Anti-npc2 Monoclonal Antibodies And A Method Of Detecting Fatty Liver Tissue, Cancer Cells Or Cancer Tissue By Using Them

Abstract

The present invention is related to anti-NPC2 monoclonal antibodies, which against NPC2 or glycosylated-NPC2; and is related to a method of detecting fatty liver tissues, cancer cells or cancer tissues by evaluating the expression level of NPC2 or glycosylated-NPC2 in the cells or tissues.

Description

CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This Non-provisional application claims priority under 35 U.S.C. .sctn.119(a) on Patent Application No(s). 100120384 filed in Taiwan, Republic of China Jun. 10, 2011, the entire contents of which are hereby incorporated by reference.

FIELD OF THE INVENTION

[0002] The present invention is related to anti-NPC2 monoclonal antibodies, which against NPC2 or glycosylated-NPC2; and is related to a method of detecting fatty liver tissues, cancer cells or cancer tissues by evaluating the expression level of NPC2 or glycosylated-NPC2 in the cells or tissues.

BACKGROUND OF THE INVENTION

[0003] Niemann-Pick Type C (NPC) disease is a lipid storage disorder that is characterized by progressive hepatomegaly and neurodegeneration. The lipid stores in liver, kidney, spleen, bone marrow and brain to cause disease. The cause of NPC is NPC1 or NPC2 gene mutation induces the accumulation of unesterified cholesterol in the late endosomes/lysosomes.

[0004] NPC2 is a small soluble glycoprotein containing 150 amino acids first characterized as a major secretory protein in human epididymis. NPC2 protein would be interacted with cholesterol in lysosome to maintain the homeostasis of cholesterol in the body. Beside, in human and mouse, NPC2 is expressed in liver and secreted into bile (Klein, Amigo et al. 2006). When NPC2 gene mutates, cholesterol will accumulate in cell (Frolov, Zielinski et al. 2003). In addition, it has been reported that Asn-38 is never glycosylated, while Asn-58 and Asn-138 can be glycosylated. In normal condition, some NPC2 proteins are glycosylated only on Asn-58, and others are glycosylated both on Asn-58 and Asn-138. The Asn-58 modification is suggested to be necessary for proper NPC2 targeting to lysosomes, while the Asn-138 is non-essential. Although all glycoforms are able to bind cholesterol, one report indicated an aberrant glycosylation pattern for NPC2 in NPC 1 deficient mouse liver and suggested that the cholesterol transport deficiency in NPC1 disease may arise from defects of glycosylated forms of NPC2 protein (Chikh, Vey et al. 2004).

[0005] In 1975, the method of producing "monoclonal antibody" is developed. The antibodies are mono-specific antibodies that are the same because they are made by identical immune cells that are all clones of a unique parent cell. Given almost any substance, it is possible to produce monoclonal antibodies that specifically bind to that substance; they can then serve to detect or purify that substance. Production of monoclonal antibodies involving human-mouse hybrid cells. Monoclonal antibodies are typically made by fusing myeloma cells with the spleen cells from a mouse that has been immunized with the desired antigen.

[0006] How to produce a huge amount of anti-NPC2 monoclonal antibodies and detect cancer by these antibodies is a problem to be solved.

SUMMARY OF THE INVENTION

[0007] As mentioned above, one of the purposes of the present invention is to provide an NPC2 monoclonal antibody, wherein the monoclonal antibody against N-terminal half 1-40 a.a (SEQ No. 2) of NPC protein.

[0008] Preferably, the NPC protein includes glycosylated NPC2 protein.

[0009] Preferably, the monoclonal antibody against N-terminal half 31-40 a.a (SEQ No. 3) of NPC protein.

[0010] Another aspect of the present invention is to provide a method of detecting fatty liver tissue in an organism, which includes the steps of: [0011] (a) Providing a tested sample form a tested organism and a normal sample; [0012] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from fatty liver.

[0013] Preferably, the sample includes blood tissue, liver tissue or the combination thereof.

[0014] Preferably, the sample is liver cell.

