild type DNA, RNA and protein
sequences for the development of collections of characterized
genetic circuit elements that can be reused in many future designs.
In some embodiments the method comprises:
[0007] Identifying a natural or synthetic biomolecule with desired
functional characteristics
[0008] Identifying similar molecules through comparative
analysis
[0009] Employing tools to optimize the molecules for performance
and expression. In some embodiments this will include optimizing
the sequence for expression in a non native host. In some
embodiments this will include use of computational tools to
identify ways to modify add, remove, increase or reduce sequence
changes with resultant functional significance for the expressed
sequences. In some embodiments this will result in combination of
functional domains from different wild type and synthetic molecules
to create novel molecules with new functional behaviours.
[0010] Amplifying or synthesizing such molecules. In some
embodiments these molecules will be designed to include
modifications such as experimental tags or elements to facilitate
future experimental identification and handling.
[0011] Combining such molecules with other genetic circuit elements
to develop gene like elements termed devices. In some embodiments
this will include the use of the software to assist with the design
of such devices.
[0012] Combining such molecules to other genetic circuit elements
or devices in order to create genetic circuits. In some embodiments
this will include the use of the software to assist with the design
of such genetic circuits.
[0013] Insertion of such molecules into standardized assays to
evaluate their performance. In some embodiments data from the
assays will be used to assess selection of genetic circuit elements
as part of a design.
[0014] Reuse of such molecules in standardized assembly
methodologies. In some embodiments this will include identification
of host the elements will be optimized for. In some embodiments
this will include experimental methodologies that the elements will
be assembled with. In some embodiments this will include the
experimental methodologies the elements will be verified and
validated with.
[0015] Modification and mutation of standardized molecules to
introduce new functional characteristics and develop new variants
of these molecules
[0016] Embodiments of the present teachings provide methods for
describing, classifying and characterizing the elements of a
genetic circuit to aid in the design of genetic circuits. Genetic
element data may be stored locally or in a server in a memory or
database.
[0017] Genetic element data may be generated for describing the
genetic circuit element, the classification of the element for its
functional role and the characterization of the genetic element for
its experimental performance. Genetic element data is a formalized
description of the data necessary to describe a genetic element in
a standardized format. In some embodiments, genetic element data
can be used to share and distribute information about a genetic
circuit element. In some embodiments genetic element data represent
the data model for how a genetic circuit element can be used in
design of a genetic circuit element. In some embodiments the
genetic element data can be used to augment design of a genetic
circuit element through use of classification terms. In some
embodiments the genetic element data can be used to augment circuit
design through use of experimental characterization data. In some
embodiments the genetic element data will describe an assembly of
genetic circuit elements into a functional unit, termed a device.
In some embodiments the genetic element data will describe an
assembly of devices into a genetic circuit.
[0018] Embodiments of the present teachings provide a means to
standardize the classification of genetic circuit elements through
use of defined terms. Some embodiments use a formalized grammar.
Some embodiments use an ontology.
[0019] Embodiments of the present teachings provide a means to
standardize the experimental characterization of a genetic circuit
element through use of standardized assays and standardized
reporting of measurements of performance from such assays. In some
embodiments this may include the production of instructions for
robots.
[0020] Embodiments described herein provide a means to develop
biophysical models of genetic circuit elements, devices and genetic
circuits. Such models can be used in scanning for existing
functional characteristics of elements of a genetic circuit design.
In some embodiments biophysical models can be used to design
desired functional properties into genetic circuit elements,
devices and genetic circuits. In some embodiments biophysical
models can contribute to modeling and simulating the likely
performance of these elements in a genetic circuit design. In some
embodiments biophysical models can be used to evaluate the
performance of genetic circuit elements, devices and genetic
circuits in the target host system.
[0021] Embodiments of the described herein provide a means to
standardize the design of a genetic circuit through the use of
design rules. Such design rules embody the ways with which genetic
circuit elements can be combined to form a device. Such design
rules embody the ways with which devices can be combined to for a
genetic circuit. Such design rules embody the ways with which
genetic circuits sense inputs from the cell, process such inputs
within the circuit and provide responses to the processing of the
inputs. In some embodiments design rules can be achieved through
use of optimization algorithms.
[0022] Embodiments of the present teachings provide a means to
develop, classify and standardize the design of genetic circuits
used to assay genetic design elements.
[0023] Embodiments of the present teachings provide a means to
encode and characterize the experimental data resulting from assay
measurements so that they can be included as part of the
characterization data within a genetic element data. In some
embodiments this may include single variable analysis measurements.
In some embodiments this may include multiple variable analyses
measurements. In some embodiments this may include results from
analyses. In some embodiments this may include mathematical
formulas or algorithms.
[0024] Embodiments of the present teachings provide a means to
compare, sort, filter, exclude and otherwise select and manipulate
parts based upon the information included in their genetic element
data.
[0025] Embodiments of the present teachings provide a means to use
developed genetic circuit elements, devices and circuits as
template design templates. Design templates can be used as
archetypal and reusable solutions for genetic circuits. Design
templates are associated with assembled DNA molecules.
Implementation of the design is realized through assembly of the
corresponding DNA molecules. Reuse of the design templates is
realized through reuse of the assembled DNA molecules in further
experimental manipulations.
[0026] Embodiments of the present teachings provide a means to
simulate design of devices and circuits in silico to identify and
discover designs that may detect desired inputs, process these
detected inputs in a predictable manner and respond to the
processing by producing a desired output. In some embodiments, this
may include the identification, reduction and elimination of design
issues between genetic circuit elements and devices; between
genetic circuit elements, devices and circuits; between genetic
circuit elements, devices and the target host. In some embodiments,
this may include the ability to identify and remove, redesign or
avoid issues that may result in non othogonality between the
different elements of the design. In some embodiments, the inputs
may include molecules present in the cell, such as chemicals,
metabolites, DNAs, RNAs, proteins, carbohydrates and lipids. In
some embodiments, the inputs may include external queues that act
upon the cell, such as cellular-cellular queues, environmental
queues and chemical queues. In some embodiments the outputs may
includes and interact with molecules present in the cell, such as
chemicals, metabolites, DNAs, RNAs, proteins, carbohydrates and
lipids. In some embodiments, the outputs may include and interact
with external queues that act upon the cell, such as
cellular-cellular queues, environmental queues and chemical
queues.
[0027] Embodiments of the present teachings provide systems and
methods to simulate the design, preparation for and execution of
experiments to assemble DNA sequences corresponding to the designed
genetic circuit elements, devices and circuits. In some
embodiments, this may permit the comparison and combination of
different assembly technologies to identify the most efficient path
for assembly. In some embodiments, this may include the
communication of such data to robotic systems that prepare and
execute the experiments to assemble the DNA sequences.
[0028] Embodiments of the present teachings provide systems and
methods to simulate the design and performance characteristics
resulting from inputs, processing steps and single outputs from the
genetic circuit. In some embodiments, this may include the use
simulate to illustrate how the genetic circuit and its parts may
perform under the presence and absence of inputs. In some
embodiments, this may include the use simulations to illustrate how
the genetic circuit can perform and interact with the host
cell.
[0029] Embodiments of the present invention provide systems and
methods to design, provision for and provide experimental guidance
for the functional analysis of the genetic circuit for the purposes
of verifying and validating the genetic circuit design within the
host cell. This may include the use of experimental tags, proteins
and markers to identify modified DNAs, transcribed genes and
translated proteins. In some embodiments, this may include
instructions to run and perform such analyses upon robotic
platforms.
[0030] Embodiments of the present teachings provide methods to
identify, design and modify wild type DNA, RNA and protein
sequences for the development of collections of characterized
genetic circuit elements that can be reused in many future designs.
In some embodiments the method comprises:
[0031] In some embodiments, the genetic circuit is deIdentifying a
natural or synthetic biomolecule with desired functional
characteristics
[0032] Identifying similar molecules through comparative
analysis
[0033] Employing tools to optimize the molecules for performance
and expression. In some embodiments this will include optimizing
the sequence for expression in a non native host. In some
embodiments this will include use of computational tools to
identify ways to modify add, remove, increase or reduce sequence
changes with resultant functional significance for the expressed
sequences. In some embodiments this will result in combination of
functional domains from different wild type and synthetic molecules
to create novel molecules with new functional behaviours.
[0034] Amplifying or synthesizing such molecules. In some
embodiments these molecules will be designed to include
modifications such as experimental tags or elements to facilitate
future experimental identification and handling.
[0035] Combining such molecules with other genetic circuit elements
to develop gene like elements termed devices. In some embodiments
this will include the use of the software to assist with the design
of such devices.
[0036] Combining such molecules to other genetic circuit elements
or devices in order to create genetic circuits. In some embodiments
this will include the use of the software to assist with the design
of such genetic circuits.
[0037] Insertion of such molecules into standardized assays to
evaluate their performance. In some embodiments data from the
assays will be used to assess selection of genetic circuit elements
as part of a design.
[0038] Reuse of such molecules in standardized assembly
methodologies. In some embodiments this will include identification
of host the elements will be optimized for. In some embodiments
this will include experimental methodologies that the elements will
be assembled with. In some embodiments this will include the
experimental methodologies the elements will be verified and
validated with.
[0039] Modification and mutation of standardized molecules to
introduce new functional characteristics and develop new variants
of these molecules
[0040] Embodiments of the present teachings provide methods for
describing, classifying and characterizing the elements of a
genetic circuit to aid in the design of genetic circuits. Genetic
element data may be stored locally or in a server in a memory or
database.
[0041] Genetic element data may be generated for describing the
genetic circuit element, the classification of the element for its
functional role and the characterization of the genetic element for
its experimental performance. Genetic element data is a formalized
description of the data necessary to describe a genetic element in
a standardized format. In some embodiments, genetic element data
can be used to share and distribute information about a genetic
circuit element. In some embodiments genetic element data represent
the data model for how a genetic circuit element can be used in
design of a genetic circuit element. In some embodiments the
genetic element data can be used to augment design of a genetic
circuit element through use of classification terms. In some
embodiments the genetic element data can be used to augment circuit
design through use of experimental characterization data. In some
embodiments the genetic element data will describe an assembly of
genetic circuit elements into a functional unit, termed a device.
In some embodiments the genetic element data will describe an
assembly of devices into a genetic circuit.
[0042] Embodiments of the present teachings provide a means to
standardize the classification of genetic circuit elements through
use of defined terms. Some embodiments use a formalized grammar.
Some embodiments use an ontology.
[0043] Embodiments of the present teachings provide a means to
standardize the experimental characterization of a genetic circuit
element through use of standardized assays and standardized
reporting of measurements of performance from such assays. In some
embodiments this may include the production of instructions for
robots.
[0044] Embodiments described herein provide a means to develop
biophysical models of genetic circuit elements, devices and genetic
circuits. Such models can be used in scanning for existing
functional characteristics of elements of a genetic circuit design.
In some embodiments biophysical models can be used to design
desired functional properties into genetic circuit elements,
devices and genetic circuits. In some embodiments biophysical
models can contribute to modeling and simulating the likely
performance of these elements in a genetic circuit design. In some
embodiments biophysical models can be used to evaluate the
performance of genetic circuit elements, devices and genetic
circuits in the target host system.
[0045] Embodiments of the described herein provide a means to
standardize the design of a genetic circuit through the use of
design rules. Such design rules embody the ways with which genetic
circuit elements can be combined to form a device. Such design
rules embody the ways with which devices can be combined to for a
genetic circuit. Such design rules embody the ways with which
genetic circuits sense inputs from the cell, process such inputs
within the circuit and provide responses to the processing of the
inputs. In some embodiments design rules can be achieved through
use of optimization algorithms.
[0046] Embodiments of the present teachings provide a means to
develop, classify and standardize the design of genetic circuits
used to assay genetic design elements.
[0047] Embodiments of the present teachings provide a means to
encode and characterize the experimental data resulting from assay
measurements so that they can be included as part of the
characterization data within a genetic element data. In some
embodiments this may include single variable analysis measurements.
In some embodiments this may include multiple variable analyses
measurements. In some embodiments this may include results from
analyses. In some embodiments this may include mathematical
formulas or algorithms.
[0048] Embodiments of the present teachings provide a means to
compare, sort, filter, exclude and otherwise select and manipulate
parts based upon the information included in their genetic element
data.
[0049] Embodiments of the present teachings provide a means to use
developed genetic circuit elements, devices and circuits as
template design templates. Design templates can be used as
archetypal and reusable solutions for genetic circuits. Design
templates are associated with assembled DNA molecules.
Implementation of the design is realized through assembly of the
corresponding DNA molecules. Reuse of the design templates is
realized through reuse of the assembled DNA molecules in further
experimental manipulations.
[0050] Embodiments of the present teachings provide a means to
simulate design of devices and circuits in silico to identify to
identify and discover designs that may detect desired inputs,
process these detected inputs in a predictable manner and respond
to the processing by producing a desired output. In some
embodiments, this may include the identification, reduction and
elimination of design issues between genetic circuit elements and
devices; between genetic circuit elements, devices and circuits;
between genetic circuit elements, devices and the target host. In
some embodiments, this may include the ability to identify and
remove, redesign or avoid issues that may result in non
othogonality between the different elements of the design. In some
embodiments, the inputs may include molecules present in the cell,
such as chemicals, metabolites, DNAs, RNAs, proteins, carbohydrates
and lipids. In some embodiments, the inputs may include external
queues that act upon the cell, such as cellular-cellular queues,
environmental queues and chemical queues. In some embodiments the
outputs may includes and interact with molecules present in the
cell, such as chemicals, metabolites, DNAs, RNAs, proteins,
carbohydrates and lipids. In some embodiments, the outputs may
include and interact with external queues that act upon the cell,
such as cellular-cellular queues, environmental queues and chemical
queues.
[0051] Embodiments of the present teachings provide systems and
methods to simulate the design, preparation for and execution of
experiments to assemble DNA sequences corresponding to the designed
genetic circuit elements, devices and circuits. In some
embodiments, this may permit the comparison and combination of
different assembly technologies to identify the most efficient path
for assembly. In some embodiments, this may include the
communication of such data to robotic systems that prepare and
execute the experiments to assemble the DNA sequences.
[0052] Embodiments of the present teachings provide systems and
methods to simulate the design and performance characteristics
resulting from inputs, processing steps and single outputs from the
genetic circuit. In some embodiments, this may include the use
simulate to illustrate how the genetic circuit and its parts may
perform under the presence and absence of inputs. In some
embodiments, this may include the use simulations to illustrate how
the genetic circuit can perform and interact with the host
cell.
[0053] Embodiments of the present invention provide systems and
methods to design, provision for and provide experimental guidance
for the functional analysis of the genetic circuit for the purposes
of verifying and validating the genetic circuit design within the
host cell. This may include the use of experimental tags, proteins
and markers to identify modified DNAs, transcribed genes and
translated proteins. In some embodiments, this may include
instructions to run and perform such analyses upon robotic
platforms.
[0054] Embodiments of the present teachings provide methods and
systems to publish, distribute, share and manage sets of genetic
element data and genetic circuit designs among investigators.
Sharing of data can be performed using novel or existing
standardized publically described data formats.
[0055] Embodiments of the present teachings provide methods and
systems to publish, distribute, share and manage sets of genetic
element data and genetic circuit designs among investigators.
Sharing of data can be performed using novel or existing
standardized publically described data formats.
[0056] In some embodiments, the sequence-specific DNA binding
polypeptides are selected from the group consisting of
transcription factors, transcriptional activators, RNA polymerases,
and transcriptional repressors. In some embodiments, the
transcriptional repressor(s) are substantially identical to the
Tetracycline repressor (TetR).
[0057] In some embodiments, the host cell is a prokaryotic cell. In
some embodiments, the host cell is a eukaryotic cell.
[0058] In some embodiments, the method further comprises testing
the circuit for unintended interactions within the circuit and/or
between the circuit and the host cell genome.
[0059] In some embodiments, the providing comprises
algorithm-guided identification of sequence-specific DNA binding
polypeptides from one or more sequence database. In some
embodiments, the algorithm identifies amino acid sequence
similarity with a known sequence-specific DNA binding polypeptide.
In some embodiments, a phylogenetic tree is used to maximize the
diversity between sequence-specific DNA binding polypeptides in a
library. In some embodiments, the algorithm identifies
sequence-specific DNA binding polypeptide based on a phylogenetic
tree. In some embodiments, the algorithm identifies
sequence-specific DNA binding polypeptide based on their predicted
ability to bind to different target DNA sequences. In some
embodiments, the predicted ability is based on a bioinformatic
algorithm that predicts the target DNA sequence by assuming that
the sequence-specific DNA binding polypeptide is autoregulated.
[0060] In some embodiments, the optimizing comprises codon
optimization of a gene encoding the polypeptide. In some
embodiments, the optimizing comprises selecting random codons
different from the native codons such that the coding sequence for
the sequence-specific DNA binding polypeptide is different from the
native coding sequence.
[0061] In some embodiments, the optimizing comprises using an
algorithm to eliminate transcriptionally functional sequences in a
gene encoding the polypeptide. In some embodiments, the functional
sequences are ribosome binding sites, regulatory elements, or
terminators. In some embodiments, the functional sequences are
target DNA sequences for other sequence-specific DNA binding
polypeptides in the orthogonal set.
[0062] In some embodiments, the target DNA sequences are determined
by an in vitro method. In some embodiments, the in vitro method
comprises contacting a set of sequence-specific DNA-binding
polypeptides to an array of polynucleotides, thereby determining
polynucleotide sequences bound by the DNA-binding polypeptides. In
some embodiments, the array of polynucleotides is a microarray. In
some embodiments, the polynucleotides to form a hairpin. In some
embodiments, the hairpin comprises a target DNA sequence. In some
embodiments, the hairpin comprises a 30 bp inverted repeat. In some
embodiments, the inverted sequence has a T at position 14, A at
position 13, A at position 7, T at position -7, T at position -13,
and A at position -14. In some embodiments, the hairpin sequences
are designed to have no more than a particular GC content. In some
embodiments, the GC content of the hairpin is equal or less than
35%.
[0063] In some embodiments, the in vitro method is based on
high-throughput sequencing to quantify RNA transcripts.
[0064] In some embodiments, the target DNA sequences are determined
by an in vivo method. In some embodiments, the in vivo method
comprises expression of the sequence-specific DNA binding
polypeptide. In some embodiments, the in vivo method comprises
constructing a synthetic regulatory element library, wherein
regulatory elements in the library comprise one or more of the
identified target DNA sequence(s). In some embodiments, the
synthetic regulatory element library comprises mutations in the
target DNA sequence binding region. In some embodiments, the target
DNA sequence binding region is between -10 and -35 regions of the
regulatory element. In some embodiments, the target DNA sequence is
a -10 region or a -35 region. In some embodiments, the target DNA
sequence is in a eukaryotic regulatory element. In some
embodiments, the target DNA sequence in the eukaryotic regulatory
element is identified in a yeast two-hybrid assay.
[0065] In some embodiments, the position of the target DNA sequence
recruits RNA polymerase.
[0066] In some embodiments, the position of the target DNA sequence
in the regulatory element is selected from: at the -10 or -35
region of the regulatory element, in the UP-region of the
regulatory element, upstream of the -35 site, between the -10 and
-35 sites. between the -10 and transcriptional start site,
overlapping the transcriptional start site, and overlapping an
activator binding site.
[0067] In some embodiments, the sequence-specific DNA-binding
polypeptide comprises a modification that results in recruitment of
RNA polymerase to DNA bound by the sequence-specific DNA-binding
polypeptide. In some embodiments, the modification is the addition
of the C-terminal VP 16 sequence.
[0068] In some embodiments, the orthogonal set is determined by
identifying a set of sequence-specific DNA-binding polypeptides
that do not bind to each other's target DNA sequences. In some
embodiments, the designing cognate sequence-specific DNA binding
polypeptide-target DNA sequence pairs comprises maximizing the size
of the set of orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence pairs. In some embodiments, the
identifying comprises using a bioinformatic model built using
empirical DNA binding data. In some embodiments, the bioinformatic
model maximizes the diversity between target DNA sequences in the
set of orthogonal sequence-specific DNA binding polypeptide-target
sequence pairs. In some embodiments, a graph partitioning algorithm
is used to identify the maximum orthogonal set. In some
embodiments, edges of the set are weighted by sequence entropy
calculated by the set of DNA binding sequences to which two target
DNA sequences bind.
[0069] In some embodiments, the repressors are TetR homologues,
zinc finger proteins, or Tal effectors. In some embodiments, the
TetR homolgues are AcrR, AmtR, ArpA, BM3R1, BarA, BetI, EthR, FarA,
HapR, HlyIIR, IcaR, LmrA, LuxT, McbR, MphR, MtrR, MtrR, PhlF, PsrA,
QacR, ScbR, SmcR, SmeT, TetR, TtgR, TylP, UidR, VarR.
[0070] In some embodiments, the transcriptional activators are
sigma factors.
[0071] In some embodiments, the genetic circuit is determined using
a logic minimization algorithm. In some embodiments, the logic
minimization algorithm is ESPRESSO.
[0072] In some embodiments, the genetic circuit is defined using a
hardware descriptive language. In some embodiments, the hardware
descriptive language is VHDL or Verilog.
[0073] In some embodiments, the genetic circuit is a combination of
logic gates. In some embodiments, the logic gates are selected from
the group consisting of AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND,
IMPLIES, and ANDN gates. In some embodiments, the NOR gates
comprise a transcriptional repressors and a transcriptional
repressor target DNA sequence. In some embodiments, the AND gates
comprises a sigma factor and a sigma factor target DNA sequence. In
some embodiments, the sigma factor is a chimeric sigma factor
comprising a first and second domain wherein the first and second
domains are from two different sigma factors, wherein the first
domain binds to a -10 region of a regulatory element and the second
domain binds to a -35 region of a regulatory element.
[0074] In some embodiments, the RNA polymerase is substantially
identical to T7 RNA polymerase (RNAP). In some embodiments, the set
of orthogonal pairs comprises at least two or more different RNA
polymerases substantially identical to T7 RNA polymerase (RNAP). In
some embodiments, the T7 RNAP has been modified from its native
form to reduce toxicity to a heterologous organism. In some
embodiments, the modification includes one or more of addition of
an N-terminal Lon protease tag, a GTG start codon, and/or an R632S
mutation.
[0075] In some embodiments, the method further comprises mutating
T7 RNAP to generate an orthogonal set of polypeptides substantially
identical to T7 RNAP that bind to different DNA sequences. In some
embodiments, the polypeptides comprise a loop corresponding to the
loop between 745 and 761 of T7 RNAP, wherein the loop is mutated to
the sequence of a homologous phage polymerase.
[0076] In some embodiments, the RNA polymerase is from T3, K1F, or
N4.
[0077] In some embodiments, a cognate target DNA sequence is
created by mutating at least one nucleotide of a T7 RNAP dependent
promoter between nucleotides -13 and -18
[0078] In some embodiments, a cognate target DNA sequence comprises
a DNA binding sequence for T3, K1F, or N4 phage polymerase.
[0079] In some embodiments, strength of the cognate target DNA
sequence has been modified by mutating the nucleotides between -4
and -8.
[0080] In some embodiments, the method comprises generating a
library of promoters with different strengths by recombining
defined sequences between -13 and -18 with defined sequences
between -4 and -8 of a DNA binding sequence for T7, T3, K1F, or N4
phage polymerase.
[0081] In some embodiments, the transcriptional activator requires
a second chaperone polypeptide to be bound to the activator to
generate transcriptional activity. In some embodiments, the
transcriptional activator is substantially identical to InvF (from
Salmonella typhimurium), MxiE (from Shigella flexneri), or ExsA
(from Pseudomonas aeriginosa). In some embodiments, the chaperone
is substantially similar to SicA (from Salmonella typhimurium),
IpgC (from Shigella flexneri), or ExsC (from Pseudomonas
aeriginosa)
[0082] In some embodiments, the transcriptional activator and
chaperone are used to construct an AND gate. In some embodiments,
one promoter serves as an input controls the expression of the
activator and a second promoter that serves as an input controls
the expression of the chaperone.
[0083] Embodiments of the invention also provide methods of
generating a library of orthogonal sigma factors, transcriptional
repressor, and/or RNA polymerases. In some embodiments, the method
comprises generating a library of polynucleotides encoding chimeric
sigma factors, wherein the chimeric sigma factors comprise a domain
from at least two different sigma factors, wherein each of the
domains bind to the -10 or *-35 region of a regulatory element; and
expressing chimeric sigma factors from the library of
polynucleotides, thereby generating a library of chimeric sigma
factors.
[0084] Embodiments of the invention also provide for a host cell
comprising a heterologous genetic circuit comprising at least two
orthogonal sequence-specific DNA binding polypeptides, wherein the
genetic circuit is a combination of logic gates. In some
embodiments, the logic gates are selected from the group consisting
of AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND, IMPLIES, and ANDN
gates. In some embodiments, the NOR gates comprise a
transcriptional repressors and a transcriptional repressor target
DNA sequence. In some embodiments, the AND gates comprises a sigma
factor and a sigma factor target DNA sequence. In some embodiments,
the sigma factor is a chimeric sigma factor comprising a first and
second domain wherein the first and second domains are from two
different sigma factors, wherein the first domain binds to a -10
region of a regulatory element and the second domain binds to a -35
region of a regulatory element.
[0085] In some embodiments, the at least two sequence-specific DNA
binding polypeptides are selected from the group consisting of
transcription factors, transcriptional activators, RNA polymerases,
and transcriptional repressors.
[0086] In some embodiments, the at least two sequence-specific DNA
binding polypeptides are transcriptional activators.
[0087] In some embodiments, the at least two sequence-specific DNA
binding polypeptides are RNA polymerases.
[0088] In some embodiments, wherein the at least two
sequence-specific DNA binding polypeptides are transcriptional
repressors.
[0089] In some embodiments, the logic gates comprise a regulatory
element, wherein the regulatory element comprises a target DNA
sequence bound by one of the sequence-specific DNA binding
polypeptides and wherein the position of the target DNA sequence in
the regulatory element is selected from: at the -10 or -35 region
of the regulatory element, in the UP-region of the regulatory
element, upstream of the -35 site, between the -10 and -35 sites.
between the -10 and transcriptional start site, overlapping the
transcriptional start site, and overlapping an activator binding
site. In some embodiments, the at least two sequence-specific DNA
binding polypeptides are selected from the group consisting of
transcription factors, transcriptional activators, RNA polymerases,
and transcriptional repressors.
[0090] In some embodiments, the host cell is a prokaryotic host
cell. In some embodiments, the gates are combined by having the
output promoter of an upstream gate serve as the input promoter of
a downstream gate. In some embodiments, a spacer sequence is
included after the promoter that serves as a connection point
between gates. In some embodiments, the spacer is encoded at the
5'-UTR of the mRNA encoding a transcription factor before the
ribosome binding site. In some embodiments, the spacer forms a stem
loop, is a native sequence from a metabolic pathway, or is from a
5'-UTR obtained from a phage. In some embodiments, the stem loop is
a ribozyme. In some embodiments, the ribozyme is RiboJ.
[0091] Embodiments of the invention also provide a computer
readable medium encoded with instructions, executable for a
process, for designing a host cell comprising a heterologous
genetic circuit comprising at least two orthogonal
sequence-specific DNA binding polypeptides, wherein the genetic
circuit is a combination of logic gates, the instructions
comprising instructions for:
providing a set of sequence-specific DNA binding polypeptides;
optimizing expression of the polypeptides in a heterologous host
cell; identifying target DNA sequences to which the polypeptides
bind; generating synthetic transcriptional regulatory elements
comprising at least one identified target DNA sequence, wherein the
regulatory elements are responsive to a sequence-specific DNA
binding polypeptide from the set of sequence-specific DNA binding
polypeptides; designing cognate sequence-specific DNA binding
polypeptide-target DNA sequence pairs to generate one or more
orthogonal sequence-specific DNA binding polypeptide-target DNA
sequence pairs; designing a genetic circuit comprising a
combination of logic gates, the logic gates comprising the one or
more orthogonal sequence-specific DNA binding polypeptide-target
DNA sequence pairs.
[0092] Embodiments of the invention also provide a computer product
comprising a computer readable medium encoded with a plurality of
instructions for controlling a computing system to perform an
operation for designing a host cell comprising a heterologous
genetic circuit comprising at least two orthogonal
sequence-specific DNA binding polypeptides, wherein the genetic
circuit is a combination of logic gates, the instructions
comprising instructions for the steps of any of the methods
described above or elsewhere herein.
DEFINITIONS
[0093] "Genetic circuits" are comprised of a set of heterologous
expression cassettes whose (generally protein) products regulate
other expression cassettes in the set and/or regulate an ultimate
output of the circuit. Genetic circuit components can be used to
implement any arbitrary Boolean operation in living cells based on
an input detected by the circuit. Individual components for
particular operations can be coupled to inputs and to one another
in order to implement a genetic circuit that operates on a complex
expression. Genetic circuits may process a Boolean expression that
connect logic variables representing the cues via logic operations
(e.g., AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND, IMPLIES, and ANDN
gates).
[0094] A "set" refers to a group of two or more items. Generally,
the items will have a similar effect or action (e.g., a set of
activators, a set of repressors, etc.).
[0095] "Optimizing expression" of a polypeptide, as used herein,
refers to altering the nucleotide sequences of a coding sequence
for a polypeptide to refine or alter the expression of the
polypeptide (e.g., by altering transcription of an RNA encoding the
polypeptide) to achieve a desired result. The desired result can be
optimal expression, but can also be simply obtaining sufficient
expression in a heterologous host cell to test activity (e.g., DNA
sequence binding) of the polypeptide. "Optimizing" can also include
altering the nucleotide sequence of the gene to alter or eliminate
native transcriptional regulatory sequences in the gene, thereby
eliminating possible regulation of expression of the gene in the
heterologous host cell by the native transcriptional regulatory
sequence(s). Optimization can include replacement of codons in the
gene with other codons encoding the same amino acid. The
replacement codons can be those that result in optimized codon
usage for the host cell, or can be random codons encoding the same
amino acid, but not necessarily selected for the most "preferred"
codon in a particular host cell.
[0096] "Heterologous," in reference to a relationship between a
cell and a polynucleotide means the polynucleotide originates from
a foreign species, or, if from the same species, is modified from
its original (native) form.
[0097] "Target DNA sequences" refer to DNA sequences bound by
sequence-specific DNA binding polypeptides. For example, an
operator for a transcriptional activator or repressor is a target
DNA sequence.
[0098] "Transcriptional regulatory elements" refer to any
nucleotide sequence that influences transcription initiation and
rate, or stability and/or mobility of a transcript product.
Regulatory sequences include, but are not limited to, promoters,
promoter control elements, protein binding sequences, 5' and 3'
UTRs, transcriptional start sites, termination sequences,
polyadenylation sequences, introns, etc. Such transcriptional
regulatory sequences can be located either 5'-, 3'-, or within the
coding region of the gene and can be either promote (positive
regulatory element) or repress (negative regulatory element) gene
transcription.
[0099] The term "operably linked" refers to a functional linkage
between a nucleic acid expression control sequence (such as a
promoter, or array of transcription factor binding sites) and a
second nucleic acid sequence, wherein the expression control
sequence directs transcription of the nucleic acid corresponding to
the second sequence.
[0100] A "cognate pair" as used herein refers to a
sequence-specific DNA binding polypeptide and a target DNA sequence
that is bound by the particular sequence-specific DNA binding
polypeptide. For sequence-specific DNA binding polypeptides that
bind more than one target nucleic acid, the cognate pair can be
formed with the sequence-specific DNA binding polypeptide and any
one of the target DNA sequences the polypeptide binds.
[0101] "Orthogonal" transcriptional systems refer to systems (e.g.,
one, two, three, or more) of transcriptional regulatory elements
comprising target DNA sequences regulated by their cognate
sequence-specific DNA binding polypeptide such that the
sequence-specific DNA binding polypeptides in the system do not
have "cross-talk," i.e., the sequence-specific DNA binding
polypeptides do not interfere or regulate transcriptional
regulatory elements in the system other than the transcriptional
regulatory elements containing the cognate target DNA sequence of
the sequence-specific DNA binding polypeptide.
[0102] "Sequence-specific DNA binding polypeptides" refer to
polypeptides that bind DNA in a nucleotide sequence specific
manner. Exemplary sequence-specific DNA binding polypeptides
include, but are not limited to transcription factors (e.g.,
transcriptional activators), RNA polymerases, and transcriptional
repressors.