[0015] Another aspect of the present invention is to provide a method of detecting cancer in an organism, which includes the steps of: [0016] (a) Providing a tested sample form a tested organism and a normal sample; [0017] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from cancer.

[0018] Preferably, the cancer includes breast cancer, colon cancer, lung cancer and prostate cancer.

[0019] Another aspect of the present invention is to provide a method of detecting cancer in an organism, which includes the steps of: [0020] (a) Providing a tested sample form a tested organism and a normal sample; [0021] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is lower than the expression level of normal sample means the tested organism is suffered from cancer.

[0022] Preferably, the cancer includes hepatic cancer or kidney cancer.

[0023] Preferably, the detecting method includes western-blotting, immunoprecipitation and immunohistochemistry.

[0024] Preferably, the sequence of NPC2 is:

TABLE-US-00001 (SEQ NO. 1) MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQL SKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGIN CPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI VSHL.smallcircle.

BRIEF DESCRIPTION OF THE DRAWINGS

[0025] FIG. 1A illustrates GEX4T-1-NPC2 plasmid of expressing GST-NPC2 protein.

[0026] FIG. 1B illustrates pET28a-NPC2 plasmid of expressing His-NPC2 protein.

[0027] FIG. 2 shows western-blotting analysis of different kinds of monoclonal antibodies against His-NPC2 and GST-NPC2.

[0028] FIG. 3 shows western-blotting analysis of different kinds of monoclonal antibodies against NPC2 in mouse epididyme.

[0029] FIG. 4A illustrates epitope region mapping of anti-NPC2 monoclonal antibody (full length of pNPC2-HA).

[0030] FIG. 4B illustrates epitope region mapping of anti-NPC2 monoclonal antibody (1-80 a.a).

[0031] FIG. 4C illustrates epitope region mapping of anti-NPC2 monoclonal antibody (81-151 a.a).

[0032] FIG. 4D illustrates epitope region mapping of anti-NPC2 monoclonal antibody (41-105a.a).

[0033] FIG. 5 shows the detecting of epitope region of monoclonal NPC2 antibody (3-6B).

[0034] FIG. 6 shows the knockdown effect of shNPC2 in sk-hep1 cells was detected using anti-NPC2 monoclonal antibody.

[0035] FIG. 7 shows the H&E staining of the MCD diet-induced steatohepatitis liver tissues from both genders of WT mice.

[0036] FIG. 8 shows the serum ALT levels from 0, 1, 2 and 5 weeks of MCD fed WT mice.

[0037] FIG. 9 shows the expression level of glycosylated-NPC2 is enhanced in MCD fed WT mice.

[0038] FIG. 10 shows the IHC staining of NPC2 using monoclonal NPC2 antibody (3-6B).

[0039] FIG. 11 shows the western blot of serum sample MCD fed WT mice using monoclonal NPC2 antibody (3-6B).

[0040] FIG. 12 shows the immunohistochemical staining of 46 pairs of human fatty liver and 50 pairs of HCC tissues using monoclonal NPC2 antibody (3-6B).

[0041] FIG. 13 shows the protein level of NPC2 in breast cancer cell.

[0042] FIG. 14 shows the protein level of NPC2 in colon cancer cell.

[0043] FIG. 15 shows the protein level of NPC2 in lung cancer cell.

[0044] FIG. 16 shows the protein level of NPC2 in prostate cancer cell.

[0045] FIG. 17 shows the protein level of NPC2 in kidney cancer cell.

[0046] FIG. 18 shows the protein level of NPC2 in hepatic cancer cell.

DETAILED DESCRIPTION OF THE INVENTION

[0047] The anti-NPC2 monoclonal antibody of the present invention can be identified by western blotting, immunoprecipitation and immunohistochemistry. The epitope region of present invention performs highly sensitivity to NPC2 or glycosylated-NPC2. Wherein the sequence of NPC2 is:

TABLE-US-00002 (SEQ NO. 1) MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQL SKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGIN CPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI VSHL.

[0048] One of aspect of the present invention is to provide a method of detecting fatty liver tissue in an organism, which includes the steps of: [0049] (a) Providing a tested sample form a tested organism and a normal sample; [0050] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from fatty liver.