[0103] A "transcriptional activator" refers to a polypeptide, which
when bound to a promoter sequence, activates or increases
transcription of an RNA comprising the operably-linked coding
sequence. In some embodiments, the transcriptional activator bound
to a target sequence in a promoter can assist recruitment of RNA
polymerase to the promoter. A "transcriptional repressor" refers to
a polypeptide, which when bound to a promoter sequence, blocks or
decreases transcription of an RNA comprising the operably-linked
coding sequence. In some embodiments, the transcriptional repressor
blocks recruitment of the RNA polymerase to the promoter or blocks
the RNA polymerase's movement along the promoter.
[0104] The "-10" and "-35" regions of a promoter refer to regions
in prokaryotic promoters, as measured from the transcriptional
start site. The -10 region is sometimes also known as a "Pribnow
box" in the scientific literature. The -10 region is typically six
nucleotides long. In some embodiments, the -10 region has the
sequence "TATAAT" or a variant thereof. The -35 region" is a
sequence that can range from 8-12 nucleotides. One variant of the
-35 region is "TGTTGACA." However, as noted before, the -10 and -35
regions can have various sequences.
[0105] The term "host cell" refers to any cell capable of
replicating and/or transcribing and/or translating a heterologous
gene. Thus, a "host cell" refers to any prokaryotic cell (including
but not limited to E. coli) or eukaryotic cell (including but not
limited to yeast cells, mammalian cells, avian cells, amphibian
cells, plant cells, fish cells, and insect cells), whether located
in vitro or in vivo. For example, host cells may be located in a
transgenic animal or transgenic plant. prokaryotic cell (including
but not limited to E. coli) or eukaryotic cells (including but not
limited to yeast cells, mammalian cells, avian cells, amphibian
cells, plant cells, fish cells, and insect cells).
[0106] Two nucleic acid sequences or polypeptides are said to be
"identical" if the sequence of nucleotides or amino acid residues,
respectively, in the two sequences is the same when aligned for
maximum correspondence as described below. The term "substantial
identity," in reference to nucleotide or amino acid sequences,
means that a nucleotide or amino acid sequence, respectively,
comprises a sequence that has at least 50% sequence identity.
Alternatively, percent identity can be any integer from 50% to
100%, e.g., at least: 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%,
95%, or 99% compared to a reference sequence using the programs
described herein; preferably BLAST using standard parameters, as
described below. One of skill will recognize that the percent
identity values above can be appropriately adjusted to determine
corresponding identity of proteins encoded by two nucleotide
sequences by taking into account codon degeneracy, amino acid
similarity, reading frame positioning and the like. In some
embodiments, polypeptides that are "substantially similar" share
sequences as noted above except that residue positions which are
not identical may differ by conservative amino acid changes.
Conservative amino acid substitutions refer to the
interchangeability of residues having similar side chains.
[0107] The following eight groups each contain amino acids that are
conservative substitutions for one another:
1) Alanine (A), Glycine (G);
[0108] 2) Aspartic acid (D), Glutamic acid (E);
3) Asparagine (N), Glutamine (Q);
4) Arginine (R), Lysine (K);
5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V);
6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W);
7) Serine (S), Threonine (T); and
8) Cysteine (C), Methionine (M)
[0109] (see, e.g., Creighton, Proteins (1984)).
[0110] One example of algorithm that is suitable for determining
percent sequence identity and sequence similarity are the BLAST and
BLAST 2.0 algorithms, which are described in Altschul et al. (1977)
Nuc. Acids Res. 25:3389-3402, and Altschul et al. (1990) J. Mol.
Biol. 215:403-410, respectively. Software for performing BLAST
analyses is publicly available through the National Center for
Biotechnology Information (http://www.ncbi.nlm.nih.gov/). This
algorithm involves first identifying high scoring sequence pairs
(HSPs) by identifying short words of length W in the query
sequence, which either match or satisfy some positive-valued
threshold score T when aligned with a word of the same length in a
database sequence. T is referred to as the neighborhood word score
threshold (Altschul et al., supra). These initial neighborhood word
hits act as seeds for initiating searches to find longer HSPs
containing them. The word hits are extended in both directions
along each sequence for as far as the cumulative alignment score
can be increased. Cumulative scores are calculated using, for
nucleotide sequences, the parameters M (reward score for a pair of
matching residues; always >0) and N (penalty score for
mismatching residues; always <0). For amino acid sequences, a
scoring matrix is used to calculate the cumulative score. Extension
of the word hits in each direction are halted when: the cumulative
alignment score falls off by the quantity X from its maximum
achieved value; the cumulative score goes to zero or below, due to
the accumulation of one or more negative-scoring residue
alignments; or the end of either sequence is reached. The BLAST
algorithm parameters W, T, and X determine the sensitivity and
speed of the alignment. The BLASTN program (for nucleotide
sequences) uses as defaults a wordlength (W) of 11, an expectation
(E) or 10, M=5, N=-4 and a comparison of both strands. For amino
acid sequences, the BLASTP program uses as defaults a wordlength of
3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see
Henikoff and Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915)
alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a
comparison of both strands.
[0111] The BLAST algorithm also performs a statistical analysis of
the similarity between two sequences (see, e.g., Karlin and
Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5787). One
measure of similarity provided by the BLAST algorithm is the
smallest sum probability (P(N)), which provides an indication of
the probability by which a match between two nucleotide or amino
acid sequences would occur by chance. For example, a nucleic acid
is considered similar to a reference sequence if the smallest sum
probability in a comparison of the test nucleic acid to the
reference nucleic acid is less than about 0.2, more preferably less
than about 0.01, and most preferably less than about 0.001.
[0112] "Percentage of sequence identity" is determined by comparing
two optimally aligned sequences over a comparison window, wherein
the portion of the polynucleotide sequence in the comparison window
may comprise additions or deletions (i.e., gaps) as compared to the
reference sequence (which does not comprise additions or deletions)
for optimal alignment of the two sequences. The percentage is
calculated by determining the number of positions at which the
identical nucleic acid base or amino acid residue occurs in both
sequences to yield the number of matched positions, dividing the
number of matched positions by the total number of positions in the
window of comparison and multiplying the result by 100 to yield the
percentage of sequence identity.
BRIEF DESCRIPTION OF THE DRAWINGS
[0113] FIG. 1 is a diagram illustrating the phylogenetic tree of
ECF .sigma.s. ECF .sigma.s have been classified into 43 groups (32
shown in FIG. 1) based on their amino acid sequence. Each clade is
color coded according to the phylogenetic distribution of the ECF
.sigma. factors. Figure taken from Staron, A., H. J. Sofia, et
al.
[0114] FIG. 2 is a diagram illustrating the three-plasmid
expression system to enable controlled induction of ECF .sigma.s
and measurement of target promoter activity
[0115] FIG. 3 illustrates the growth rates of strains
over-expressing the ECF .sigma. library in 96-well format. FIG. 3
(left side) shows typical growth rate plots. FIG. 3 (right side)
shows average growth rate as % of wild type (non-ECF .sigma.
expressing) cells during exponential growth.
[0116] FIG. 4 is an illustration of the autoregulation of many ECF
.sigma.s by an upstream promoter.
[0117] FIG. 5 illustrates sequence logos of promoters found
upstream of 34 ECF .sigma. subgroups (SEQ ID NOS:1-29). For each
sequence logo, the key promoter motifs (UP, -35, spacer, -10) are
indicated. Promoters shown to be functional in vivo are indicated
by a tick mark: a tick followed by an ECF designation indicates the
promoter could only be activated by a sigma from another
subgroup.
[0118] FIG. 6 Heatmap of predicted promoter activity with different
ECF .sigma.s. 706 promoters (vertical axis) were score by promoter
models for each ECF .sigma.s (horizontal axis). Predicted promoter
activity is displayed as a sliding black to green scale (shown here
in grayscale), where green (lighter) indicates active and black
inactive (non-functional).
[0119] FIG. 7 illustrates in vivo screening of ECF .sigma. library
in 96-well format against candidate promoters fused to superfolding
GFP.
[0120] FIG. 8 illustrates a heatmap of in vivo promoter activities
against ECF .sigma.s. Only the most active and orthogonal
.sigma.-promoter pairs are illustrated.
[0121] FIG. 9 shows that ECF sigmas contain 2 DNA binding domains.
ECF sigmas (Left) contain 2 conserved DNA binding domains, R2 and
R4, that contact the promoter -10 and -35 regions, respectively.
Promoter logos of 2 candidate ECF sigmas are shown (right) that
recognize different -10 and -35 sequences (SEQ ID NOS:30 and
31).
[0122] FIG. 10 illustrates chimeric sigmas. 2 chimeric sigmas were
made by domain swapping R2 and R4 from ECF02.sub.--2817 and
ECF11.sub.--3726. Each chimeric sigma was constructed with a
cognate chimeric promoter, P02.sub.--11 for chimera ECF02_ECF11,
and P11.sub.--02 for chimera ECF11_ECF02.
[0123] FIG. 11 shows the sequences of parental (SEQ ID NOS:32 and
33) and chimeric promoters (SEQ ID NOS:34 and 35).
[0124] FIG. 12 shows the activity of the parental and chimeric
sigmas against their cognate wild type and chimeric promoters. The
promoters were fused to gfp reporters and the data represents
promoter activity as measured by fluorescence from exponentially
growing cells in the presence of each sigma. The data is presented
as a heatmap, promoter activity is displayed as fold-change over
background and also with a sliding yellow-green scale: yellow is
inactive, green is active. Note, not all promoter-sigma
combinations have been tested yet.
[0125] FIG. 13 shows the operator sequences inserted between the
-35/-10 elements of the J23119 promoter (SEQ ID NO:36), which is
present upstream of a fluorescent reporter gene (YFP). Modifying
promoter sequence content results in subsequent alteration of
promoter activity.
[0126] FIG. 14 illustrates repression from the AmtR
operator/reporter construct in an in vivo reporter assay. The AmtR
operator was inserted into the J23119 promoter and the resulting
reporter was screened against the repressor library. Only the AmtR
repressor causes repression from the AmtR operator/reporter
construct. Each spot corresponds to a different repressor
transformed into cells containing the AmtR reporter.
[0127] FIG. 15 shows raw flow cytometry data of the AmtR reporter
screened against the repressor library, thus demonstrating that
only AmtR exhibits high levels of repression from this reporter.
Each cell corresponds to a different repressor, and the AmtR
repressor is present in the yellowed-cell.
[0128] FIG. 16 depicts an array-based approach for identifying
synthetic operator sequences. A snapshot of the array, revealing
that the purified McbR protein exhibits binding to a 2.1M array, is
represented towards the bottom of the figure. Each square in the
array represents a distinct sequence. Squares harboring brighter
intensities indicate higher affinity sites. Inverted repeat=SEQ ID
NO:37; repressor consensus sequence=SEQ ID NO:38.
[0129] FIG. 17 illustrates the relative toxicity of T7 RNAP
scaffolds (SEQ ID NOS:39-44).
[0130] FIG. 18 illustrates the promoter strength of mutant T7
promoters (SEQ ID NOS:47-52). Promoter sequence motif=SEQ ID NO:45;
wild-type (WT) promoter=SEQ ID NO:46.
[0131] FIG. 19 shows the termination strength of mutant
transcriptional terminators (SEQ ID NOS:54-59 and 61-64).
Terminator sequence motif=SEQ ID NO:53; wild-type (WT)
terminator=SEQ ID NO:60.
[0132] FIG. 20 illustrates orthogonal RNAP:promoter combinations
(SEQ ID NOS:65, 46 AND 66-71). FIG. 20A shows the phage genome
based specificity loops. FIG. 20B shows the orthogonality of the
RNAP:promoter combinations.
[0133] FIG. 21 shows that T7 (SEQ ID NOS:73-78) and T3 (SEQ ID
NOS:79-84) RNAPs are orthogonal to combinatorial promoters with
phage-specific recognition domains. Partial promoter sequence=SEQ
ID NO:72.
[0134] FIG. 22 illustrates a block diagram that illustrates
components of an exemplary computing system that may be utilized
according to various embodiments described herein.
[0135] FIG. 23 illustrates a schematic for various repressor
construct design. Also illustrated are graphs showing variation
between promoters in the absence of a heterologous spacer 5' UTR
sequence.
[0136] FIG. 24 illustrates a schematic for a construct used to
screen for 5' UTR spacers as well as a graphical representation of
the results from a number of spacers.
[0137] FIG. 25 illustrates a schematic representation of a
construct containing the riboJ 5' UTR spacer and graphically shows
how the RiboJ spacer results in repeatable results for different
promoters.
[0138] FIG. 26 shoes three AND gate designs.
[0139] FIG. 27 shows the orthogonality of various gates.
[0140] FIG. 28 shows a 4-input AND gate design.
[0141] FIG. 29 illustrates consensus sequences for the AmeR, ArpA,
BarA, BarB, ButR, CasR, DhaR, EnvR, and McbR (SEQ ID NOS:85, 38 and
86-95).
[0142] FIG. 30 illustrates design of a RBS library (SEQ ID NO:96)
to select for those constructs exhibiting a high `ON` state and a
low `OFF` state. Exemplary results are shown on the right.
[0143] FIG. 31 illustrates a heat map showing that AmtR, BarB,
BetI, ButR, BM3R1, CymR, IcaR, LmrA, McbR, Ph1F, QacR, TarA, and
TetR repressors were orthogonal; high-levels of repression are
observed only in the presence of the properly matched
repressor.
DETAILED DESCRIPTION
I. Introduction
[0144] Engineering synthetic gene circuits requires a library of
"parts" that serve to regulate gene expression and can be reliably
combined together to build complex programs. Transcriptional
regulatory elements (e.g. promoters) are a "part" that control gene
expression by regulating the rate of mRNA production. Large genetic
circuits can require many promoters that can be individually
controlled. This enables conditional control of gene expression
across a circuit. A library of orthogonal promoter systems in which
regulators target specific promoters with no cross-talk across the
circuit is thus useful in design of genetic circuits.
[0145] Methods of generating a "toolbox" of genetic components and
for subsequent design of genetic circuits are provided. Orthogonal
components for use in a genetic circuit can be identified by
providing a set of sequence-specific DNA binding polypeptides,
identifying their target DNA sequences (i.e., the DNA sequences
that the polypeptides bind), and designing a set of orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
cognate pairs. Generation of the set of orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
cognate pairs provides a "toolbox" from which genetic circuits can
then be made by using the cognate pairs to generate a system of
Boolean logic gates as desired.
[0146] In some embodiments, the methods comprise:
[0147] Providing a set of sequence-specific DNA binding
polypeptides;
[0148] Optimizing expression of the polypeptides in a heterologous
host cell (e.g., the host cell species in which the genetic circuit
will eventually be employed);
[0149] Identifying the full complement of target DNA sequences
bound by at least a subset of the sequence-specific DNA binding
polypeptides; and
[0150] Designing a set of orthogonal sequence-specific DNA binding
polypeptide-target DNA sequence cognate pairs (i.e. a set in which
each pair regulates only itself and not other members of the
set).
[0151] Subsequently, the cognate pairs can be selected for use in a
genetic circuit. Because the cognate pairs are part of the
orthogonal set, the cognate pairs can be used in combinations
(e.g., 2, 3, 4, 5, 6, 7, 8, 9, or more cognate pairs) from the
orthogonal set without interference from each other. Once designed,
the genetic circuit can be deployed in a host cell and further
tested for unintended interactions within the circuit and/or with
the host cell transcriptional regulatory system.
II. Sequence-Specific DNA Binding Polypeptides
[0152] Several classes of sequence-specific DNA binding
polypeptides have been described in detail here to exemplify
sequence-specific DNA binding polypeptides. However, it should be
appreciated that similar technical approaches can be used to design
other classes of sequence-specific DNA binding polypeptides for use
in the methods described herein.
[0153] Sets of sequence-specific DNA binding polypeptides, i.e., a
plurality of different sequence-specific DNA binding polypeptides,
optionally having sequence similarity or otherwise being of the
same class of regulatory factor, can be generated as desired. In
some embodiments, one or more pre-selected (e.g., by a third party)
set of sequence-specific DNA binding polypeptides is provided.
Alternatively, or in combination, in some embodiments,
sequence-specific DNA binding polypeptides can be identified from
one or more sequence database (e.g., NCBI, etc.). A variety of
algorithms are available for identification of sequence-specific
DNA binding polypeptides. For example, sequence similarity
algorithms (e.g., BLAST and the like) can be used to identify amino
acid sequence similarity in a database to a known sequence-specific
DNA binding polypeptide. In some embodiments, for example, the
algorithm identifies sequence-specific DNA binding polypeptide
based on a phylogenetic tree.
[0154] Generation of the set of sequence-specific DNA binding
polypeptides can include increasing, and in some cases, maximizing
the diversity within the set. Said another way, given a finite and
possibly limited number of members of a set, the members can be
selected to be as different from each other as possible. For
example, in some embodiments, a phylogenetic tree is used to
maximize diversity between sequence-specific DNA binding
polypeptides in a library. In some embodiments, the algorithm
identifies sequence-specific DNA binding polypeptide based on their
predicted ability to bind to different target DNA sequences.
[0155] In some embodiments, the algorithm can predict the ability
of a sequence-specific DNA binding polypeptide to bind to different
target DNA sequences if expression of the gene encoding the
sequence-specific DNA binding polypeptide is autoregulated. For
example, most ECF sigmas are autoregulated; i.e. the gene encoding
the sigma is regulated by a promoter recognized by the same ECF
sigma. ECF sigma factors in the same ECF subgroup recognize the
same promoter sequence, since their DNA binding sequences are
highly conserved within each group. Consequently, promoters can be
identified for each subgroup by searching the upstream regulatory
regions for conserved motifs. In one example, the following steps
can be performed wholly or partially by a computer system to
determine target sequence motifs of autoregulated DNA-binding
polypeptides that bind to 2-block motifs:
[0156] 1) For each subgroup of a sequence-specific DNA binding
polypeptide (i.e., a subgroup for which it is expected all members
bind the same conserved target DNA sequence), one can generate a
set of upstream regulatory sequences by extracting the DNA
sequences upstream of each gene encoding the DNA binding
polypeptides (for example, 100, 200, 300, 400, 500, 1000 nt or more
upstream of the gene to the gene start) based on the bacterial
genomic sequences archived in a database (e.g., NCBI). The
generated sequence sets can be stored in memory for subsequent
retrieval (e.g., in a database with labels identifying sequences of
a respective sequence set).
[0157] 2) Search each sequence set for conserved over-represented
motifs. For example, a process of the computer system can use an
algorithm to search the database of sequence sets. An exemplary
algorithm is a 2-block motif finding algorithm (including but not
limited to BioProspector (Liu et al 2001: Liu X, Brutlag D L, Liu J
S. Pac Symp Biocomput. 2001; :127-38)). This search allows one to
search for two conserved sequence blocks separated by a variable
length non-conserved spacer region. An exemplary search parameter
representing the structure of ECF promoters would be: <block
1><spacer><block 2>, where block 1 is 7 nt in
length, block 2 is 5 nt in length, and the spacer length varies
from 13-15 nt.
[0158] 3) For each sequence set, the highest scoring 2-block motif
is selected by the processor to represent the target sequence
motifs for that sequence-specific DNA binding polypeptide subgroup.
Because the motif sizes can vary slightly between different
sequence-specific DNA binding polypeptide subgroups, in some
embodiments, optimal motifs are identified by performing multiple
searches with slightly different <block
1><spacer><block 2> parameters.
[0159] 4) For each sequence-specific DNA binding polypeptide
subgroup: A sequence model can be constructed by the processor
based on the highest scoring 2-block model. An exemplary model for
ECF sigma promoters would be where block 1 represents the promoter
-35 region; block 2 represents the promoter -10 region; the
variable spacer length is used to construct a histogram of spacer
lengths.
[0160] 5) The sequence model can then be used by the processor to
generate a Position Weight Matrix (PWM)-based scoring model to
identify and score new sequences. An exemplary scoring model for
ECF sigma promoters would be separate PWMs constructed based on the
aligned -35 and -10 motifs and a spacer penalty termed for
suboptimal spacer lengths based on the spacer histograms.
[0161] The above steps can be varied or adapted as necessary for
the particular type of sequence-specific DNA binding polypeptide
examined.
[0162] In addition to use of native or randomly mutated
sequence-specific DNA binding polypeptides, it should also be
appreciated that the sequence-specific DNA binding polypeptide can
be modified to increase recruitment of RNA polymerase to DNA bound
by the sequence-specific DNA-binding polypeptide. As an example,
one can modify the sequence-specific DNA binding polypeptides by
addition of a transcription factor domain known to recruit RNA
polymerase. For example, the C-terminal amino acid sequence of the
VP16 transcription factor can be linked to the sequence-specific
DNA binding polypeptide.
[0163] A. Transcriptional Activators
[0164] i. General
[0165] As noted above, it is believed that any class of
transcriptional activators can be adapted for use in the methods
described herein.
[0166] ii. Sigma Factors
[0167] In some embodiments, the sequence-specific DNA binding
polypeptide is a sigma (.sigma.) factor. Sigma factors recruit RNA
polymerase (RNAP) to specific promoter sequences to initiate
transcription. The .sigma. 70 family consist of 4 groups: Group 1
are the housekeeping .sigma.s and are essential; groups 2-4 are
alternative .sigma.s that direct cellular transcription for
specialized needs (Gruber and Gross 2003). Group 4 .sigma.s (also
known as ECF .sigma.s; extracytoplasmic function) constitute the
largest and most diverse group of .sigma.s, and have been
classified into 43 subgroups (Staron et al., Mol Microbiol 74(3):
557-81 (2009)). The subgroups can be stored in memory (e.g. a
database) of a computer system.
[0168] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise multiple sigma factors. In some
embodiments, the set comprises sigma factors from Group 1, Group 2,
Group 3, and/or Group 4 Sigma factors. The ECF subgroup of Group 4
is thought to recognize different promoter sequences, making these
.sigma.s particularly useful for constructing orthogonal
.sigma.-promoter systems. However, it will be appreciated that any
group of sigma factors can be used according to the methods of the
embodiments of the invention to develop cognate pairs. In some
embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or more
sigma factor from Table 1 (or substantially identical to a sigma
factor in Table 1) is selected for use in an orthogonal set of
cognate pairs and/or in a genetic circuit.
TABLE-US-00001 TABLE 1 Group Nr.sup.a ID.sup.b GI.sup.c
SPECIES.sup.d CLASS.sup.d PHYLUM.sup.d ECF01 >3473 109899616
Pseudoalteromonas atlantica T6c Gammaproteobacteria Proteobacteria
ECF01 >4085 114562024 Shewanella frigidimarina NCIMB 400
Gammaproteobacteria Proteobacteria ECF02 >2817 16130498
Escherichia coli K12 Gammaproteobacteria Proteobacteria ECF02
>915 119774011 Shewanella amazonensis SB2B Gammaproteobacteria
Proteobacteria ECF03 >1198 29350055 Bacteroides thetaiotaomicron
VPI-5482 Bacteroidetes ECF03 >1244 34541012 Porphyromonas
gingivalis W83 Bacteroidetes ECF04 >1609 21673117 Chlorobium
tepidum TLS Chlorobi ECF04 >1617 68549683 Pelodictyon
phaeoclathratiforme BU-1 Chlorobi ECF05 >965 28868416
Pseudomonas syringae pv. tomato str. DC3000 Gammaproteobacteria
Proteobacteria ECF05 >1054 67154316 Azotobacter vinelandii AvOP
Gammaproteobacteria Proteobacteria ECF06 >3576 15595669
Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria
ECF06 >853 26987094 Pseudomonas putida KT2440
Gammaproteobacteria Proteobacteria ECF07 >980 67154823
Azotobacter vinelandii AvOP Gammaproteobacteria Proteobacteria
ECF07 >1134 15598606 Pseudomonas aeruginosa PAO1
Gammaproteobacteria Proteobacteria ECF08 >3580 15595872
Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria
ECF08 >3627 70730114 Pseudomonas fluorescens Pf-5
Gammaproteobacteria Proteobacteria ECF09 >3581 15597622
Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria
ECF09 >1009 70730971 Pseudomonas fluorescens Pf-5
Gammaproteobacteria Proteobacteria ECF10 >3486 77360766
Pseudoalteromonas haloplanktis TAC125 Gammaproteobacteria
Proteobacteria ECF10 >2914 88706154 gamma proteobacterium KT 71
Gammaproteobacteria Proteobacteria ECF11 >3726 28868260
Pseudomonas syringae pv. tomato str. DC3000 Gammaproteobacteria
Proteobacteria ECF11 >987 28899132 Vibrio parahaemolyticus RIMD
2210633 Gammaproteobacteria Proteobacteria ECF12 >807 86158800
Anaeromyxobacter dehalogenans 2CP-C Deltaproteobacteria
Proteobacteria ECF12 >808 108762328 Myxococcus xanthus DK 1622
Deltaproteobacteria Proteobacteria ECF13 >1146 33152898
Haemophilus ducreyi 35000HP Gammaproteobacteria Proteobacteria
ECF13 >1025 37524103 Photorhabdus luminescens subsp. laumondii
TTO1 Gammaproteobacteria Proteobacteria ECF14 >3200 15608361
Mycobacterium tuberculosis H37Rv Actinobacteria ECF14 >1324
21223516 Streptomyces coelicolor A3(2) Actinobacteria ECF15 >436
77464848 Rhodobacter sphaeroides 2.4.1 Alphaproteobacteria
Proteobacteria ECF15 >524 16127705 Caulobacter crescentus CB15
Alphaproteobacteria Proteobacteria ECF16 >3622 104782321
Pseudomonas entomophila L48 Gammaproteobacteria Proteobacteria
ECF16 >973 161378140 Pseudomonas putida KT2440
Gammaproteobacteria Proteobacteria ECF17 >1691 15607875
Mycobacterium tuberculosis H37Rv Actinobacteria ECF17 >1458
21221399 Streptomyces coelicolor A3(2) Actinobacteria ECF18
>4451 21230791 Xanthomonas campestris pv. campestris str. ATCC
Gammaproteobacteria Proteobacteria 33913 ECF18 >4438 21242133
Xanthomonas axonopodis pv. citri str. 306 Gammaproteobacteria
Proteobacteria ECF19 >3197 15607586 Mycobacterium tuberculosis
H37Rv Actinobacteria ECF19 >1315 21219164 Streptomyces
coelicolor A3(2) Actinobacteria ECF20 >992 70731405 Pseudomonas
fluorescens Pf-5 Gammaproteobacteria Proteobacteria ECF20 >2913
88706222 gamma proteobacterium KT 71 Gammaproteobacteria
Proteobacteria ECF21 >1280 29350128 Bacteroides thetaiotaomicron
VPI-5482 Bacteroidetes ECF21 >2825 89889680 Flavobacteria
bacterium BBFL7 Bacteroidetes ECF22 >4450 21232074 Xanthomonas
campestris pv. campestris str. ATCC Gammaproteobacteria
Proteobacteria 33913 ECF22 >1147 21243541 Xanthomonas axonopodis
pv. citri str. 306 Gammaproteobacteria Proteobacteria ECF23 >231
15895043 Clostridium acetobutylicum ATCC 824 Firmicutes ECF23
>1851 30261806 Bacillus anthracis str. Ames Firmicutes ECF24
>69 16079737 Bacillus subtilis subsp. subtilis str. 168
Firmicutes ECF24 >1034 32470052 Escherichia coli
Gammaproteobacteria Proteobacteria ECF25 >1645 170078575
Synechococcus sp. PCC 7002 Cyanobacteria ECF25 >1643 17230772
Nostoc sp. PCC 7120 Cyanobacteria ECF26 >4464 58581966
Xanthomonas oryzae pv. oryzae KACC10331 Gammaproteobacteria
Proteobacteria ECF26 >837 77459110 Pseudomonas fluorescens PTO-1
Gammaproteobacteria Proteobacteria ECF27 >4265 21222299
Streptomyces coelicolor A3(2) Actinobacteria ECF27 >1331
31795084 Mycobacterium bovis AF2122/97 Actinobacteria ECF28
>1088 114563849 Shewanella frigidimarina NCIMB 400
Gammaproteobacteria Proteobacteria ECF28 >1040 15641058 Vibrio
cholerae O1 biovar eltor str. N16961 Gammaproteobacteria
Proteobacteria ECF29 >371 13476734 Mesorhizobium loti MAFF303099
Alphaproteobacteria Proteobacteria ECF29 >2688 71281387
Colwellia psychrerythraea 34H Gammaproteobacteria Proteobacteria
ECF30 >35 16079766 Bacillus subtilis subsp. subtilis str. 168
Firmicutes ECF30 >83 18309341 Clostridium perfringens str. 13
Firmicutes ECF31 >2963 85713274 Idiomarina baltica OS145
Gammaproteobacteria Proteobacteria ECF31 >34 16080921 Bacillus
subtilis subsp. subtilis str. 168 Firmicutes ECF32 >1122 4581629
Erwinia amylovora Gammaproteobacteria Proteobacteria ECF32 >3724
28868612 Pseudomonas syringae pv. tomato str. DC3000
Gammaproteobacteria Proteobacteria ECF33 >375 27378153
Bradyrhizobium japonicum USDA 110 Alphaproteobacteria
Proteobacteria ECF33 >423 39934888 Rhodopseudomonas palustris
CGA009 Alphaproteobacteria Proteobacteria ECF34 >3302 77164965
Nitrosococcus oceani ATCC 19707 Gammaproteobacteria Proteobacteria
ECF34 >1384 21218750 Streptomyces coelicolor A3(2)
Actinobacteria ECF35 >3582 15598092 Pseudomonas aeruginosa PAO1
Gammaproteobacteria Proteobacteria ECF35 >1119 24375055
Shewanella oneidensis MR-1 Gammaproteobacteria Proteobacteria ECF36
>3196 15609206 Mycobacterium tuberculosis H37Rv Actinobacteria
ECF36 >1595 21219385 Streptomyces coelicolor A3(2)
Actinobacteria ECF37 >3390 89094252 Oceanospirillum sp. MED92
Gammaproteobacteria Proteobacteria ECF37 >2513 83718468
Burkholderia thailandensis E264 Betaproteobacteria Proteobacteria
ECF38 >1322 21222029 Streptomyces coelicolor A3(2)
Actinobacteria ECF38 >1442 152967344 Kineococcus radiotolerans
SRS30216 Actinobacteria ECF39 >1438 21223369 Streptomyces
coelicolor A3(2) Actinobacteria ECF39 >2973 84494624 Janibacter
sp. HTCC2649 Actinobacteria ECF40 >3198 15610550 Mycobacterium
tuberculosis H37Rv Actinobacteria ECF40 >1380 62389491
Corynebacterium glutamicum ATCC 13032 Actinobacteria ECF41 >491
16127496 Caulobacter crescentus CB15 Alphaproteobacteria
Proteobacteria ECF41 >1141 77459658 Pseudomonas fluorescens
PfO-1 Gammaproteobacteria Proteobacteria ECF42 >3583 15596548
Pseudomonas aeruginosa PAO1 Gammaproteobacteria Proteobacteria
ECF42 >4454 77747962 Xanthomonas campestris pv. campestris str.
ATCC Gammaproteobacteria Proteobacteria 33913 ECF43 >4437
21244845 Xanthomonas axonopodis pv. citri str. 306
Gammaproteobacteria Proteobacteria ECF43 >3477 109897287
Pseudoalteromonas atlantica T6c Gammaproteobacteria
Proteobacteria
[0169] In addition to native sigma factors, chimeric or other
variant sigma factors can also be used in the method of the
invention. For example, in some embodiments, one or more sigma
factor are submitted to mutation to generate library of sigma
factor variants and the resulting library can be screen for novel
DNA binding activities.
[0170] In some embodiments, chimeric sigma factors formed from
portions of two or more sigma factors can be used. Accordingly,
embodiments of the invention provide for generating a library of
polynucleotides encoding chimeric sigma factors, wherein the
chimeric sigma factors comprise a domain from at least two
different sigma factors, wherein each of the domains bind to the
-10 or -35 region of a regulatory element; and expressing chimeric
sigma factors from the library of polynucleotides, thereby
generating a library of chimeric sigma factors. For example, in
some embodiments, chimeric sigma factors are generated comprising a
"Region 2" from a first sigma factor and a "Region 4" from a second
sigma factor, thereby generating chimeric sigma factors with novel
DNA binding activities. "Region 2" of sigma factors is a conserved
domain that recognizes -10 regions of promoters. "Region 4" is a
conserved domain of sigma factors that recognizes -35 regions of
promoters. It will be appreciated that chimeric sigma factors can
be generated from any two native sigma factors that bind different
target DNA sequences (e.g., different promoter sequences). As noted
in the Examples, it has been found that chimeric sigma factors
formed from the ECF2 and ECF11 subgroups have unique DNA binding
activities useful for generating orthogonal sets as described
herein. Exemplary chimeric sigma factors include, but are not
limited to, ECF11_ECF02 (containing amino acids 1-106 from
ECF02.sub.--2817 and 122-202 from ECF11.sub.--3726) and ECF02_ECF11
(containing amino acids 1-121 from ECF11.sub.--3726 and 107-191
from ECF02.sub.--2817).
[0171] The ECF11_ECF02 amino acid sequence (SEQ ID NO:97) is as
follows:
TABLE-US-00002 1
MRITASLRTFCHLSTPHSDSTTSRLWIDEVTAVARQRDRDSFMRIYDHFAPRLLRYLTGL 61
NVPEGQAEELVQEVLLKLWHKAESFDPSKASLGTWLFRIARNLYIDSVRKDRGWVQVQNS 121
LEQLERLEAISNPENLMLSEELRQIVFRTIESLPEDLRMAITLRELDGLSYEEIAAIMDC 181
PVGTVRSRIFRAREAIDNKVQPLIRR*
[0172] The ECF02_ECF11 amino acid sequence (SEQ ID NO:98) is as
follows:
TABLE-US-00003 1
MSEQLTDQVLVERVQKGDQKAFNLLVVRYQHKVASLVSRYVPSGDVPDVVQEAFIKAYRA 61
LDSFRGDSAFYTWLYRIAVNTAKNYLVAQGRRPPSSDVDAIEAENFEQLERLEAPVDRTL 121
DYSQRQEQQLNSAIQNLPTDQAKVLRMSYFEALSHREISERLDMPLGTVKSCLRLAFQKL 181
RSRIEES*
[0173] iii. RNA Polymerases
[0174] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise polypeptides having DNA binding
activity and that are a variant of the T7 RNA polymerase (RNAP).
The T7 RNAP amino acid sequence (SEQ ID NO:99) is as follows:
TABLE-US-00004 1 mntiniaknd fsdielaaip fntladhyge rlareqlale
hesyemgear frkmferqlk 61 agevadnaaa kplittllpk miarindwfe
evkakrgkrp tafqflqeik peavayitik 121 ttlacltsad nttvqavasa
igraiedear fgrirdleak hfkknveeql nkrvghvykk 181 afmqvveadm
lskgllggea wsswhkedsi hvgvrcieml iestgmvslh rqnagvvgqd 241
setielapey aeaiatraga lagispmfqp cvvppkpwtg itgggywang rrplalvrth
301 skkalmryed vympevykai niaqntawki nkkvlavanv itkwkhcpve
dipaiereel 361 pmkpedidmn pealtawkra aaavyrkdka rksrrislef
mleqankfan hkaiwfpynm 421 dwrgrvyavs mfnpqgndmt kglltlakgk
pigkegyywl kihgancagv dkvpfperik 481 fieenhenim acaksplent
wwaeqdspfc flafcfeyag vqhhglsync slplafdgsc 541 sgiqhfsaml
rdevggravn llpsetvqdi ygivakkvne ilqadaingt dnevvtvtde 601
ntgeisekvk lgtkalagqw laygvtrsvt krsvmtlayg skefgfrqqv ledtiqpaid
661 sgkglmftqp nqaagymakl iwesysvtvv aaveamnwlk saakllaaev
kdkktgeilr 721 krcavhwvtp dgfpvwqeyk kpiqtrlnlm flgqfrlqpt
intnkdseid ahkqesgiap 781 nfvhsqdgsh lrktvvwahe kygiesfali
hdsfgtipad aanlfkavre tmvdtyescd 841 vladfydqfa dqlhesqldk
mpalpakgnl nlrdilesdf afa
[0175] The T7 RNAP promoter has also been characterized (see, e.g.,
Rong et al., Proc. Natl. Acad. Sci. USA vol. 95 no. 2 515-519
(1998) and is well known.
[0176] As described in the Examples, methods have been discovered
for generating orthogonal pairs of RNAP variants and target
promoter variants. In some embodiments, one (e.g., 1, 2, 3, 4, 5,
6, 7, 8, 9, etc.) or more different RNA polymerases substantially
identical to T7 RNAP is selected for use in an orthogonal set of
cognate pairs and/or in a genetic circuit.
[0177] Due to toxicity of expression of native T7 RNAP, a series of
mutations and modifications were designed such that a library of
RNAP variants could be expressed and tested for activity in cells
without excessive toxicity. Accordingly, embodiments of the
invention provide for one or more of the following modifications
(and thus, for example, an embodiment of the invention provides for
host cells comprising expression cassettes, or nucleic acids
comprising expression cassettes, wherein the expression cassette
encodes a RNAP variant substantially identical to T7 RNAP, wherein
the expression cassette comprises one or more of the
following):
[0178] Expression of the T7 RNAP variant can be expressed from a
low copy plasmid. Expression of the RNAP can be controlled by a
separately encoded protein from a separate vector, thereby blocking
expression of the RNAP until a second vector is added to the cells
promoting RNAP expression;
[0179] Translational control: a GTG start codon; weak ribosomal
binding sites (RBSs), and/or random DNA spacers to insulate RNAP
expression can be used;
[0180] A molecular tag to promote rapid degradation of the RNAP.
For example, an Lon N-terminal tag will result in rapid degradation
of the tagged RNAP by the Lon protease system.
[0181] A mutated RNAP active site (e.g., within amino acids 625-655
of T7 RNAP). For example, it has been discovered that a mutation of
the position corresponding to amino acid 632 (R632) of T7 RNAP can
be mutated to reduce the RNAP's activity. In some embodiments, the
RNAP contains a mutation corresponding to R632S.
[0182] Moreover, a variety of mutant T7 promoters have been
discovered that can be used in a genetic circuit. Thus, in some
embodiments, an expression cassette comprising a promoter operably
linked to a second polynucleotide, wherein the promoter comprises a
mutant sequence as set forth in FIG. 18, is provided. In some
embodiments, a host cell comprises the expression cassette.
[0183] A number of different stem loop structures that function as
terminators for T7 RNAP have been discovered. See, FIG. 19.
Accordingly, an embodiment of the invention provides for expression
cassettes comprising a promoter functional to a native T7 RNAP or
an RNAP substantially identical thereto, wherein the operably lined
polynucleotide encodes a terminator selected from FIG. 19.
[0184] Also provided are RNAP variants comprising and altered
specificity loop (corresponding to positions between 745 and 761.
Thus in some embodiments, an RNAP is provided that is identical or
substantially identical to T7 RNAP but has a Loop Sequence selected
from those in FIG. 20A between positions 745 and 761.
Polynucleotides encoding such RNAPs are also provided. Similarly,
an expression cassette comprising a promoter operably linked to a
polynucleotide encoding such RNAPs are also provided.
[0185] Also provided are expression cassettes comprising a
promoter, which promoter comprises a "Promoter Sequence "selected
from FIG. 20A, operably linked to a second polynucleotide. As
explained in the Examples, FIGS. 20A and 20B set forth orthogonal
cognate pairs of RNAP variants and promoters. These pairs can be
deployed to form genetic circuits as desired.
[0186] iv. Activators Requiring Chaperones
[0187] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise polypeptides having DNA binding
activity and that require a separate chaperone protein to bind the
sequence-specific DNA-binding polypeptide for the sequence-specific
DNA-binding polypeptide to be active. Exemplary transcriptional
activators requiring a chaperone for activity include, but are not
limited to activator is substantially similar to InvF from
Salmonella typhimurium, MxiE from Shigella flexneri, and ExsA from
Pseudomonas aeriginosa. These listed activators require binding of
SicA from Salmonella typhimurium, IpgC from Shigella flexneri, or
ExsC from Pseuodomas aeriginosa, respectively, for activation.
Sequence information for the above components are provides as
follows:
TABLE-US-00005 DNA sequence encoding the named polypeptide Optional
Name Type (SEQ ID NO:) Mutation sicA Gene
Atggattatcaaaataatgtcagcgaagaacgtgttgcggaaatgatttgggatgccgttagtg-
aa
ggcgccacgctaaaagacgttcatgggatccctcaagatatgatggacggtttatatgctcatgctt
atgagttttataaccagggacgactggatgaagctgagacgttctttcgtttcttatgcatttatgattt
ttacaatcccgattacaccatgggactggcggcagtatgccaactgaaaaaacaatttcagaaagc
atgtgacctttatgcagtagcgtttacgttacttaaaaatgattatcgccccgttttttttaccgggcagt
gtcaattattaatgcgtaaggcagcaaaagccagacagtgttttgaacttgtcaatgaacgtactga
agatgagtctctgcgggcaaaagcgttggtctatctggaggcgctaaaaacggcggagacagag
cagcacagtgaacaagaaaaggaataa (100) sicA* Mutant
Atggattatcaaaataatgtcagcgaagaacgtgttgcggaaatgatttgggatgccgttagtgaa
The large sicA
ggcgccacgctaaaagacgttcatgggatccctcaagatatgatggacggtttatatgctcatgctt
"t" of
atgagttttataaccagggacgactggatgaagctgagacgttctttcgttacttatgcatttatgatt
the sicA
tttacaatcccgattacaccatgggactggcggcagtatgccaactgaaaaaacaatttcagaaag
sequence
catgtgacctttatgcagtagcgtttacgttacttaaaaatgattatcgccccgttttttttaccgggca
above was
gtgtcaattattaatgcgtaaggcagcaaaagccagacagtgttttgaacttgtcaatgaacgtact
mutated
gaagatgagtctctgcgggcaaaagcgttggtctatctggaggcgctaaaaacggcggagacag to
"a" agcagcacagtgaacaagaaaaggaataa (101) by error- prone PCR. This
mutation was made to reduce cross talk between SicA and mxiE. invF
Gene Atgctaaatacgcaggaagtacttaaagaaggagagaagcggaaaatccgcagcccggaagc
The with
atggtttatacagacgtgttccgcgcaaaagctgcatatgtcattttctgaaagccgacacaatg
accepted new
aaaattgcctgattcaggaaggcgcgctgcttttttgcgagcaggccgttgtcgcaccagtatcag
start start
gagacctggtttttcgaccgttaaaaattgaagtactcagcaaattactggcatttatcgatggcgc-
a codon (the codon
ggattagtggacacgacatatgctgaatccgataaatgggttttgctgagtcctgagtttcgcgcta-
t large
ttggcaagatcgtaaacgctgcgagtactggtttttgcagcaaattattacgccttctccggccttca
"atg") was
ataaggtactggcgctgttacgaaaaagcgagagttactggttggttggctatttactcgctcagtc
determined
aaccagcggcaacacgatgagaatgctgggagaagactatggcgtttcttatacccattttcgtcgt
to be
ttgtgcagcagagcgttgggcggaaaagcgaagagtgaattacgaaactggcgtatggcgcaat
incorrect
cgctgctgaatagtgtagaaggccacgagaacatcacccaattagccgttaatcatggttactcatc
and a
gccttcacatttttctagtgagatcaaagagctgatcggcgtttcgccgcggaaattatcaaatattat
correct tcaattggcagacaaatga (102) upstream start codon was found.
psicA Promoter
Ccacaagaaacgaggtacggcattgagccgcgtaaggcagtagcgatgtattcattgggcgtttt
ttgaatgttcactaaccaccgtcggggtttaataactgcatcagataaacgcagtcgttaagttctac
aaagtcggtgacagataacaggagtaagta (103) ipgC Gene
Atgtctttaaatatcaccgaaaatgaaagcatctctactgcagtaattgatgcaattaactctg-
gcgc
tacactgaaagatattaatgcaattcctgatgatatgatggatgacatttattcatatgcttatgactttt
acaacaaaggaagaatagaggaagctgaagttttcttcaggtttttatgtatatacgacttttacaatg
tagactacattatgggactcgcagctatttatcagataaaagaacagttccaacaagcagcagacc
tttatgctgtcgcttttgcattaggaaaaaatgactatacaccagtattccatactggacaatgtcagc
ttcggttgaaagcccccttaaaagctaaagagtgcttcgaactcgtaattcaacacagcaatgatga
aaaattaaaaataaaagcacaatcatacttggacgcaattcaggatatcaaggagtaa (104)
mxiE Gene
atgagtaaatataaaggcctgaacaccagcaacatgttctacatctacagctctggtcatgaa- cc
The wide with
ggtgaacgttgaactggtgaaagataaagaacgtaacatcatcgaactggcaccggcgtggaaa
type codon
ggctttttctttgtgcgtaaccagaacatcaaattcagcgataacgttaactaccactacc gene
has optimiz-
gcttcaacatcaactcttgcgcaaaattcctggcgttttgggattattttagcggcgccctggt-
tgaac "ttttttttt" ation
attctcacgcagaaaaatgcatccatttctaccacgaaaacgatctgcgtgatagctgtaatacgga
in this
atctatgctggataaactgatgctgcgcttcatttttagtagcgatcagaacgtgtctaatgccctggc
enlarged
aatgatccgtatgaccgaaagttatcatctggttctgtacctgctgcgtacgattgaaaaagaaaaa
sequence
gaagtgcgcatcaaaagcctgaccgaacactatggcgtttctgaagcgtactttcgtagtctgtgtc
region.
gcaaagcgctgggtgccaaagtgaaagaacagctgaacacgtggcgcctggtgaatggcctgc One
tggatgttttcctgcataaccagaccattacgagcgcggccatgaacaatggttatgcgtctaccag
more "t"
tcacttcagcaatgaaattaaaacgcgtctgggctttagtgcccgcgaactgagcaacatcaccttc
was added ctggtgaagaaaattaatgaaaaaatctaa (105) to make "tttttttttt"
and then the entire gene was codon optimized by GenScript. The
addition- al "t" was added to make this ORF in-frame. In addi-
tion, the wide-type gene starts with "g" and this synthetic gene
starts with "a." pip.alpha.H9.8 Promoter
gcgaaaatgacatcaaaaacgccattaacctgatgttctggggaatataaatgtcaggctagggtc
aaaaatcgtggcgttgacaaaatggctgcgttacgtcattgagcatatccaggactggccggcaa
accgggtacgcgatctgttgccttggaaagttgatctgacctctcagtaaatatcaatacggttctga
cgagccgcttaccgttcaaatatgaagtacgatgtttaactaaccgaaaaacaagaacaatacggt
gcaaacaggccattcacggttaactgaaacagtatcgtttttttacagccaattttgtttatccttattat
aataaaaaagtgct (106) pip.alpha.H9.8* Promoter
gcgaaaatgacatcaaaaacgccattaacctgatgttctggggaatataaatgtcaggctagggtc
The with
aaaaatcgtggcgttgacaaaatggctgcgttacgtcattgagcatatccaggactggccggcaa
enlarged mutation
accgggtacgcgatctgttgccttggaaagttgatctgacctctcagtaaatatcaatacggtt-
ctga "ta"
cgagccgcttaccgttcaaatatgaagtacgatgtttaactaaccgaaaaacaagaacaatacggt
above of
gcaaacaggccattcacggttaactgaaacagtatcgtttttttacagccaattttgtttatccttatta
pip.alpha.H9.8 agataaaaaagtgct (107) was mutated to "ag" by
saturation mutagenesis. This muta- tion was made to reduce leaky
expression of pip.alpha.H9.8. exsC Gene
atggatttaacgagcaaggtcaaccgactgcttgccgagttcgcaggccgtatcggtttgcctt-
cc ctgtccctcgacgaggagggcatggcgagcctcctgttcgacgaacaggtgggcgtcaccctgt
tgctgctcgccgagcgcgagcgtctgttgctggaggccgatgtggcgggcatcgatgtgctggg
cgaggggatctttcgccagctcgccagcttcaaccgccattggcaccgtttcgatctgcatttcggc
ttcgacgagctgaccggcaaggtccagttgtatgcgcagattctcgcagcgcaactgaccctcga
atgcttcgaggcgaccttggccaatctgctcgatcacgccgagttctggcagcgcctgctgccgt
gcgacagtgatcgcgaggcggtcgctgcggtcggcatgagggtttga (108) exsD Gene
atggagcaggaagacgataagcagtactcccgagaagcggtgttcgctggcaggcgggtatcc
gtggtgggctcggacgcccgctcgcggggtcgggtgccgggttacgcatcgagcagtttgtatc
gtgagtccggaatcatcagtgcgcggcaactggcgttgctgcagcggatgctgccgcgcctgcg
gctggagcaactgttccgctgcgagtggttgcagcagcgcctggcgcgcggcctggcgctggg
gcgcgaagaggtgcggcagattctcctctgcgcggcgcaggacgacgacggctggtgctccga
actgggcgaccgggtcaacctcgccgtgccgcagtcgatgatcgactgggtcctgctgccggtc
tatggctggtgggaaagcctgctcgaccaggcgatccccggctggcgcctgtcgctggtggagc
tggagacccagtcccggcaactgcgagtcaagtccgaattctggtcccgcgtggccgagctgga
gccggagcaggcccgcgaggaactggccagggtcgccaagtgccaggcgcgcacccagga
acaggtggccgaactggccggcaagctggagacggcttcggcactggcgaagagcgcctggc
cgaactggcagcggggcatggcgacgctgctcgccagcggcgggctggccggcttcgagccg
atccccgaggtcctcgaatgcctctggcaacctctctgccggctggacgacgacgtcggcgcgg
cggacgccgtccaggcctggctgcacgaacgcaacctgtgccaggcacaggatcacttctactg
gcagagctga (109) exsA Gene
atgcaaggagccaaatctcttggccgaaagcagataacgtcttgtcattggaacattccaactt-
tcg
aatacagggtaaacaaggaagagggcgtatatgttctgctcgagggcgaactgaccgtccagga
catcgattccactttttgcctggcgcctggcgagttgcttttcgtccgccgcggaagctatgtcgtaa
gtaccaagggaaaggacagccgaatactctggattccattatctgcccagtttctacaaggcttcgt
ccagcgcttcggcgcgctgttgagtgaagtcgagcgttgcgacgagcccgtgccgggcatcatc
gcgttcgctgccacgcctctgctggccggttgcgtcaaggggttgaaggaattgcttgtgcatgag
catccgccgatgctcgcctgcctgaagatcgaggagttgctgatgctcttcgcgttcagtccgcag
gggccgctgctgatgtcggtcctgcggcaactgagcaaccggcatgtcgagcgtctgcagctatt
catggagaagcactacctcaacgagtggaagctgtccgacttctcccgcgagttcggcatgggg
ctgaccaccttcaaggagctgttcggcagtgtctatggggtttcgccgcgcgcctggatcagcga
gcggagaatcctctatgcccatcagttgctgctcaacagcgacatgagcatcgtcgacatcgccat
ggaggcgggcttttccagtcagtcctatttcacccagagctatcgccgccgtttcggctgcacgcc
gagccgctcgcggcaggggaaggacgaatgccgggctaaaaataactga (110) pexsD
Promoter
gaaggacgaatgccgggctaaaaataactgacgttttttgaaagcccggtagcggctgcatgagt
agaatcggcccaaat (111) pexsC Promoter
gatgtggcttttttcttaaaagaaaagtctctcagtgacaaaagcgatgcatagcccggtgctagca
tgcgctgagcttt (112) rfp Gene
atggcttcctccgaagacgttatcaaagagttcatgcgtttcaaagttcgtatggaaggttccgt-
taa
cggtcacgagttcgaaatcgaaggtgaaggtgaaggtcgtccgtacgaaggtacgcagaccgct
aaactgaaagttaccaaaggtggtccgctgccgttcgcttgggacatcctgtccccgcagttccag
tacggttccaaagcttacgttaaacacccggctgacatcccggactacctgaaactgtccttcccg
gaaggtttcaaatgggaacgtgttatgaacttcgaagacggtggtgttgttaccgttacccaggact
cctccctgcaagacggtgagttcatctacaaagttaaactgcgtggtactaacttcccgtccgacg
gtccggttatgcagaaaaaaaccatgggttgggaagcttccaccgaacgtatgtacccggaagac
ggtgctctgaaaggtgaaatcaaaatgcgtctgaaactgaaagacggtggtcactacgacgctga
agttaaaaccacctacatggctaaaaaaccggttcagctgccgggtgcttacaaaaccgacatca
aactggacatcacctcccacaacgaagactacaccatcgttgaacagtacgaacgtgctgaaggt
cgtcactccaccggtgctgcagcaaacgacgaaaactacgcttaa (113)
In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or
more transcriptional activators requiring chaperones (e.g., those
substantially identical to a transcriptional activator listed
above), as well as its corresponding chaperone is selected for use
in an orthogonal set of cognate pairs and/or in a genetic
circuit.
[0188] B. Transcriptional Repressors
[0189] i. General
[0190] It is believed that any class of transcriptional repressors
can be adapted for use in the methods described herein.
[0191] ii. Tet Repressors
[0192] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise polypeptides having DNA binding
activity and that are a variant of the Tet Repressor (Tet.sup.R).
The Tet R protein and operator sequences are provided in, e.g.,
Postle et al., Nucl. Acid Res. 12:4849-4863 (1984); Hillen et al.,
Ann. Rev. Microbiol. 48:345-369 (1994); Wissmann et al., J. Mol.
Biol. 202:397-406 (1988)). A wide variety of organisms have
repressor proteins with homology to Tet.sup.R that bind target DNA
sequences other than the classical Tet operator. Thus, a diversity
of Tet.sup.R homologs are available to generate a set of
polypeptides that are substantially identical to Tet.sup.R. As
demonstrated in the Examples, Tet.sup.R homologs can be identified
in metagenomic gene searches and then tested to determine their
target DNA sequence(s) (as further discussed below). Table 2
provides a selected (non-limiting) list of potential Tet.sup.R
homologs. Table 3 provides a list target DNA sequences (labeled in
the table as "operators") to which the listed Tet.sup.R homologs
bind.
TABLE-US-00006 TABLE 2 Repressor SwissProt ID Organism AcrR P0ACT0
Escherichia coli AmeR Q9F8V9 Agrobacterium tumefaciens AmrR Q9RG61
Pseudomonas aeruginosa AmtR Q9S3L4 Corynebacterium glutamicum ArpA
Q54189 Streptomyces griseus ArpR Q9KJC4 Pseudomonas putida BarA
Q9LBV6 Streptomyces virginiae BarB O24739 Streptomyces virginiae
BetI P17446 Escherichia coli BM1P1 O68276 Bacillus megaterium BM3R1
P43506 Bacillus megaterium BpeR Q6VV70 Burkholderia pseudomallel
ButR Q9AJ68 Streptomyces cinnamonensis CalR1 Q8KNI9 Micromonospora
echinospora CampR Q93TU7 Rhodococcus erythropolis CasR Q9F6W0
Rhizobium etli CprB O66129 Micrococus luteus CymR O33453 Psudomonas
putida Cyp106 Q59213 Bacillus megaterium DhaR Q9RAJ1 Mycobacterium
sp. GP1 Ef0113 Q8KU49 Enterococcus faecalis EnvR P0ACT2 Escherichia
coli EthR P96222 Mycobacterium tubercolosis FarA O24741
Streptomyces lavendulae HapR O30343 Vibrio cholerae HemR P72185
Propionibacterium freudenreichii HlyIIR Q63B57 Bacillus cereus IcaR
Q9RQQ0 Staphylococcus aureus IcaR Q8GLC6 Staphylococcus epidermidis
IfeR O68442 Agrobacterium tumefaciens JadR2 Q56153 Streptomyces
venezuelae KstR Q9RA03 Rhodococcus erythropolis LanK Q9ZGB7
Streptomyces cyanogenus LitR Q8KX64 Vibrio fischeri LmrA O34619
Bacillus subtilis LuxT Q9ANS7 Vibrio harveyi McbR Q8NLK1
Corynebacterium glutamicum MmfR Q9JN89 Streptomyces coelicolor MphB
Q9ZN97 Escherichia coli MphR Q9EVJ6 Escherichia coli MtrR P39897
Neisseria gonorrhoeae NonG Q9XDF0 Streptomyces griseus OpaR O50285
Vibrio parahaemolyticus Orf2 Q9XDV7 Streptomyces griseus orfL6
Q8VV87 Terrabacter sp. DBF63 PaaR Q9FA56 Azoarcus evanssi PhaD
Q9F9Z7 Pseudomonas resinovorans PhlF Q9RF02 Pseudomonas fluorescens
PqrA Q9F147 Streptomyces coelicolor PsbI Q9XDW2 Rhodopseudomonas
palustris PsrA Q9EX90 Pseudomonas putida Q9ZF45 Q9ZF45 Lactococcus
lactis QacR P0A0N4 Staphylococcus aureus RmrR Q9KIH5 Rhizobium etli
ScbR O86852 Streptomyces coelicolor SmcR Q9L8G8 Vibrio vulnificus
SmeT Q8KLP4 Stenotropomonas maltophilia SrpR Q9R9T9 Pseudomonas
putida TarA Q9RPK9 Streptomyces tendae TcmR P39885 Streptomyces
glaucescens ThlR O85706 Clostridium acetobutylicum TtgR Q9AIU0
Pseudomonas putida TtgW Q93PU7 Pseudomonas putida TylP Q9XCC7
Streptomyces fradiae TylQ Q9ZHP8 Streptomyces fradiae UidR P0ACT6
Escherichia coli UrdK Q9RP98 Streptomyces fradiae Tu2717 VanT
Q8VQC6 Vibrio anguillarum VarR Q9AJL5 Streptomyces virginiae YdeS
P96676 Bacillus subtilis YDH1 P22645 Xanthobacter autotrophicus
YixD P32398 Bacillus subtilis YjdC P0ACU7 Escherichia coli
TABLE-US-00007 TABLE 3 Repressor Operator sequence (SEQ ID NO:)
Length McbR TGAACAGCTTGGTCTA (114) 16 UidR CTATTGGTTAACCAATTT (115)
18 BM3R1 CGGAATGAACGTTCATTCCG (116) 20 AmtR ATTATCTATAGATCGATAGAAA
(117) 22 BetI TTATATTGAACGTCCAATGAAT (118) 22 HapR
TTATTGATTTTTAATCAAATAA (119) 22 HlyIIR TTTAAACAAGAATTTTAAATAT (120)
22 SmcR TTATTGATAAATCTGCGTAAAA (121) 22 AcrR
TACATACATTTATGAATGTATGTA (122) 24 ArpA CGACATACGGGACGCCCCGTTTAT
(123) 24 LmrA AGATAATAGACCAGTCACTATATT (124) 24 BarA
AGATACATACCAACCGGTTCTTTTGA (125) 26 QacR CTTATAGACCGATCGCACGGTCTATA
(126) 26 TyIP ATACAAACCGCGTCAGCGGTTTGTAA (127) 26 MtrR
TTTTTATCCGTGCAATCGTGTATGTAT (128) 27 FarA
GATACGAACGGGACGGACGGTTTGCAGC (129) 28 IcaR Se
ACAACCTAACTAACGAAAGGTAGGTGAA (130) 28 ScbR
GAAAAAAAACCGCTCTAGTCTGTATCTTA (131) 29 PhIF
ATGATACGAAACGTACCGTATCGTTAAGGT (132) 30 SmeT
GTTTACAAACAAACAAGCATGTATGTATAT (133) 30 MphR
GAATATAACCGACGTGACTGTTACATTTAGG (134) 31 LuxT
TTCGGTTTACTTTGTTTAGAATACCCACGTCT (135) 32 PsrA
AGCAGGGCTGAAACGTATGTTTCAAACACCTGTTTCTG (136) 38 TtgR
CAGCAGTATTTACAAACAACCATGAATGTAAGTATATTCC (137) 40 VarR
CACTTGTACATCGTATAACTCTCATATACGTTGTAGAACAG 41 (138) EthR
GTGTCGATAGTGTCGACATCTCGTTGACGGCCTCGACATTACG 55 TTGATAGCGTGG
(139)
In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, etc.) or
more repressors from Table 2 (or substantially identical to a
repressor in Table 2) is selected for use in an orthogonal set of
cognate pairs and/or in a genetic circuit.
[0193] iii. Tal Effectors
[0194] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise Tal effectors. The plant
pathogenic bacteria of the genus Xanthomonas are known to cause
many diseases in important crop plants. Pathogenicity of
Xanthomonas depends on a conserved type III secretion (T3S) system
which injects more than 25 different effector proteins into the
plant cell. Among these injected proteins are transcription
activator-like (TAL) effectors which mimic plant transcriptional
activators and manipulate the plant transcript (see Kay et al
(2007) Science 318:648-651). These proteins contain a DNA binding
domain and a transcriptional activation domain. One of the most
well characterized TAL-effectors is AvrBs3 from Xanthomonas
campestgris pv. Vesicatoria (see Bonas et al (1989) Mol Gen Genet.
218: 127-136 and WO2010079430). TAL-effectors contain a centralized
domain of tandem repeats, each repeat containing approximately 34
amino acids, which control the DNA binding specificity of these
proteins. In addition, they contain a nuclear localization sequence
and an acidic transcriptional activation domain (for a review see
Schornack S, et al (2006) J Plant Physiol 163(3): 256-272).
[0195] Specificity of TAL effectors depends on the sequences found
in the tandem repeats. The repeated sequence comprises
approximately 102 bp and the repeats are typically 91-100%
homologous with each other. Polymorphism of the repeats is usually
located at positions 12 and 13 and there appears to be a one-to-one
correspondence between the identity of the hypervariable diresidues
at positions 12 and 13 with the identity of the contiguous
nucleotides in the TAL-effector's target sequence (see Moscou and
Bogdanove, (2009) Science 326:1501 and Boch et al (2009) Science
326:1509-1512). Experimentally, the code for DNA recognition of
these TAL-effectors has been determined such that an HD sequence at
positions 12 and 13 leads to a binding to cytosine (C), NG binds to
T, NI to A, C, G or T, NN binds to A or G, and IG binds to T. These
DNA binding repeats have been assembled into proteins with new
combinations and numbers of repeats, to make artificial
transcription factors that are able to interact with new sequences
and activate the expression of a reporter gene in plant cells (Boch
et al (2009) Science 326:1509-1512d). Accordingly, the set of
sequence-specific DNA-binding polypeptides can comprise native or
non-natural Tal effectors.
[0196] In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9,
etc.) or more Tal effectors is selected for use in an orthogonal
set of cognate pairs and/or in a genetic circuit.
[0197] iv. Zinc Fingers
[0198] In some embodiments, the set of sequence-specific
DNA-binding polypeptides comprise zinc finger DNA binding domains.
Zinc finger binding domains can be engineered to recognize and bind
to any nucleic acid sequence of choice. See, for example, Beerli et
al. (2002) Nat. Biotechnol. 20:135-141; Pabo et al. (2001) Ann.
Rev. Biochem. 70:313-340; Isalan et al. (2001) Nat. Biotechnol.
19:656-660; Segal et al. (2001) Curr. Opin. Biotechnol. 12:632-637;
Choo et al. (2000) Curr. Opin. Struct. Biol. 10:411-416; Zhang et
al. (2000) J. Biol. Chem. 275(43):33850-33860; Doyon et al. (2008)
Nat. Biotechnol. 26:702-708; and Santiago et al. (2008) Proc. Natl.
Acad. Sci. USA 105:5809-5814. An engineered zinc finger binding
domain can have a novel binding specificity compared to a
naturally-occurring zinc finger protein. Engineering methods
include, but are not limited to, rational design and various types
of selection. Rational design includes, for example, using
databases comprising doublet, triplet, and/or quadruplet nucleotide
sequences and individual zinc finger amino acid sequences, in which
each doublet, triplet or quadruplet nucleotide sequence is
associated with one or more amino acid sequences of zinc fingers
which bind the particular triplet or quadruplet sequence. See, for
example, U.S. Pat. Nos. 6,453,242 and 6,534,261. Alternative
methods, such as rational design using a nondegenerate recognition
code table may also be used to design a zinc finger binding domain
to target a specific sequence (Sera et al. (2002) Biochemistry
41:7074-7081). Publically available web-based tools for identifying
potential target sites in DNA sequences and designing zinc finger
binding domains may be found at http://www.zincfingertools.org and
http://bindr.gdcb.iastate.edu/ZiFiT/, respectively (Mandell et al.