[0051] Wherein the sample can be, but not limited to blood tissue, liver tissue or the combination thereof.

[0052] Wherein the sample can be, but not limited to liver cell.

[0053] Another aspect of the present invention is to provide a method of detecting cancer in an organism, which includes the steps of: [0054] (a) Providing a tested sample form a tested organism and a normal sample; [0055] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from cancer.

[0056] Wherein the cancer can be, but not limited to breast cancer, colon cancer, lung cancer and prostate cancer.

[0057] Another aspect of the present invention is to provide a method of detecting cancer in an organism, which includes the steps of: [0058] (a) Providing a tested sample form a tested organism and a normal sample; [0059] (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is lower than the expression level of normal sample means the tested organism is suffered from cancer.

[0060] Wherein the cancer can be, but not limited to hepatic cancer and kidney cancer.

[0061] Wherein the detecting method can be, but not limited to western-blotting, immunoprecipitation and immunohistochemistry.

[0062] Wherein the sequence of NPC2 is:

TABLE-US-00003 (SEQ NO. 1) MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVSPCPTQPCQL SKGQSYSVNVTFTSNIQSKSSKAVVHGILMGVPVPFPIPEPDGCKSGIN CPIQKDKTYSYLNKLPVKSEYPSIKLVVEWQLQDDKNQSLFCWEIPVQI VSHL.

[0063] As mentioned above, the monoclonal antibodies of the present invention specific recognize NPC2 and glycosylated-NPC2. Besides, the present invention provides a method of detecting cancer by the monoclonal antibodies.

EXAMPLES

Example 1

Generate NPC2 Monoclonal Antibodies

[0064] To generate a series of monoclonal antibodies against NPC2, purified GST-NPC2 or His-NPC2 were mixed with Freund's complete (for the initial immunization) or incomplete (for the booster injections) adjuvant (Sigma Co., St. Louis, Mo., USA) and the resultant mixture was used as an immunogen. His-NPC2 RP was used as a screened antigen for antibody arose by GST-NPC2 RP, and vice versa (FIG. 1). Mouse mAbs were produced by hybridoma technique. The hybridomas were dispensed into six 96-well plates and cultured in a HAT medium. The culture supernatants were screened using enzyme immunoassay (EIA) with GST-NPC2 RP and His-NPC2 RP. Hybridoma cells with high optic density were confirmed with Western blot assay immediately. Each well of cells with positive results were subcloned into a 96-well plate with a cell density of 0.5 cell per well. The resultant single clone with positive results were inoculated at a dosage of 5.times.10.sup.6 to a BALB/c mouse which has been primed with 0.5 ml pristine (Sigma-Aldrich) previously. Monoclonal antibodies are purified from the mouse ascites with protein-A antibody purification kits (Pro-Chem Inc. Acton, Mass.) and concentrated using Centricon Plus-80 columns (Millipore). The isotype of each mAb was determined using a commercial kit (SouthernBiotech, Birmingham, Ala.). High-tittered mAbs purified from ascites were diluted with 0.1M NaHCO.sub.3 (pH=8.6) to a concentration of 100 .mu.g/ml, and added to 6 ml sterile polystyrene Petri dishes. After coating overnight at 4.degree. C. in a humidified container, the plates were blocked with the blocking buffer (0.1 M NaHCO.sub.3 pH=8.6, 5 mg/ml BSA, 0.02% NaN3, with a sterilized filter, stored at 4.degree. C.) and incubated for at least 1 hour at 4.degree. C. M13 phages displaying random heptapeptides at the N-terminus of its minor coat protein (pIII) were subsequently added (Ph.D.-7.TM. Phage Display Peptide Library, New England Biolabs Inc.). The phages bound to the plates were selected and repeatedly screened for 3 times before they were subjected to DNA sequencing.

[0065] Anti-NPC2 monoclonal antibodies (including 14-8D. 5-5B, 5-4B, 4-12C, 3-6B, 2-7D, I-5B and 1-2G) had been generated and characterized in table 1.