(2006) Nuc. Acid Res. 34:W516-W523; Sander et al. (2007) Nuc. Acid
Res. 35:W599-W605).
[0199] A zinc finger DNA binding domain may be designed to
recognize a DNA sequence ranging from about 3 nucleotides to about
21 nucleotides in length, or from about 8 to about 19 nucleotides
in length. In some embodiments, the zinc finger binding domains
comprise at least three zinc finger recognition regions (i.e., zinc
fingers). In one embodiment, the zinc finger binding domain may
comprise four zinc finger recognition regions. In another
embodiment, the zinc finger binding domain may comprise five zinc
finger recognition regions. In still another embodiment, the zinc
finger binding domain may comprise six zinc finger recognition
regions. A zinc finger binding domain may be designed to bind to
any suitable target DNA sequence. See for example, U.S. Pat. Nos.
6,607,882; 6,534,261 and 6,453,242.
[0200] Exemplary methods of selecting a zinc finger recognition
region may include phage display and two-hybrid systems, and are
disclosed in U.S. Pat. Nos. 5,789,538; 5,925,523; 6,007,988;
6,013,453; 6,410,248; 6,140,466; 6,200,759; and 6,242,568; as well
as WO 98/37186; WO 98/53057; WO 00/27878; WO 01/88197 and GB
2,338,237. In addition, enhancement of binding specificity for zinc
finger binding domains has been described, for example, in WO
02/077227.
[0201] Zinc finger recognition regions and/or multi-fingered zinc
finger proteins may be linked together using suitable linker
sequences, including for example, linkers of five or more amino
acids in length. See, U.S. Pat. Nos. 6,479,626; 6,903,185; and
7,153,949, for non-limiting examples of linker sequences of six or
more amino acids in length. The zinc finger binding domains
described herein may include a combination of suitable linkers
between the individual zinc fingers of the protein.
[0202] In some embodiments, one (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9,
etc.) or more zinc fingers is selected for use in an orthogonal set
of cognate pairs and/or in a genetic circuit.
III. Optimizing Expression of Sequence-Specific DNA Binding
Polypeptides
[0203] Once a set of sequence-specific DNA binding polypeptides
have been identified, in some embodiments, expression of the
polypeptides is optimized for expression in a heterologous host
cell. Optimization will generally include a determination of
polynucleotides encoding the polypeptides in the set (and ideally
no additional promoter or terminator sequences) and then alteration
of the polynucleotide for expression in the host cell.
[0204] Optimizing involves alteration of one or more codon in the
coding sequence. The codon changes can result in codon optimization
for the host cell, i.e., the cell in which the polynucleotide is to
be expressed for testing and/or for expressing as part of a genetic
circuit. Methods of codon optimization are known (e.g., Sivaraman
et al., Nucleic Acids Res. 36:e16 (2008); Mirzahoseini, et al.,
Cell Journal (Yakhteh) 12(4):453 Winter 2011; U.S. Pat. No.
6,114,148) and can include reference to commonly used codons for a
particular host cell. In some embodiments, one or more codon is
randomized, i.e., a native codon is replaced with a random codon
encoding the same amino acid. This latter approach can help to
remove any cis-acting sequences involved in the native regulation
of the polypeptide. In some embodiments, an algorithm is used to
eliminate transcriptionally functional sequences in a gene encoding
the polypeptide. For example, in some embodiments, ribosome binding
sites, transcriptional regulatory elements, terminators, or other
DNA sequences bound by proteins are removed from the native coding
sequence. Notably, the functional sequences removed can be
functional in the native species (from which the sequence was
originally derived), from the heterologous host cell, or both. In
some embodiments, optimizing comprises removal of sequences in the
native coding sequence that are functional for other
sequence-specific DNA binding polypeptides in the set of
sequence-specific DNA binding polypeptides.
[0205] In some embodiments, as noted above, optimization will
depend on the host cell used. Host cells can be any prokaryotic
cell (including but not limited to E. coli) or eukaryotic cell
(including but not limited to yeast cells, mammalian cells, avian
cells, amphibian cells, plant cells, fish cells, and insect
cells).
[0206] In some embodiments, expression of the sequence-specific DNA
binding polypeptides is optimized for a particular host cell for
production of the polypeptide for testing (e.g., identification of
target DNA sequences of the polypeptides) and also optimized for
expression in a second host cell in which the ultimate genetic
circuit will be expressed.
IV. Identification of Target DNA sequences to which
Sequence-Specific DNA Binding Polypeptides Bind
[0207] Once a set of sequence-specific DNA binding polypeptides
have been provided and expressed, the polypeptides can be tested to
identify DNA sequences to which the polypeptides bind ("target DNA
sequences"). Identification of target DNA sequences can be
performed in vitro or in vivo.
[0208] A. In vitro
[0209] In some embodiments, the target DNA sequence(s) for
polypeptides are determined in vitro. For example,
sequence-specific DNA binding polypeptides can be expressed (e.g.,
via optimized expression from a host cell), optionally purified as
needed, labeled, and contacted to an array of polynucleotides under
conditions to allow for sequence-specific binding of the
polypeptide to any target polynucleotides present on the array. The
location of the label on the array can subsequently to used to
determine the identity of the target polynucleotide bound. A
variety of different arrays (e.g., comprising 100 s, to 1000 s,
millions, or more polynucleotides) can be used. In some
embodiments, microarray technology is used.
[0210] As desired, polynucleotides having random sequences, and/or
sequences of random length, can be screened for their ability to
bind to the sequence-specific DNA binding polypeptides. In some
embodiments, the polynucleotides in the array are rationally
designed. For example, in some embodiments, the polynucleotides are
designed to include a hairpin structure. For example, the hairpin
can contain, and thereby display, the target DNA sequence. Hairpins
can be designed to have various lengths and sequences. In some
embodiments, the hairpins comprise an inverted repeat. For example,
the inverted repeats can have 20, 22, 24, 26, 28, 30, 32, 34, 36 or
more nucleotides.
[0211] In some embodiments, the inverted sequence has a T at
position 14, A at position 13, A at position 7, T at position -7, T
at position -13, and A at position -14. The positions are counted
backwards starting from the axis of symmetry (center of the probe),
which begins with the number 1 (or -1, for the adjacent
complement).
[0212] In some embodiments, the polynucleotides are designed to
allow for a sufficient sequence diversity while making a limited
number of polynucleotides (e.g., when the number of positions on an
array are limited). In some embodiments, the hairpin sequences are
designed to have no more than a particular GC content, thereby
limiting the possible number of sequences without significantly
altering the available diversity. In some embodiments, the GC
content of the hairpin is equal or less than 25% 40%, 35%, 30%,
25%, 20% or less.
[0213] In some embodiments, an in vitro or in vivo method can be
used for identifying target DNA sequences (e.g., operators). For
example, in some embodiments, a library of putative transcriptional
activator (e.g., sigma factor) binding polynucleotide sequences,
which are predicted to bind to a particular transcriptional
activator or portions thereof, is constructed. The library can
comprise randomized, putative transcriptional activator binding
polynucleotide sequences inserted into plasmids without terminator
sequences. When contacted with the transcriptional activator and
RNA polymerase (e.g., E. coli RNA polymerase), the plasmid is
transcribed, thereby creating RNA transcripts complementary to the
DNA sequence of the plasmid. Since the plasmids of the library do
not have transcriptional terminators, transcription of the plasmids
will not end until the RNA polymerase is no longer in contact with
the plasmid. In some instances, an increase in quantity of RNA will
indicate that the transcriptional activators have successfully
bound to transcriptional operators and generated RNA transcripts.
In other instances, the absence of an increase in RNA quantity will
suggest that the transcriptional activators and RNA polymerase may
not have bound to operator sequences to activate transcription. In
some embodiments, an in vitro transcription assay is used to
determine the level of transcription from the plasmids of the
library when in the presence of the sigma factor. In other
embodiments, an in vivo transcription assay is used to identify the
plasmids in the library constructed with sigma factor target
binding polynucleotide sequences. For example, plasmids of the
library can be transformed in the host cells expressing sigma
factors, chimeric sigma factors, or portions thereof, and then RNA
transcripts generated from the plasmid can be quantified. The RNA
transcripts from transcription assays can be quantified by methods,
including, but not limited to, high-throughput sequencing, RNA-seq,
next-generation RNA sequencing, microarray, or quantitative
RT-PCR.
[0214] B. In Vivo
[0215] In some embodiments, the target DNA sequence(s) for
polypeptides are determined in vivo. For instance, in vivo methods
for identifying target DNA sequences can include generation of
synthetic transcriptional regulatory elements comprising potential
DNA target sequences operably linked to a reporter gene (thereby
forming a reporter expression cassette), and testing such reporter
expression cassette in a host cell for transcriptional response to
a sequence-specific DNA binding polypeptide expressed in the cell.
The particular expression response will depend on whether the
sequence-specific DNA binding polypeptide is an activator (in which
case increased expression is a positive response) or a repressor
(in which case reduced expression is a positive response).
[0216] In some embodiments, a synthetic regulatory element library
is constructed wherein library members comprise different target
DNA sequence(s). The base regulatory element will comprise at least
a minimal promoter functional in the host cell and can optionally
comprise further cis-acting regulatory elements. The potential
target DNA sequence(s) can be position anywhere within the
regulatory element useful for testing promoter activity. The
position of the potential target DNA sequence will depend, in part,
on the particular type of sequence-specific DNA binding polypeptide
being tested. In some embodiments, the regulatory element comprises
-10 and -35 regions and the potential target DNA sequence binding
region is located between the -10 and -35 regions of the regulatory
element. In some embodiments, the potential target DNA sequence
comprises one or both of the -10 or -35 regions of the regulatory
element. In some embodiments, the position of the target DNA
sequence in the regulatory element is selected from: at the -10 or
-35 region of the regulatory element, in the UP-region of the
regulatory element, upstream of the -35 site, between the -10 and
-35 sites. between the -10 and transcriptional start site,
overlapping the transcriptional start site, and overlapping an
activator binding site.
[0217] Potential target DNA sequences in the library of regulatory
elements can be generated, for example, by design or random
mutagenesis.
[0218] The regulatory element (e.g., minimal promoter) can be
function in a prokaryotic cell, a eukaryotic, or both. Sequences
within the regulatory element can be derived from eukaryotic
promoters, prokaryotic promoters, or can be synthetic variants of
such sequences.
[0219] Once the library of regulatory elements has been generated,
the library can be screened in host cells to determine whether,
and/or to what extent, expression of a sequence-specific DNA
binding polypeptide results in activation or repression of
transcription from the library expression cassettes. Once library
members are identified with the desired activity, the target DNA
sequences within the regulatory element can be determined (e.g., by
reference to a database of library members, or nucleotide
sequencing, etc.).
V. Generation of Synthetic Transcriptional Regulatory Elements
[0220] Once target DNA sequence(s) bound by a sequence-specific DNA
binding polypeptide are identified, the activity of one or more of
the target DNA sequences can be tested to confirm the cognate
sequence-specific DNA binding polypeptide binds to the target DNA
sequence in the context of the regulatory element and/or regulates
expression controlled by the regulatory element. In some
embodiments, this activity test will have been completed in the
target DNA sequence identification process (see, e.g., the in vivo
screening process discussed above). However, even in situations in
which target DNA sequences have been found to function in
regulatory elements, it may be desirable to modify the position of
the DNA sequence in the regulatory element and/or test the DNA
sequence in one or more additional regulatory elements.
VI. Design of Cognate Pairs
[0221] Embodiments of the invention also provides for generation of
sets of cognate sequence-specific DNA binding polypeptide-target
DNA sequence pairs for use in a genetic circuit. It will be
appreciated that in essentially any initial set of
sequence-specific DNA binding polypeptides and their target DNA
sequences, there will be "overlap" in target DNA sequences between
different polypeptides. Therefore, embodiments of the invention
provides for methods of generating a set of cognate orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
pairs, i.e., pairs of polypeptides/DNA sequences that do not
interact with each other. In view of knowledge (e.g., from
empirical data) regarding the DNA binding sequence of each
sequence-specific DNA binding polypeptide of interest, one can
design a set of cognate pairs.
[0222] In some embodiments, the method comprises identifying a set
of sequence-specific DNA-binding polypeptides that do not bind to
each other's target DNA sequences.
[0223] Design of sets of cognate sequence-specific DNA binding
polypeptide-target DNA sequence pairs can, in some embodiments,
involve maximizing the size of the set of orthogonal
sequence-specific DNA binding polypeptide-target DNA sequence
pairs. This sort of design can involve, for example, bioinformatic
algorithms to maximize the set based on the cognate pairs
available. For example, bioinformatic models can be employed that
maximize the diversity between target DNA sequences in the set of
orthogonal sequence-specific DNA binding polypeptide-target
sequence pairs. In some embodiments, sequence entropy, also
sometimes known as a "Shannon information entropy," is used in
analysis of target DNA sequences, e.g., when polypeptides bind to
more than one target DNA sequence. The more sequences to which a
polypeptide binds, the higher the information entropy. This type of
analysis provides a quantitative method to measure the percent
overlap between the target DNA sequences to which two polypeptides
bind. A higher joint information entropy means that there are more
sequences to which two polypeptides can bind. In graph theory, the
polypeptides are "nodes" and the "edges" are how close they are
(e.g., a measured by their different binding sequences). In some
embodiments, algorithms, including but not limited to, graph
partitioning algorithms, can be used to identify the largest
connected network of nodes. In some embodiments, a graph
partitioning algorithm, k-means clustering, position weight
matrices, hidden markov models, neural networks, or other
algorithms are employed. These algorithms maybe performed by a
processor executing instructions encoded on a computer-readable
storage medium.
[0224] Ultimately, a set of orthogonal cognate sequence-specific
DNA binding polypeptide-target DNA sequence pairs are provided. The
set of orthogonal pairs can then be used as "tools" to generate a
genetic circuit as desired.
[0225] In some embodiments, control elements adapted for a
particular host cell can be used in host cells derived from other
species. In other embodiments, some or all of the control elements
may not be optimized for use in a second host cell. In such cases,
standardized assays as described herein can be used to identify
control elements for the second host cell.
VII. Design of Genetic Circuits
[0226] Genetic circuits are comprised of an array of logic gates
that process one or more input signals, process the input, and
generate an output according to a logic design. Generation of logic
gates can be generated using expression cassettes that respond to
biological inputs, wherein the expression cassettes are regulated
using combinations of repressors and activators. A variety of logic
gates using such expression cassettes have been described. See,
Tamsir et al., Nature, 469(7329): 212-215 (2011). The genetic
circuit can function as, for example, a switch, oscillator, pulse
generator, latch, flip-flop, feedforward loop, or feedback
loop.
[0227] The term "gate" is used to refer to a device or molecular
mechanism that produces a particular (predetermined) output in
response to one or more inputs. Thus, for example, an AND gate
produces a HIGH output only when all inputs are HIGH. An OR gate
produces a HIGH output when any input is HIGH and a LOW output only
when all inputs are LOW. A NOT function returns a HIGH when input
is LOW and a LOW when input is HIGH. Logic Gates and their uses are
well known to those of skill in the art (see, e.g. Horowitz and
Hill (1990) The Art of Electronics, Cambridge University Press,
Cambridge). In some embodiments, the genetic circuits generated
from the identified set of orthogonal pairs comprise 1, 2, 3, 4, 5,
6, 7, 8, 9 or more logic gates. Exemplary logic gates include,
e.g., AND, NAND, NOR, OR, NOT, XOR, EQUALS, AND, IMPLIES, and ANDN
gates. For example, NOR gates can comprise a transcriptional
repressors and a transcriptional repressor target DNA sequence. AND
gates can comprise a transcriptional activator and a
transcriptional activator target DNA sequence.
[0228] In some embodiments, a genetic circuit is designed with the
aid of an algorithm. For example, a logic minimization algorithm
can be used to identify the minimum number of parts (e.g.,
repressors, activators, operators, etc.) for achievement a
particular logic circuit. Algorithms may be performed by a
processor by executing instructions encoded on a
computer-executable storage medium. An exemplary algorithm can be
in a VLSI design, for example the ESPRESSO program. See, e.g.,
Rudell, R L: Multiple-Valued Logic Minimization for PLASynthesis.
Berkeley, Calif.:UC-Berkeley; 1986. In some embodiments, The output
of the logic minimization tool feeds into programs, such as Logic
Friday (e.g., Wu Y, et al. Nature 461:104-108 (2009)), which act as
a visualization tool and enable constraints to be applied to the
construction of a circuit diagram. See, Clancy and Voigt, Current
Opinion in Biotechnology 21:1-10 (2010). In some embodiments, the
genetic circuit is determined using a hardware descriptive
language. In some embodiments, the hardware descriptive language is
VHDL or Verilog.
[0229] Once a genetic circuit is designed and implemented, the
genetic circuit can be tested by challenging the circuit with a
variety of inputs to confirm that the expected outputs are
generated. This can assist to confirm that no unintended
interactions occur within the genetic circuit or between the
genetic circuit and the host cell in which the genetic circuit is
expressed.
VIII. Computer Implemented Methods
[0230] Embodiments of the invention as described above can be
implemented in the form of control logic using hardware and/or
using computer software, firmware, or combinations thereof, in a
modular or integrated manner. For example, the logic minimization
methods for determining the genetic circuit, sequence similarity
algorithms, and motif finding algorithms, can be implemented via
the various forms above. Based on the disclosure and teachings
provided herein, a person of ordinary skill in the art will know
and appreciate other ways and/or methods to implement the present
invention using hardware and a combination of hardware and
software.
[0231] Computing system 700 can include one or more processors,
such as a processor 704. Processor 704 can be implemented using a
general or special purpose processing engine such as, for example,
a microprocessor, controller or other control logic. In this
example, processor 704 is connected to a bus 702 or other
communication medium.
[0232] Memory 706 (which may be organized as a database) can store
the classification information (e.g., functional roles and
activities) of the sequences and assay data used to design the
genetic circuit. Any data mentioned herein (e.g., classification
information) can be downloaded from remote memory (e.g., from a
network drive or a server that can be considered to be part of the
computer system) and stored in a local memory that is more quickly
accessible to a processor on which certain steps of methods are
being implemented. Conversely, data generated by such a processor
can be uploaded to the remote memory.
[0233] Further, it should be appreciated that a computing system
700 of FIG. 22 may be embodied in any of a number of forms, such as
a rack-mounted computer, mainframe, supercomputer, server, client,
a desktop computer, a laptop computer, a tablet computer, hand-held
computing device (e.g., PDA, cell phone, smart phone, palmtop,
etc.), cluster grid, netbook, embedded systems, or any other type
of special or general purpose computing device as may be desirable
or appropriate for a given application or environment.
Additionally, a computing system 700 can include a conventional
network system including a client/server environment and one or
more database servers, distributed networks, or integration with
LIS/LIMS infrastructure. A number of conventional network systems,
including a local area network (LAN) or a wide area network (WAN),
and including wireless and/or wired components, are known in the
art. Additionally, client/server environments, distributed systems,
database servers, and networks are well documented in the art.
[0234] Computing system 700 may include bus 702 or other
communication mechanism for communicating information, and
processor 704] coupled with bus 702 for processing information.
[0235] Computing system 700 also includes a memory 706, which can
be a random access memory (RAM) or other dynamic memory, coupled to
bus 702 for storing instructions to be executed by processor 704.
The instructions may include instructions for performing methods of
embodiments described herein. Memory 706 also may be used for
storing temporary variables or other intermediate information
during execution of instructions to be executed by processor 704.
Computing system 700 further includes a read only memory (ROM)
[708] or other static storage device coupled to bus 702 for storing
static information and instructions for processor 704.
[0236] Any of the software components or functions described in
this application, may be implemented as software code to be
executed by a processor using any suitable computer language such
as, for example, Java, C++ or Perl using, for example, conventional
or object-oriented techniques. The software code may be stored as a
series of instructions, or commands on a computer readable medium
for storage and/or transmission, suitable media include random
access memory (RAM), a read only memory (ROM), a magnetic medium
such as a hard-drive or a floppy disk, or an optical medium such as
a compact disk (CD) or DVD (digital versatile disk), flash memory,
and the like. The computer readable medium may be any combination
of such storage or transmission devices.
[0237] Computing system 700 may also include a storage device 710,
such as a magnetic disk, optical disk, or solid state drive (SSD)
is provided and coupled to bus 702 for storing information and
instructions. Storage device 710 may include a media drive and a
removable storage interface. A media drive may include a drive or
other mechanism to support fixed or removable storage media, such
as a hard disk drive, a floppy disk drive, a magnetic tape drive,
an optical disk drive, a CD or DVD drive (R or RW), flash drive, or
other removable or fixed media drive. As these examples illustrate,
the storage media may include a computer-readable storage medium
having stored therein particular computer software, instructions,
or data.
[0238] In alternative embodiments, storage device 710 may include
other similar instrumentalities for allowing computer programs or
other instructions or data to be loaded into computing system 700.
Such instrumentalities may include, for example, a removable
storage unit and an interface, such as a program cartridge and
cartridge interface, a removable memory (for example, a flash
memory or other removable memory module) and memory slot, and other
removable storage units and interfaces that allow software and data
to be transferred from the storage device 710 to computing system
700.
[0239] Computing system 700 can also include a communications
interface 718. Communications interface 718 can be used to allow
software and data to be transferred between computing system 700
and external devices. Examples of communications interface 718 can
include a modem, a network interface (such as an Ethernet or other
NIC card), a communications port (such as for example, a USB port,
a RS-232C serial port), a PCMCIA slot and card, Bluetooth, etc.
Software and data transferred via communications interface 718 are
in the form of signals which can be electronic, electromagnetic,
optical or other signals capable of being received by
communications interface 718. These signals may be transmitted and
received by communications interface 718 via a channel such as a
wireless medium, wire or cable, fiber optics, or other
communications medium. Some examples of a channel include a phone
line, a cellular phone link, an RF link, a network interface, a
local or wide area network, and other communications channels.
[0240] Computing system 700 may be coupled via bus 702 to a display
712, such as a cathode ray tube (CRT) or liquid crystal display
(LCD), for displaying information to a computer user. An input
device 714, including alphanumeric and other keys, is coupled to
bus 702 for communicating information and command selections to
processor 704, for example. An input device may also be a display,
such as an LCD display, configured with touchscreen input
capabilities.
[0241] Execution of the sequences of instructions contained in
memory [706] causes processor [704] to perform the process states
described herein. Alternatively hard-wired circuitry may be used in
place of or in combination with software instructions to implement
embodiments of the present teachings. Thus implementations of
embodiments of the present teachings are not limited to any
specific combination of hardware circuitry and software.
[0242] The term "computer-readable medium" as used herein generally
refers to any media that is involved in providing one or more
sequences or one or more instructions to processor 704 for
execution. Such instructions, generally referred to as "computer
program code" (which may be grouped in the form of computer
programs or other groupings), when executed, enable the computing
system 700 to perform features or functions of embodiments of the
present invention. These and other forms of computer-readable media
may take many forms, including but not limited to, non-volatile
media, volatile media, and transmission media. Non-volatile media
includes, for example, solid state, optical or magnetic disks, such
as storage device 710. Volatile media includes dynamic memory, such
as memory 706. Transmission media includes coaxial cables, copper
wire, and fiber optics, including the wires that comprise bus 702.
A computer product can be or include the computer-readable medium.
For example, a computer product can be a computer system that
includes one or more processors and a computer readable medium that
has instructions for controlling the one or more processors to
peform any of the methods described herein.
[0243] Common forms of computer-readable media include, for
example, a floppy disk, a flexible disk, hard disk, magnetic tape,
or any other magnetic medium, a CD-ROM, any other optical medium,
punch cards, paper tape, any other physical medium with patterns of
holes, a RAM, PROM, and EPROM, a FLASH-EPROM, any other memory chip
or cartridge, a carrier wave as described hereinafter, or any other
medium from which a computer can read.
[0244] Various forms of computer readable media may be involved in
carrying one or more sequences of one or more instructions to
processor 704 for execution. For example, the instructions may
initially be carried on magnetic disk of a remote computer. The
remote computer can load the instructions into its dynamic memory
and send the instructions over a network. The instructions received
by memory 706 may optionally be stored on storage device 710 either
before or after execution by processor 704.
[0245] It will be appreciated that, for clarity purposes, the above
description has described embodiments of the invention with
reference to different functional units and processors. However, it
will be apparent that any suitable distribution of functionality
between different functional units, processors or domains may be
used without detracting from the invention. For example,
functionality illustrated to be performed by separate processors or
controllers may be performed by the same processor or controller.
Hence, references to specific functional units are only to be seen
as references to suitable means for providing the described
functionality, rather than indicative of a strict logical or
physical structure or organization.
IX. Computational Implementation of Genetic Circuit Design
[0246] Genetic Element Data & Data Models
[0247] Much of biological data is reported in a standardized way.
Many of these data formats support an implicit data model,
facilitating understanding of the data by humans and use of that
data in computational analysis. In this embodiment, genetic element
data may represent a standardized way for reporting and
transferring data. The implicit data model will include a
standardized representation of basic information. Genetic element
data may contain a standardized representation of classification
data which provides identification of functional regions of the
sequence, as well as the functional description of that sequence.
Finally, genetic element data may provide a standardized
classification of the experimental characterization information
associated with the part. In some embodiments, genetic element data
can be added, removed, modified or updated over time. Genetic
element data may be updated on a server and downloaded locally.
[0248] Classification of Genetic Design Elements, Devices and
Circuits
[0249] Genetic element data can be characterized using standardized
terms, such as the features seen in GenBank records. Such terms can
be used automation systems based upon controlled vocabularies, or
ontology based terms.
[0250] Characterization Based Upon Experimental Measurements
[0251] Performance of a genetic design element, device or genetic
circuit can be based upon use of meausurement data. Meta data
associated with a given assay can be used to classify the types of
experimental investigations performed upon the element. Raw data
can be reported managed, and stored in a standardized format. This
in turn permits the comparison of elements that have gone through
similar experimental investigations and provides a means to use
data from several such investigations as a way to sort, filter,
compare and select elements with appropriate performance
characteristics for genetic circuit design.
[0252] Development and Use of Design Template
[0253] A design template is a general solution to a design problem
that recurs repeatedly in many projects. Software designers adapt
the template solution to their specific project. Templates use a
formal approach to describing a design problem, its proposed
solution, and any other factors that might affect the problem or
the solution. A successful template should have established itself
as leading to a good solution in three previous projects or
situations.
[0254] In embodiments described herein, design templates can be
developed from genetic element data in order to identify genetic
circuit elements, devices and genetic circuits that have certain
characteristics. Such characteristics can be annotated through use
of ontology or controlled vocabulary terms. According to
embodiments described herein, designs can be searched and
identified and reused or modified to suit the purposes of new
designs. The corresponding DNA sequences can be identified and
experimental manipulations can be performed upon them to introduce
new desired functionality.
[0255] Computer Aided Design Algorithms
[0256] According to various embodiments, genetic circuit elements
may be classified and characterized and their data stored. This may
permit the data to be used in a genetic compiler program. A genetic
compiler program is a software program, computer executable
instructions, that may allow a system to use genetic circuit
element data to design, develop, verify and validate gentic
circuits. The types of algorithms supporting a design methodology
used in such a genetic compiler program may include the following
steps: [0257] Receiving the specification of genetic circuits based
upon desired inputs and resultant outcomes, the identification of
design constraints or requirements affecting that specification.
[0258] Design of the processing of the inputs to result in desired
outcomes. [0259] Analysis and design for orthogonality checks
between the circuit design elements, the proposed devices, the
proposed genetic circuit and the proposed target genome. [0260]
Identification and compositional arrangement of appropriate genetic
circuit elements. [0261] Assembly and Experimental verification and
validation of the design.
[0262] According to various embodiments described herein, the
design process is an interative process, supporting simultaneous
development of similar solutions for desired performance
characteristics.
[0263] Development of Standardized Assays
[0264] According to various embodiments described herein
characterization of genetic circuit elements, devices and genetc
circuits may be through use of standardized assays, designed to
measure the performance of an identified element as compared to a
set of variant elements. Description of such experiments will be
encoded in a standardized fashion for use in the software.
[0265] Orthogonality & Interaction Checks for Computational
Designs
[0266] According to various embodiments described herein, data may
be collected to identify possible design constraints during device
and genetic circuit design and development. In some embodiments,
this may include checks for genetic element design, development and
usage. In some embodiments, this may include checks for device
design, development and usage. In some embodiments, this may
include checks for genetic circuit design, development and usage.
In some embodiments, this may include checks for genetic circuit
element, device and genetic circuit, development and usage within
identified hosts. In some embodiments this will include checks for
genetic circuit element, device and genetic circuit, development
and usage within identified populations of hosts.
[0267] Assembly, Validation & Verification of Computational
Designs
[0268] According to various embodiments described herein, data may
be collected to identify possible design constraints during device
and genetic circuit assembly, validation and verification. In some
embodiments, this may include checks for assembly constraints. In
some embodiments this may include checks for verification
constraints. In some embodiments, this may include checks for
validation constraints.
[0269] Modeling & Simulation
[0270] According to various embodiments described herein, data may
be collected to identify possible functioning of the genetic
circuit element, device or genetic circuit. This data may be used
to demonstrate the functioning of the design during modeling.
Models may be used to query the performance of the design under
different condition during simulations.
[0271] Incorporation of Performance Data into Models &
Simulations
[0272] According to various embodiments described herein, data may
be collected to identify the actual performance of the genetic
circuit element, device or genetic circuit in the host system. As
described in the section for assay standardization, performance
data may be collected and reported for use in a computer analysis
in a standardized fashion. This data may be used to demonstrate the
actual functioning of the design as compared to predicted
functioning of the device during modeling. Models may be used to
query the actual performance of the design as compared to the
predicted performance of the device under different conditions
during simulations.
EXAMPLES
[0273] The following examples are offered to illustrate, but not to
limit the claimed invention.
Example 1
Orthogonal Sigmas for Programmable Transcriptional Regulation
[0274] Engineering synthetic gene circuits requires a library of
"parts" that serve to regulate gene expression and can be reliably
combined together to build complex programs (see, Voigt, C. A.,
Curr. Opin. Biotechnol., 17(5): 548-57, (2006)). Promoters are an
essential "part" that control gene expression by regulating the
rate of mRNA production. Large genetic circuits require many
promoters that can be individually controlled. This enables
conditional control of gene expression across a circuit and
requires a library of orthogonal promoter systems in which
regulators target specific promoters with no cross-talk across the
circuit.
[0275] To achieve orthogonal regulation, we are using sigma
(.sigma.) factors to construct orthogonal .sigma.-promoter systems.
Sigma factors recruit RNA polymerase (RNAP) to specific promoter
sequences to initiate transcription. The .sigma. 70 family consist
of 4 groups: Group 1 are the housekeeping .sigma.s and are
essential; Groups 2-4 are alternative .sigma.s that direct cellular
transcription for specialized needs (see, Gruber, T. M. and C. A.
Gross, Annu. Rev. Microbiol., 57: 441-66, (2003)). Group 4 .sigma.s
(also known as ECF .sigma.s; extracytoplasmic function) constitute
the largest and most diverse group of .sigma.s, and have been
classified into 43 subgroups (FIG. 1; see, Staron, A., H. J. Sofia,
et al., Mol. Microbiol., 74(3): 557-1, (2009)). Each subgroup is
thought to recognize different promoter sequences, making these
.sigma.s ideal for constructing orthogonal .sigma.-promoter
systems. We have constructed a library of ECF .sigma.s that can be
expressed in E. coli and are using both computational and
experimental methods to identify promoter sequences and demonstrate
orthogonal regulation.