TABLE-US-00004 TABLE 1 Anti-NPC2 monoclonal antibodies: 14-8D. 5- 5B, 5-4B, 4-12C, 3-6B, 2-7D, 1-5B and 1-2G Immunoglobulin monoclonal gene Heavy Light antibodies name chain chain Epitope 1-2G NPC2 IgG2a kappic N-terminal 1~40 amino acid 1-5B NPC2 IgG2a kappic N-terminal 1~40 amino acid 2-7B NPC2 IgG2a kappic N-terminal 1~40 amino acid 3-6B NPC2 IgG2a kappic N-terminal 1~40 amino acid 4-12C NPC2 IgG2a kappic N-terminal 1~40 amino acid 5-4B NPC2 IgG2a kappic N-terminal 1~40 amino acid 5-5B NPC2 IgG2a kappic N-terminal 1~40 amino acid 14-8D NPC2 IgG2a kappic N-terminal 1~40 amino acid

Example 2

Confirm the Reactivity of NPC2 Monoclonal Antibodies

[0066] Using mouse epididymic cells (known as expressing NPC2 protein) as sample to test the reactivity of the antibodies of example 1 by western-blotting. The result shows in FIG. 2. In addition, these mAbs can specifically recognize mouse epididyme, which is a NPC2 abundantly express tissue. In FIG. 2, the result are 14-8D, 5-5B, pre-immune serum (negative control), 5-4B, 4-12C, 3-6B, positive control, 2-7B, 1-5B and 1-2G from left to right. Besides, the Mw of GST-NPC2 and His-NPC2 are at the position of 43 and 17. All of the monoclonal antibodies showed a good reactivity against His-NPC2 and GST-NPC2.

Example 3

The Epitope Region of NPC2 Monoclonal Antibody

[0067] In order to map the epitope region of monoclonal NPC2 antibodies, different length of pNPC2-HA including full-length pNPC2-HA, N-terminal half (1-80 amino acid), 41-105 amino acid and C-terminal half (81-151 amino acid) had been transfected into 293T cells for 24 hrs and harvested for western blot analysis.

[0068] As shown in FIG. 4A-4D, the arrows indicate the epitope region and the No. 1.about.9 represents the monoclonal antibodies of 14-8D. 5-5B, 5-4B, 4-12C, positive control, 3-6B, 2-7B, 1-5B and 1-2G respectively. All eight NPC2 monoclonal antibodies can recognize full length and N-terminal half (1-80 aa) of pNPC2-HA. While, 41-105 aa and C-terminal half (81-151 aa) of NPC2 were not the NPC2 monoclonal antibodies binding sites.

[0069] Taken together, all of the anti-NPC2 monoclonal antibodies recognize amino acids 1-40 of NPC2 protein, MRFLAATFLLLALSTAAQAEPVQFKDCGSVDGVIKEVNVS (SEQ No. 2).

Example 4

The Epitope Region of Anti-NPC2 Monoclonal Antibody 3-6B

[0070] Using Peptide Screening to identify the epitope region of anti-NPC2 monoclonal antibody (3-6B), synthesized 4 peptides of 10 aa which includes N-terminal half (1-40 aa) of NPC2. Then, identified the epitope region by enzyme immunoassay (EIA).

[0071] Coated the synthesized peptides on EIA 96 well plate by 10 ug/ml (in 68 mM NaHCO3 and 32 mM NaCO3, PH 9.6) and blocked by 2% BSA in PBST. Then, using primary antibody 3-6B worked for 1 hr in 37.degree. C. and washed by PBST (PBS+0.05% TWEEN 20) for 4 times. Next, adding secondary antibody anti-mouse IgG HRP (1:3000) for 1 hr in 37.degree. C. and washed by PBST (PBS+0.05% TWEEN 20) wash for 4 times. Then adding OPD and 3N HCl to stop reaction and using ELx808 enzyme immunoassay analyzer by 490 nm wavelength.

[0072] The result showed in table 2, the OD490 of peptide NPC2-3140 by anti-NPC2 monoclonal antibody (3-6B) are 1.716 and 1.607, the other peptides are lower than 0.1 (Table 2). The average of OD490 showed in FIG. 5.