A. Constructing the ECF Sigma Library
[0276] The ECF .sigma. library was constructed as follows: 2
.sigma. candidates were selected from each ECF subgroup (FIG. 1) to
maximize promoter diversity to create a library of 86 .sigma.s
(Table 1). Each candidate was chosen from an organism closely
related to E. coli to maximize the likelihood of the functionally
binding to E. coli RNAP (note .sigma.-RNAP interactions are highly
conserved and .sigma.s from Bacillus subtilis have been shown to
function with E. coli RNAP). Where possible, .sigma.s were selected
that have a known cognate anti-.sigma.. These are specific negative
regulators of .sigma.s, thereby increasing the regulatory utility
of each .sigma. for engineering genetic circuits. For each .sigma.
the DNA coding sequences were refactored and codon optimized for E.
coli by Geneart. DNA fragments were synthesized by Geneart
containing the refactored coding sequences with the flanking
restriction sites Nde I overlapping the start codon (CATATG; Nde I
site with start codon underlined) and a Bam HI and Hind III site
immediately downstream of the TAA stop codon. The synthesized DNA
fragments were cloned on Nde 1-Hind III sites in to a
pET21.sigma.-derived expression vector (Novagen) enabling the
.sigma. genes to be expressed from a T7 promoter. In the vector the
genes were cloned in-frame and downstream of an N-terminal
His.sub.6 (SEQ ID NO:140) tag coding sequence with a cleavable
PreScission protease cleavage site to enable protein purification.
Thus, all .sigma.s in our library contain the additional N-terminal
sequence: MGSSHHHHHHSSGLEVLFQGPH (SEQ ID NO:141) (PreScission
protease cleavage site underlined).
B. Expressing the ECF Sigma Library and Measuring Toxicity in E.
Coli Host
[0277] Expression of the ECF .sigma. library was monitored using a
3 plasmid system encoding a T7 expression system, ECF .sigma.
library, and target promoter reporter transformed in DH10b cells
(see, FIG. 2). The T7 expression system is encoded on a low copy
plasmid (pN565; incW ori: K. Temme) and is tightly regulated using
a P.sub.tac promoter containing a symmetrical Lad operator
(lacO.sub.sym). This enables a tight OFF state when uninduced, and
graded T7 induction with IPTG. The T7 gene encodes a modified
non-toxic form of T7 RNAP that has a low processivity substitution
(R632S), an N-terminal Lon degradation tag, and is weakly expressed
using the low activity GTG start codon and a weak ribosome binding
site. The ECF .sigma.s are individually carried on derivatives of
the T7 expression vector, pET21a (pBR322 ori). The ECF promoter
reporter vector (low copy, pSC101 ori), carries ECF-specific
promoters fused to a superfolding gfp reporter, enabling
fluorescent measurements of .sigma. activity.
[0278] Only small numbers of .sigma. molecules (.about.100 s) are
required in a cell to observe gene expression; however, expression
of foreign proteins in E. coli can be toxic. Sigmas may be toxic
due to erroneous gene expression or by binding strongly to RNA
polymerase, preventing gene expression by host .sigma.s. Toxicity
was determined by measuring the changes in growth rate from
over-expressing each member of the ECF .sigma. library in DH10b
host E. coli cells assayed in 96-well format both in exponentially
growing cultures and colony sizes on agar plates. FIG. 3 (left
side) illustrates typical growth plots of DH10b strains carrying
different ECF .sigma.s after high induction (100 .mu.M IPTG) for 8
hrs in LB at 37.degree. C. shaking in 96-well plates at 480 rpm, 6
mm diameter, in a Varioskan 96-well plate reader. Over-expression
of only 15% of .sigma.s in our library result in large growth
defects, similar results are observed on colony sizes on agar
plates (data not shown).
C. Identifying Target Promoters
[0279] Many ECF .sigma.s autoregulate their own gene expression
(FIG. 4). Since each ECF .sigma. subgroup is thought to recognize
different promoter sequences, promoters can be found by searching
upstream of .sigma. genes within each subgroup for conserved
motifs. Promoters have been identified for 13 subgroups (see,
Staron, A., H. J. Sofia, et al., Mol. Microbiol., 74(3): 557-1,
(2009)); computational searches are in progress to identify
promoter motifs for the remaining subgroups. The currently
identified promoter sequences have been used to construct promoter
models in which the key -10 and -35 promoter motifs are defined
using two-block motif searcher, BioProspector (see, Liu, X., D. L.
Brutlag, et al., Pac. Symp. Biocomput., 2001: 127-38, (2001)) and
the variable length spacing between the motifs quantified using
histograms (FIG. 5).
[0280] D. Predicting Promoter Orthogonality
[0281] The 34 promoter models were used to predict whether .sigma.s
from the different ECF subgroups were able to recognize promoters
from another subgroup (cross-talk) or if they were specific to just
their own subgroup (orthogonal). For promoters from each subgroup,
scoring models were constructed as described in Rhodius, V. A.
& V. K. Mutalik, Proc Natl. Acad. Sci. U.S.A., 107(7):2854-9,
(2010) using Position Weight Matrices (PWMs) for the -35 and -10
motifs, and a penalty term for suboptimal distances between the
-35/-10 motifs:
Score=PWM.sub.-35+PWM.sub.-10+spacer penalties
[0282] This model can then be used to "score" promoter sequences:
the resultant score has been shown to be proportional to promoter
strength (rate of mRNA production) (Rhodius, V. A. & V. K.
Mutalik, Proc Natl. Acad. Sci. U.S.A., 107(7):2854-9, (2010)),
i.e.
Score.varies. log(promoter strength)
[0283] The 34 promoter scoring models were used to score 706
promoter sequences from all 34 ECF .sigma.s to predict specificity
of promoter recognition. We find that in general the .sigma.s are
highly specific, mainly recognizing promoters from their own
subgroup (FIG. 6)
E. Testing Sigma-Promoter Orthogonality
[0284] Next, we tested the orthogonality of the ECF
.sigma.-promoter pairs. Using our promoter scoring models to
predict orthogonal promoters, for each ECF .sigma. subgroup we
constructed candidate promoters fused to gfp. Each promoter was
then screened in vivo against the entire ECF .sigma. library in
96-well format using our .sigma. expression system to measure
promoter activity (see FIGS. 2 and 7).
[0285] Using this approach we identified 24 orthogonal
.sigma.-promoter systems (FIG. 8). Functional promoters are listed
in the Table below. Our results show that the ECF .sigma.s are
highly orthogonal with the .sigma.s very specific to their cognate
promoter, making them ideal orthogonal regulators.
Sequence of functional ECF promoters from -60 to +20. The core -35
and -10 motifs are underlined.
TABLE-US-00008 Promoter Sequence (-60 to +20) (SEQ ID NOS: 221-244)
Pecf02_2817
CATGACAAACAAAAACAGATGCGTTACGGAACTTTACAAAAACGAGACACTCTAACCCTTTGCTTGCTCAAAT-
TGCAGCT Pecf03_UP1198
CAGTACAAAATTTTTTAGATGCGTTTTTAACTTCGTTCCTTTTCGGCGTTCTAATAACCAAAGCTCAGAAATA-
ATAGATG Pecf11_3726
ATGCCTCCACACCGCTCGTCACATCCTGTGATCCACTCTTCATCCCGCTACGTAACACCTCTGCATCGCGAAC-
CAAAACC Pecf12_UP807
CAGTACAAAATTTTTTAGATGCGTTGCGGGAATCTCCCCGGCCGATGGGCCGTTTCCCAGGTCGAGTGGCCTG-
AATCGGA Pecf15_UP436
CAGTACAAAATTTTTTAGATGCGTTCTTGGGAACCGAACGCCGGTGCCCGCGTTCGGTTCCGGGGATCTTATC-
AACTTTT Pecf16_3622
CTTGGATGAAAAGAAACCCACCGACGGTGTAACCCTGGCGGCCGATGCAACGAACTAACTCACAGGACGTGCT-
CAGCACC Pecf17_UP1691
CAGTACAAAATTTTTTAGATGCGTTTGGTGAACCAAACTCTTACTCGACTCGTGTCAGTAAGCGGGAGGTGAT-
CGCGTGG Pecf18_UP1700
CAGTACAAAATTTTTTAGATGCGTTTGCATCCAGATTGTCTCGGCGGCGGTAATGCCATAAGCAATGTTCGAT-
GGCGCAG Pecf19_UP1315
CAGTACAAAATTTTTTAGATGCGTTTCCTCCCGCTCCTGTGGAGCACGATCGAACGCGAACGCGGTCACTATA-
CCCATGC Pecf20_992
GCGCGGATAAAAATTTCATTTGCCCGCGACGGATTCCCCGCCCATCTATCGTTGAACCCATCA-
GCTGCGTTCATCAGCGA Pecf21_UP4014
CAGTACAAAATTTTTTAGATGCGTTAGGCAACCCTTTTTCATCCGGCTTCGTCTATATCTATAGAAACCGACA-
CCAAACC Pecf22_UP1147
CAGTACAAAATTTTTTAGATGCGTTGTTGTGAGGAATCGCGCTCCTGCGCGAATCATCCCGTGTCGTCCCTTC-
ACCTGCC Pecf24_UP69
CAGTACAAAATTTTTTAGATGCGTTACGGAACGCAGTCTTTTCGTCTGTATCAACTCCAAAATTCATCGTGCC-
TAAACAT Pecf25_UP4311
CAGTACAAAATTTTTTAGATGCGTCGAGGAACTCAAACTGCGCCATTATCGTCTAGCTAACAGAGGTTCTGCT-
TGGGAGG Pecf26_UP601
CAGTACAAAATTTTTTAGATGCGTTTGGAATAACCGGTCGCCTCCATCCGTTTACATACCGAATCCCGGCAGC-
GCCGGCC Pecf29_UP371
CAGTACAAAATTTTTTAGATGCGTTCCGGGAACCTTTTGTCGGCACGAACATCCAATTGGCGGATGAAACACT-
TTGTCTG Pecf30_2079
ACCATCCGTATTTTTTTAGGGATTTATAAAACTTTTCCATGGCGTGCGTCGTCTAATAAATGGGAAGGAGGAA-
ATGATGT Pecf31_34
CAATGGCTGAAAAGAATTGTAAAAAAGATGAACGCTTTTGAATCCGGTGTCGTCTCATAAGGCA-
GAAAAACAAAAAAGGG Pecf32_1122
GCGACTTTATTTAACAGCGGCATGGCCAGGGAACCGATGCGTCAATCGCACCACACAATGACAACTGCTCTCA-
TCATTGA Pecf33_375
TAAGTTGAACAATTTTGCACCTTCCGTCGAACCGTCCGCTGCATCGACCCGACCAACCTTGCG-
AGACGGCCTTTGAGCGT Pecf38_UP1322
CAGTACAAAATTTTTTAGATGCGTTGTACAACCCTCACGGGGGTGGACGTGTCCAACTGGCGTGGCAGAGGTT-
CTCGATT Pecf39_UP1413
CAGTACAAAATTTTTTAGATGCGTTTGTCAACCGTCCACGACGCGCTGGCGTCTGGAAGGGTGACCCAGCCAG-
ACCAGCG Pecf41_UP1141
CAGTACAAAATTTTTTAGATGCGTTCACGTCACAAACCCGAAAGCTGAATCGTCATCCCGTTGAATCCCTCAA-
ACACGGA Pecf42_UP4062
CAGTACAAAATTTTTTAGATGCGTTCGCTGTCGATCCGGCCCGTCGTCGTTCGTCGTACCCCCGAGAGCCCGC-
GAAAGGC
[0286] In summary, we have constructed a library of 86 ECF .sigma.
factors for controlled expression in an E. coli host.
Over-expression of the majority of these .sigma.s has little effect
on growth in E. coli demonstrating their suitability for use as
regulators in this host. Using computational approaches we have
identified and constructed promoter models for 34 ECF subgroups. In
vivo assays show that the ECF .sigma.-promoter systems are highly
orthogonal, with 24 orthogonal systems identified to date. We
suggest that these .sigma.s are ideal candidates for constructing
orthogonal regulatory systems for genetic engineering.
Example 2
Screening a Repressor Library to Build Orthogonal Circuits
[0287] This examples describes the construction of chimeric sigmas
as a means to diversify available orthogonal regulatory systems.
Our work with ECF sigmas demonstrates that they are ideal tools for
constructing orthogonal regulatory systems.
[0288] ECF sigmas contain 2 highly conserved DNA binding domains.
Conserved Region 2 recognizes the promoter -10 sequence and
conserved Region 4 recognizes the promoter -35 sequence (FIG. 9).
We selected 2 ECF sigmas that each recognized different -10 and -35
sequences (sigmas ECF02.sub.--2817 from Escherichia coli and
ECF11.sub.--3726 from Psuedomonas syringae; FIG. 9) and constructed
chimeric proteins by swapping their DNA binding domains. The
domains were connected within the unstructured "linker" region with
a seamless join so that no additional amino acids were added or
removed. Our most successful chimeric constructs were (FIG. 10):
ECF11_ECF02 (containing amino acids 1-106 from ECF02.sub.--2817 and
122-202 from ECF11.sub.--3726) and ECF02_ECF11 (containing amino
acids 1-121 from ECF11.sub.--3726 and 107-191 from
ECF02.sub.--2817).
[0289] Cognate chimeric promoters were also constructed in which
the upstream -35 region (sequences -60 to -21) and the downstream
-10 region (-19 to +20) were swapped (FIGS. 10 and 11). The
activity of parental and chimeric sigmas were assayed in vivo at
the wild type and chimeric promoters (FIG. 12). We found that our
chimeric sigma factors were able to initiate transcription at their
respective chimeric promoters, but not at the "opposite" chimeric
promoter, demonstrating that the chimeras are both functional and
specific to their target promoters. The high-specificity of the
chimeric sigmas demonstrates that this is an effective strategy to
dramatically expand the diversity of orthogonal
sigm.sigma.-promoter systems for genetic circuits.
Example 3
Screening a Repressor Library to Build Orthogonal Circuits
[0290] This examples demonstrates a method of characterizing a
library of repressor proteins belonging to the TetR family. Genetic
circuits are often constructed using prokaryotic repressor
proteins. Currently, only a few well-characterized repressors are
implemented within circuit designs, which severely limit the number
and complexity of programs that result. To expand the toolbox of
programmable orthogonal operator-repressor pairs, we are
characterizing a library of repressor proteins belonging to the
TetR family. The newly characterized repressors will allow for the
generation of transcriptional circuits of increasing
complexity.
A. Generation of the Repressor Library
[0291] The Tetracycline repressor (TetR) represents one of the most
well characterized microbial regulators. Based on the robust
transcriptional control exhibited by TetR, this family of
repressors is well suited for use in the programming of genetic
circuits. To date, TetR itself is the only repressor within this
family that has been used for such purposes. To expand the toolbox
of programmable transcriptional repressor proteins, we are
characterizing a library of 73 GENEART-synthesized repressors
belonging to the TetR family (Table 2).
[0292] Using a metagenomic approach, the repressors included within
our library originate from 47 distinct prokaryotic organisms, and
were selected based on two criteria: 1) homology to TetR, and 2)
predicted variation in target sequence recognition. Each gene was
refactored and codon optimized for production in E. coli.
Post-synthesis, repressor coding sequences were inserted downstream
of the T7 promoter, into a pET expression vector that contains an
amino-terminal 6.times.-His (SEQ ID NO:141) tag.
B. Repressor Library Characterization Using In Vivo Reporter
Assays
[0293] The operator sequences recognized by 26 repressors included
in our library have been previously identified (Table 3). These
operators range 16-55 bp in length, and typically contain inverted
repeat sequences. To determine whether these repressors promote
repression when paired with their properly matched operator
sequences, reporters containing each operator sequence were
constructed. Using in vivo reporter assays, constructs were then
screened against the library in 96 well format.
[0294] Reporters containing 23 of the known operator sequences were
constructed, whereby each operator sequence is inserted into a
strong constitutive promoter (J23119) that is situated upstream of
the yellow fluorescent protein (YFP) reporter gene (FIG. 13).
Specifically, operator sequences are inserted into the 17 bp spacer
that is present between the -35 and -10 regions of the J23119
promoter sequence. Because known operators are typically larger
than 17 bp, the -35 or -10 region must be modified to accommodate
each operator (which may render the resulting construct
inactive).
[0295] Those reporters that render an active/fluorescent construct
are then screened against the library in 96-well format.
Specifically, the repressor library is transformed into cells
containing an individual reporter and the T7 polymerase gene. A
blue light transilluminator is then used to visualize fluorescence
and subsequent repression of the transformation plate (FIG. 14).
Flow cytometry is used to quantify the level of observed repression
(FIG. 15). Of the constructs screened to date, orthogonal
repression has been observed for the AmtR, BarB, BetI, ButR, BM3R1,
CymR, IcaR, LmrA, McbR, Ph1F, QacR, TarA, and TetR repressors.
Furthermore, the observed repression is orthogonal; high-levels of
repression are observed only in the presence of the properly
matched repressor (FIG. 31). Further construction and screening of
the known operator sequences is being carried out, and it is
expected that additional, orthogonal repressor-operator pairs will
be identified.
C. Identifying Sequences Bound by Uncharacterized Repressors
[0296] While some of the operators for repressors included in our
library have been characterized, the majority are unknown. To
determine the sequences bound by the previously uncharacterized
repressors, newly designed protein binding arrays are being
utilized. Each array contains 2.1 million distinct 28-mer inverted
repeat sequences. A purified, fluorescently labeled repressor is
applied to each array; each sequence becomes associated with an
intensity value upon repressor binding. Data extraction and motif
analysis reveal consensus sequences that are bound with high
affinity (FIG. 16). To date, consensus sequences for the AmeR,
ArpA, BarA, BarB, ButR, CasR, DhaR, EnvR, and McbR repressors have
been identified (FIG. 29).
[0297] Using these 2.1M arrays, each repressor within the library
is purified and its binding profile extracted. Consensus sequences
representing those bound with high affinity, referred to as
synthetic operator sequences are then inserted into the J23119
promoter (FIG. 13) and screened for repression. The behavior of
those repressors exhibiting high levels of repression are then
tuned using a RBS library, to select for those constructs
exhibiting a high `ON` state and a low `OFF` state (FIG. 30). The
transfer function of the newly identified and tuned operator
repressor pair is then examined for orthogonality against our
library.
[0298] In summary, we have constructed and are characterizing a
library of 73 TetR homologs. Utilizing both in vivo reporter assays
and protein binding arrays, we are determining the sequences bound
by each repressor, building reporters, and screening the
orthogonality of each newly determined binding sequence against our
library in vivo (FIG. 31). Initial results demonstrate that
repression is highly specific for the properly matched repressor,
and that our library exhibits orthogonal behavior. Complete
characterization of the transcriptional repressor library will
drastically increase the number of parts available for genetic
circuit design, and will thereby enhance the complexity of circuits
that may be constructed.
Example 4
Generation of Orthogonal RNAP:Promoter Interactions and Promoters
of Different Strengths
[0299] This example describes a physical library of RNA Polymerases
(RNAPs) that bind orthogonal promoter sequences and mutations in
these promoters that elicit different strengths of expression. This
example also illustrates a method of constructing a T7 RNAP
"scaffold" with reduced host toxicity to serve as a platform for
creating orthogonal variants. In addition, this example describes
the generation of orthogonal RNAP-promoter interaction by analyzing
phage genomes to guide mutations to the RNAP scaffold and a region
of the T7 promoter. Furthermore, this example describes the
generation of promoters of different strengths by mutating a
different region of the T7 promoter. Methods herein can be applied
to extend the existing library or to create new libraries based on
protein-DNA interactions.
[0300] The T7 RNAP and promoter have historical utility in gene
expression applications and recent utility in synthetic biology
genetic circuits. There is value in identifying orthogonal
RNAP-promoter interactions as well as promoter variants of
differing strengths.
[0301] Previous efforts to generate orthogonal RNAP-promoter
interactions have fallen into two categories: 1) sourcing RNAP from
different phage and characterizing their orthogonality based on
which promoters they bind, or 2) mutating the T7 RNAP in an attempt
to generate RNAPs that bind different promoters. Previous efforts
to generate promoters of different strengths were based on
non-specific mutations throughout the entire promoter structure. We
have created both orthogonal RNAP-promoter interactions and also
numerous phage promoters with different transcriptional
strengths.
[0302] An embodiments of the invention consists of a physical
library of RNAPs that bind orthogonal promoter sequences and
mutations to these promoters that elicit different strengths of
expression. It can be divided into three primary aspects. Firstly,
we constructed a T7 RNAP "scaffold" with reduced host toxicity to
serve as a platform for creating orthogonal variants. Secondly, we
generated promoters of different strengths by mutating a different
region of the T7 promoter. And thirdly, we generated orthogonal
RNAP-promoter interactions by analyzing phage genomes to guide
mutations to the RNAP scaffold and a region of the T7 promoter. In
certain embodiments, the methodology described herein can be
applied to extend the existing library or to create new libraries
based on protein-DNA interactions.
A. T7 RNAP Scaffold: RNAP Backbone Mutations
[0303] We constructed a T7 RNAP "scaffold" with reduced host
toxicity to serve as a platform for creating multiple orthogonal
variants. We were able to achieve better control of T7 RNAP
activity by adopting functional design elements based on four key
molecular mechanisms, including physical isolation, translational
control, degradative control and processivity modulation. FIG. 17
highlights several of the T7 RNAP scaffolds with varying levels of
toxicity.
[0304] The physical isolation mechanism allows for the activation
of an engineered genetic circuit in host cells that do not carry
the T7 RNAP plasmid. We cloned the T7 RNAP on a low copy plasmid,
separate from any T7 promoters and/or genes we wished to express.
Then, we co-transformed our genetic circuit plasmid and T7 RNAP
plasmid into host cells, and were able to activate the circuit.
[0305] The translational control mechanism is based on minimizing
T7 RNAP concentration by using weak ribosome binding sites, the
sequence GTG as an suboptimal start codon, and random DNA spacers
which insulate T7 RNAP expression from changes in upstream promoter
activity.
[0306] The degradative control is achieved by using an N-terminal
tag to promote rapid degradation of the T7 RNAP by the Lon protease
system. Our tag is based on the N-terminal sequence of the UmuD
protein from E. coli.
[0307] It is known by those skilled in the art that naturally, T7
RNAP transcribes DNA approximately eight times faster than the
native E. coli RNAP. It has been determined that the active site
mutations affect both promoter escape and transcription rate. We
have characterized mutations located in the O-helix of T7 RNAP that
spans residues 625-655. Studies of RNAP mutants have been described
from Rui Sousa's laboratory (see, Bonner et al., EMBO J., 11(10),
3767-75 (1992), Bonner et al., J. Biol. Chem., 269(40), 25120-8
(1994), and Makarova et al., Proc. Natl. Acad. Sci. U.S.A., 92(26),
12250-4 (1995)). Based on this analysis and our design, we created
a library of T7 RNAP mutants and tested their processivity. The
best mutation we identified is R632S, which has not been mentioned
in any reference to date. We identified the R632S mutation while
creating an RBS library. This particular R to S mutation at
position 632 has not been studied before.
B. Promoter Strength Library
[0308] We developed and utilized a method of modulating RNAP
specificity and promoter strength simultaneously by introducing
mutations in different domains of the T7 promoter. T7 RNAP
recognizes and initiates transcription from 17 promoters in the T7
phage. These promoters vary in sequence, and the consensus sequence
is known as the T7 promoter. A number of groups have mutated the T7
promoter to produce variation in promoter activity. The variance is
the result of altered binding affinity of the RNAP for the
promoter, altered efficiency of transcript initiation, or a
combination of the two. Further characterization of the interaction
between T7 RNAP and promoter has identified a recognition domain
between bases -17 and -5, as well as an initiation domain between
bases -4 and +6 (see, Ikeda et al., Nucleic Acids Research, 20(10),
2517-2524 (1992) and McGinness and Joyce, J. Biol. Chem., 277(4),
2987-2991 (2002)). Protein structures have shown that the T7 RNAP
initially binds to the recognition domain of the promoter and
subsequently interacts with the initiation domain to melt the DNA
and form a transcription bubble. Recently, a study from the
Ellington lab showed in vitro that mutations of the initially
transcribed region (+1 to +6) result in a library of promoters with
varying activity (see, Davidson et al., Symposium on Biocomputing,
15, 433-443 (2010)).
[0309] We hypothesized that mutations in the recognition domain of
the T7 promoter would primarily influence RNAP:DNA binding and
mutations in the initiation domain predominately influence rate of
transcription initiation. Therefore, we adopted a strategy to
modularize the T7 promoter for the purpose of changing RNAP
specificity and promoter strength simultaneously. We developed a
promoter library by randomly mutating the T7 promoter from bases -2
to +3 (see FIG. 18). The promoter library was cloned into a plasmid
vector containing RFP and co-transformed with a mutant T7 RNAP
scaffold. We assessed library activity by screening colonies for
RFP expression using flow cytometry (see FIG. 18).
C. Terminator Library
[0310] To avoid repeated use of the same transcriptional components
in the synthetic genetic circuits, we created numerous T7 promoter
and transcriptional terminator derivatives. Since duplication of a
sequence can hamper in vitro cloning methods or lead to homologous
recombination in vivo, each transcriptional unit in the circuit
ideally requires a unique transcriptional terminator.
[0311] We developed a library of synthetic terminators that
facilitate T7 RNAP transcription. Using the naturally occurring T7
phage terminator as a seed sequence, we developed a degenerate
terminator sequence that was predicted to form stem-loop
structures. We cloned the terminator library between GFP and RFP.
When co-transformed with a mutant T7 RNAP scaffold, we observed a
reduction in RFP expression for many clones. We assessed
termination efficiency across the library by screening colonies for
reduction of RFP expression using flow cytometry (see FIG. 19).
D. Methodology for Generating Orthogonal RNAP:Promoter
Interactions
[0312] We created a methodology to generate orthogonal
RNAP:promoter interactions and identified synthetic RNAP:promoter
combinations that are mutally orthogonal.
[0313] The T7 RNAP specificity loop is a beta-hairpin that extends
from approximately residue 730 to approximately residue 770. This
loop is the primary determinant of RNAP:DNA binding, and previous
crystal structures have shown direct major-groove DNA interactions
with residues 746, 748, 756 and 758. Previous research focused on
changing these four residues to influence specificity of RNAP
binding and to recognize novel promoters.
[0314] We hypothesized that specificity loop conformation and DNA
interaction are the influenced by the entire loop, not simply the
four residues implicated by previous studies. In particular, we
thought that random mutagenesis of a few residues within the loop
could detrimentally alter the ability of the RNAP specificity loop
adopt a conformation that can interact with the major groove of the
promoter. However, we also believed that mutations elsewhere in the
loop could compensate for mutations to the residues that interact
with DNA. These compensating mutations would confer on the loop the
ability recover proper conformation for interacting with the
promoter and potentially confer specificity for alternative DNA
sequences.
[0315] An exhaustive search of all possible loop sequences is not
feasible (i.e., no. of residues to the power of the no. of 20 amino
acids; .about.40.sup.20=1.times.10.sup.32). We believed that we
could best source alternative loop sequences from biology. By
identifying phage related to T7 in sequence databases, we created
library of alternative specificity loop candidates sourced from
homologous RNAP. Each RNAP contains a functional specificity loop
that is divergent in sequence and possibly in structure from T7
RNAP. Additionally, many of the consensus promoters for phage found
in sequence databases diverge from the T7 consensus promoter.
[0316] We grafted alternative specificity loops in place of the T7
RNAP specificity loop to produce a library of synthetic RNAP. We
found that in many cases this library recognized the consensus
promoter for the source phage, rather than the T7 consensus
promoter. In four cases, this methodology produced RNAP:promoter
combinations that are mutually orthogonal.
[0317] The methodology for generating orthogonal binding pairs
comprises computational and experimental steps, including
identification of RNAP and promoters from phage genomes in sequence
databases, alignment of the specificity loop region from all RNAP,
creation of synthetic RNAPs and synthetic promoters, and
experimental testing for orthogonality.
[0318] In certain embodiments, we identified RNAP and promoters
from phage genomes in sequence databases. For instance, we selected
RNAP sequences based on annotation or sequence homology to T7 RNAP.
We selected promoters based on annotations or using a promoter
identification algorithm we developed. This algorithm can scan
phage genomes and identify regions containing a particular "seed"
sequence. For example, a seed sequence we used was the highly
conserved core of the T7 consensus promoter, CACTA. We aligned the
regions surrounding the seed and eliminated highly divergent
sequences.
[0319] In certain embodiments, we aligned the specificity loop
region from all RNAP based on amino acid sequence. We derived a
cladogram from the alignment and used it to identify families of
specificity loops. We generated consensus promoters for each phage
using sequence logos. Then, we grouped consensus promoters into
families based on recognition domain sequence. We observed perfect
correlation between the RNAP families and promoter families.
[0320] We created synthetic RNAPs by replacing the specificity loop
sequence between residues 745 and 761 with a consensus loop
sequence from a given phage family. FIG. 20A highlights some of the
synthetic RNAPs and their mutated specificity loops. Note that he
phage families are named for a representative phage from the
family. In certain embodiment, the RNAP based on phage N4 family
and retaining the T7 residue 745 was found to exhibit better
orthogonality.
[0321] We created synthetic promoters by replacing bases -12 to -7
in the T7 consensus promoter with the corresponding bases from the
phage family consensus promoter.
[0322] We co-transformed synthetic RNAP with synthetic promoters
controlling RFP expression. We observed orthogonal activity as
expected. Substantially more RFP was produced when synthetic RNAP
were co-transformed with the synthetic promoters from the same
phage family (see FIG. 20B).
E. Combinatorial Promoters
[0323] The methodology described herein was applied to improve the
previous iterations of the synthetic promoter library. Combining
mutations that confer orthogonality with mutations conferring
altered strength into a single promoter greatly extends the utility
of our invention. It is possible to utilize multiple RNAP in a
single cell, each controlling multiple transcriptional units with a
range of specified transcription rates.
[0324] Using the methodology described herein, we demonstrated that
we could combine orthogonal promoters responsive to T7 RNAP or T3
RNAP with the promoter strength library to achieve predictable
outcomes. The combinatorial promoters were assembled from the T7 or
T3 synthetic recognition domain and the synthetic initiation domain
of the promoter strength library. The experiments demonstrated that
promoters showed activity only when co-transformed with the RNAP
specified by their recognition domain (see FIG. 21). Additionally,
the strength of activity was proportional to that encoded by their
initiation domain.
Example 5
5' UTR Sequences
[0325] A complex transcriptional regulatory circuit can be
decomposed into several basic modules. These basic modules can
consist of a regulatory gene and its regulated promoter. In such
basic module, both input and output are promoter activities, and
their relation can be described by a transfer function. A task for
synthetic biologists is to characterize the transfer function.
Unfortunately, transfer function we investigated are
context-dependent ("context-dependent" means the same basic module
owns different transfer functions in different contexts). In our
experiments, the testing module is a NOT logic gate that consists
of cI repressor and its repressed pOR1 promoter (sequence:
tttgacatacctctggcggtgatatataatggttgc; SEQ ID NO:142). After
generating this module, the NOT gate module was connected to three
different upstream inducible promoters. The three promoters
were:
TABLE-US-00009 Pbad SEQ ID NO: 143) (sequence:
agaaaccaattgtccatattgcatcagacattgccgtcactgcgtcttttactggctcttctcgctaaccaaac-
cggtaaccccgcttattaa
aagcattctgtaacaaagcgggaccaaagccatgacaaaaacgcgtaacaaaagtgtctataatcacggcagaa-
aagtccacattgat
tatttgcacggcgtcacactttgctatgccatagcatttttatccataagattagcggatcctacctgacgctt-
tttatcgcaactctctactgt ttctccatacccg;, Ptac SEQ ID NO: 144)
(sequence:
ggcaaatattctgaaatgagctgttgacaattaatcatcggctcgtataatgtgtggaattgtgagcggataac-
aatttcacac; and Modified-Ptac SEQ ID NO: 145) (sequence:
ggcaaatattctgaaatgagctgataaatgtgagcggataacattgacattgtgagcggataacaagatactga-
gcac;.
[0326] We found that, under the three different promoters, the same
NOT gate generated three completely different transfer functions.
Experimentally, the input and output promoter activities were
measured by the same super-fold gfp(gfp) gene with a same ribosome
binding sequence (SDA: actagaaggaggaaaaaaatg; SEQ ID NO:146). See
FIG. 23.
[0327] We knew that usually a piece of upstream promoter regions
are transcribed into message RNA of regulatory genes. It is
possible they change the translation rate and/or stability of the
mRNA and ultimately change the regulatory gene expression in
comparison with reporter gene's, so a fused cI-gfp gene (stop codon
of cI is deleted, a short linker sequence "GGCGGTGGCGGT" (SEQ ID
NO:147) is added, and the start codon of gfp is removed too) was
constructed to monitor the regulatory gene expression. Experimental
data indicated the relation between GFP and CI-GFP under Pbad and
Ptac promoter are linear but with different slopes (slope of Pbad
is 2.31, while slope of Ptac is 0.25). This means that the ratio
between the regulatory gene (cI-gfp) and reporter gene (gfp)
expression is 2.31 under Ptac promoters, but is 0.25 under Pbad
promoter. See FIG. 23. On the other hand, if the transcribed
promoter sequence was removed, the inherent properties of promoters
were changed by the 5'UTR of the downstream gene region. Our
Modified-Ptac promoter belongs to such a case. The Modified-Ptac
promoter has a moved LacI binding site from a transcribed promoter
region to an un-transcribed promoter region (Ref: Lutz R, Bujard H.
Nucleic Acids Res 1997, 25:1203-1210). The relation between GFP and
CI-GFP was not linear any more. See FIG. 23. With the promoter
activity releasing, the expression of GFP increases normally, but
the expression of CI-GFP ceases to increase further after a shortly
normal increasing, so the inherent dynamical range of Modified-Ptac
promoter are changed by CI-GFP with a ribosome binding sequence
(SDmut: actagaaccatgaaaaaagtg; SEQ ID NO:148). Therefore, some
additional sequence must be identified and inserted between
promoter and the downstream gene to insulate them each other.
[0328] We have shown that transcriptional modules could seriously
interfere with each other when being connected, and some optimized
sequences as spacers must be found to prevent such interference. We
collected about sixty 5'UTR sequences from the scientific
literature and tested their properties by the
Modified-Ptac-{spacer}-(gfp/cI-gfp) system. See FIG. 24. Their
sequences are listed below. All the sixty sequences can be sorted
into five different classes: stem loops, high-transcription escape,
anti-escaping sequences, carbon utilization and T5/T7
bacteriophage. Most of the spacers could recover the linear
relation between GFP and CI-GFP (their slopes and R-squares are
listed below). In the whole spacer library, the best spacer was a
ribozyme that can remove 5' leading sequences that come from the
upstream promoter region after transcribed into mRNA (bottom and
right of FIG. 24).
TABLE-US-00010 Statis- tics (Adj. Refer- Sources Sequences (SEQ ID
NO:) Slope R.sup.2) ences Num/names 1 pD/E20J T5 phage
Agttcgatgagagcgataaccctctacaaataattttgtttaa 0.913 0.999 [Ref 1]
(149) 2 pH207J T5 phage ataaattgataaacaaaaacctctacaaataattttgtttaa
0.679 0.991 [Ref 1] (150) 3 pN25J T5 phage
ataaatttgagagaggagttcctctacaaataattttgtttaa 0.349 0.991 [Ref 2]
(151) 4 pG25J T5 phage attaaagaggagaaattaaccctctacaaataattttgtttaa
0.370 0.998 [Ref 1] (152) 5 pJ5J T5 phage
aaacctaatggatcgaccttcctctacaaataattttgtttaa 6.49 0.996 [Ref 1]
(153) 6 pA1J T7 phage atcgagagggacacggcgacctctacaaataattttgtttaa
0.421 0.996 [Ref 1] (154) 7 pA2J T7 phage
gctaggtaacactagcagccctctacaaataattttgtttaa 0.862 0.998 [Ref 1]
(155) 8 pA3J T7 phage atgaaacgacagtgagtcacctctacaaataattttgtttaa
1.407 0.990 [Ref 1] (156) 9 phi10J T7 phage
agggagaccacaacggtttccctctacaaataattttgtttaa 0.582 0.995 [Ref 3]
(157) 10 DG146aJ High- attaaaaaacctgctaggatcctctacaaataattttgtttaa
1.693 0.995 [Ref 4] trans- (158) cription escape 11 DG122J High-
ataaaggaaaacggtcaggtcctctacaaataattttgtttaa N/A N/A [Ref 4] trans-
(159) cription escape 12 DG131aJ High-
ataggttaaaagcctgtcatcctctacaaataattttgtttaa 2.708 0.996 [Ref 4]
trans- (160) cription escape 13 Carbon
acaataaaaaatcatttacatgtttcctctacaaataattttgtttaa 2.215 0.884 [Ref
MhpR3hppJ utiliza- (161) 10] tion 14 GlcCJ Carbon
agaagcagcgcgcaaaaatcagctgcctctacaaataattttgtttaa 0.319 0.990 [Ref
utiliza- (162) 10] tion 15 Carbon
atgagttcatttcagacaggcaaatcctctacaaataattttgtttaa 1.336 0.996 [Ref
FucRPfucPJ utiliza- (163) 10] tion 16 Carbon
aacttgcagttatttactgtgattacctctacaaataattttgtttaa 0.899 0.998 [Ref
FuncRPfucAJ utiliza- (164) 10] tion 17 Carbon
agccacaaaaaaagtcatgttggttcctctacaaataattttgtttaa 1.104 0.971 [Ref
ChbRNagCJ utiliza- (165) 10] tion 18 AraCJ Carbon
acacagtcacttatcttttagttaaaaggtcctctacaaataattttgtttaa 0.961 0.998
[Ref utiliza- (166) 10] tion 19 Anti-
atccggaatcctcttcccggcctctacaaataattttgtttaa 2.245 0.995 [Ref 5]
AntiescapeJ escaping (167) sequences 20 LeiQiJ
aacaaaataaaaaggagtcgctcaccctctacaaataattttgtttaa 0.112 0.396 [Ref
6] (168) 21 T5 phage agttcgatgagagcgataacagttccagattcaggaactataa
0.216 0.994 [Ref 1] pD/E20RBS (169) 22 T5 phage
ataaattgataaacaaaaaagttccagattcaggaactataa 0.509 0.999 [Ref 1]
pH207RBS (170) 23 pN25RBS T5 phage
ataaatttgagagaggagttagttccagattcaggaactataa 1.058 0.998 [Ref 2]
(171) 24 pG25RBS T5 phage
attaaagaggagaaattaacagttccagattcaggaactataa 0.806 0.999 [Ref 1]
(172) 25 pJ5RBS T5 phage
aaacctaatggatcgaccttagttccagattcaggaactataa 0.454 0.999 [Ref 1]
(173) 26 pA1RBS T7 phage atcgagagggacacggcgaagttccagattcaggaactataa
2.532 0.999 [Ref 1] (174) 27 pA2RBS T7 phage
gctaggtaacactagcagcagttccagattcaggaactataa N/A N/A [Ref 1] (175) 28
pA3RBS T7 phage atgaaacgacagtgagtcaagttccagattcaggaactataa N/A N/A
[Ref 1] (176) 29 T7 phage
agggagaccacaacggtttcagttccagattcaggaactataa 0.363 0.999 [Ref 3]
phi10RBS (177) 30 High- attaaaaaacctgctaggatagttccagattcaggaactataa
1.779 0.997 [Ref 4] DG146aRBS trans- (178) cription escape 31 High-
ataaaggaaaacggtcaggtagttccagattcaggaactataa 0.514 0.998 [Ref 4]
DG122RBS trans- (179) cription escape 32 High-
ataggttaaaagcctgtcatagttccagattcaggaactataa 0.118 0.997 [Ref 4]
DG131aRBS trans- (180) cription escape 33 Carbon
acaataaaaaatcatttacatgtttagttccagattcaggaactataa 3.849 0.998 [Ref
MhpR3hppRBS utiliza- (181) 10] tion 34 GlcCRBS Carbon
agaagcagcgcgcaaaaatcagctgagttccagattcaggaactataa 0.329 0.989 [Ref
utiliza- (182) 10] tion 35 Carbon
atgagttcatttcagacaggcaaatagttccagattcaggaactataa 0.388 0.999 [Ref
FucRPfucPRBS utiliza- (183) 10] tion 36 Carbon
aacttgcagttatttactgtgattaagttccagattcaggaactataa 0.248 0.994 [Ref
FuncRPfucAR utiliza- (184) 10] BS tion 37 Carbon
agccacaaaaaaagtcatgttggttagttccagattcaggaactataa N/A N/A [Ref
ChbRNagCRB utiliza- (185) 10] S tion 38 AraCRBS Carbon
acacagtcacttatcttttagttaaaaggtagttccagattcaggaactataa 0.539 0.959
[Ref utiliza- (186) 10] tion 39 Anti-
atccggaatcctcttcccggagttccagattcaggaactataa 5.543 0.983 [Ref 5]
Antiescape escaping (187) RBS sequences 40 LeiQiRBS
aacaaaataaaaaggagtcgctcacagttccagattcaggaactataa(188) N/A N/A [Ref
6] Hairpin 41 OmpA4 Stem gatcaccagggggatcccccggtgaaggat 0.369 0.949
[Ref 7] loops (189) 42 OmpA952 Stem
gatcgcccaccggcagctgccggtgggcgatcaaggat 0.282 0.691 [Ref 7] loops
(190) 43 OmpA29 Stem gatcatcggtagagttaatattgagcagatcccccggtgaaggat
4.039 0.994 [Ref 7] loops (191) 44 papA Stem
attgatctggttattaaaggtaatcgggtcatttta 1.583 0.990 [Ref 7] loops
(192) 45 pufBA Stem gttctccacgggtgggatgagcccctcgtggtggaaatgcg 2.353
0.975 [Ref 7] loops (193) 46 gene32 Stem
agcatgaggtaaagtgtcatgcaccaa 0.052 0.767 [Ref 7] loops (194) 47 pHP4
Stem acgtcgacttatctcgagtgagatattgttgacggtac 1.381 0.972 [Ref 8
loops (195) 48 pHP10 Stem acgtcgacttatctcgagtgagataagttgacggtac
1.620 0.999 [Ref 8] loops (196) 49pHP17 Stem
acgtcgacttatctcgagactgcagttcaatagagatattgttgacggtac 0.155 0.961
[Ref 8] loops (197) 50 Ribo50 Stem
gactgtcaccggatgtgctttccggtctgatgagtccgtgaggacgaaacag 0.341 0.971
[Ref 9] loops (198) (Ribo- zyme) 51 Stem
gatcaccagggggatcccccggtgaaggatcctctacaaataattttgtttaa 0.908 0.991
[Ref 7] OmpA952J loops (199) 52 OmpA64J Stem
Gatcgcccaccggcagctgccggtgggcgatcaaggatcctctacaaataatt N/A N/A [Ref
7] loops ttgtttaa (200) 53 OmpA29J Stem
gatcatcggtagagttaatattgagcagatcccccggtgaaggatcctctacaaa 0.776 0.958
[Ref 7] loops taattttgtttaa (201) 54 papAJ Stem
attgatctggttattaaaggtaatcgggtcattttacctctacaaataattttgtttaa 0.049
0.671 [Ref 7] loops (202) 55 pufBAJ Stem
Gttctccacgggtgggatgagcccctcgtggtggaaatgcgcctctacaaataa 0.046 0.699
[Ref 7] loops ttttgtttaa (203) 56 gene32 Stem
agcatgaggtaaagtgtcatgcaccaacctctacaaataattttgtttaa 0.667 0.937 [Ref
7] loops (204) 57 pHP4J Stem
Acgtcgacttatctcgagtgagatattgttgacggtaccctctacaaataattttgt 1.125
0.952 [Ref 8]
loops ttaa (205) 58 pHP10J Stem
Acgtcgacttatctcgagtgagataagttgacggtaccctctacaaataattttgtt 0.070
0.447 [Ref 8] loops taa (206) 59 pHP17J Stem
acgtcgacttatctcgagactgcagttcaatagagatattgttgacggtaccctct 0.546
0.986 [Ref 8] loops acaaataattttgtttaa (207) 60 RiboJ Stem
gactgtcaccggatgtgctttccggtctgatgagtccgtgaggacgaaacagcc 1.050 0.996
[Ref 9] loops tctacaaataattttgtttaa (208) (Ribo- zyme) 1. Deuschle
U, Kammerer W, Gentz R, Bujard H: Promoters of Escherichia coli: a
hierarchy of in vivo strength indicates alternate structures. EMBO
J 1986, 5: 2987-2994. 2. Kammerer W, Deuschle U, Gentz R, Bujard H:
Functional dissection of Escherichia coli promoters: information in
the transcribed region is involved in late steps of the overall
process. EMBO J 1986, 5: 2995-3000. 3. Davis J H, Rubin A J, Sauer
R T: Design, construction and characterization of a set of
insulated bacterial promoters. Nucleic Acids Res 2011, 39:
1131-1141. 4. Hsu L M, Cobb I M, Ozmore J R, Khoo M, Nahm G, Xia L,
Bao Y, Ahn C: Initial transcribed sequence mutations specifically
affect promoter escape properties. Biochemistry 2006, 45:
8841-8854. 5. Chan C L, Gross C A: The anti-initial transcribed
sequence, a portable sequence that impedes promoter escape,
requires sigma70 for function. J. Biol. Chem 2001, 276:
38201-38209. 6. Lynch S A, Desai S K, Sajja H K, Gallivan J P: A
high-throughput screen for synthetic riboswitches reveals
mechanistic insights into their function. Chem. Biol 2007, 14:
173-184. 7. Emory S A, Bouvet P, Belasco J G: A 5'-terminal
stem-loop structure can stabilize mRNA in Escherichia coli. Genes
Dev 1992, 6: 135-148. 8. Carrier T A, Keasling J D: Library of
synthetic 5' secondary structures to manipulate mRNA stability in
Escherichia coli. Biotechnol. Prog 1999, 15: 58-64. 9. Nelson J A,
Shepotinovskaya I, Uhlenbeck O C: Hammerheads derived from sTRSV
show enhanced cleavage and ligation rate constants. Biochemistry
2005, 44: 14577-14585. 10. Website: on the world wide web at
biocyc.org/.
[0329] We tested the Ribozyme spacer (RiboJ) under all three tested
upstream promoters. For all three promoters, the riboJ spacer can
process the transcribed mRNA and remove the transcribed promoter
region from the mRNA. As a result, the transcripts of gfp, cI-gfp
and cI genes become unique, even though their promoter region and
transcribed 5' leading sequence of mRNA are completely different.
Our experimental data showed the slope for GFP and CI-GFP relation
converged into a same value (about 1.16) after adding the RiboJ
spacer. The slope for the Pbad promoter increased from 0.25 to
1.19, while the slope for Ptac promoter decrease from 2.31 to 1.14.
See, FIG. 25. Notably, the nonlinear relation between Cland CI-GFP
under Modified-Ptac promoter became linear with the similar slope
(1.11) in comparison with two previous promoters. When we inserted
the RiboJ spacer between the NOT gate module and the three upstream
inducible promoters, the relation between input and output promoter
activity become unique. This means that the NOT gate has the same
transfer function in different contexts and can become easily
predicted. We also tested other three NOT gate modules (cI-POR222,
cILVA-POR1 and cILVA-POR222), all of them having a unique transfer
function in three different contexts. In summary, this spacer-added
assembling method can dramatically promote the construction of more
complex transcriptional circuits.
Part Mining Additional Insulator Parts
[0330] Genetic programs are getting larger, requiring the
functional connection of multiple genetic circuits. The reliable
connection of these circuits will require the routine incorporation
of insulator parts into the circuit design. The ribozyme function
is locally implemented, so orthogonality and crosstalk is not a
problem as it is in the scale-up of the number of circuits.
However, re-using the same 75 bp part in a design could lead to
homologous recombination and evolutionary instability (Galdzicki,
M., Rodriguez, C., Chandran, D., Sauro, H. M. & Gennari, J. H.
Standard Biological Parts Knowledgebase. PLoS One 6, (2011)). To
expand the number of available insulators, the NCBI sequence
database was searched for sequences similar to the sTRSV-ribozyme.
Nine additional ribozymes were identified and screened for their
insulating capability (see table below). These sequences share only
an average of 75% sequence identity.
[0331] Each ribozyme was tested for its ability to produce the same
ratio of CI-GFP to GFP, whether under the control pTAC or pBAD
(Table 2). Each ribozyme differed in its capability to rectify the
ratios. Out of this library, five were identified that function as
insulators: sLTSV+(Forster, A. C. & Symons, R. H. Cell 50, 9-16
(1987)), Scc+(Di Serio,
[0332] F., Dar s, J. A., Ragozzino, A. & Flores, R. J. Virol.
71, 6603-6610 (1997)), SarMV+(Kaper, J. M., Tousignant, M. E. &
Steger, G. Biochem. Biophys. Res. Commun. 154, 318-325 (1988)),
PLMVd-(Hernandez, C. & Flores, R. Proc. Natl. Acad. Sci. U.S.A.
89, 3711-3715 (1992)), sVTMoV+(Roossinck, M. J., Sleat, D. &
Palukaitis, P. Satellite RNAs of plant viruses: structures and
biological effects. Microbiol. Rev. 56, 265-279 (1992)). This
demonstrates that the insulating function is a general property of
the ribozyme function, and not specific to the sTRSV-ribozyme.
TABLE-US-00011 Performance of Ribozymes Obtained via Part Mining
Slope.sup.c Slope.sup.c Name.sup.a Sequence (SEQ ID NOS:
209-218).sup.b pBAD pTAC LtsvJ
AGTACGTCTGAGCGTGATACCCGCTCACTGAAGATGGCCCGGTAGGGCCGAAACGTACCTCTACAAAT-
AATTTTGTTTAA 0.6 0.6 SccJ
AGATGCTGTAGTGGGATGTGTGTCTCACCTGAAGAGTACAAAAGTCCGAAACGGTATCCTCTACAAATA-
ATTTTGTTTAA 1.1 1.2 RiboJ
AGCTGTCACCGGATGTGCTTTCCGGTCTGATGAGTCCGTGAGGACGAAACAGCCTCTACAAATAATTT-
TGTTTAA 1.4 1.3 SarJ
AGACTGTCGCCGGATGTGTATCCGACCTGACGATGGCCCAAAAGGGCCGAAACAGTCCTCTACAAATAA-
TTTTGTTTAA 2.2 2.4 PlmJ
AGTCATAAGTCTGGGCTAAGCCCACTGATGAGTCGCTGAAATGCGACGAAACTTATGACCTCTACAAAT-
AATTTTGTTTAA 1.6 1.8 VtmoJ
AGTCCGTAGTGGATGTGTATCCACTCTGATGAGTCCGAAAGGACGAAACGGACCTCTACAAATAATTT-
TGTTTAA 1.0 1.3 ChmJ
AGAAGAGGTCGGCACCTGACGTCGGTGTCCTGATGAAGATCCATGACAGGATCGAAACCTCTTCCTCTA-
CAAATAATTTTGTTT 1.9 2.4 AA ScvmJ
AGTACTGTCGCCAGACGTGGACCCGGCCTGATGAGTCCGAAAGGACGAAACAGTACCTCTACAAATAA-
TTTTGTTTAA 0.8 1.4 SltJ
AGGACGTATGAGACTGACTGAAACGCCGTCTCACTGATGAGGCCATGGCAGGCCGAAACGTCCCTCTAC-
AAATAATTTTGTTTAA 2.2 1.4 PlmvJ
AGGAAGAGTCTGTGCTAAGCACACTGACGAGTCTCTGAGATGAGACGAAACTCTTCCCTCTACAAATA-
ATTTTGTTTAA 2.0 5.9 .sup.aAll the names were changed on the base of
their original names in the reference.sup.7,8, as an additional
hairpin was added to expose the SD sequence in the RBS. .sup.bThe
green residues forming the stem I, the blue residues forming the
stem II and the red residues as the conserved catalytic core come
from these ribozymes. The pink residues forming the stem III come
from the additional hairpin. .sup.cThe slope of the expression of
gfp and cI-gfp genes under the control of two promoters. The slopes
are calculated as the average of at least three experiments on
different days. The average error was 14%. The detailed
measurements, including standard deviations are provided in the
additional table below.
Performances of 10 Ribozyme Spacers
[0333] Besides the RiboJ-ribozyme spacer, we also tested nine other
ribozymes under the pTAC and pBAD promoter in order to discover
alternative insulators. For each spacer, we measured the expression
of GFP and CI-GFP for both the pTAC and pBAD inducible systems. The
relationship of GFP and CI-GFP was fitted with a linear curve by
origin software (OriginLab Inc.). The slopes are provided in Table
S3.
TABLE-US-00012 Summary of performances of Ribozyme spacers Slopes
promoter Day Day Day Day Rank Name name 1 2 3 4 Mean .+-. std 1
LtsvJ pBAD 0.603 0.587 0.547 0.566 0.575 .+-. 0.0244 pTAC 0.605
0.533 0.581 0.523 0.56 .+-. 0.039 2 SccJ pBAD 1.24 1.097 1.08 1.088
1.13 .+-. 0.0762 pTAC 1.389 1.09 1.172 0.936 1.15 .+-. 0.189 3
RiboJ pBAD 1.13 1.68 1.37 1.59 1.44 .+-. 0.246 pTAC 1.141 1.66
1.075 1.25 1.28 .+-. 0.262 4 SarJ pBAD 2.36 2.27 1.95 2.19 2.19
.+-. 0.176 pTAC 2.44 2.55 2.37 2.13 2.37 .+-. 0.178 5 PlmJ pBAD
1.77 1.49 1.33 1.69 1.57 .+-. 0.197 pTAC 1.89 1.76 1.76 1.77 1.79
.+-. 0.0635 6 VtmoJ pBAD 1.065 1.04 0.999 0.927 1.01 .+-. 0.0603
pTAC 1.43 1.25 1.226 1.162 1.27 .+-. 0.115 7 ChmJ pBAD 1.91 1.82
1.85 2.11 1.92 .+-. 0.130 pTAC 2.28 2.4 2.73 2.14 2.39 .+-. 0.252 8
ScvmJ pBAD 0.91 0.77 0.79 0.81 0.82 .+-. 0.0622 pTAC 1.56 1.377
1.277 1.41 .+-. 0.144 9 SltJ pBAD 2.07 2.0 1.74 2.95 2.19 .+-.
0.526 pTAC 1.5 1.45 1.22 1.22 1.43 .+-. 0.149 10 PlmvJ pBAD 2.32
1.96 1.39 2.42 2.02 .+-. 0.466 pTAC 5.74 7.57 4.86 5.62 5.95 .+-.
1.15
Example 6
AND Gates
AND Gates
[0334] Three 2-input AND gates have been constructed and fully
characterized. See, FIG. 26. All the genetic parts including
promoters and genes are from Type III secretion systems. The type
III secretion system (T3SS) is a molecular machine, which secretes
effector proteins from pathogenic bacteria to eukaryotic cells
during infection. This system has a complex regulatory network
including activator-chaperone pairs, which can be used for building
AND gates. For example (FIG. 26, left top), InvF, an AraC-like
activator from the Salmonella pathogenicity island 1, interacts
with SicA, a chaperone protein. This InvF-SicA complex can activate
the sicA promoter (psicA) when the complex binds to the promoter.
That is, such activation happens only when the two proteins
coexist. Thus, this system acts as an AND gate.
[0335] Three other activator-chaperone pairs have been recruited
from Shigella flexneri, Yersinia enterocolitica, and Pseudomonas
aeruginosa. The YsaE-SycB (activator-chaperone) pair from Yersinia
enterocolitica did not work in E. coli DH10B, but all other three
pairs (InvF-SicA, MxiE-IpgC, and ExsDA-ExsC) work as AND gates. The
mechanism for the ExsDA-ExsC system is different from that of
InvF-SicA and MxiE-IpgC. ExsA is an activator and activates the
pexsC promoter without forming complex with chaperone protein.
Instead, there is ExsD molecule in the system, which sequesters and
prevents ExsA from binding to the promoter. Consequently, when the
two genes (exsD and exsA) are under the same promoter control (in
this case, pTet), inducing this promoter by adding aTc (inducer)
does not lead to activation of pexsC promoter. Once the chaperone
ExsC coexists in the system, however, ExsC binds to ExsD more
tightly than ExsA does. Thus, if all three proteins coexist and
ExsC sequesters ExsD enough to release free ExsA, the pexsC
promoter can be turned on.
[0336] The AND gates consist of three parts (middle three portion
of FIG. 26): two inducible input promoters, activator-chaperone
genes under the control of these inducible promoters, and a
reporter gene (rfP, red fluorescence protein gene) under the
control of the promoter that is activated by the
activator-chaperone complex (or by the activator alone for the
pexsC case). The three gates have been fully characterized by
measuring fluorescence (right three portions of FIG. 26). E. coli
strain DH10B containing the AND gate was grown in LB medium
(Miller, B D Bioscience, San Jose, Calif.) overnight at 37.degree.
C. and then transferred to fresh LB medium. The cultures were
induced at OD of 0.5 with inducers of different concentrations. The
inducer concentrations are as follows: arabinose concentrations
(Ara, mM) are 0, 0.0016, 0.008, 0.04, 0.2, 1, 5, and 25 from bottom
to top of FIG. 26; 3006 homoserine lactone concentrations (3006,
nM) are 0, 0.32, 1.6, 8, 40, 200, 1000, and 5000 from bottom to top
of FIG. 26; and anhydrotetracycline concentrations (aTc, ng/ml) are
0, 0.0032, 0.016, 0.08, 0.4, 2, 10, and 50 from left to right. Each
culture (0.6 ml) was induced for 6 hrs in 96-well plates (deep well
plates with total volume capacity of 2 ml) and flow cytometer data
were obtained using a BD Biosciences LSR11 flow cytometer (BD
Bioscience, San Jose, Calif.). The data were gated by forward and
side scatter, and each data set consists of at least 10,000 cells.
The average fluorescence was calculated using FlowJo (TreeStar
Inc., Ashland, Oreg.). The scale bar is in a log scale.
Gate Orthogonality
[0337] When the AND gates are connected, these gates should be
orthogonal. That is, each activator-chaperone pair should interact
only with its cognate partner and promoter, not with the other
partners and promoters. All the possible interaction combinations
have been tested, and orthogonality of the three AND gates were
confirmed (see the middle and right heat-maps of FIG. 27;
fluorescence values are normalized by a maximum value and the scale
bar is in a linear scale; all the experiments were performed as
described above using each strain containing
activator-chaperone-promoter as indicated in the figures). The
middle and right heat-maps of FIG. 27 show orthogonality of
activator/chaperone interaction and activator/promoter binding,
respectively.
[0338] The wild-type SicA cross-talks (interacts) with MxiE. To
eliminate such cross-talk, the sicA gene was mutated and a SicA
mutant (SicA*F62Y) was found to be orthogonal to the other
partners. To obtain this sicA variant, error-prone PCR was
performed and library of SicA mutant proteins was screened as
follows: [0339] Random mutations were introduced by PCR reactions
which were performed using 1.times.PCR buffer (Invitrogen,
Carlsbad, Calif.) supplemented with 7 mM MgCl.sub.2, 0.3 mM
MnCl.sub.2, 0.2 mM of dATP and dGTP, 1 mM of dCTP and dTTP, and
0.05 U Taq DNA polymerase (Invitrogen, Carlsbad, Calif.). [0340]
Using the same experimental procedure as described above, strains
containing the mutated sicA gene, the invF gene, and psicA promoter
were screened, and positive clones with high fluorescence (compared
to a positive control that contains wild type sicA-invF-psicA) were
selected at 5 mM Ara and 100 ng/ml aTc. [0341] The selected sicA
mutant genes were transformed into strains containing MxiE and the
pipaH9.8 promoter, and the negative clone (containing SicA*) with
low fluorescence (compared to a negative control that contains wild
type sicA-invF-pipaH9.8) was selected at 5 mM Ara and 100 ng/ml
aTc. The promoter pipaH9.8 was mutated to reduce its basal
expression level. Its high basal expression level can be
problematic when the AND gate containing it is connected with other
gates. One issue is a so-called impedance matching problem. Imagine
a simple cascade circuit where an input promoter of the first
module generates an activator, which turns on an output promoter of
the second module. If the promoter of the first module has too high
a basal activity, the activator is always expressed enough to turn
on the output of the second module, and the entire circuit is
always on. To improve its dynamic range, the -10 region of the
pipaH9.8 promoter was changed from TATAAT to TAAGAT by using
saturation mutagenesis. The forward and reverse primers for
saturation mutagenesis are as follows:
TABLE-US-00013 [0341] NNATAAAAAAGTGCTGAATTCAC (SEQ ID NO: 219) and
NNATAAGGATAAACAAAATTGGCTG, (SEQ ID NO: 220)
respectively.
4-Input AND Gate
[0342] The three 2-input AND gates constructed above (see AND GATE
Section) were connected (as shown in the left of FIG. 28) to create
a 4-input AND gate. This gate comprises four sensors (6 kb in
size), integrated circuits (6 kb in size), and reporter gene (rfp
in this diagram). The entire system has 11 orthogonal regulatory
proteins in one cell.
[0343] The sensor module consists of 4 input promoters (pBAD, pTac,
pLux, and pTet) and the genes encoding their regulatory proteins
(AraC, Lad, LuxR, and TetR). The four inputs for the four sensor
promoters are Ara, IPTG, AI-1 (3006), and aTc. Each input promoter
is connected with the gene(s) encoding the regulatory protein(s)
from T3SS (IpgC, MxiE, ExsC, ExsD/ExsA). Note that the input
promoter for mxiE is switched from pTet (see the middle diagram in
the Section 1) to pTac. In addition, the output gene rfp for the
pipaH9.8 and pexsC promoters (see the middle of FIG. 26) are
replaced with sicA* and invF, respectively. Such swapping allows
the three 2-input AND gates to be connected to each other (making
the integrated circuit module) as well as to the sensor module. As
described in the AND GATE Section, each 2-input AND gate is turned
on only when both inputs are on (signal 1). Thus, this 4-input AND
gate is turned on only when the four input is on. The fluorescence
was measured as described above using the E. coli strain DH10B
containing this 4-input AND gate, and the result is shown in the
histogram. The four inducer concentrations used for the "on" input
(signal 1) are as follows: Ara (5 mM), IPTG (0.5 mM), 3006 (5
.mu.M), and aTc (2 ng/ml). The x-axis is fluorescence (arbitrary
unit, au) and the y-axis is the normalized cell count. All the DNA
parts were assembled using the one-step isothermal DNA assembly
method (Nat. Methods, 6, 343-345). The strain contains three
plasmids with total size of 21 kb: [0344] 1. pXCPi-epA containing
[0345] araC and lad under constitutive promoter control, [0346]
ipgC under pBAD control, [0347] mxiE under pTac control, and [0348]
sicA* under pipaH9.8 control [0349] 2. pCDAC-invF containing [0350]
luxR and tetR under constitutive promoter control, [0351] exsC
under pLux control, [0352] exsDA under pTet control [0353] invF
under pexsC control [0354] 3. psicA-rfp containing rfp under psicA
control
[0355] The examples and embodiments described herein are for
illustrative purposes only and that various modifications or
changes in light thereof will be suggested to persons skilled in
the art and are to be included within the spirit and purview of
this application and scope of the appended claims. All
publications, patents, and patent applications cited herein are
hereby incorporated by reference in their entirety for all
purposes.