[0073] Therefore, the epitope region of anti-NPC2 monoclonal antibody (3-6B) is 31-40aa of N-terminal of NPC2 and the sequences is: DGVIKEVNVS (SEQ No. 3)

TABLE-US-00005 TABLE 2 Enzyme immunoassay of anti-NPC2 monoclonal antibody (3-6B) Optical density, NPCR peptides OD)(average) OD1 OD2 NPC2 01-10aa 0.0775 0.084 0.071 NPC2 11-20aa 0.056 0.054 0.058 NPC2 21-30aa 0.057 0.054 0.06 NPC2 31-40aa 1.6615 1.716 1.607

Example 5

The Sensitivity of Anti-NPC2 Monoclonal Antibody 3-6B

[0074] The sensitivity of anti-NPC2 monoclonal antibody (3-6B) was detected from shNPC2 transfected Sk-hep1 cells which are known as NPC2 expressing cells. Transfected shNPC2 into Sk-hep1 cell to knock down the NPC2 and used transfecting vector with and without shNPC2 gene to perform western-blotting. Besides, using a-tubulin as control.

[0075] As shown in FIG. 6, the anti-NPC2 monoclonal antibody can recognize the NPC2 protein in Sk-hep1 cells but can not detect in shNPC2 transfected cells.

[0076] Therefore, the anti-NPC2 monoclonal antibody (3-6B) performs high sensitivity to NPC2.

Example 6

The Expression of NPC2 in MCD Diet Induced Fatty Liver Tissues and Serum

[0077] It has been reported that feeding mice with a methionine and choline deficient (MCD) diet results in hepatic steatosis and steatohepatitis which mimic non-alcoholic steatohepatitis in human. Therefore, we decided to utilize such model to investigate the roles of NPC2 in steastosis using our monoclonal NPC2 antibody.

[0078] H&E staining of MCD mice liver tissue followed by 1, 2 and 5 weeks of MCD demonstrated in FIG. 7.

[0079] In FIG. 7, the upper and lower rows represent the H&E staining of male mice and female mice respectively. And from left to right are H&E staining of liver tissues from normal, 2 weeks MCD and 5 weeks MCD mice. Wherein the MCD diet begins to induce steatosis at the second week, inflammatory infiltration at the fifth week (shown as arrows).

[0080] As expected, the MCD diet begins to induce steatosis at the second week, steatohepatitis and abnormal serum ALT levels at the fifth week (FIG. 8). In both male and female mice, as the MCD duration increase the ALT levels gets higher. The unit of y-axis is U/L (U=unit, L=liter).

[0081] Next, using 1:2000 diluted anti-NPC2 monoclonal antibody 3-6B to observe glycosylated-NPC protein level of the liver cell extract in male and female MCD mice by western blot analysis. As shown in FIG. 9, that glycosylated-NPC2 was significantly enhanced as the MCD treatment.

[0082] Besides, using 1:200 diluted anti-NPC2 monoclonal antibody 3-6B to observe glycosylated-NPC of 5 weeks MCD mice by IHC staining. As shown in FIG. 10, IHC staining of mouse normal and fatty liver tissues showed that NPC2 displayed an enlargement of punctuate structure in steatosis region than those steatosis-adjacent tissues.

[0083] In addition, serum levels of NPC2 were enhanced followed by 5 weeks of MCD diet-induced steatohepatitis model (FIG. 11), suggesting that the increasing of NPC2 in serum may correlate to the progression of hepatosteatosis in mice.

Example 7

IHC Staining of NPC2 in Human Fatty Liver and HCC Tissues

[0084] The expression of NPC2 in human fatty liver and HCC tissues were evaluated using immunohistochemical (IHC) staining. The results showed that among 56 pairs of steatosis (S) and steatosis adjacent (SA) tissues, 41 (73%) steatosis tissues had higher NPC2 expression, 10 (18%) had equal level and 5 (9%) had lower expression than their SA tissue counterparts (FIG. 12, upper panel). The difference of the NPC2 expression between steatosis and steatosis adjacent tissues is statistically significant (Wilcoxon Signed Ranks Test, p=0.02).