Sequence CWU 1
1
244166DNAArtificial Sequencesynthetic promoter sequence motif
1nnnntaaann tnnnnaaatn annannntnn tgaaacnttt tnnnnnnnna nnncgtataa
60naaann 66262DNAArtificial Sequencesynthetic promoter sequence
motif 2nnnaannnan aaaaaattnn annnnnnnnn gaacttttcn aatannnnnn
agtctaannn 60ng 62369DNAArtificial Sequencesynthetic promoter
sequence motif 3antnanaatt ntaatattnt ttanaggtga ttaaaccttt
tgtctaaatn atagtctaac 60accaaanaa 69448DNAArtificial
Sequencesynthetic promoter sequence motif 4nnnnnnnnnn nnnntnngna
aaatnnnnnn nnnntnnntt gtntnncn 48568DNAArtificial Sequencesynthetic
promoter sequence motif 5nnnnnnnnnn naataattna tannntnnag
tgatccaatt tcnancccgc cacgtattaa 60ntnanana 68667DNAArtificial
Sequencesynthetic promoter sequence motif 6nncggnaanc cnnncagcgg
acncgcggcc gggaataaca cggncgccnn cnctgttgnn 60nggancg
67769DNAArtificial Sequencesynthetic promoter sequence motif
7tttcccnggt agcgaaangn acagccnggt ttctcaggna aagctcagat tgctcatatc
60ccgcccata 69866DNAArtificial Sequencesynthetic promoter sequence
motif 8nnnnnnncna caaaannncn cccnncnnnn ggaacnntnn cnncnacnnn
gcgttncgnn 60cnnnnn 66970DNAArtificial Sequencesynthetic promoter
sequence motif 9agnngcngnt annnaacntt tnggnggcga tgtaaccaan
nncgnccnac ncgcgaataa 60gnnggnaggg 701067DNAArtificial
Sequencesynthetic promoter sequence motif 10gggcnccgcg gcnncncgcn
ggncgcgggc tgaaccgaac ngcngccggc gtcgtgtnnn 60tggcggg
671168DNAArtificial Sequencesynthetic promoter sequence motif
11cggcnnnngc nncagnnnnn gcgcggnntc tgcatccacn nnnncccgnt ncccgtatnn
60nnanncnn 681254DNAArtificial Sequencesynthetic promoter sequence
motif 12gnnnncnnnn ncngncccac cgatccnnnn cancnncnnc tccgaatann nnng
541368DNAArtificial Sequencesynthetic promoter sequence motif
13ncantnncnn naaaannnnn nnattngncc gacggattgn nnnnnnngnn ncgttcaann
60nncngann 681470DNAArtificial Sequencesynthetic promoter sequence
motif 14antanannan ngnntttttt caanacnnca tgcaaccntc ntnnanannn
ttgcgtctat 60nnnaatagaa 701569DNAArtificial Sequencesynthetic
promoter sequence motif 15nnnnanaant tcnaattatt ttagttannn
tgtaataatt tncnnntttn nacgactaat 60nnataaaaa 691668DNAArtificial
Sequencesynthetic promoter sequence motif 16tnatttnatg cntncnanaa
atngacaatg tctggaanaa taccaanaga taaaatcatt 60agatanta
681766DNAArtificial Sequencesynthetic promoter sequence motif
17tganngagtc tanaatnnga cacnaantcc aggaacaant gtngnaccag nacgtcaaat
60aaanag 661868DNAArtificial Sequencesynthetic promoter sequence
motif 18nnnncnntnn ngnnantttc gncnnnggcg ggaataaact ccgcccnncn
ggcgtttnnn 60cnnnnann 681952DNAArtificial Sequencesynthetic
promoter sequence motif 19nccggnngcn ccnccncnnc gggaacancn
nnccctaagc tggngttgnn nn 522071DNAArtificial Sequencesynthetic
promoter sequence motif 20cnncnancng cgcangcann ngnnacnagc
cgggaacgcn ngcnccnccc ncgccatcca 60atgcacggag g 712171DNAArtificial
Sequencesynthetic promoter sequence motif 21tnataaatat ttnaattaat
ttanaaattt atgaaacttt ttttaannnt natncgtcta 60ataaatgtaa a
712270DNAArtificial Sequencesynthetic promoter sequence motif
22nnnntgtntt tttannnant tnanaaannn ntgaactttt tgntnttnng nggcgtctna
60tatanagaaa 702353DNAArtificial Sequencesynthetic promoter
sequence motif 23tnnnnnnncn cctngtnngg gaaccgatcc gtnnntnnnn
ccacacagcg ana 532470DNAArtificial Sequencesynthetic promoter
sequence motif 24ccnnnngttt gtancatttt gcnctgccng acgaaacatn
tccncnnncc ncgaaaccaa 60tttcccgaga 702571DNAArtificial
Sequencesynthetic promoter sequence motif 25ttgnaacnna nctttatgtt
gcgaaccgnn gacgatagcg ggtngcccnn gngcggtcaa 60gcnaanaatc c
712671DNAArtificial Sequencesynthetic promoter sequence motif
26gnncnccccc gcgaccnggt ngnccnggng gtacacccnn ggcggggngg cncgcgtcca
60actggcgtga c 712768DNAArtificial Sequencesynthetic promoter
sequence motif 27cgggcgcncc ngncccgtnc ngcccncccg tcaaccgnnc
ccgccgcgcc ngcgtccggn 60gggngncg 682869DNAArtificial
Sequencesynthetic promoter sequence motif 28nnnnnncngg cnnnnnnnnn
cncgcgtcga tgtcacannc gccgggnctg nctcgtcttg 60tnngcgnaa
692967DNAArtificial Sequencesynthetic promoter sequence motif
29nngnnncnnc acaaatnntt tngcccggga tgtcgatnnn gcgcnnnccc gttcgtcccn
60nggntga 673050DNAArtificial Sequencesynthetic promoter sequence
motif 30naaaaatnca tnannggntg aacttttnca anannncnna gtctaaannn
503150DNAArtificial Sequencesynthetic promoter sequence motif
31nnantancnn nnnntccngt gatccaaacn nncnncagcn ncgtatnana
503280DNAArtificial Sequencesynthetic parental promoter sequence
32tgcgtaattt attcacaagc ttgcatggaa cttgtggata aaatcacggt ctgataaaac
60agtgaatgat aacctcgttg 803380DNAArtificial Sequencesynthetic
parental promoter sequence 33gcctccacac cgctcgtcac atcctgtgat
ccactcttca tcccgctacg taacacctct 60gcatcgcgaa ccaaaaccag
803480DNAArtificial Sequencesynthetic chimeric promoter sequence
34tgcgtaattt attcacaagc ttgcatggaa cttgtggata tcccgctacg taacacctct
60gcatcgcgaa ccaaaaccag 803580DNAArtificial Sequencesynthetic
chimeric promoter sequence 35gcctccacac cgctcgtcac atcctgtgat
ccactctata aaatcacggt ctgataaaac 60agtgaatgat aacctcgttg
803635DNAArtificial Sequencesynthetic J23119 promoter and operator
sequence insert 36ttgacagcta gctcagtcct aggtataatc gtagc
353767DNAArtificial Sequencesynthetic inverted repeat sequence
37gcnnnnnnnn nnnnnnnnnn nnnnnnnnnn gcgaggcnnn nnnnnnnnnn nnnnnnnnnn
60nnnnngc 673812DNAArtificial Sequencesynthetic repressor consensus
sequence, ButR consensus sequence 38gtgtcactca aa
123919DNAArtificial Sequencesynthetic T7 RNAP N77 scaffold
39aattgtgagc ggataacaa 1940120DNAArtificial Sequencesynthetic T7
RNAP N115 scaffold 40atgttgttta tcaagcctgc ggatctccgc gaaattgtga
cttttccgct atttagcgat 60cttgttcagt gtggctttcc ttcaccggca gcagattacg
ttgaacagcg catcgatctg 1204175DNAArtificial Sequencesynthetic T7
RNAP N121 scaffold 41atgttgttta tcaagcctgc ggatctccgc gaaattgtga
cttttccgct atttagcgat 60cttgttcagt gtggc 7542120DNAArtificial
Sequencesynthetic T7 RNAP N130 scaffold 42atgttgttta tcaagcctgc
ggatctccgc gaaattgtga ctgccgcggc agcgagcgat 60cttgttcagt gtggctttcc
ttcaccggca gcagattacg ttgaacagcg catcgatctg 1204334DNAArtificial
Sequencesynthetic T7 RNAP N249 scaffold 43tatccaaacc agtagctcaa
ttggagtcgt ctat 344440DNAArtificial Sequencesynthetic T7 RNAP N249
scaffold random DNA spacer 44tgcagtttta ttctctcgcc agcactgtaa
taggcactaa 404523DNAArtificial Sequencesynthetic T7 promoter
sequence motif 45taatacgact cactannnnn aga 234623DNAArtificial
Sequencesynthetic T7 wild-type (WT) promoter sequence 46taatacgact
cactataggg aga 234723DNAArtificial Sequencesynthetic T7 Mut1 mutant
promoter sequence 47taatacgact cactacaggc aga 234823DNAArtificial
Sequencesynthetic T7 Mut2 mutant promoter sequence 48taatacgact
cactagagag aga 234923DNAArtificial Sequencesynthetic T7 Mut3 mutant
promoter sequence 49taatacgact cactaatggg aga 235023DNAArtificial
Sequencesynthetic T7 Mut4 mutant promoter sequence 50taatacgact
cactataggt aga 235123DNAArtificial Sequencesynthetic T7 Mut5 mutant
promoter sequence 51taatacgact cactaaaggg aga 235223DNAArtificial
Sequencesynthetic T7 Mut6 mutant promoter sequence 52taatacgact
cactattggg aga 235348DNAArtificial Sequencesynthetic
transcriptional terminator sequence motif 53tannnnaacc sswwssssss
tcwwwwcgss sssswwssgg ttttttgt 485429DNAArtificial
Sequencesynthetic mutant transcriptional terminator 52 sequence
54tataaaacgg ggggctaggg gttttttgt 295548DNAArtificial
Sequencesynthetic mutant transcriptional terminator 23 sequence
55tactcgaacc cctagcccgc tcttatcggg cggctagggg ttttttgt
485637DNAArtificial Sequencesynthetic mutant transcriptional
terminator 72 sequence 56tagcagaacc gctaacgggg gcgaaggggt tttttgt
375748DNAArtificial Sequencesynthetic mutant transcriptional
terminator 48 sequence 57tactcgaacc cctagcccgc tcttatcggg
cggctagggg ttttttgt 485829DNAArtificial Sequencesynthetic mutant
transcriptional terminator 1 sequence 58tacatatcgg gggggtaggg
gttttttgt 295929DNAArtificial Sequencesynthetic mutant
transcriptional terminator 2 sequence 59tacatatcgg gggggtaggg
gttttttgt 296048DNAArtificial Sequencesynthetic wild-type (WT)
transcriptiona terminator sequence 60tagcataacc ccttggggcc
tctaaacggg tcttgagggg ttttttgt 486147DNAArtificial
Sequencesynthetic mutant transcriptional terminator 31 sequence
61taccctaacc ccttccccgg tcaatcgggg cggatggggt tttttgt
476247DNAArtificial Sequencesynthetic mutant transcriptional
terminator 58 sequence 62tagaccaacc ccttgcggcc tcaatcgggg
gggatggggt tttttgt 476337DNAArtificial Sequencesynthetic mutant
transcriptional terminator 25 sequence 63tactctaacc ccatcggccg
tcttaggggt tttttgt 376448DNAArtificial Sequencesynthetic mutant
transcriptional terminator 17 sequence 64tacctcaacc ccttccgccc
tcatatcgcg gggcatgcgg ttttttgt 486539PRTArtificial
Sequencesynthetic T7 RNAP specificity loop sequence 65Val Trp Gln
Glu Tyr Lys Lys Pro Ile Gln Thr Arg Leu Asn Leu Met1 5 10 15Phe Leu
Gly Gln Phe Arg Leu Gln Pro Thr Ile Asn Thr Asn Lys Asp 20 25 30Ser
Glu Ile Asp Ala His Lys 356639PRTArtificial Sequencesynthetic T3
RNAP specificity loop sequence 66Val Trp Gln Glu Tyr Lys Lys Pro
Ile Gln Lys Arg Leu Asp Met Ile1 5 10 15Phe Leu Gly Gln Phe Arg Leu
Gln Pro Thr Ile Asn Thr Asn Lys Asp 20 25 30Ser Glu Ile Asp Ala His
Lys 356723DNAArtificial Sequencesynthetic T3 promoter sequence
67taataaccct cactataggg aga 236839PRTArtificial Sequencesynthetic
K1F RNAP specificity loop sequence 68Val Trp Gln Glu Tyr Lys Lys
Pro Ile Gln Thr Arg Leu Asn Leu Met1 5 10 15Phe Leu Gly Ser Phe Asn
Leu Gln Pro Thr Val Asn Thr Asn Lys Asp 20 25 30Ser Glu Ile Asp Ala
His Lys 356923DNAArtificial Sequencesynthetic K1F promoter sequence
69taataactat cactataggg aga 237039PRTArtificial Sequencesynthetic
N4 RNAP specificity loop sequence 70Val Trp Gln Glu Tyr Lys Lys Pro
Ile Gln Thr Arg Ile Asp Cys Val1 5 10 15Ile Leu Gly Thr His Arg Met
Ala Leu Thr Ile Asn Thr Asn Lys Asp 20 25 30Ser Glu Ile Asp Ala His
Lys 357123DNAArtificial Sequencesynthetic N4 promoter sequence
71taataaccca cactataggg aga 237215DNAArtificial Sequencesynthetic
partial T7 promoter sequence 72taatacgact cacta 157323DNAArtificial
Sequencesynthetic T7Mut1 promoter sequence 73taatacgact cactacaggc
aga 237423DNAArtificial Sequencesynthetic T7Mut2 promoter sequence
74taatacgact cactagagag aga 237523DNAArtificial Sequencesynthetic
T7Mut3 promoter sequence 75taatacgact cactaatggg aga
237623DNAArtificial Sequencesynthetic T7Mut4 promoter sequence
76taatacgact cactataggt aga 237723DNAArtificial Sequencesynthetic
T7Mut5 promoter sequence 77taatacgact cactaaaggg aga
237823DNAArtificial Sequencesynthetic T7Mut6 promoter sequence
78taatacgact cactattggg aga 237923DNAArtificial Sequencesynthetic
T3Mut1 promoter sequence 79taataaccct cactacaggc aga
238023DNAArtificial Sequencesynthetic T3Mut2 promoter sequence
80taataaccct cactagagag aga 238123DNAArtificial Sequencesynthetic
T3Mut3 promoter sequence 81taataaccct cactaatggg aga
238223DNAArtificial Sequencesynthetic T3Mut4 promoter sequence
82taataaccct cactataggt aga 238323DNAArtificial Sequencesynthetic
T3Mut5 promoter sequence 83taataaccct cactaaaggg aga
238423DNAArtificial Sequencesynthetic T3Mut6 promoter sequence
84taataaccct cactattggg aga 238512DNAArtificial Sequencesynthetic
AmeR repressor consensus sequence 85tagtgacgnt ta
128614DNAArtificial Sequencesynthetic JadR2 repressor consensus
sequence 86agatacnngt atct 148712DNAArtificial Sequencesynthetic
ArpA repressor consensus sequence 87tccacatgta gc
128812DNAArtificial Sequencesynthetic CasR repressor consensus
sequence 88tgagtactgt aa 128910DNAArtificial Sequencesynthetic LitR
repressor consensus sequence 89gcttatatgc 109018DNAArtificial
Sequencesynthetic BarA repressor consensus sequence 90gcacgatcat
gatcgtgc 189112DNAArtificial Sequencesynthetic DhaR repressor
consensus sequence 91acggcatgta tc 129212DNAArtificial
Sequencesynthetic McbR repressor consensus sequence 92tntagacaga cc
129312DNAArtificial Sequencesynthetic BarB repressor consensus
sequence 93gcngaataan at 129412DNAArtificial Sequencesynthetic EnvR
repressor consensus sequence 94ggccaatgag ta 129512DNAArtificial
Sequencesynthetic repressor consensus sequence 95agactagaca ga
129618DNAArtificial Sequencesynthetic degenerate ribosomal binding
site (RBS) library 96tcacacggaa akrcywsg 1897206PRTArtificial
Sequencesynthetic chimeric sigma factor ECF11_ECF02 97Met Arg Ile
Thr Ala Ser Leu Arg Thr Phe Cys His Leu Ser Thr Pro1 5 10 15His Ser
Asp Ser Thr Thr Ser Arg Leu Trp Ile Asp Glu Val Thr Ala 20 25 30Val
Ala Arg Gln Arg Asp Arg Asp Ser Phe Met Arg Ile Tyr Asp His 35 40
45Phe Ala Pro Arg Leu Leu Arg Tyr Leu Thr Gly Leu Asn Val Pro Glu
50 55 60Gly Gln Ala Glu Glu Leu Val Gln Glu Val Leu Leu Lys Leu Trp
His65 70 75 80Lys Ala Glu Ser Phe Asp Pro Ser Lys Ala Ser Leu Gly
Thr Trp Leu 85 90 95Phe
Arg Ile Ala Arg Asn Leu Tyr Ile Asp Ser Val Arg Lys Asp Arg 100 105
110Gly Trp Val Gln Val Gln Asn Ser Leu Glu Gln Leu Glu Arg Leu Glu
115 120 125Ala Ile Ser Asn Pro Glu Asn Leu Met Leu Ser Glu Glu Leu
Arg Gln 130 135 140Ile Val Phe Arg Thr Ile Glu Ser Leu Pro Glu Asp
Leu Arg Met Ala145 150 155 160Ile Thr Leu Arg Glu Leu Asp Gly Leu
Ser Tyr Glu Glu Ile Ala Ala 165 170 175Ile Met Asp Cys Pro Val Gly
Thr Val Arg Ser Arg Ile Phe Arg Ala 180 185 190Arg Glu Ala Ile Asp
Asn Lys Val Gln Pro Leu Ile Arg Arg 195 200 20598187PRTArtificial
Sequencesynthetic chimeric sigma factor ECF02_ECF11 98Met Ser Glu
Gln Leu Thr Asp Gln Val Leu Val Glu Arg Val Gln Lys1 5 10 15Gly Asp
Gln Lys Ala Phe Asn Leu Leu Val Val Arg Tyr Gln His Lys 20 25 30Val
Ala Ser Leu Val Ser Arg Tyr Val Pro Ser Gly Asp Val Pro Asp 35 40
45Val Val Gln Glu Ala Phe Ile Lys Ala Tyr Arg Ala Leu Asp Ser Phe
50 55 60Arg Gly Asp Ser Ala Phe Tyr Thr Trp Leu Tyr Arg Ile Ala Val
Asn65 70 75 80Thr Ala Lys Asn Tyr Leu Val Ala Gln Gly Arg Arg Pro
Pro Ser Ser 85 90 95Asp Val Asp Ala Ile Glu Ala Glu Asn Phe Glu Gln
Leu Glu Arg Leu 100 105 110Glu Ala Pro Val Asp Arg Thr Leu Asp Tyr
Ser Gln Arg Gln Glu Gln 115 120 125Gln Leu Asn Ser Ala Ile Gln Asn
Leu Pro Thr Asp Gln Ala Lys Val 130 135 140Leu Arg Met Ser Tyr Phe
Glu Ala Leu Ser His Arg Glu Ile Ser Glu145 150 155 160Arg Leu Asp
Met Pro Leu Gly Thr Val Lys Ser Cys Leu Arg Leu Ala 165 170 175Phe
Gln Lys Leu Arg Ser Arg Ile Glu Glu Ser 180
18599883PRTEnterobacteria phage T7bacteriophage T7 RNA polymerase
(RNAP) 99Met Asn Thr Ile Asn Ile Ala Lys Asn Asp Phe Ser Asp Ile
Glu Leu1 5 10 15Ala Ala Ile Pro Phe Asn Thr Leu Ala Asp His Tyr Gly
Glu Arg Leu 20 25 30Ala Arg Glu Gln Leu Ala Leu Glu His Glu Ser Tyr
Glu Met Gly Glu 35 40 45Ala Arg Phe Arg Lys Met Phe Glu Arg Gln Leu
Lys Ala Gly Glu Val 50 55 60Ala Asp Asn Ala Ala Ala Lys Pro Leu Ile
Thr Thr Leu Leu Pro Lys65 70 75 80Met Ile Ala Arg Ile Asn Asp Trp
Phe Glu Glu Val Lys Ala Lys Arg 85 90 95Gly Lys Arg Pro Thr Ala Phe
Gln Phe Leu Gln Glu Ile Lys Pro Glu 100 105 110Ala Val Ala Tyr Ile
Thr Ile Lys Thr Thr Leu Ala Cys Leu Thr Ser 115 120 125Ala Asp Asn
Thr Thr Val Gln Ala Val Ala Ser Ala Ile Gly Arg Ala 130 135 140Ile
Glu Asp Glu Ala Arg Phe Gly Arg Ile Arg Asp Leu Glu Ala Lys145 150
155 160His Phe Lys Lys Asn Val Glu Glu Gln Leu Asn Lys Arg Val Gly
His 165 170 175Val Tyr Lys Lys Ala Phe Met Gln Val Val Glu Ala Asp
Met Leu Ser 180 185 190Lys Gly Leu Leu Gly Gly Glu Ala Trp Ser Ser
Trp His Lys Glu Asp 195 200 205Ser Ile His Val Gly Val Arg Cys Ile
Glu Met Leu Ile Glu Ser Thr 210 215 220Gly Met Val Ser Leu His Arg
Gln Asn Ala Gly Val Val Gly Gln Asp225 230 235 240Ser Glu Thr Ile
Glu Leu Ala Pro Glu Tyr Ala Glu Ala Ile Ala Thr 245 250 255Arg Ala
Gly Ala Leu Ala Gly Ile Ser Pro Met Phe Gln Pro Cys Val 260 265
270Val Pro Pro Lys Pro Trp Thr Gly Ile Thr Gly Gly Gly Tyr Trp Ala
275 280 285Asn Gly Arg Arg Pro Leu Ala Leu Val Arg Thr His Ser Lys
Lys Ala 290 295 300Leu Met Arg Tyr Glu Asp Val Tyr Met Pro Glu Val
Tyr Lys Ala Ile305 310 315 320Asn Ile Ala Gln Asn Thr Ala Trp Lys
Ile Asn Lys Lys Val Leu Ala 325 330 335Val Ala Asn Val Ile Thr Lys
Trp Lys His Cys Pro Val Glu Asp Ile 340 345 350Pro Ala Ile Glu Arg
Glu Glu Leu Pro Met Lys Pro Glu Asp Ile Asp 355 360 365Met Asn Pro
Glu Ala Leu Thr Ala Trp Lys Arg Ala Ala Ala Ala Val 370 375 380Tyr
Arg Lys Asp Lys Ala Arg Lys Ser Arg Arg Ile Ser Leu Glu Phe385 390
395 400Met Leu Glu Gln Ala Asn Lys Phe Ala Asn His Lys Ala Ile Trp
Phe 405 410 415Pro Tyr Asn Met Asp Trp Arg Gly Arg Val Tyr Ala Val
Ser Met Phe 420 425 430Asn Pro Gln Gly Asn Asp Met Thr Lys Gly Leu
Leu Thr Leu Ala Lys 435 440 445Gly Lys Pro Ile Gly Lys Glu Gly Tyr
Tyr Trp Leu Lys Ile His Gly 450 455 460Ala Asn Cys Ala Gly Val Asp
Lys Val Pro Phe Pro Glu Arg Ile Lys465 470 475 480Phe Ile Glu Glu
Asn His Glu Asn Ile Met Ala Cys Ala Lys Ser Pro 485 490 495Leu Glu
Asn Thr Trp Trp Ala Glu Gln Asp Ser Pro Phe Cys Phe Leu 500 505
510Ala Phe Cys Phe Glu Tyr Ala Gly Val Gln His His Gly Leu Ser Tyr
515 520 525Asn Cys Ser Leu Pro Leu Ala Phe Asp Gly Ser Cys Ser Gly
Ile Gln 530 535 540His Phe Ser Ala Met Leu Arg Asp Glu Val Gly Gly
Arg Ala Val Asn545 550 555 560Leu Leu Pro Ser Glu Thr Val Gln Asp
Ile Tyr Gly Ile Val Ala Lys 565 570 575Lys Val Asn Glu Ile Leu Gln
Ala Asp Ala Ile Asn Gly Thr Asp Asn 580 585 590Glu Val Val Thr Val
Thr Asp Glu Asn Thr Gly Glu Ile Ser Glu Lys 595 600 605Val Lys Leu
Gly Thr Lys Ala Leu Ala Gly Gln Trp Leu Ala Tyr Gly 610 615 620Val
Thr Arg Ser Val Thr Lys Arg Ser Val Met Thr Leu Ala Tyr Gly625 630
635 640Ser Lys Glu Phe Gly Phe Arg Gln Gln Val Leu Glu Asp Thr Ile
Gln 645 650 655Pro Ala Ile Asp Ser Gly Lys Gly Leu Met Phe Thr Gln
Pro Asn Gln 660 665 670Ala Ala Gly Tyr Met Ala Lys Leu Ile Trp Glu
Ser Val Ser Val Thr 675 680 685Val Val Ala Ala Val Glu Ala Met Asn
Trp Leu Lys Ser Ala Ala Lys 690 695 700Leu Leu Ala Ala Glu Val Lys
Asp Lys Lys Thr Gly Glu Ile Leu Arg705 710 715 720Lys Arg Cys Ala
Val His Trp Val Thr Pro Asp Gly Phe Pro Val Trp 725 730 735Gln Glu
Tyr Lys Lys Pro Ile Gln Thr Arg Leu Asn Leu Met Phe Leu 740 745
750Gly Gln Phe Arg Leu Gln Pro Thr Ile Asn Thr Asn Lys Asp Ser Glu
755 760 765Ile Asp Ala His Lys Gln Glu Ser Gly Ile Ala Pro Asn Phe
Val His 770 775 780Ser Gln Asp Gly Ser His Leu Arg Lys Thr Val Val
Trp Ala His Glu785 790 795 800Lys Tyr Gly Ile Glu Ser Phe Ala Leu
Ile His Asp Ser Phe Gly Thr 805 810 815Ile Pro Ala Asp Ala Ala Asn
Leu Phe Lys Ala Val Arg Glu Thr Met 820 825 830Val Asp Thr Tyr Glu
Ser Cys Asp Val Leu Ala Asp Phe Tyr Asp Gln 835 840 845Phe Ala Asp
Gln Leu His Glu Ser Gln Leu Asp Lys Met Pro Ala Leu 850 855 860Pro
Ala Lys Gly Asn Leu Asn Leu Arg Asp Ile Leu Glu Ser Asp Phe865 870
875 880Ala Phe Ala 100498DNASalmonella typhimuriumtranscriptional
activator chaperone protein sicA 100atggattatc aaaataatgt
cagcgaagaa cgtgttgcgg aaatgatttg ggatgccgtt 60agtgaaggcg ccacgctaaa
agacgttcat gggatccctc aagatatgat ggacggttta 120tatgctcatg
cttatgagtt ttataaccag ggacgactgg atgaagctga gacgttcttt
180cgtttcttat gcatttatga tttttacaat cccgattaca ccatgggact
ggcggcagta 240tgccaactga aaaaacaatt tcagaaagca tgtgaccttt
atgcagtagc gtttacgtta 300cttaaaaatg attatcgccc cgtttttttt
accgggcagt gtcaattatt aatgcgtaag 360gcagcaaaag ccagacagtg
ttttgaactt gtcaatgaac gtactgaaga tgagtctctg 420cgggcaaaag
cgttggtcta tctggaggcg ctaaaaacgg cggagacaga gcagcacagt
480gaacaagaaa aggaataa 498101498DNAArtificial Sequencesynthetic
sicA* F62Y mutant sicA transcriptional activator chaperone protein
101atggattatc aaaataatgt cagcgaagaa cgtgttgcgg aaatgatttg
ggatgccgtt 60agtgaaggcg ccacgctaaa agacgttcat gggatccctc aagatatgat
ggacggttta 120tatgctcatg cttatgagtt ttataaccag ggacgactgg
atgaagctga gacgttcttt 180cgttacttat gcatttatga tttttacaat
cccgattaca ccatgggact ggcggcagta 240tgccaactga aaaaacaatt
tcagaaagca tgtgaccttt atgcagtagc gtttacgtta 300cttaaaaatg
attatcgccc cgtttttttt accgggcagt gtcaattatt aatgcgtaag
360gcagcaaaag ccagacagtg ttttgaactt gtcaatgaac gtactgaaga
tgagtctctg 420cgggcaaaag cgttggtcta tctggaggcg ctaaaaacgg
cggagacaga gcagcacagt 480gaacaagaaa aggaataa 498102750DNASalmonella
typhimuriumtranscriptional activator invF with new corrected
upstream start codon 102atgctaaata cgcaggaagt acttaaagaa ggagagaagc
ggaaaatccg cagcccggaa 60gcatggttta tacagacgtg ttccgcgcaa aagctgcata
tgtcattttc tgaaagccga 120cacaatgaaa attgcctgat tcaggaaggc
gcgctgcttt tttgcgagca ggccgttgtc 180gcaccagtat caggagacct
ggtttttcga ccgttaaaaa ttgaagtact cagcaaatta 240ctggcattta
tcgatggcgc aggattagtg gacacgacat atgctgaatc cgataaatgg
300gttttgctga gtcctgagtt tcgcgctatt tggcaagatc gtaaacgctg
cgagtactgg 360tttttgcagc aaattattac gccttctccg gccttcaata
aggtactggc gctgttacga 420aaaagcgaga gttactggtt ggttggctat
ttactcgctc agtcaaccag cggcaacacg 480atgagaatgc tgggagaaga
ctatggcgtt tcttataccc attttcgtcg tttgtgcagc 540agagcgttgg
gcggaaaagc gaagagtgaa ttacgaaact ggcgtatggc gcaatcgctg
600ctgaatagtg tagaaggcca cgagaacatc acccaattag ccgttaatca
tggttactca 660tcgccttcac atttttctag tgagatcaaa gagctgatcg
gcgtttcgcc gcggaaatta 720tcaaatatta ttcaattggc agacaaatga
750103163DNASalmonella typhimuriumpromoter(1)...(163)psicA promoter
103ccacaagaaa cgaggtacgg cattgagccg cgtaaggcag tagcgatgta
ttcattgggc 60gttttttgaa tgttcactaa ccaccgtcgg ggtttaataa ctgcatcaga
taaacgcagt 120cgttaagttc tacaaagtcg gtgacagata acaggagtaa gta
163104468DNAShigella flexneritranscriptional activator chaperone
protein ipgC 104atgtctttaa atatcaccga aaatgaaagc atctctactg
cagtaattga tgcaattaac 60tctggcgcta cactgaaaga tattaatgca attcctgatg
atatgatgga tgacatttat 120tcatatgctt atgactttta caacaaagga
agaatagagg aagctgaagt tttcttcagg 180tttttatgta tatacgactt
ttacaatgta gactacatta tgggactcgc agctatttat 240cagataaaag
aacagttcca acaagcagca gacctttatg ctgtcgcttt tgcattagga
300aaaaatgact atacaccagt attccatact ggacaatgtc agcttcggtt
gaaagccccc 360ttaaaagcta aagagtgctt cgaactcgta attcaacaca
gcaatgatga aaaattaaaa 420ataaaagcac aatcatactt ggacgcaatt
caggatatca aggagtaa 468105756DNAArtificial Sequencesynthetic
Shigella flexneri transcriptional activator mxiE with codon
optimization 105atgagtaaat ataaaggcct gaacaccagc aacatgttct
acatctacag ctctggtcat 60gaaccggtga acgttgaact ggtgaaagat aaagaacgta
acatcatcga actggcaccg 120gcgtggaaag gctttttctt tgtgcgtaac
cagaacatca aattcagcga taacgttaac 180taccactacc gcttcaacat
caactcttgc gcaaaattcc tggcgttttg ggattatttt 240agcggcgccc
tggttgaaca ttctcacgca gaaaaatgca tccatttcta ccacgaaaac
300gatctgcgtg atagctgtaa tacggaatct atgctggata aactgatgct
gcgcttcatt 360tttagtagcg atcagaacgt gtctaatgcc ctggcaatga
tccgtatgac cgaaagttat 420catctggttc tgtacctgct gcgtacgatt
gaaaaagaaa aagaagtgcg catcaaaagc 480ctgaccgaac actatggcgt
ttctgaagcg tactttcgta gtctgtgtcg caaagcgctg 540ggtgccaaag
tgaaagaaca gctgaacacg tggcgcctgg tgaatggcct gctggatgtt
600ttcctgcata accagaccat tacgagcgcg gccatgaaca atggttatgc
gtctaccagt 660cacttcagca atgaaattaa aacgcgtctg ggctttagtg
cccgcgaact gagcaacatc 720accttcctgg tgaagaaaat taatgaaaaa atctaa
756106350DNAShigella flexneripromoter(1)...(350)pipaH9.8 promoter
106gcgaaaatga catcaaaaac gccattaacc tgatgttctg gggaatataa
atgtcaggct 60agggtcaaaa atcgtggcgt tgacaaaatg gctgcgttac gtcattgagc
atatccagga 120ctggccggca aaccgggtac gcgatctgtt gccttggaaa
gttgatctga cctctcagta 180aatatcaata cggttctgac gagccgctta
ccgttcaaat atgaagtacg atgtttaact 240aaccgaaaaa caagaacaat
acggtgcaaa caggccattc acggttaact gaaacagtat 300cgttttttta
cagccaattt tgtttatcct tattataata aaaaagtgct 350107350DNAArtificial
Sequencesynthetic mutated pipaH9.8 Shigella flexneri promoter
pipaH9.8* 107gcgaaaatga catcaaaaac gccattaacc tgatgttctg gggaatataa
atgtcaggct 60agggtcaaaa atcgtggcgt tgacaaaatg gctgcgttac gtcattgagc
atatccagga 120ctggccggca aaccgggtac gcgatctgtt gccttggaaa