[0085] We further analyzed the expression levels of NPC2 in 50 pairs of tumor (T) and tumor-adjacent (TA) tissues from HCC patients using IHC staining. Importantly, 72% (36/50) tumor tissues had significant lower expression level of NPC2 than the tumor-adjacent tissues (FIG. 12, lower panel).

[0086] The statistic result shows in Table 3:

TABLE-US-00006 TABLE 3 IHC staining of NPC2 in human fatty liver and HCC tissues Human fatty liver tissues S < SA S = SA S > SA N (%) N (%) N (%) p value 5 (9%) 10 (18%) 41 (73%) 0.02* Human HCC tissues T < TA T = TA T > TA N (%) N (%) N (%) p value 36 (72%) 12 (24%) 2 (4%) 0.02* S = steatosis tissue; SA = steatosis-adjacent tissue; T = tumor tissue; TA = tumor-adjacent tissue.

[0087] Taken together, the data implies that the changes of NPC2 expression may reflect the pathogenesis of steatosis and subsequent HCC development. It is important to note that the most common form of chronic liver disease is non-alcoholic fatty liver disease, which encompasses a clinicopathologic spectrum of disease ranging from isolated hepatic steatosis to NASH, which can progress to cirrhosis HCC. Until now, the alteration of NPC2 expression pattern in fatty liver and HCC did not observe in any publications. Besides, the level of NPC2 in serum can reflect to the process of steatohepatitis. Therefore, our data indicated that the applications of our NPC2 monoclonal antibody are helpful for the clinical diagnosis and research of non-alcoholic fatty liver disease.

Example 8

The Expression of NPC2 in Multiple Cancer Tissues

[0088] In order to investigate the clinical application of NPC2 monoclonal antibodies, we detected the expression of NPC2 in various normal and cancer tissues using IHC staining. FIG. 13-18 shows the IHC staining of cancer tissues in 23 breast cancer patients, 38 colon cancer patients, 44 lung cancer patients, 60 prostate cancer patients, 33 kidney cancer patients and 50 liver cancer patients respectively and the statistic result shows in Table 4-9.

[0089] Comparison between these normal tissues and their corresponding tumor tissues, NPC2 was significantly up-regulated in breast, colon, lung, and prostate cancers. In contrast, NPC2 was significantly down-regulated in kidney and liver. While, there were no difference between normal and cancer tissues of rectum, pancreas, esophagus, stomach, ovary and uterine cervix. Taken together, these results indicated that the aberrant expression of NPC2 is associated with different cancers.

TABLE-US-00007 TABLE 4 The NPC protein level in breast cancer patients and in normal people. n = 23 T > N T = N T < N P value n (%) 18 (78%) 4 (17%) 1 (4%) <0.01

TABLE-US-00008 TABLE 5 The NPC protein level in colon cancer patients and in normal people. n = 38 T > N T = N T < N P value n (%) 18 (47%) 14 (37%) 6 (16%) 0.045

TABLE-US-00009 TABLE 6 The NPC protein level in lung cancer patients and in normal people. n = 44 T > N T = N T < N P value n (%) 36 (82%) 5 (11%) 9 (20%) <0.01

TABLE-US-00010 TABLE 7 The NPC protein level in prostate cancer patients and in normal people. T (n = 60) N (n = 9) grade - .+-. 1+ 2+ 3+ - .+-. 1+ 2+ P value n (%) 1 (5%) 3 (5%) 22 (37%) 25 (42%) 9 (15%) 1 (11%) 0 6 (66%) 2 (22%) 0.05

TABLE-US-00011 TABLE 8 The NPC protein level in kidney cancer patients and in normal people. n = 33 T > N T = N T < N P value n (%) 2 (6%) 0 31 (94%) <0.001

TABLE-US-00012 TABLE 9 The NPC protein level in liver cancer patients and in normal people. n = 50 T > N T = N T < N P value n (%) 2 (4%) 12 (24%) 36 (72%) 0.02

[0090] As mentioned above, NPC2 protein level can be an index of cancer development. Therefore, the present invention of anti-NPC2 monoclonal antibody can be used as cancer detection.