gttgatctga cctctcagta 180aatatcaata cggttctgac gagccgctta
ccgttcaaat atgaagtacg atgtttaact 240aaccgaaaaa caagaacaat
acggtgcaaa caggccattc acggttaact gaaacagtat 300cgttttttta
cagccaattt tgtttatcct tattaagata aaaaagtgct 350108438DNAPseudomonas
aeruginosatranscriptional activator chaperone protein exsC
108atggatttaa cgagcaaggt caaccgactg cttgccgagt tcgcaggccg
tatcggtttg 60ccttccctgt ccctcgacga ggagggcatg gcgagcctcc tgttcgacga
acaggtgggc 120gtcaccctgt tgctgctcgc cgagcgcgag cgtctgttgc
tggaggccga tgtggcgggc 180atcgatgtgc tgggcgaggg gatctttcgc
cagctcgcca gcttcaaccg ccattggcac 240cgtttcgatc tgcatttcgg
cttcgacgag ctgaccggca aggtccagtt gtatgcgcag 300attctcgcag
cgcaactgac cctcgaatgc ttcgaggcga ccttggccaa tctgctcgat
360cacgccgagt tctggcagcg cctgctgccg tgcgacagtg atcgcgaggc
ggtcgctgcg 420gtcggcatga gggtttga 438109831DNAPseudomonas
aeruginosaexsD 109atggagcagg aagacgataa gcagtactcc cgagaagcgg
tgttcgctgg caggcgggta 60tccgtggtgg gctcggacgc ccgctcgcgg ggtcgggtgc
cgggttacgc atcgagcagt 120ttgtatcgtg agtccggaat catcagtgcg
cggcaactgg cgttgctgca gcggatgctg 180ccgcgcctgc ggctggagca
actgttccgc tgcgagtggt tgcagcagcg cctggcgcgc 240ggcctggcgc
tggggcgcga agaggtgcgg cagattctcc tctgcgcggc gcaggacgac
300gacggctggt gctccgaact gggcgaccgg gtcaacctcg ccgtgccgca
gtcgatgatc 360gactgggtcc tgctgccggt ctatggctgg tgggaaagcc
tgctcgacca ggcgatcccc 420ggctggcgcc tgtcgctggt ggagctggag
acccagtccc ggcaactgcg agtcaagtcc 480gaattctggt cccgcgtggc
cgagctggag ccggagcagg cccgcgagga actggccagg 540gtcgccaagt
gccaggcgcg cacccaggaa caggtggccg aactggccgg caagctggag
600acggcttcgg cactggcgaa gagcgcctgg ccgaactggc agcggggcat
ggcgacgctg 660ctcgccagcg gcgggctggc cggcttcgag ccgatccccg
aggtcctcga atgcctctgg 720caacctctct gccggctgga cgacgacgtc
ggcgcggcgg acgccgtcca ggcctggctg 780cacgaacgca acctgtgcca
ggcacaggat cacttctact ggcagagctg a 831110837DNAPseudomonas
aeruginosatranscriptional activator exsA 110atgcaaggag ccaaatctct
tggccgaaag cagataacgt cttgtcattg gaacattcca 60actttcgaat acagggtaaa
caaggaagag ggcgtatatg ttctgctcga gggcgaactg 120accgtccagg
acatcgattc cactttttgc ctggcgcctg gcgagttgct tttcgtccgc
180cgcggaagct atgtcgtaag taccaaggga aaggacagcc gaatactctg
gattccatta 240tctgcccagt ttctacaagg cttcgtccag cgcttcggcg
cgctgttgag tgaagtcgag 300cgttgcgacg agcccgtgcc gggcatcatc
gcgttcgctg ccacgcctct gctggccggt 360tgcgtcaagg ggttgaagga
attgcttgtg catgagcatc cgccgatgct cgcctgcctg 420aagatcgagg
agttgctgat gctcttcgcg ttcagtccgc aggggccgct gctgatgtcg
480gtcctgcggc aactgagcaa ccggcatgtc gagcgtctgc agctattcat
ggagaagcac 540tacctcaacg agtggaagct gtccgacttc tcccgcgagt
tcggcatggg gctgaccacc 600ttcaaggagc tgttcggcag tgtctatggg
gtttcgccgc gcgcctggat cagcgagcgg 660agaatcctct atgcccatca
gttgctgctc aacagcgaca tgagcatcgt cgacatcgcc 720atggaggcgg
gcttttccag tcagtcctat ttcacccaga gctatcgccg ccgtttcggc
780tgcacgccga gccgctcgcg gcaggggaag gacgaatgcc gggctaaaaa taactga
83711180DNAPseudomonas aeruginosapromoter(1)...(80)pexsD promoter
111gaaggacgaa tgccgggcta aaaataactg acgttttttg aaagcccggt
agcggctgca 60tgagtagaat cggcccaaat 8011280DNAPseudomonas
aeruginosapromoter(1)...(80)pexsC promoter 112gatgtggctt ttttcttaaa
agaaaagtct ctcagtgaca aaagcgatgc atagcccggt 60gctagcatgc gctgagcttt
80113702DNADiscosoma sp.red fluorescent protein (RFP) reporter
protein 113atggcttcct ccgaagacgt tatcaaagag ttcatgcgtt tcaaagttcg
tatggaaggt 60tccgttaacg gtcacgagtt cgaaatcgaa ggtgaaggtg aaggtcgtcc
gtacgaaggt 120acgcagaccg ctaaactgaa agttaccaaa ggtggtccgc
tgccgttcgc ttgggacatc 180ctgtccccgc agttccagta cggttccaaa
gcttacgtta aacacccggc tgacatcccg 240gactacctga aactgtcctt
cccggaaggt ttcaaatggg aacgtgttat gaacttcgaa 300gacggtggtg
ttgttaccgt tacccaggac tcctccctgc aagacggtga gttcatctac
360aaagttaaac tgcgtggtac taacttcccg tccgacggtc cggttatgca
gaaaaaaacc 420atgggttggg aagcttccac cgaacgtatg tacccggaag
acggtgctct gaaaggtgaa 480atcaaaatgc gtctgaaact gaaagacggt
ggtcactacg acgctgaagt taaaaccacc 540tacatggcta aaaaaccggt
tcagctgccg ggtgcttaca aaaccgacat caaactggac 600atcacctccc
acaacgaaga ctacaccatc gttgaacagt acgaacgtgc tgaaggtcgt
660cactccaccg gtgctgcagc aaacgacgaa aactacgctt aa
70211416DNAArtificial Sequencesynthetic target DNA sequence
operator for McbR repressor 114tgaacagctt ggtcta
1611518DNAArtificial Sequencesynthetic target DNA sequence operator
for UidR repressor 115ctattggtta accaattt 1811620DNAArtificial
Sequencesynthetic target DNA sequence operator for BM3R1 repressor
116cggaatgaac gttcattccg 2011722DNAArtificial Sequencesynthetic
target DNA sequence operator for AmtR repressor 117attatctata
gatcgataga aa 2211822DNAArtificial Sequencesynthetic target DNA
sequence operator for BetI repressor 118ttatattgaa cgtccaatga at
2211922DNAArtificial Sequencesynthetic target DNA sequence operator
for HapR repressor 119ttattgattt ttaatcaaat aa 2212022DNAArtificial
Sequencesynthetic target DNA sequence operator for HlyIIR repressor
120tttaaacaag aattttaaat at 2212122DNAArtificial Sequencesynthetic
target DNA sequence operator for SmcR repressor 121ttattgataa
atctgcgtaa aa 2212224DNAArtificial Sequencesynthetic target DNA
sequence operator for AcrR repressor 122tacatacatt tatgaatgta tgta
2412324DNAArtificial Sequencesynthetic target DNA sequence operator
for ArpA repressor 123cgacatacgg gacgccccgt ttat
2412424DNAArtificial Sequencesynthetic target DNA sequence operator
for LmrA repressor 124agataataga ccagtcacta tatt
2412526DNAArtificial Sequencesynthetic target DNA sequence operator
for BarA repressor 125agatacatac caaccggttc ttttga
2612626DNAArtificial Sequencesynthetic target DNA sequence operator
for QacR repressor 126cttatagacc gatcgcacgg tctata
2612726DNAArtificial Sequencesynthetic target DNA sequence operator
for TylP repressor 127atacaaaccg cgtcagcggt ttgtaa
2612827DNAArtificial Sequencesynthetic target DNA sequence operator
for MtrR repressor 128tttttatccg tgcaatcgtg tatgtat
2712928DNAArtificial Sequencesynthetic target DNA sequence operator
for FarA repressor 129gatacgaacg ggacggacgg tttgcagc
2813028DNAArtificial Sequencesynthetic target DNA sequence operator
for IcaR Se repressor 130acaacctaac taacgaaagg taggtgaa
2813129DNAArtificial Sequencesynthetic target DNA sequence operator
for ScbR repressor 131gaaaaaaaac cgctctagtc tgtatctta
2913230DNAArtificial Sequencesynthetic target DNA sequence operator
for PhlF repressor 132atgatacgaa acgtaccgta tcgttaaggt
3013330DNAArtificial Sequencesynthetic target DNA sequence operator
for SmeT repressor 133gtttacaaac aaacaagcat gtatgtatat
3013431DNAArtificial Sequencesynthetic target DNA sequence operator
for MphR repressor 134gaatataacc gacgtgactg ttacatttag g
3113532DNAArtificial Sequencesynthetic target DNA sequence operator
for LuxT repressor 135ttcggtttac tttgtttaga atacccacgt ct
3213638DNAArtificial Sequencesynthetic target DNA sequence operator
for PsrA repressor 136agcagggctg aaacgtatgt ttcaaacacc tgtttctg
3813740DNAArtificial Sequencesynthetic target DNA sequence operator
for TtgR repressor 137cagcagtatt tacaaacaac catgaatgta agtatattcc
4013841DNAArtificial Sequencesynthetic target DNA sequence operator
for VarR repressor 138cacttgtaca tcgtataact ctcatatacg ttgtagaaca g
4113955DNAArtificial Sequencesynthetic target DNA sequence operator
for EthR repressor 139gtgtcgatag tgtcgacatc tcgttgacgg cctcgacatt
acgttgatag cgtgg 551406PRTArtificial Sequencesynthetic His-6 tag,
amino-terminal 6x-His tag 140His His His His His His1
514122PRTArtificial Sequencesynthetic N-terminal His-6 tag with
cleavable PreScission protease cleavage site 141Met Gly Ser Ser His
His His His His His Ser Ser Gly Leu Glu Val1 5 10 15Leu Phe Gln Gly
Pro His 2014236DNAArtificial Sequencesynthetic repressed pOR1
promoter 142tttgacatac ctctggcggt gatatataat ggttgc
36143289DNAArtificial Sequencesynthetic upstream inducible promoter
Pbad 143agaaaccaat tgtccatatt gcatcagaca ttgccgtcac tgcgtctttt
actggctctt 60ctcgctaacc aaaccggtaa ccccgcttat taaaagcatt ctgtaacaaa
gcgggaccaa 120agccatgaca aaaacgcgta acaaaagtgt ctataatcac
ggcagaaaag tccacattga 180ttatttgcac ggcgtcacac tttgctatgc
catagcattt ttatccataa gattagcgga 240tcctacctga cgctttttat
cgcaactctc tactgtttct ccatacccg 28914484DNAArtificial
Sequencesynthetic upstream inducible promoter Ptac 144ggcaaatatt
ctgaaatgag ctgttgacaa ttaatcatcg gctcgtataa tgtgtggaat 60tgtgagcgga
taacaatttc acac 8414578DNAArtificial Sequencesynthetic upstream
inducible promoter Modified-Ptac 145ggcaaatatt ctgaaatgag
ctgataaatg tgagcggata acattgacat tgtgagcgga 60taacaagata ctgagcac
7814621DNAArtificial Sequencesynthetic super-fold gfp ribosome
binding sequence (SDA) 146actagaagga ggaaaaaaat g
2114712DNAArtificial Sequencesynthetic fused cI-gfp gene short
linker sequence 147ggcggtggcg gt 1214821DNAArtificial
Sequencesynthetic ribosome binding sequence SDmut 148actagaacca
tgaaaaaagt g 2114943DNAArtificial Sequencesynthetic pD/E20J T5
bacteriophage 5' UTR spacer sequence 149agttcgatga gagcgataac
cctctacaaa taattttgtt taa 4315042DNAArtificial Sequencesynthetic
pH207J T5 bacteriophage 5' UTR spacer sequence 150ataaattgat
aaacaaaaac ctctacaaat aattttgttt aa 4215143DNAArtificial
Sequencesynthetic pN25J T5 bacteriophage 5' UTR spacer sequence
151ataaatttga gagaggagtt cctctacaaa taattttgtt taa
4315243DNAArtificial Sequencesynthetic pG25J T5 bacteriophage 5'
UTR spacer sequence 152attaaagagg agaaattaac cctctacaaa taattttgtt
taa 4315343DNAArtificial Sequencesynthetic pJ5J T5 bacteriophage 5'
UTR spacer sequence 153aaacctaatg gatcgacctt cctctacaaa taattttgtt
taa 4315442DNAArtificial Sequencesynthetic pA1J T7 bacteriophage 5'
UTR spacer sequence 154atcgagaggg acacggcgac ctctacaaat aattttgttt
aa 4215542DNAArtificial Sequencesynthetic pA2J T7 bacteriophage 5'
UTR spacer sequence 155gctaggtaac actagcagcc ctctacaaat aattttgttt
aa 4215642DNAArtificial Sequencesynthetic pA3J T7 bacteriophage 5'
UTR spacer sequence 156atgaaacgac agtgagtcac ctctacaaat aattttgttt
aa 4215743DNAArtificial Sequencesynthetic phi10J T7 bacteriophage
5' UTR spacer sequence 157agggagacca caacggtttc cctctacaaa
taattttgtt taa 4315843DNAArtificial Sequencesynthetic DG146aJ
high-transcription escape 5' UTR spacer sequence 158attaaaaaac
ctgctaggat cctctacaaa taattttgtt taa 4315943DNAArtificial
Sequencesynthetic DG122J high-transcription escape 5' UTR spacer
sequence 159ataaaggaaa acggtcaggt cctctacaaa taattttgtt taa
4316043DNAArtificial Sequencesynthetic DG131aJ high-transcription
escape 5' UTR spacer sequence 160ataggttaaa agcctgtcat cctctacaaa
taattttgtt taa 4316148DNAArtificial Sequencesynthetic MhpR3hppJ
carbon utilization 5' UTR spacer sequence 161acaataaaaa atcatttaca
tgtttcctct acaaataatt ttgtttaa 4816248DNAArtificial
Sequencesynthetic GlcCJ carbon utilization 5' UTR spacer sequence
162agaagcagcg cgcaaaaatc agctgcctct acaaataatt ttgtttaa
4816348DNAArtificial Sequencesynthetic FucRPfucPJ carbon
utilization 5' UTR spacer sequence 163atgagttcat ttcagacagg
caaatcctct acaaataatt ttgtttaa 4816448DNAArtificial
Sequencesynthetic FuncRPfucAJ carbon utilization 5' UTR spacer
sequence 164aacttgcagt tatttactgt gattacctct acaaataatt ttgtttaa
4816548DNAArtificial Sequencesynthetic ChbRNagCJ carbon utilization
5' UTR spacer sequence 165agccacaaaa aaagtcatgt tggttcctct
acaaataatt ttgtttaa 4816653DNAArtificial Sequencesynthetic AraCJ
carbon utilization 5' UTR spacer sequence 166acacagtcac ttatctttta
gttaaaaggt cctctacaaa taattttgtt taa 5316743DNAArtificial
Sequencesynthetic AntiescapeJ anti-escaping sequence 5' UTR spacer
sequence 167atccggaatc ctcttcccgg cctctacaaa taattttgtt taa
4316848DNAArtificial Sequencesynthetic LeiQiJ 5' UTR spacer
sequence 168aacaaaataa aaaggagtcg ctcaccctct acaaataatt ttgtttaa
4816943DNAArtificial Sequencesynthetic pD/E20RBS T5 bacteriophage
5' UTR spacer sequence 169agttcgatga gagcgataac agttccagat
tcaggaacta taa 4317042DNAArtificial Sequencesynthetic pH207RBS T5
bacteriophage 5' UTR spacer sequence 170ataaattgat aaacaaaaaa
gttccagatt caggaactat aa 4217143DNAArtificial Sequencesynthetic
pN25RBS T5 bacteriophage 5' UTR spacer sequence 171ataaatttga
gagaggagtt agttccagat tcaggaacta taa 4317243DNAArtificial
Sequencesynthetic pG25RBS T5 bacteriophage 5' UTR spacer sequence
172attaaagagg agaaattaac agttccagat tcaggaacta taa
4317343DNAArtificial Sequencesynthetic pJ5RBS T5 bacteriophage 5'
UTR spacer sequence 173aaacctaatg gatcgacctt agttccagat tcaggaacta
taa 4317442DNAArtificial Sequencesynthetic pA1RBS T7 bacteriophage
5' UTR spacer sequence 174atcgagaggg acacggcgaa gttccagatt
caggaactat aa 4217542DNAArtificial Sequencesynthetic pA2RBS T7
bacteriophage 5' UTR spacer sequence 175gctaggtaac actagcagca
gttccagatt caggaactat aa 4217642DNAArtificial Sequencesynthetic
pA3RBS T7 bacteriophage 5' UTR spacer sequence 176atgaaacgac
agtgagtcaa gttccagatt caggaactat aa 4217743DNAArtificial
Sequencesynthetic phi10RBS T7 bacteriophage 5' UTR spacer sequence
177agggagacca caacggtttc agttccagat tcaggaacta taa
4317843DNAArtificial Sequencesynthetic DG146aRBS high-transcription
escape 5' UTR spacer sequence 178attaaaaaac ctgctaggat agttccagat
tcaggaacta taa 4317943DNAArtificial Sequencesynthetic DG122RBS
high-transcription escape 5' UTR spacer sequence 179ataaaggaaa
acggtcaggt agttccagat tcaggaacta taa 4318043DNAArtificial
Sequencesynthetic DG131aRBS high-transcription escape 5' UTR spacer
sequence 180ataggttaaa agcctgtcat agttccagat tcaggaacta taa
4318148DNAArtificial Sequencesynthetic MhpR3hppRBS carbon
utilization 5' UTR spacer sequence 181acaataaaaa atcatttaca
tgtttagttc cagattcagg aactataa 4818248DNAArtificial
Sequencesynthetic GlcCRBS carbon utilization 5' UTR spacer sequence
182agaagcagcg cgcaaaaatc agctgagttc cagattcagg aactataa
4818348DNAArtificial Sequencesynthetic FucRPfucPRBS carbon
utilization 5' UTR spacer sequence 183atgagttcat ttcagacagg
caaatagttc cagattcagg aactataa 4818448DNAArtificial
Sequencesynthetic FuncRPfucARBS carbon utilization 5' UTR spacer
sequence 184aacttgcagt tatttactgt gattaagttc cagattcagg aactataa
4818548DNAArtificial Sequencesynthetic ChbRNagCRBS carbon
utilization 5' UTR spacer sequence 185agccacaaaa aaagtcatgt
tggttagttc cagattcagg aactataa 4818653DNAArtificial
Sequencesynthetic AraCRBS carbon utilization 5' UTR spacer sequence
186acacagtcac ttatctttta gttaaaaggt agttccagat tcaggaacta taa
5318743DNAArtificial Sequencesynthetic AntiescapeRBS anti-escaping
sequence 5' UTR spacer sequence 187atccggaatc ctcttcccgg agttccagat
tcaggaacta taa 4318848DNAArtificial Sequencesynthetic LeiQiRBS 5'
UTR spacer sequence 188aacaaaataa aaaggagtcg ctcacagttc cagattcagg
aactataa 4818930DNAArtificial Sequencesynthetic OmpA4 hairpin stem
loop 5' UTR spacer sequence 189gatcaccagg gggatccccc ggtgaaggat
3019038DNAArtificial Sequencesynthetic OmpA952 hairpin stem loop 5'
UTR spacer sequence 190gatcgcccac cggcagctgc cggtgggcga tcaaggat
3819145DNAArtificial Sequencesynthetic OmpA29 hairpin stem loop 5'
UTR spacer sequence 191gatcatcggt agagttaata ttgagcagat cccccggtga
aggat 4519236DNAArtificial Sequencesynthetic papA hairpin stem loop
5' UTR spacer sequence 192attgatctgg ttattaaagg taatcgggtc atttta
3619341DNAArtificial Sequencesynthetic pufBA hairpin stem loop 5'
UTR spacer sequence 193gttctccacg ggtgggatga gcccctcgtg gtggaaatgc
g 4119427DNAArtificial Sequencesynthetic gene32 hairpin stem loop
5' UTR spacer sequence 194agcatgaggt aaagtgtcat gcaccaa
2719538DNAArtificial Sequencesynthetic pHP4 hairpin stem loop 5'
UTR spacer sequence 195acgtcgactt atctcgagtg agatattgtt gacggtac
3819637DNAArtificial Sequencesynthetic pHP10 hairpin stem loop 5'
UTR spacer sequence 196acgtcgactt atctcgagtg agataagttg acggtac
3719751DNAArtificial Sequencesynthetic pHP17 hairpin stem loop 5'
UTR spacer sequence 197acgtcgactt atctcgagac tgcagttcaa tagagatatt
gttgacggta c 5119852DNAArtificial Sequencesynthetic Ribo50 hairpin
stem loop (ribozyme) 5' UTR spacer sequence 198gactgtcacc
ggatgtgctt tccggtctga tgagtccgtg aggacgaaac ag 5219953DNAArtificial
Sequencesynthetic OmpA952J hairpin stem loop 5' UTR spacer sequence
199gatcaccagg gggatccccc ggtgaaggat cctctacaaa taattttgtt taa
5320061DNAArtificial Sequencesynthetic OmpA64J hairpin stem loop 5'
UTR spacer sequence 200gatcgcccac cggcagctgc cggtgggcga tcaaggatcc
tctacaaata attttgttta 60a 6120168DNAArtificial Sequencesynthetic
OmpA29J hairpin stem loop 5' UTR spacer sequence 201gatcatcggt
agagttaata ttgagcagat cccccggtga aggatcctct acaaataatt 60ttgtttaa
6820259DNAArtificial Sequencesynthetic papAJ hairpin stem loop 5'
UTR spacer sequence 202attgatctgg ttattaaagg taatcgggtc attttacctc
tacaaataat tttgtttaa 5920364DNAArtificial Sequencesynthetic pufBAJ
hairpin stem loop 5' UTR spacer sequence 203gttctccacg ggtgggatga
gcccctcgtg gtggaaatgc gcctctacaa ataattttgt 60ttaa
6420450DNAArtificial Sequencesynthetic gene32 hairpin stem loop 5'
UTR spacer sequence 204agcatgaggt aaagtgtcat gcaccaacct ctacaaataa
ttttgtttaa 5020561DNAArtificial Sequencesynthetic pHP4J hairpin
stem loop 5' UTR spacer sequence 205acgtcgactt atctcgagtg
agatattgtt gacggtaccc tctacaaata attttgttta 60a
6120660DNAArtificial Sequencesynthetic pHP10J hairpin stem loop 5'
UTR spacer sequence 206acgtcgactt atctcgagtg agataagttg acggtaccct
ctacaaataa ttttgtttaa 6020774DNAArtificial Sequencesynthetic pHP17J
hairpin stem loop 5' UTR spacer sequence 207acgtcgactt atctcgagac
tgcagttcaa tagagatatt gttgacggta ccctctacaa 60ataattttgt ttaa
7420875DNAArtificial Sequencesynthetic RiboJ hairpin stem loop
(ribozyme) 5' UTR spacer sequence 208gactgtcacc ggatgtgctt
tccggtctga tgagtccgtg aggacgaaac agcctctaca 60aataattttg tttaa
7520980DNAArtificial Sequencesynthetic LtsvJ ribozyme 209agtacgtctg
agcgtgatac ccgctcactg aagatggccc ggtagggccg aaacgtacct 60ctacaaataa
ttttgtttaa 8021080DNAArtificial Sequencesynthetic SccJ ribozyme
210agatgctgta gtgggatgtg tgtctcacct gaagagtaca aaagtccgaa
acggtatcct 60ctacaaataa ttttgtttaa 8021175DNAArtificial
Sequencesynthetic RiboJ ribozyme 211agctgtcacc
ggatgtgctt tccggtctga tgagtccgtg aggacgaaac agcctctaca 60aataattttg
tttaa 7521279DNAArtificial Sequencesynthetic SarJ ribozyme
212agactgtcgc cggatgtgta tccgacctga cgatggccca aaagggccga
aacagtcctc 60tacaaataat tttgtttaa 7921381DNAArtificial
Sequencesynthetic PlmJ ribozyme 213agtcataagt ctgggctaag cccactgatg
agtcgctgaa atgcgacgaa acttatgacc 60tctacaaata attttgttta a
8121475DNAArtificial Sequencesynthetic VtmoJ ribozyme 214agtccgtagt
ggatgtgtat ccactctgat gagtccgaaa ggacgaaacg gacctctaca 60aataattttg
tttaa 7521586DNAArtificial Sequencesynthetic ChmJ ribozyme
215agaagaggtc ggcacctgac gtcggtgtcc tgatgaagat ccatgacagg
atcgaaacct 60cttcctctac aaataatttt gtttaa 8621678DNAArtificial
Sequencesynthetic ScvmJ ribozyme 216agtactgtcg ccagacgtgg
acccggcctg atgagtccga aaggacgaaa cagtacctct 60acaaataatt ttgtttaa
7821785DNAArtificial Sequencesynthetic SltJ ribozyme 217aggacgtatg
agactgactg aaacgccgtc tcactgatga ggccatggca ggccgaaacg 60tccctctaca
aataattttg tttaa 8521879DNAArtificial Sequencesynthetic PlmvJ
ribozyme 218aggaagagtc tgtgctaagc acactgacga gtctctgaga tgagacgaaa
ctcttccctc 60tacaaataat tttgtttaa 7921923DNAArtificial
Sequencesynthetic pipaH9.8 promoter saturation mutagenesis forward
primer 219nnataaaaaa gtgctgaatt cac 2322025DNAArtificial
Sequencesynthetic pipaH9.8 promoter saturation mutagenesis reverse
primer 220nnataaggat aaacaaaatt ggctg 2522180DNAArtificial
Sequencesynthetic functional ECF promoter Pecf02 2817 221catgacaaac
aaaaacagat gcgttacgga actttacaaa aacgagacac tctaaccctt 60tgcttgctca
aattgcagct 8022280DNAArtificial Sequencesynthetic functional ECF
promoter Pecf03 UP1198 222cagtacaaaa ttttttagat gcgtttttaa
cttcgttcct tttcggcgtt ctaataacca 60aagctcagaa ataatagatg
8022380DNAArtificial Sequencesynthetic functional ECF promoter
Pecf11 3726 223atgcctccac accgctcgtc acatcctgtg atccactctt
catcccgcta cgtaacacct 60ctgcatcgcg aaccaaaacc 8022480DNAArtificial
Sequencesynthetic functional ECF promoter Pecf12 UP807
224cagtacaaaa ttttttagat gcgttgcggg aatctccccg gccgatgggc
cgtttcccag 60gtcgagtggc ctgaatcgga 8022580DNAArtificial
Sequencesynthetic functional ECF promoter Pecf15 UP436
225cagtacaaaa ttttttagat gcgttcttgg gaaccgaacg ccggtgcccg
cgttcggttc 60cggggatctt atcaactttt 8022680DNAArtificial
Sequencesynthetic functional ECF promoter Pecf16 3622 226cttggatgaa
aagaaaccca ccgacggtgt aaccctggcg gccgatgcaa cgaactaact 60cacaggacgt
gctcagcacc 8022780DNAArtificial Sequencesynthetic functional ECF
promoter Pecf17 UP1691 227cagtacaaaa ttttttagat gcgtttggtg
aaccaaactc ttactcgact cgtgtcagta 60agcgggaggt gatcgcgtgg
8022880DNAArtificial Sequencesynthetic functional ECF promoter
Pecf18 UP1700 228cagtacaaaa ttttttagat gcgtttgcat ccagattgtc
tcggcggcgg taatgccata 60agcaatgttc gatggcgcag 8022980DNAArtificial
Sequencesynthetic functional ECF promoter Pecf19 UP1315
229cagtacaaaa ttttttagat gcgtttcctc ccgctcctgt ggagcacgat
cgaacgcgaa 60cgcggtcact atacccatgc 8023080DNAArtificial
Sequencesynthetic functional ECF promoter Pecf20 992 230gcgcggataa
aaatttcatt tgcccgcgac ggattccccg cccatctatc gttgaaccca 60tcagctgcgt
tcatcagcga 8023180DNAArtificial Sequencesynthetic functional ECF
promoter Pecf21 UP4014 231cagtacaaaa ttttttagat gcgttaggca
accctttttc atccggcttc gtctatatct 60atagaaaccg acaccaaacc
8023280DNAArtificial Sequencesynthetic functional ECF promoter
Pecf22 UP1147 232cagtacaaaa ttttttagat gcgttgttgt gaggaatcgc
gctcctgcgc gaatcatccc 60gtgtcgtccc ttcacctgcc 8023380DNAArtificial
Sequencesynthetic functional ECF promoter Pecf24 UP69 233cagtacaaaa
ttttttagat gcgttacgga acgcagtctt ttcgtctgta tcaactccaa 60aattcatcgt
gcctaaacat 8023480DNAArtificial Sequencesynthetic functional ECF
promoter Pecf25 UP4311 234cagtacaaaa ttttttagat gcgtcgagga
actcaaactg cgccattatc gtctagctaa 60cagaggttct gcttgggagg
8023580DNAArtificial Sequencesynthetic functional ECF promoter
Pecf26 UP601 235cagtacaaaa ttttttagat gcgtttggaa taaccggtcg
cctccatccg tttacatacc 60gaatcccggc agcgccggcc 8023680DNAArtificial
Sequencesynthetic functional ECF promoter Pecf29 UP371
236cagtacaaaa ttttttagat gcgttccggg aaccttttgt cggcacgaac
atccaattgg 60cggatgaaac actttgtctg 8023780DNAArtificial
Sequencesynthetic functional ECF promoter Pecf30 2079 237accatccgta
tttttttagg gatttataaa acttttccat ggcgtgcgtc gtctaataaa 60tgggaaggag
gaaatgatgt 8023880DNAArtificial Sequencesynthetic functional ECF
promoter Pecf31 34 238caatggctga aaagaattgt aaaaaagatg aacgcttttg
aatccggtgt cgtctcataa 60ggcagaaaaa caaaaaaggg 8023980DNAArtificial
Sequencesynthetic functional ECF promoter Pecf32 1122 239gcgactttat
ttaacagcgg catggccagg gaaccgatgc gtcaatcgca ccacacaatg 60acaactgctc
tcatcattga 8024080DNAArtificial Sequencesynthetic functional ECF
promoter Pecf33 375 240taagttgaac aattttgcac cttccgtcga accgtccgct
gcatcgaccc gaccaacctt 60gcgagacggc ctttgagcgt 8024180DNAArtificial
Sequencesynthetic functional ECF promoter Pecf38 UP1322
241cagtacaaaa ttttttagat gcgttgtaca accctcacgg gggtggacgt
gtccaactgg 60cgtggcagag gttctcgatt 8024280DNAArtificial
Sequencesynthetic functional ECF promoter Pecf39 UP1413
242cagtacaaaa ttttttagat gcgtttgtca accgtccacg acgcgctggc
gtctggaagg 60gtgacccagc cagaccagcg 8024380DNAArtificial
Sequencesynthetic functional ECF promoter Pecf41 UP1141
243cagtacaaaa ttttttagat gcgttcacgt cacaaacccg aaagctgaat
cgtcatcccg 60ttgaatccct caaacacgga 8024480DNAArtificial
Sequencesynthetic functional ECF promoter Pecf42 UP4062
244cagtacaaaa ttttttagat gcgttcgctg tcgatccggc ccgtcgtcgt
tcgtcgtacc 60cccgagagcc cgcgaaaggc 80
* * * * *
References