Sequence CWU 1

1

31151PRTHomo sapiens 1Met Arg Phe Leu Ala Ala Thr Phe Leu Leu Leu Ala Leu Ser Thr Ala1 5 10 15Ala Gln Ala Glu Pro Val Gln Phe Lys Asp Cys Gly Ser Val Asp Gly 20 25 30Val Ile Lys Glu Val Asn Val Ser Pro Cys Pro Thr Gln Pro Cys Gln 35 40 45Leu Ser Lys Gly Gln Ser Tyr Ser Val Asn Val Thr Phe Thr Ser Asn 50 55 60Ile Gln Ser Lys Ser Ser Lys Ala Val Val His Gly Ile Leu Met Gly65 70 75 80Val Pro Val Pro Phe Pro Ile Pro Glu Pro Asp Gly Cys Lys Ser Gly 85 90 95Ile Asn Cys Pro Ile Gln Lys Asp Lys Thr Tyr Ser Tyr Leu Asn Lys 100 105 110Leu Pro Val Lys Ser Glu Tyr Pro Ser Ile Lys Leu Val Val Glu Trp 115 120 125Gln Leu Gln Asp Asp Lys Asn Gln Ser Leu Phe Cys Trp Glu Ile Pro 130 135 140Val Gln Ile Val Ser His Leu145 150240PRTHomo sapiens 2Met Arg Phe Leu Ala Ala Thr Phe Leu Leu Leu Ala Leu Ser Thr Ala1 5 10 15Ala Gln Ala Glu Pro Val Gln Phe Lys Asp Cys Gly Ser Val Asp Gly 20 25 30Val Ile Lys Glu Val Asn Val Ser 35 40310PRTHomo sapiens 3Asp Gly Val Ile Lys Glu Val Asn Val Ser1 5 10

Claims

1. An NPC2 monoclonal antibody, wherein the monoclonal antibody against N-terminal half 1-40 amino acid (SEQ No. 2) of NPC protein.

2. The NPC2 monoclonal antibody in claim 1, wherein the NPC2 protein includes glycosylated NPC2 protein.

3. The NPC2 monoclonal antibody in claim 1, wherein the monoclonal antibody against N-terminal half 31-40 amino acid (SEQ No. 3) of NPC protein.

4. A method of detecting fatty liver tissue in an organism, which includes the steps of: (a) Providing a tested sample form a tested organism and a normal sample; (b) Detecting the expression level of NPC2 protein or glycosylated NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from fatty liver.

5. The method of claim 4, wherein the sample includes blood tissue, liver tissue or the combination thereof.

6. The method of claim 5, wherein the sample is liver cell.

7. The method of claim 4, wherein the detecting method includes western-blotting, immunoprecipitation and immunohistochemistry.

8. A method of detecting cancer in an organism, which includes the steps of: (a) Providing a tested sample form a tested organism and a normal sample; (b) Detecting the expression level of NPC2 protein or glycosylated-NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is higher than the expression level of normal sample means the tested organism is suffered from cancer.

9. The method of claim 8, wherein the cancer includes breast cancer, colon cancer, lung cancer and prostate cancer.

10. The method of claim 8, wherein the detecting method includes western-blotting, immunoprecipitation and immunohistochemistry.

11. A method of detecting cancer in an organism, which includes the steps of: (a) Providing a tested sample form a tested organism and a normal sample; (b) Detecting the expression level of NPC2 protein or glycosylated-NPC2 protein in the tested sample and the normal sample by the monoclonal antibody of claim 1 and evaluating the expression level, wherein the expression level of the tested sample is lower than the expression level of normal sample means the tested organism is suffered from cancer.

12. The method of claim 11, wherein the cancer includes hepatic cancer and kidney cancer.

13. The method of claim 11, wherein the detecting method includes western-blotting, immunoprecipitation and immunohistochemistry.